F493946

General Info

Members Datasets Scaffolds Average Seq Length
1436 449 2872 189

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100572098|Ga0070679_1005720982
Length 194
Sequence VVLSDVTIERLIAEGRIGIDPYDVSLLQPSSVDVRVDRFFRVFHNARYPYIDVKQPQEALTELVEMHDDEEPFILHPGEFVLGSTLEVVSLPNDLVARLEGKSSLGRLGLLIHSTAGFIDPGFEGNVTLELSNVANLPITIYYGMKIGQISFMQMSEPAMNPYGSGALGSKYRGQRGPTPSRYYENFEQSSKNE

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
121 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
122 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
123 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
255 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
256 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
257 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
258 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
259 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
262 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
263 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
264 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
265 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
266 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
267 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
268 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
269 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
270 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
271 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
272 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
273 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
279 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
280 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
281 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
282 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
283 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
284 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
285 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
286 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
287 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
288 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
289 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
299 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
300 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
321 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
325 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
326 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
332 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
333 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
334 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
341 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
342 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
343 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
348 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
361 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
362 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
363 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
383 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
384 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
385 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
386 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
412 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
413 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
414 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
415 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
416 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
417 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
418 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
419 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
420 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
421 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
422 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
425 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
426 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
427 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
428 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
429 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
430 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
431 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
432 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
433 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
434 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
435 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
436 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
437 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
442 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
443 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
444 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
445 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
446 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
447 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
448 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
449 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.56
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 8.64
Rhizosphere 88.79
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100572098 3300005530 Bacteria 1073
2 JGI25152J39213_1000046 3300002773 Bacteria 85532
3 JGI25407J50210_10003857 3300003373 Bacteria 3630
4 JGI25404J52841_10083426 3300003659 Bacteria 668
5 Ga0055542_1006635 3300003762 Bacteria 2451
6 Ga0065714_10155660 3300005288 Bacteria 1080
7 Ga0070658_10014372 3300005327 Bacteria 6351
8 Ga0070658_10034647 3300005327 Bacteria 4062
9 Ga0070658_10097451 3300005327 Bacteria 2428
10 Ga0070658_10177298 3300005327 Bacteria 1793
11 Ga0070658_10184496 3300005327 Bacteria 1756
12 Ga0070676_10089279 3300005328 Bacteria 1885
13 Ga0070676_10236823 3300005328 Bacteria 1212
14 Ga0070683_100003641 3300005329 Bacteria 12550
15 Ga0070683_100012451 3300005329 Bacteria 7394
16 Ga0070683_100070160 3300005329 Bacteria 3269
17 Ga0070683_100197102 3300005329 Bacteria 1912
18 Ga0070683_100401326 3300005329 Bacteria 1307
19 Ga0070690_100021285 3300005330 Bacteria 3957
20 Ga0070690_100084585 3300005330 Bacteria 2080
21 Ga0070670_100246151 3300005331 Bacteria 1557
22 Ga0070670_100377517 3300005331 Bacteria 1248
23 Ga0068869_100089683 3300005334 Bacteria 2309
24 Ga0068869_100108563 3300005334 Bacteria 2108
25 Ga0070666_10011943 3300005335 Bacteria 5465
26 Ga0070680_100009218 3300005336 Bacteria 7568
27 Ga0070680_100113835 3300005336 Bacteria 2254
28 Ga0070680_100139622 3300005336 Bacteria 2031
29 Ga0070682_100045851 3300005337 Bacteria 2711
30 Ga0070682_100053356 3300005337 Bacteria 2533
31 Ga0070682_100123921 3300005337 Bacteria 1739
32 Ga0070682_100151094 3300005337 Unclassified 1593
33 Ga0068868_101232677 3300005338 Bacteria 693
34 Ga0070660_100002284 3300005339 Bacteria 13167
35 Ga0070660_100079320 3300005339 Bacteria 2575
36 Ga0070660_100184708 3300005339 Bacteria 1688
37 Ga0070660_100188711 3300005339 Unclassified 1669
38 Ga0070660_100394327 3300005339 Bacteria 1144
39 Ga0070689_100014123 3300005340 Bacteria 5794
40 Ga0070689_100080810 3300005340 Bacteria 2551
41 Ga0070691_10033053 3300005341 Bacteria 2432
42 Ga0070687_100121059 3300005343 Bacteria 1497
43 Ga0070687_100843173 3300005343 Bacteria 653
44 Ga0070661_100072080 3300005344 Bacteria 2542
45 Ga0070661_100297783 3300005344 Bacteria 1255
46 Ga0070661_101214594 3300005344 Unclassified 631
47 Ga0070692_10002531 3300005345 Bacteria 7111
48 Ga0070692_10020956 3300005345 Bacteria 3176
49 Ga0070692_10055201 3300005345 Bacteria 2076
50 Ga0070668_100094651 3300005347 Bacteria 2358
51 Ga0070668_100105061 3300005347 Bacteria 2242
52 Ga0070668_100164197 3300005347 Bacteria 1804
53 Ga0070668_100363052 3300005347 Bacteria 1228
54 Ga0070669_100000002 3300005353 Bacteria 506497
55 Ga0070669_101446737 3300005353 Bacteria 597
56 Ga0070675_100197867 3300005354 Bacteria 1743
57 Ga0070675_100295554 3300005354 Bacteria 1426
58 Ga0070674_100008245 3300005356 Bacteria 6192
59 Ga0070674_100022938 3300005356 Bacteria 4030
60 Ga0070674_100855180 3300005356 Bacteria 789
61 Ga0070673_100132374 3300005364 Bacteria 2094
62 Ga0070673_100630558 3300005364 Bacteria 980
63 Ga0070673_100773666 3300005364 Bacteria 885
64 Ga0070688_100097160 3300005365 Bacteria 1935
65 Ga0070688_100185188 3300005365 Bacteria 1447
66 Ga0070688_100652974 3300005365 Unclassified 810
67 Ga0070688_101290959 3300005365 Unclassified 589
68 Ga0070659_100027699 3300005366 Bacteria 4368
69 Ga0070659_100209762 3300005366 Bacteria 1605
70 Ga0070659_100213661 3300005366 Bacteria 1590
71 Ga0070667_100068362 3300005367 Bacteria 3023
72 Ga0070667_100101719 3300005367 Bacteria 2483
73 Ga0070667_100267268 3300005367 Bacteria 1533
74 Ga0070703_10003466 3300005406 Bacteria 4498
75 Ga0070709_10204981 3300005434 Bacteria 1399
76 Ga0070709_10334055 3300005434 Bacteria 1116
77 Ga0070714_100104428 3300005435 Bacteria 2500
78 Ga0070714_100115887 3300005435 Bacteria 2378
79 Ga0070713_100017467 3300005436 Bacteria 5427
80 Ga0070713_100229014 3300005436 Bacteria 1689
81 Ga0070713_100232044 3300005436 Bacteria 1678
82 Ga0070713_100932769 3300005436 Bacteria 836
83 Ga0070710_10083352 3300005437 Bacteria 1871
84 Ga0070710_10435630 3300005437 Bacteria 885
85 Ga0070701_10008989 3300005438 Bacteria 4355
86 Ga0070711_100020225 3300005439 Bacteria 4286
87 Ga0070711_100251430 3300005439 Bacteria 1387
88 Ga0070705_100006893 3300005440 Bacteria 5580
89 Ga0070705_100139298 3300005440 Bacteria 1594
90 Ga0070705_100284075 3300005440 Bacteria 1178
91 Ga0070705_100463123 3300005440 Bacteria 954
92 Ga0070700_100086817 3300005441 Bacteria 2032
93 Ga0070700_100401348 3300005441 Bacteria 1031
94 Ga0070694_100027674 3300005444 Bacteria 3684
95 Ga0070694_100077622 3300005444 Bacteria 2301
96 Ga0070694_100242333 3300005444 Bacteria 1360
97 Ga0070694_100918075 3300005444 Bacteria 723
98 Ga0070708_100234521 3300005445 Bacteria 1722
99 Ga0070663_100033893 3300005455 Bacteria 3531
100 Ga0070663_100167475 3300005455 Bacteria 1696
101 Ga0070663_100320768 3300005455 Bacteria 1246
102 Ga0070678_100033436 3300005456 Bacteria 3570
103 Ga0070678_100651361 3300005456 Bacteria 945
104 Ga0070678_100720990 3300005456 Bacteria 900
105 Ga0070678_100741929 3300005456 Bacteria 887
106 Ga0070662_100013464 3300005457 Bacteria 5444
107 Ga0070662_100032163 3300005457 Bacteria 3685
108 Ga0070662_100046759 3300005457 Bacteria 3110
109 Ga0070681_10007964 3300005458 Bacteria 10371
110 Ga0070681_10016690 3300005458 Bacteria 7331
111 Ga0070681_10023282 3300005458 Bacteria 6229
112 Ga0070681_10036925 3300005458 Bacteria 4904
113 Ga0070681_10257360 3300005458 Bacteria 1658
114 Ga0070681_10305714 3300005458 Bacteria 1500
115 Ga0068867_100072350 3300005459 Bacteria 2580
116 Ga0068867_100077648 3300005459 Bacteria 2496
117 Ga0070685_10003221 3300005466 Bacteria 8305
118 Ga0070685_10004772 3300005466 Bacteria 6864
119 Ga0070685_10356343 3300005466 Bacteria 1002
120 Ga0070685_10396369 3300005466 Bacteria 955
121 Ga0070706_100003660 3300005467 Bacteria 15046
122 Ga0070706_100023763 3300005467 Bacteria 5643
123 Ga0070706_100539888 3300005467 Bacteria 1085
124 Ga0070707_100002146 3300005468 Bacteria 18879
125 Ga0070707_100057963 3300005468 Bacteria 3715
126 Ga0070707_100087877 3300005468 Bacteria 3007
127 Ga0070707_100461895 3300005468 Bacteria 1230
128 Ga0070698_100013048 3300005471 Bacteria 8796
129 Ga0070698_100039664 3300005471 Bacteria 4844
130 Ga0070698_100219532 3300005471 Bacteria 1835
131 Ga0070698_100567816 3300005471 Unclassified 1074
132 Ga0070699_100003545 3300005518 Bacteria 13794
133 Ga0070699_100059708 3300005518 Bacteria 3303
134 Ga0070699_100067160 3300005518 Bacteria 3114
135 Ga0070699_100118178 3300005518 Bacteria 2330
136 Ga0070699_100344883 3300005518 Bacteria 1341
137 Ga0070679_100002180 3300005530 Bacteria 17674
138 Ga0070679_100030712 3300005530 Bacteria 5306
139 Ga0070679_100039874 3300005530 Bacteria 4668
140 Ga0070679_100066942 3300005530 Bacteria 3581
141 Ga0070679_100108072 3300005530 Bacteria 2767
142 Ga0070679_100144007 3300005530 Bacteria 2361
143 Ga0070684_100000887 3300005535 Bacteria 21150
144 Ga0070684_100011152 3300005535 Bacteria 7155
145 Ga0070684_100012096 3300005535 Bacteria 6901
146 Ga0070684_100014289 3300005535 Bacteria 6427
147 Ga0070684_100127407 3300005535 Bacteria 2294
148 Ga0070684_100322747 3300005535 Bacteria 1418
149 Ga0070697_100009908 3300005536 Bacteria 7431
150 Ga0070697_100133987 3300005536 Bacteria 2079
151 Ga0070697_100343641 3300005536 Bacteria 1288
152 Ga0068853_100011384 3300005539 Bacteria 7225
153 Ga0068853_100167137 3300005539 Bacteria 1988
154 Ga0070672_100189287 3300005543 Bacteria 1717
155 Ga0070686_100016719 3300005544 Bacteria 4272
156 Ga0070686_100104765 3300005544 Bacteria 1917
157 Ga0070686_100124717 3300005544 Bacteria 1773
158 Ga0070686_100234527 3300005544 Bacteria 1333
159 Ga0070686_100604799 3300005544 Unclassified 864
160 Ga0070686_100605277 3300005544 Bacteria 864
161 Ga0070695_100392616 3300005545 Bacteria 1050
162 Ga0070695_101260208 3300005545 Bacteria 610
163 Ga0070696_100019458 3300005546 Bacteria 4598
164 Ga0070696_100043037 3300005546 Bacteria 3123
165 Ga0070693_100367661 3300005547 Bacteria 989
166 Ga0070665_100000625 3300005548 Bacteria 48195
167 Ga0070665_100071423 3300005548 Bacteria 3477
168 Ga0070665_100121490 3300005548 Bacteria 2613
169 Ga0070704_100003404 3300005549 Bacteria 9112
170 Ga0070704_100011285 3300005549 Bacteria 5473
171 Ga0070704_100032794 3300005549 Bacteria 3507
172 Ga0070704_100612672 3300005549 Bacteria 958
173 Ga0068855_100018515 3300005563 Bacteria 8373
174 Ga0068855_100034169 3300005563 Bacteria 6066
175 Ga0068855_100075689 3300005563 Bacteria 3908
176 Ga0068855_100178835 3300005563 Bacteria 2399
177 Ga0068855_100224800 3300005563 Bacteria 2104
178 Ga0068855_100414857 3300005563 Bacteria 1473
179 Ga0070664_100048291 3300005564 Bacteria 3597
180 Ga0070664_100295233 3300005564 Bacteria 1463
181 Ga0070664_100410164 3300005564 Bacteria 1240
182 Ga0070664_100496299 3300005564 Bacteria 1125
183 Ga0068857_100165255 3300005577 Bacteria 2010
184 Ga0068854_100066535 3300005578 Bacteria 2623
185 Ga0068854_100338056 3300005578 Bacteria 1229
186 Ga0068854_100787346 3300005578 Bacteria 828
187 Ga0068856_100026978 3300005614 Bacteria 5603
188 Ga0068856_100255658 3300005614 Bacteria 1767
189 Ga0068856_100282471 3300005614 Bacteria 1677
190 Ga0068856_100415257 3300005614 Bacteria 1366
191 Ga0070702_100026938 3300005615 Bacteria 3096
192 Ga0070702_100057772 3300005615 Bacteria 2245
193 Ga0068852_100043382 3300005616 Bacteria 3815
194 Ga0068852_100069567 3300005616 Bacteria 3086
195 Ga0068852_100135911 3300005616 Bacteria 2270
196 Ga0068852_100150981 3300005616 Bacteria 2160
197 Ga0068859_100110232 3300005617 Bacteria 2814
198 Ga0068859_100751744 3300005617 Bacteria 1064
199 Ga0068864_100269055 3300005618 Bacteria 1587
200 Ga0068866_10310043 3300005718 Bacteria 989
201 Ga0068861_100103306 3300005719 Bacteria 2271
202 Ga0068861_100375190 3300005719 Unclassified 1255
203 Ga0068861_101045854 3300005719 Bacteria 782
204 Ga0068851_10094026 3300005834 Bacteria 1582
205 Ga0068851_10388740 3300005834 Bacteria 819
206 Ga0068870_10021664 3300005840 Bacteria 3148
207 Ga0068870_10954642 3300005840 Bacteria 609
208 Ga0068863_100263196 3300005841 Bacteria 1668
209 Ga0068858_100027442 3300005842 Bacteria 5289
210 Ga0068858_100278716 3300005842 Bacteria 1592
211 Ga0068858_101565851 3300005842 Unclassified 650
212 Ga0068858_102184061 3300005842 Bacteria 547
213 Ga0068860_100019464 3300005843 Bacteria 6581
214 Ga0068860_100037378 3300005843 Bacteria 4648
215 Ga0068862_100001063 3300005844 Bacteria 26294
216 Ga0068862_100246359 3300005844 Bacteria 1627
217 Ga0068862_100247710 3300005844 Bacteria 1623
218 Ga0068862_100643914 3300005844 Bacteria 1022
219 Ga0081455_10015740 3300005937 Bacteria 7325
220 Ga0081455_10022676 3300005937 Bacteria 5859
221 Ga0081455_10032676 3300005937 Bacteria 4687
222 Ga0081455_10032852 3300005937 Bacteria 4670
223 Ga0081455_10040470 3300005937 Bacteria 4109
224 Ga0081455_10056920 3300005937 Bacteria 3317
225 Ga0081455_10058075 3300005937 Bacteria 3276
226 Ga0081455_10356753 3300005937 Bacteria 1029
227 Ga0081538_10000330 3300005981 Bacteria 54129
228 Ga0081538_10001228 3300005981 Bacteria 26896
229 Ga0081538_10001290 3300005981 Bacteria 26012
230 Ga0081538_10007527 3300005981 Bacteria 9410
231 Ga0081538_10047404 3300005981 Bacteria 2635
232 Ga0081538_10137821 3300005981 Bacteria 1132
233 Ga0081540_1009957 3300005983 Bacteria 6482
234 Ga0081540_1012344 3300005983 Bacteria 5636
235 Ga0081539_10001337 3300005985 Bacteria 42952
236 Ga0081539_10041689 3300005985 Bacteria 2681
237 Ga0081539_10199326 3300005985 Bacteria 926
238 Ga0070717_10041894 3300006028 Bacteria 3734
239 Ga0075365_10003096 3300006038 Bacteria 8453
240 Ga0075363_100089490 3300006048 Bacteria 1692
241 Ga0075363_100246956 3300006048 Bacteria 1027
242 Ga0075432_10004635 3300006058 Bacteria 4681
243 Ga0075432_10012966 3300006058 Bacteria 2832
244 Ga0075432_10037726 3300006058 Bacteria 1682
245 Ga0070715_10138585 3300006163 Bacteria 1179
246 Ga0070715_10197536 3300006163 Bacteria 1020
247 Ga0070716_100091705 3300006173 Bacteria 1840
248 Ga0070716_100146864 3300006173 Bacteria 1512
249 Ga0070716_100176834 3300006173 Unclassified 1398
250 Ga0070712_100028072 3300006175 Bacteria 3762
251 Ga0070712_100033201 3300006175 Bacteria 3490
252 Ga0070712_100045337 3300006175 Bacteria 3035
253 Ga0070712_100224613 3300006175 Bacteria 1488
254 Ga0075362_10055513 3300006177 Bacteria 1782
255 Ga0075367_10185945 3300006178 Bacteria 1296
256 Ga0097621_100233690 3300006237 Bacteria 1606
257 Ga0097621_100309678 3300006237 Bacteria 1397
258 Ga0075370_10161743 3300006353 Bacteria 1314
259 Ga0068871_100111925 3300006358 Bacteria 2297
260 Ga0068871_100174284 3300006358 Bacteria 1845
261 Ga0068871_100266690 3300006358 Bacteria 1495
262 Ga0075428_100002710 3300006844 Bacteria 19287
263 Ga0075428_100081065 3300006844 Bacteria 3542
264 Ga0075428_100159254 3300006844 Bacteria 2451
265 Ga0075428_101009277 3300006844 Bacteria 881
266 Ga0075428_101097533 3300006844 Bacteria 840
267 Ga0075430_100009019 3300006846 Bacteria 8430
268 Ga0075430_100102461 3300006846 Bacteria 2390
269 Ga0075430_100136046 3300006846 Bacteria 2047
270 Ga0075430_100283078 3300006846 Bacteria 1372
271 Ga0075431_100001020 3300006847 Bacteria 24950
272 Ga0075431_100017616 3300006847 Bacteria 7261
273 Ga0075431_100047691 3300006847 Bacteria 4417
274 Ga0075431_100199297 3300006847 Bacteria 2049
275 Ga0075431_100465464 3300006847 Bacteria 1258
276 Ga0075433_10033563 3300006852 Bacteria 4401
277 Ga0075433_10037108 3300006852 Bacteria 4202
278 Ga0075433_10059649 3300006852 Bacteria 3338
279 Ga0075433_10301595 3300006852 Bacteria 1419
280 Ga0075434_100048762 3300006871 Bacteria 4202
281 Ga0075434_100112943 3300006871 Bacteria 2728
282 Ga0075434_100141319 3300006871 Bacteria 2427
283 Ga0075434_100159314 3300006871 Bacteria 2277
284 Ga0075434_100325366 3300006871 Bacteria 1558
285 Ga0075434_100350779 3300006871 Bacteria 1497
286 Ga0075434_100624736 3300006871 Unclassified 1096
287 Ga0075429_100052744 3300006880 Bacteria 3538
288 Ga0075429_100238786 3300006880 Bacteria 1592
289 Ga0075429_100247617 3300006880 Bacteria 1560
290 Ga0075429_100330209 3300006880 Bacteria 1334
291 Ga0075429_100574506 3300006880 Bacteria 988
292 Ga0075429_101178989 3300006880 Bacteria 669
293 Ga0068865_100022281 3300006881 Bacteria 4130
294 Ga0068865_100024408 3300006881 Bacteria 3966
295 Ga0068865_100334613 3300006881 Bacteria 1222
296 Ga0068865_100427821 3300006881 Bacteria 1090
297 Ga0075436_100001835 3300006914 Bacteria 14562
298 Ga0075436_100006708 3300006914 Bacteria 7881
299 Ga0075436_100011000 3300006914 Bacteria 6213
300 Ga0075436_100020746 3300006914 Bacteria 4508
301 Ga0075436_100053533 3300006914 Bacteria 2786
302 Ga0075436_100142230 3300006914 Bacteria 1686
303 Ga0075436_100186821 3300006914 Bacteria 1466
304 Ga0097620_100110230 3300006931 Bacteria 2814
305 Ga0097620_100751726 3300006931 Bacteria 1064
306 Ga0075435_100007425 3300007076 Bacteria 7808
307 Ga0075435_100037084 3300007076 Bacteria 3880
308 Ga0075435_100324741 3300007076 Bacteria 1317
309 Ga0075435_100472263 3300007076 Bacteria 1083
310 Ga0075435_100593019 3300007076 Bacteria 961
311 Ga0105244_10004212 3300009036 Bacteria 9998
312 Ga0105240_10022063 3300009093 Bacteria 8450
313 Ga0105240_10085266 3300009093 Bacteria 3870
314 Ga0105240_10148064 3300009093 Bacteria 2799
315 Ga0111539_10013119 3300009094 Bacteria 10364
316 Ga0111539_10023472 3300009094 Bacteria 7578
317 Ga0111539_10040970 3300009094 Bacteria 5571
318 Ga0111539_10056335 3300009094 Bacteria 4672
319 Ga0111539_10060296 3300009094 Bacteria 4496
320 Ga0111539_10089782 3300009094 Bacteria 3611
321 Ga0111539_10124544 3300009094 Bacteria 3020
322 Ga0111539_10249129 3300009094 Bacteria 2068
323 Ga0111539_10294990 3300009094 Bacteria 1887
324 Ga0111539_10307348 3300009094 Bacteria 1845
325 Ga0111539_10317039 3300009094 Bacteria 1814
326 Ga0111539_10372505 3300009094 Bacteria 1662
327 Ga0111539_10419597 3300009094 Bacteria 1558
328 Ga0111539_10703241 3300009094 Bacteria 1176
329 Ga0111539_11382177 3300009094 Bacteria 817
330 Ga0105245_10024429 3300009098 Bacteria 5307
331 Ga0105245_10043540 3300009098 Bacteria 4004
332 Ga0105245_10058133 3300009098 Bacteria 3480
333 Ga0105245_10078137 3300009098 Bacteria 3019
334 Ga0105245_10093151 3300009098 Bacteria 2776
335 Ga0105245_10131590 3300009098 Bacteria 2347
336 Ga0105245_10169296 3300009098 Bacteria 2079
337 Ga0105245_10202285 3300009098 Bacteria 1908
338 Ga0105247_10058184 3300009101 Bacteria 2391
339 Ga0114129_10017930 3300009147 Bacteria 10079
340 Ga0114129_10076752 3300009147 Bacteria 4651
341 Ga0114129_10164573 3300009147 Bacteria 3028
342 Ga0114129_10458833 3300009147 Bacteria 1670
343 Ga0114129_10487702 3300009147 Bacteria 1611
344 Ga0114129_11018607 3300009147 Bacteria 1042
345 Ga0114129_11045073 3300009147 Bacteria 1026
346 Ga0114129_11091867 3300009147 Bacteria 999
347 Ga0114129_12300428 3300009147 Bacteria 647
348 Ga0105243_10013026 3300009148 Bacteria 6283
349 Ga0105243_10018258 3300009148 Bacteria 5311
350 Ga0105243_10020325 3300009148 Bacteria 5035
351 Ga0105243_10033330 3300009148 Bacteria 3983
352 Ga0105243_10036838 3300009148 Bacteria 3799
353 Ga0105243_10050214 3300009148 Bacteria 3294
354 Ga0105243_11318847 3300009148 Bacteria 739
355 Ga0105241_10222536 3300009174 Bacteria 1587
356 Ga0105241_10905214 3300009174 Bacteria 819
357 Ga0105242_10049351 3300009176 Bacteria 3425
358 Ga0105242_10085512 3300009176 Bacteria 2645
359 Ga0105242_10103539 3300009176 Bacteria 2415
360 Ga0105242_10140911 3300009176 Bacteria 2092
361 Ga0105242_10287482 3300009176 Bacteria 1496
362 Ga0105242_10727460 3300009176 Bacteria 974
363 Ga0105242_10847123 3300009176 Bacteria 909
364 Ga0105242_11032000 3300009176 Bacteria 832
365 Ga0105248_10046557 3300009177 Bacteria 4861
366 Ga0105248_10134961 3300009177 Bacteria 2784
367 Ga0105248_10193695 3300009177 Bacteria 2290
368 Ga0105248_10786702 3300009177 Unclassified 1074
369 Ga0105238_10337870 3300009551 Bacteria 1494
370 Ga0105238_10396582 3300009551 Bacteria 1373
371 Ga0105238_10983483 3300009551 Bacteria 864
372 Ga0105249_10070967 3300009553 Bacteria 3217
373 Ga0105249_10096470 3300009553 Bacteria 2774
374 Ga0105249_10152408 3300009553 Unclassified 2227
375 Ga0105249_10201390 3300009553 Bacteria 1948
376 Ga0105249_10250976 3300009553 Bacteria 1754
377 Ga0105249_12872056 3300009553 Bacteria 553
378 Ga0105030_114543 3300009987 Bacteria 692
379 Ga0105239_10013046 3300010375 Bacteria 9236
380 Ga0105239_10124667 3300010375 Bacteria 2862
381 Ga0105239_10165737 3300010375 Bacteria 2470
382 Ga0105239_10168474 3300010375 Bacteria 2449
383 Ga0105239_10634248 3300010375 Bacteria 1220
384 Ga0105246_10005235 3300011119 Bacteria 7886
385 Ga0105246_10036011 3300011119 Bacteria 3312
386 Ga0105246_10113067 3300011119 Bacteria 1998
387 Ga0105246_10184971 3300011119 Bacteria 1607
388 Ga0105246_10226621 3300011119 Bacteria 1469
389 Ga0105246_10566060 3300011119 Bacteria 976
390 Ga0105246_11173788 3300011119 Bacteria 705
391 Ga0157346_1003880 3300012480 Bacteria 858
392 Ga0157341_1010607 3300012494 Bacteria 785
393 Ga0157319_1016381 3300012497 Bacteria 673
394 Ga0157347_1010583 3300012502 Bacteria 970
395 Ga0157373_10095877 3300013100 Bacteria 2088
396 Ga0157373_10141235 3300013100 Bacteria 1694
397 Ga0157371_10055114 3300013102 Bacteria 2821
398 Ga0157371_10067574 3300013102 Bacteria 2530
399 Ga0157371_10349834 3300013102 Bacteria 1076
400 Ga0157371_10359882 3300013102 Bacteria 1060
401 Ga0157370_10024054 3300013104 Bacteria 6039
402 Ga0157370_10030046 3300013104 Bacteria 5326
403 Ga0157370_10087914 3300013104 Bacteria 2919
404 Ga0157370_10212494 3300013104 Bacteria 1793
405 Ga0157370_11131434 3300013104 Bacteria 707
406 Ga0157369_10029044 3300013105 Bacteria 6114
407 Ga0157369_10081190 3300013105 Bacteria 3470
408 Ga0157369_10124154 3300013105 Bacteria 2738
409 Ga0157369_10325986 3300013105 Bacteria 1596
410 Ga0157369_11538031 3300013105 Bacteria 677
411 Ga0157374_11438495 3300013296 Bacteria 712
412 Ga0157374_11800228 3300013296 Bacteria 638
413 Ga0157378_10205213 3300013297 Bacteria 1866
414 Ga0157378_10328522 3300013297 Bacteria 1488
415 Ga0157378_10659266 3300013297 Bacteria 1063
416 Ga0157378_11769749 3300013297 Bacteria 666
417 Ga0163162_10429511 3300013306 Bacteria 1453
418 Ga0163162_10611694 3300013306 Bacteria 1215
419 Ga0157372_10196373 3300013307 Bacteria 2337
420 Ga0157372_10624960 3300013307 Bacteria 1255
421 Ga0157372_10698334 3300013307 Bacteria 1181
422 Ga0157372_11714419 3300013307 Bacteria 723
423 Ga0157375_10014646 3300013308 Bacteria 7004
424 Ga0157375_10028657 3300013308 Bacteria 5224
425 Ga0157375_10099855 3300013308 Bacteria 2982
426 Ga0157375_10142516 3300013308 Bacteria 2525
427 Ga0157375_11552403 3300013308 Bacteria 782
428 Ga0157375_11793610 3300013308 Bacteria 727
429 Ga0163163_10588459 3300014325 Bacteria 1176
430 Ga0163163_11052540 3300014325 Bacteria 877
431 Ga0157380_10034297 3300014326 Bacteria 3914
432 Ga0157380_10436093 3300014326 Bacteria 1254
433 Ga0157380_11109054 3300014326 Unclassified 831
434 Ga0157377_10008757 3300014745 Bacteria 4947
435 Ga0157377_10010749 3300014745 Bacteria 4541
436 Ga0157377_10030589 3300014745 Bacteria 2918
437 Ga0157377_10065648 3300014745 Bacteria 2086
438 Ga0157377_10073352 3300014745 Bacteria 1983
439 Ga0157377_10864173 3300014745 Unclassified 673
440 Ga0157379_10007228 3300014968 Bacteria 9606
441 Ga0157379_10501277 3300014968 Bacteria 1125
442 Ga0157376_10048687 3300014969 Bacteria 3507
443 Ga0157376_10345642 3300014969 Bacteria 1422
444 Ga0157376_10442703 3300014969 Bacteria 1266
445 Ga0163161_10151557 3300017792 Bacteria 1762
446 Ga0197907_11161130 3300020069 Bacteria 1744
447 Ga0206356_11461127 3300020070 Bacteria 1908
448 Ga0206353_10651167 3300020082 Bacteria 1562
449 Ga0213871_10005066 3300021441 Bacteria 2692
450 Ga0209025_1001520 3300025294 Bacteria 29676
451 Ga0207697_10131474 3300025315 Bacteria 1082
452 Ga0207655_1005376 3300025728 Bacteria 8722
453 Ga0207653_10009987 3300025885 Bacteria 2960
454 Ga0207653_10020231 3300025885 Bacteria 2106
455 Ga0207682_10159245 3300025893 Bacteria 1022
456 Ga0207692_10461076 3300025898 Bacteria 801
457 Ga0207642_10019819 3300025899 Bacteria 2613
458 Ga0207642_10127440 3300025899 Bacteria 1323
459 Ga0207642_10352436 3300025899 Bacteria 869
460 Ga0207710_10118652 3300025900 Bacteria 1262
461 Ga0207688_10009478 3300025901 Bacteria 5299
462 Ga0207688_10016919 3300025901 Bacteria 3961
463 Ga0207688_10031092 3300025901 Bacteria 2946
464 Ga0207688_10056477 3300025901 Bacteria 2205
465 Ga0207680_10055089 3300025903 Bacteria 2395
466 Ga0207685_10087521 3300025905 Bacteria 1304
467 Ga0207699_10147167 3300025906 Unclassified 1554
468 Ga0207699_10253676 3300025906 Bacteria 1213
469 Ga0207645_10024069 3300025907 Bacteria 3951
470 Ga0207645_10329080 3300025907 Bacteria 1020
471 Ga0207643_10036703 3300025908 Bacteria 2748
472 Ga0207643_10044089 3300025908 Bacteria 2518
473 Ga0207643_10598079 3300025908 Bacteria 710
474 Ga0207705_10018897 3300025909 Bacteria 4927
475 Ga0207705_10036877 3300025909 Bacteria 3499
476 Ga0207705_10151140 3300025909 Bacteria 1740
477 Ga0207705_10533679 3300025909 Bacteria 912
478 Ga0207684_10029662 3300025910 Bacteria 4656
479 Ga0207684_10085533 3300025910 Bacteria 2686
480 Ga0207684_10087289 3300025910 Bacteria 2658
481 Ga0207684_10110095 3300025910 Bacteria 2357
482 Ga0207684_10439595 3300025910 Bacteria 1120
483 Ga0207684_10482913 3300025910 Bacteria 1063
484 Ga0207654_10101867 3300025911 Bacteria 1770
485 Ga0207654_10268518 3300025911 Bacteria 1150
486 Ga0207654_10362818 3300025911 Bacteria 1000
487 Ga0207707_10006590 3300025912 Bacteria 10127
488 Ga0207707_10087499 3300025912 Bacteria 2722
489 Ga0207707_10216454 3300025912 Bacteria 1668
490 Ga0207695_10114142 3300025913 Bacteria 2677
491 Ga0207695_10572011 3300025913 Bacteria 1011
492 Ga0207693_10003963 3300025915 Bacteria 12582
493 Ga0207693_10013076 3300025915 Bacteria 6697
494 Ga0207693_10030694 3300025915 Bacteria 4246
495 Ga0207693_10243380 3300025915 Bacteria 1412
496 Ga0207663_10215405 3300025916 Bacteria 1394
497 Ga0207663_10271885 3300025916 Bacteria 1255
498 Ga0207663_10617528 3300025916 Bacteria 853
499 Ga0207660_10020089 3300025917 Bacteria 4478
500 Ga0207660_10049701 3300025917 Bacteria 2975
501 Ga0207662_10014292 3300025918 Bacteria 4452
502 Ga0207662_10024351 3300025918 Bacteria 3484
503 Ga0207662_10405653 3300025918 Unclassified 925
504 Ga0207657_10042742 3300025919 Bacteria 3996
505 Ga0207657_10172473 3300025919 Bacteria 1752
506 Ga0207657_10249173 3300025919 Bacteria 1416
507 Ga0207657_10472122 3300025919 Bacteria 984
508 Ga0207649_10107186 3300025920 Bacteria 1860
509 Ga0207649_10295841 3300025920 Bacteria 1182
510 Ga0207649_10407607 3300025920 Bacteria 1018
511 Ga0207649_10742971 3300025920 Bacteria 763
512 Ga0207652_10043531 3300025921 Bacteria 3823
513 Ga0207652_10046187 3300025921 Bacteria 3715
514 Ga0207652_10178087 3300025921 Bacteria 1910
515 Ga0207646_10006140 3300025922 Bacteria 12497
516 Ga0207646_10006269 3300025922 Bacteria 12335
517 Ga0207646_10152180 3300025922 Bacteria 2086
518 Ga0207646_10518412 3300025922 Bacteria 1073
519 Ga0207681_10000009 3300025923 Bacteria 410736
520 Ga0207681_10028072 3300025923 Bacteria 3644
521 Ga0207694_10309333 3300025924 Bacteria 1302
522 Ga0207659_10617011 3300025926 Bacteria 925
523 Ga0207687_10474482 3300025927 Bacteria 1041
524 Ga0207687_10826073 3300025927 Bacteria 791
525 Ga0207700_10000012 3300025928 Bacteria 231712
526 Ga0207700_10182759 3300025928 Bacteria 1757
527 Ga0207700_10397258 3300025928 Bacteria 1208
528 Ga0207664_10019978 3300025929 Bacteria 4959
529 Ga0207664_10046280 3300025929 Bacteria 3414
530 Ga0207664_10084696 3300025929 Bacteria 2586
531 Ga0207664_10090170 3300025929 Bacteria 2512
532 Ga0207644_10066422 3300025931 Bacteria 2626
533 Ga0207690_10045941 3300025932 Bacteria 2889
534 Ga0207690_10168263 3300025932 Bacteria 1640
535 Ga0207690_10195708 3300025932 Bacteria 1532
536 Ga0207690_10349101 3300025932 Bacteria 1169
537 Ga0207690_10400496 3300025932 Bacteria 1094
538 Ga0207706_10054003 3300025933 Bacteria 3546
539 Ga0207706_10068330 3300025933 Bacteria 3127
540 Ga0207706_10073483 3300025933 Bacteria 3007
541 Ga0207706_10374187 3300025933 Bacteria 1237
542 Ga0207686_10097318 3300025934 Bacteria 1957
543 Ga0207686_10119830 3300025934 Bacteria 1789
544 Ga0207686_10156703 3300025934 Bacteria 1592
545 Ga0207686_10174868 3300025934 Bacteria 1517
546 Ga0207686_10235578 3300025934 Unclassified 1330
547 Ga0207686_10368014 3300025934 Bacteria 1087
548 Ga0207686_10823808 3300025934 Bacteria 745
549 Ga0207709_10147765 3300025935 Bacteria 1624
550 Ga0207709_10155025 3300025935 Bacteria 1591
551 Ga0207709_10328843 3300025935 Bacteria 1147
552 Ga0207709_10770385 3300025935 Bacteria 775
553 Ga0207670_10014342 3300025936 Bacteria 4702
554 Ga0207670_10163280 3300025936 Bacteria 1664
555 Ga0207669_10032569 3300025937 Bacteria 2929
556 Ga0207669_10121630 3300025937 Bacteria 1773
557 Ga0207669_10153559 3300025937 Bacteria 1616
558 Ga0207669_10252298 3300025937 Bacteria 1314
559 Ga0207669_10269832 3300025937 Bacteria 1277
560 Ga0207704_10054060 3300025938 Bacteria 2445
561 Ga0207704_10455730 3300025938 Bacteria 1022
562 Ga0207704_10473042 3300025938 Bacteria 1004
563 Ga0207704_10493406 3300025938 Bacteria 985
564 Ga0207704_10966458 3300025938 Bacteria 719
565 Ga0207704_11153135 3300025938 Bacteria 660
566 Ga0207665_10001466 3300025939 Bacteria 15877
567 Ga0207665_10004281 3300025939 Bacteria 9485
568 Ga0207665_10117622 3300025939 Bacteria 1875
569 Ga0207665_10126859 3300025939 Bacteria 1808
570 Ga0207665_10243368 3300025939 Bacteria 1326
571 Ga0207691_10051487 3300025940 Bacteria 3764
572 Ga0207711_10164420 3300025941 Bacteria 2011
573 Ga0207711_10215226 3300025941 Bacteria 1756
574 Ga0207711_10465724 3300025941 Bacteria 1177
575 Ga0207689_10014420 3300025942 Bacteria 6723
576 Ga0207689_10192159 3300025942 Bacteria 1684
577 Ga0207689_10207145 3300025942 Bacteria 1620
578 Ga0207689_10347525 3300025942 Bacteria 1233
579 Ga0207661_10014827 3300025944 Bacteria 5716
580 Ga0207661_10092504 3300025944 Bacteria 2521
581 Ga0207661_10153507 3300025944 Bacteria 1992
582 Ga0207661_10489862 3300025944 Bacteria 1123
583 Ga0207661_10558259 3300025944 Bacteria 1049
584 Ga0207661_11211843 3300025944 Bacteria 694
585 Ga0207679_10057167 3300025945 Bacteria 2884
586 Ga0207667_10166754 3300025949 Bacteria 2264
587 Ga0207667_10253124 3300025949 Bacteria 1802
588 Ga0207667_10266607 3300025949 Bacteria 1751
589 Ga0207667_10554228 3300025949 Bacteria 1162
590 Ga0207651_10261091 3300025960 Bacteria 1422
591 Ga0207651_10445264 3300025960 Bacteria 1110
592 Ga0207712_10166684 3300025961 Bacteria 1718
593 Ga0207712_10203101 3300025961 Bacteria 1573
594 Ga0207668_10037124 3300025972 Bacteria 3259
595 Ga0207668_10037177 3300025972 Bacteria 3257
596 Ga0207668_10139115 3300025972 Bacteria 1864
597 Ga0207668_10608913 3300025972 Bacteria 952
598 Ga0207668_11064917 3300025972 Bacteria 724
599 Ga0207640_10168942 3300025981 Bacteria 1627
600 Ga0207658_10008375 3300025986 Bacteria 7039
601 Ga0207658_10071669 3300025986 Bacteria 2624
602 Ga0207677_10023358 3300026023 Bacteria 3819
603 Ga0207677_10139988 3300026023 Bacteria 1851
604 Ga0207703_10148390 3300026035 Bacteria 2042
605 Ga0207703_11490538 3300026035 Unclassified 651
606 Ga0207639_10287038 3300026041 Bacteria 1449
607 Ga0207678_10111101 3300026067 Bacteria 2338
608 Ga0207678_10162357 3300026067 Bacteria 1908
609 Ga0207678_11123023 3300026067 Bacteria 696
610 Ga0207708_10008954 3300026075 Bacteria 7406
611 Ga0207708_10023773 3300026075 Bacteria 4632
612 Ga0207708_10103974 3300026075 Bacteria 2200
613 Ga0207708_10478560 3300026075 Bacteria 1041
614 Ga0207702_10235700 3300026078 Bacteria 1712
615 Ga0207648_10014277 3300026089 Bacteria 7341
616 Ga0207648_10088100 3300026089 Bacteria 2710
617 Ga0207648_10117253 3300026089 Bacteria 2340
618 Ga0207648_10171797 3300026089 Bacteria 1916
619 Ga0207676_10071562 3300026095 Bacteria 2785
620 Ga0207674_10019100 3300026116 Bacteria 7430
621 Ga0207674_10041180 3300026116 Bacteria 4779
622 Ga0207674_10072059 3300026116 Bacteria 3471
623 Ga0207674_10199522 3300026116 Bacteria 1950
624 Ga0207675_100006399 3300026118 Bacteria 11157
625 Ga0207675_100012983 3300026118 Bacteria 7776
626 Ga0207675_100220507 3300026118 Bacteria 1827
627 Ga0207675_100242608 3300026118 Bacteria 1742
628 Ga0207675_100393206 3300026118 Bacteria 1365
629 Ga0207683_10011235 3300026121 Bacteria 7633
630 Ga0207683_10021405 3300026121 Bacteria 5536
631 Ga0207683_10398445 3300026121 Bacteria 1266
632 Ga0207683_10480373 3300026121 Bacteria 1147
633 Ga0207683_10645067 3300026121 Bacteria 981
634 Ga0207683_10751405 3300026121 Bacteria 905
635 Ga0207698_10017055 3300026142 Bacteria 4917
636 Ga0207698_10039101 3300026142 Bacteria 3511
637 Ga0207698_10148666 3300026142 Bacteria 2030
638 Ga0207698_10377230 3300026142 Bacteria 1348
639 Ga0207698_11609064 3300026142 Bacteria 665
640 Ga0209998_10018860 3300027717 Bacteria 1467
641 Ga0209998_10035881 3300027717 Bacteria 1112
642 Ga0209974_10065380 3300027876 Bacteria 1235
643 Ga0207428_10000393 3300027907 Bacteria 54718
644 Ga0207428_10011660 3300027907 Bacteria 7755
645 Ga0207428_10021808 3300027907 Bacteria 5419
646 Ga0207428_10025802 3300027907 Bacteria 4913
647 Ga0207428_10105175 3300027907 Bacteria 2177
648 Ga0207428_10137362 3300027907 Bacteria 1868
649 Ga0207428_10150273 3300027907 Bacteria 1773
650 Ga0268266_10000799 3300028379 Bacteria 41836
651 Ga0268266_10385049 3300028379 Bacteria 1323
652 Ga0268265_10004154 3300028380 Bacteria 10148
653 Ga0268265_10473170 3300028380 Bacteria 1175
654 Ga0268264_10006890 3300028381 Bacteria 9537
655 Ga0268264_10104738 3300028381 Bacteria 2466
656 Ga0265338_10225043 3300028800 Bacteria 1399
657 Ga0265340_10217169 3300031247 Bacteria 857
658 Ga0307408_100001088 3300031548 Bacteria 20782
659 Ga0307408_100076319 3300031548 Bacteria 2492
660 Ga0307408_100121428 3300031548 Bacteria 2024
661 Ga0307408_100314547 3300031548 Bacteria 1317
662 Ga0307408_100332868 3300031548 Bacteria 1283
663 Ga0307408_100391749 3300031548 Bacteria 1190
664 Ga0307408_100480590 3300031548 Bacteria 1084
665 Ga0307408_100833353 3300031548 Bacteria 839
666 Ga0307508_10004869 3300031616 Bacteria 12920
667 Ga0307405_10000639 3300031731 Bacteria 13463
668 Ga0307405_10048244 3300031731 Bacteria 2625
669 Ga0307405_10137020 3300031731 Bacteria 1701
670 Ga0307405_10140625 3300031731 Bacteria 1682
671 Ga0307405_10240922 3300031731 Bacteria 1339
672 Ga0307413_10024410 3300031824 Bacteria 3296
673 Ga0307413_10027481 3300031824 Bacteria 3153
674 Ga0307413_11036895 3300031824 Bacteria 705
675 Ga0307410_10020515 3300031852 Bacteria 4043
676 Ga0307410_10031542 3300031852 Bacteria 3402
677 Ga0307410_10163098 3300031852 Bacteria 1672
678 Ga0307410_10530092 3300031852 Bacteria 973
679 Ga0307410_10590847 3300031852 Bacteria 925
680 Ga0307406_10058992 3300031901 Bacteria 2468
681 Ga0307406_10145267 3300031901 Bacteria 1685
682 Ga0307406_10220153 3300031901 Bacteria 1410
683 Ga0307406_10379537 3300031901 Bacteria 1114
684 Ga0307406_10496182 3300031901 Bacteria 989
685 Ga0307407_10021264 3300031903 Bacteria 3342
686 Ga0307407_10255038 3300031903 Bacteria 1204
687 Ga0307407_10257131 3300031903 Bacteria 1199
688 Ga0307407_10292844 3300031903 Bacteria 1132
689 Ga0307412_10000473 3300031911 Bacteria 24063
690 Ga0307412_10050650 3300031911 Bacteria 2741
691 Ga0307412_10186629 3300031911 Bacteria 1564
692 Ga0307412_10194322 3300031911 Bacteria 1536
693 Ga0307409_100024998 3300031995 Bacteria 4179
694 Ga0307409_100053445 3300031995 Bacteria 3103
695 Ga0307409_100058035 3300031995 Bacteria 3003
696 Ga0307409_100101699 3300031995 Bacteria 2385
697 Ga0307409_100255964 3300031995 Bacteria 1603
698 Ga0307409_100288647 3300031995 Bacteria 1520
699 Ga0307409_100441587 3300031995 Bacteria 1254
700 Ga0307409_101067616 3300031995 Bacteria 828
701 Ga0307416_100000543 3300032002 Bacteria 19195
702 Ga0307416_100055876 3300032002 Bacteria 3182
703 Ga0307416_100126252 3300032002 Bacteria 2292
704 Ga0307416_100187412 3300032002 Bacteria 1946
705 Ga0307416_100231661 3300032002 Bacteria 1781
706 Ga0307416_100251116 3300032002 Bacteria 1721
707 Ga0307416_100768014 3300032002 Bacteria 1057
708 Ga0307416_100991623 3300032002 Bacteria 943
709 Ga0307416_101484993 3300032002 Bacteria 783
710 Ga0307411_10116137 3300032005 Bacteria 1926
711 Ga0307415_100050111 3300032126 Bacteria 2827
712 Ga0307415_100076399 3300032126 Bacteria 2374
713 Ga0307415_100082431 3300032126 Bacteria 2301
714 Ga0307415_100191310 3300032126 Bacteria 1615
715 Ga0307415_100229659 3300032126 Bacteria 1493
716 Ga0307415_100499817 3300032126 Bacteria 1063
717 Ga0307415_100534689 3300032126 Bacteria 1031
718 Ga0307415_101294694 3300032126 Bacteria 690
719 Ga0316583_10064237 3300032133 Unclassified 1285
720 Ga0373948_0036000 3300034817 Bacteria 1018
721 Ga0373929_0000008 3300035085 Bacteria 298561
722 Ga0373929_0001933 3300035085 Bacteria 3876
723 Ga0373929_0010886 3300035085 Bacteria 1705
724 Ga0373949_0003001 3300035090 Bacteria 4145
725 Ga0373951_0002983 3300035091 Bacteria 4195
726 Ga0373952_0010209 3300035092 Bacteria 1811
727 Ga0373932_0001874 3300035112 Bacteria 5627
728 Ga0373932_0116961 3300035112 Unclassified 885
729 Ga0373939_0050909 3300035114 Bacteria 1286
730 Ga0373941_0000689 3300035115 Bacteria 6870
731 Ga0373941_0004348 3300035115 Bacteria 3266
732 Ga0373960_0005466 3300035121 Bacteria 2945
733 Ga0373942_0011614 3300035207 Bacteria 2091
734 Ga0373961_0000425 3300035241 Bacteria 17488
735 Ga0373961_0003054 3300035241 Bacteria 4212
736 Ga0373962_0006858 3300035242 Bacteria 2773
737 Ga0373962_0020160 3300035242 Bacteria 1749
738 Ga0373962_0176029 3300035242 Bacteria 713
739 Ga0373931_0005957 3300035691 Bacteria 5668
740 Ga0373931_0013889 3300035691 Bacteria 3929
741 Ga0373931_0065932 3300035691 Bacteria 1964
742 Ga0373931_0078445 3300035691 Bacteria 1817
743 Ga0373935_0810975 3300035692 Unclassified 691
744 Ga0373947_0126634 3300035725 Bacteria 1627
745 Ga0395899_0009205 3300037312 Bacteria 7584
746 Ga0395899_0013482 3300037312 Bacteria 6249
747 Ga0395899_0014372 3300037312 Bacteria 6044
748 Ga0395899_0017690 3300037312 Bacteria 5429
749 Ga0395899_0020071 3300037312 Bacteria 5070
750 Ga0395899_0025092 3300037312 Bacteria 4501
751 Ga0395899_0053111 3300037312 Bacteria 3001
752 Ga0395899_0070601 3300037312 Bacteria 2556
753 Ga0395899_0097457 3300037312 Bacteria 2126
754 Ga0395899_0108426 3300037312 Bacteria 1998
755 Ga0395899_0117893 3300037312 Bacteria 1904
756 Ga0395899_0159560 3300037312 Bacteria 1594
757 Ga0395899_0178205 3300037312 Bacteria 1493
758 Ga0395899_0216038 3300037312 Bacteria 1330
759 Ga0395900_0001263 3300037418 Bacteria 30958
760 Ga0395900_0011737 3300037418 Bacteria 8957
761 Ga0395900_0015802 3300037418 Bacteria 7694
762 Ga0395900_0016029 3300037418 Bacteria 7635
763 Ga0395900_0027139 3300037418 Bacteria 5862
764 Ga0395900_0035139 3300037418 Bacteria 5163
765 Ga0395900_0040863 3300037418 Bacteria 4780
766 Ga0395900_0041226 3300037418 Bacteria 4760
767 Ga0395900_0056727 3300037418 Bacteria 4031
768 Ga0395900_0065413 3300037418 Bacteria 3735
769 Ga0395900_0098219 3300037418 Bacteria 3008
770 Ga0395900_0106115 3300037418 Bacteria 2885
771 Ga0395900_0113159 3300037418 Bacteria 2785
772 Ga0395900_0140192 3300037418 Bacteria 2476
773 Ga0395900_0142711 3300037418 Bacteria 2451
774 Ga0395900_0179388 3300037418 Bacteria 2153
775 Ga0395900_0218136 3300037418 Bacteria 1924
776 Ga0395900_0223040 3300037418 Bacteria 1899
777 Ga0395900_0248420 3300037418 Bacteria 1781
778 Ga0395900_0250179 3300037418 Bacteria 1774
779 Ga0395900_0256178 3300037418 Bacteria 1749
780 Ga0395900_0350431 3300037418 Bacteria 1450
781 Ga0395900_0369851 3300037418 Bacteria 1403
782 Ga0395900_0378871 3300037418 Bacteria 1383
783 Ga0395900_0446469 3300037418 Bacteria 1250
784 Ga0395900_0591880 3300037418 Bacteria 1050
785 Ga0395898_0000795 3300037466 Bacteria 53570
786 Ga0395898_0002292 3300037466 Bacteria 23000
787 Ga0395898_0005555 3300037466 Bacteria 13599
788 Ga0395898_0006822 3300037466 Bacteria 12142
789 Ga0395898_0018229 3300037466 Bacteria 7161
790 Ga0395898_0018559 3300037466 Bacteria 7091
791 Ga0395898_0020122 3300037466 Bacteria 6780
792 Ga0395898_0024209 3300037466 Bacteria 6125
793 Ga0395898_0031257 3300037466 Bacteria 5322
794 Ga0395898_0041411 3300037466 Bacteria 4549
795 Ga0395898_0055457 3300037466 Bacteria 3865
796 Ga0395898_0067582 3300037466 Bacteria 3460
797 Ga0395898_0086767 3300037466 Bacteria 3015
798 Ga0395898_0100355 3300037466 Bacteria 2780
799 Ga0395898_0152830 3300037466 Bacteria 2208
800 Ga0395898_0232401 3300037466 Bacteria 1758
801 Ga0395898_0274394 3300037466 Bacteria 1608
802 Ga0395898_0361869 3300037466 Bacteria 1383
803 Ga0395898_0373678 3300037466 Bacteria 1359
804 Ga0395898_0502531 3300037466 Bacteria 1153
805 Ga0395898_0887478 3300037466 Bacteria 830
806 Ga0395898_0890394 3300037466 Bacteria 828
807 Ga0395898_0970095 3300037466 Bacteria 787
808 Ga0395905_0001754 3300037471 Bacteria 25323
809 Ga0395905_0008154 3300037471 Bacteria 10346
810 Ga0395905_0009489 3300037471 Bacteria 9510
811 Ga0395905_0045175 3300037471 Bacteria 4131
812 Ga0395905_0051315 3300037471 Bacteria 3863
813 Ga0395905_0101635 3300037471 Bacteria 2699
814 Ga0395905_0128043 3300037471 Bacteria 2388
815 Ga0395905_0138021 3300037471 Bacteria 2294
816 Ga0395905_0188335 3300037471 Bacteria 1936
817 Ga0395905_0215358 3300037471 Bacteria 1799
818 Ga0395905_0629562 3300037471 Bacteria 975
819 Ga0395905_0665904 3300037471 Bacteria 943
820 Ga0395905_0725317 3300037471 Bacteria 896
821 Ga0395905_0950274 3300037471 Bacteria 762
822 Ga0395901_0003357 3300038443 Bacteria 16129
823 Ga0395901_0003708 3300038443 Bacteria 15401
824 Ga0395901_0008348 3300038443 Bacteria 10469
825 Ga0395901_0009956 3300038443 Bacteria 9634
826 Ga0395901_0013971 3300038443 Bacteria 8171
827 Ga0395901_0016014 3300038443 Bacteria 7638
828 Ga0395901_0016308 3300038443 Bacteria 7567
829 Ga0395901_0021053 3300038443 Bacteria 6680
830 Ga0395901_0024337 3300038443 Bacteria 6214
831 Ga0395901_0051113 3300038443 Bacteria 4296
832 Ga0395901_0053638 3300038443 Bacteria 4189
833 Ga0395901_0056433 3300038443 Bacteria 4085
834 Ga0395901_0082039 3300038443 Bacteria 3368
835 Ga0395901_0085355 3300038443 Bacteria 3300
836 Ga0395901_0085853 3300038443 Bacteria 3290
837 Ga0395901_0087776 3300038443 Bacteria 3252
838 Ga0395901_0091646 3300038443 Bacteria 3181
839 Ga0395901_0092079 3300038443 Bacteria 3173
840 Ga0395901_0142606 3300038443 Bacteria 2518
841 Ga0395901_0152876 3300038443 Bacteria 2424
842 Ga0395901_0160495 3300038443 Bacteria 2361
843 Ga0395901_0202777 3300038443 Bacteria 2079
844 Ga0395901_0230542 3300038443 Bacteria 1933
845 Ga0395901_0271436 3300038443 Bacteria 1764
846 Ga0395901_0277332 3300038443 Bacteria 1743
847 Ga0395901_0349681 3300038443 Bacteria 1525
848 Ga0395901_0364943 3300038443 Bacteria 1488
849 Ga0395901_0386202 3300038443 Bacteria 1440
850 Ga0395901_0419350 3300038443 Bacteria 1373
851 Ga0395901_0422654 3300038443 Bacteria 1366
852 Ga0395901_0422805 3300038443 Bacteria 1366
853 Ga0395901_0510835 3300038443 Bacteria 1222
854 Ga0395901_0524317 3300038443 Bacteria 1203
855 Ga0395901_1084680 3300038443 Bacteria 772
856 Ga0395901_1148773 3300038443 Bacteria 745
857 Ga0395901_1161623 3300038443 Bacteria 739
858 Ga0395901_1185782 3300038443 Bacteria 730
859 Ga0395901_1418546 3300038443 Bacteria 652
860 Ga0242420_017464 3300038996 Bacteria 1256
861 Ga0242420_033140 3300038996 Bacteria 965
862 Ga0436365_1112078 3300039437 Bacteria 1796
863 Ga0436360_0817146 3300039438 Bacteria 4150
864 Ga0436362_0193206 3300039453 Bacteria 728
865 Ga0439436_0003181 3300041404 Bacteria 4979
866 Ga0439436_0024523 3300041404 Bacteria 1780
867 Ga0439438_001298 3300041405 Bacteria 11055
868 Ga0439438_045989 3300041405 Bacteria 1122
869 Ga0439439_0002905 3300041406 Bacteria 3723
870 Ga0439461_0000713 3300041410 Bacteria 4842
871 Ga0439466_0007871 3300041411 Bacteria 4022
872 Ga0439466_0022763 3300041411 Bacteria 2209
873 Ga0451789_1064853 3300041443 Bacteria 835
874 Ga0451797_0102084 3300041453 Bacteria 659
875 Ga0451797_1111866 3300041453 Bacteria 959
876 Ga0451802_1776733 3300041460 Unclassified 725
877 Ga0451807_0155102 3300041486 Bacteria 599
878 Ga0451807_1961644 3300041486 Bacteria 2528
879 Ga0451807_2346038 3300041486 Bacteria 1744
880 Ga0451835_0543550 3300041492 Bacteria 1770
881 Ga0451839_0581077 3300041496 Bacteria 4068
882 Ga0451847_0773695 3300041503 Unclassified 710
883 Ga0451849_1358585 3300041505 Bacteria 1470
884 Ga0451849_1483773 3300041505 Bacteria 2585
885 Ga0451843_0519664 3300041509 Unclassified 1480
886 Ga0451855_0835047 3300041511 Bacteria 1375
887 Ga0451855_1460886 3300041511 Bacteria 716
888 Ga0451853_0870872 3300041512 Unclassified 806
889 Ga0451853_1343855 3300041512 Bacteria 751
890 Ga0451853_1819789 3300041512 Bacteria 1080
891 Ga0451853_2510936 3300041512 Bacteria 1487
892 Ga0451853_3695274 3300041512 Bacteria 1163
893 Ga0439433_0000133 3300041999 Bacteria 11002
894 Ga0439433_0016104 3300041999 Bacteria 1653
895 Ga0439442_003160 3300042002 Bacteria 3259
896 Ga0439442_006217 3300042002 Bacteria 2395
897 Ga0439442_017543 3300042002 Bacteria 1477
898 Ga0439442_034164 3300042002 Bacteria 1063
899 Ga0439432_000702 3300042006 Bacteria 12536
900 Ga0439449_0000267 3300042007 Bacteria 18795
901 Ga0439449_0005707 3300042007 Bacteria 4758
902 Ga0439449_0027218 3300042007 Bacteria 2133
903 Ga0439449_0040295 3300042007 Bacteria 1736
904 Ga0439451_008645 3300042009 Bacteria 2064
905 Ga0439452_000706 3300042010 Bacteria 16293
906 Ga0439454_000546 3300042011 Bacteria 3088
907 Ga0439454_016557 3300042011 Bacteria 1044
908 Ga0439457_002732 3300042014 Bacteria 4959
909 Ga0439457_014431 3300042014 Bacteria 1768
910 Ga0439462_0005141 3300042015 Bacteria 3212
911 Ga0450911_005829 3300042115 Bacteria 1879
912 Ga0450913_020486 3300042117 Bacteria 604
913 Ga0450919_010325 3300042121 Bacteria 1068
914 Ga0450920_000295 3300042122 Bacteria 7557
915 Ga0450920_000669 3300042122 Bacteria 5484
916 Ga0450897_009819 3300042128 Bacteria 912
917 Ga0450906_029724 3300042145 Bacteria 966
918 Ga0439446_0004453 3300042156 Bacteria 3552
919 Ga0450908_001583 3300042184 Bacteria 4422
920 Ga0439434_0022050 3300042435 Bacteria 1914
921 Ga0439444_0093361 3300042437 Bacteria 674
922 Ga0450918_032822 3300042531 Bacteria 919
923 Ga0450893_0032163 3300042532 Bacteria 939
924 Ga0451577_0025642 3300042876 Bacteria 5348
925 Ga0439440_0123077 3300042993 Bacteria 724
926 Ga0466972_0520052 3300044658 Unclassified 561
927 Ga0466965_0174223 3300044683 Bacteria 1133
928 Ga0466966_0379690 3300044684 Bacteria 849
929 Ga0466961_0077795 3300044693 Bacteria 2101
930 Ga0466963_0001595 3300044694 Bacteria 12321
931 Ga0466963_0018211 3300044694 Bacteria 4387
932 Ga0466963_0024634 3300044694 Bacteria 3831
933 Ga0466964_0013917 3300044706 Bacteria 3055
934 Ga0466964_0148855 3300044706 Bacteria 1083
935 Ga0453684_0044176 3300044712 Bacteria 5970
936 Ga0453684_0707931 3300044712 Bacteria 1094
937 Ga0466968_0022051 3300044735 Bacteria 2585
938 Ga0466970_0017892 3300044765 Bacteria 3665
939 Ga0466970_0142624 3300044765 Bacteria 1320
940 Ga0466970_0169428 3300044765 Bacteria 1210
941 Ga0466957_0050530 3300044842 Bacteria 2530
942 Ga0466960_0003429 3300044901 Bacteria 6097
943 Ga0466960_0016338 3300044901 Bacteria 3217
944 Ga0466958_0482519 3300045836 Bacteria 804
945 Ga0466967_0000028 3300045976 Bacteria 59545
946 Ga0466967_0001037 3300045976 Bacteria 15243
947 Ga0466967_0015794 3300045976 Bacteria 5931
948 Ga0466967_1026256 3300045976 Bacteria 821
949 Ga0495592_0029720 3300046454 Bacteria 4137
950 Ga0495603_0022783 3300046455 Bacteria 3790
951 Ga0495603_0152852 3300046455 Bacteria 1340
952 Ga0495603_0176632 3300046455 Bacteria 1236
953 Ga0495590_0099476 3300046457 Bacteria 1033
954 Ga0495590_0159729 3300046457 Bacteria 819
955 Ga0495629_0043473 3300046459 Bacteria 3154
956 Ga0495629_0120149 3300046459 Bacteria 1830
957 Ga0495641_0013713 3300046461 Bacteria 4432
958 Ga0495651_0057234 3300046462 Bacteria 2993
959 Ga0495653_0000468 3300046463 Bacteria 31243
960 Ga0495653_0031269 3300046463 Bacteria 4232
961 Ga0495580_0237772 3300046472 Bacteria 1249
962 Ga0495582_0029166 3300046473 Bacteria 3029
963 Ga0495582_0071781 3300046473 Bacteria 1915
964 Ga0495582_0266851 3300046473 Bacteria 982
965 Ga0495582_0533634 3300046473 Bacteria 679
966 Ga0495605_0050585 3300046474 Bacteria 2027
967 Ga0495605_0289369 3300046474 Bacteria 695
968 Ga0495605_0310538 3300046474 Bacteria 666
969 Ga0495639_0002895 3300046475 Bacteria 7472
970 Ga0495639_0220327 3300046475 Bacteria 933
971 Ga0495662_0055307 3300046476 Bacteria 1917
972 Ga0495662_0076298 3300046476 Bacteria 1627
973 Ga0495664_0053009 3300046477 Bacteria 2412
974 Ga0495584_0080076 3300046491 Bacteria 1643
975 Ga0495584_0090453 3300046491 Bacteria 1543
976 Ga0495584_0437258 3300046491 Bacteria 665
977 Ga0495585_0169633 3300046492 Bacteria 1128
978 Ga0495585_0349262 3300046492 Bacteria 719
979 Ga0495594_0048752 3300046499 Bacteria 2327
980 Ga0495594_0066109 3300046499 Bacteria 2006
981 Ga0495596_0177482 3300046500 Bacteria 828
982 Ga0495608_0130158 3300046511 Bacteria 1611
983 Ga0495608_0140439 3300046511 Bacteria 1542
984 Ga0495618_0031364 3300046514 Bacteria 3325
985 Ga0495618_0198257 3300046514 Bacteria 1271
986 Ga0495630_0006446 3300046517 Bacteria 8348
987 Ga0495630_0065030 3300046517 Bacteria 2741
988 Ga0495630_0925674 3300046517 Bacteria 664
989 Ga0495631_0053942 3300046518 Bacteria 1754
990 Ga0495631_0209104 3300046518 Bacteria 834
991 Ga0495663_0008411 3300046525 Bacteria 2859
992 Ga0495663_0019481 3300046525 Bacteria 1943
993 Ga0495666_0074730 3300046526 Bacteria 1607
994 Ga0495642_0064715 3300046528 Bacteria 1521
995 Ga0495642_0271076 3300046528 Bacteria 743
996 Ga0495665_0000658 3300046531 Bacteria 17722
997 Ga0495665_0030148 3300046531 Bacteria 2903
998 Ga0495640_0448158 3300046533 Bacteria 789
999 Ga0495586_0187369 3300046535 Bacteria 1171
1000 Ga0495586_0192398 3300046535 Bacteria 1155
1001 Ga0495587_0003469 3300046536 Bacteria 10505
1002 Ga0495609_0020981 3300046538 Bacteria 3015
1003 Ga0495597_0245477 3300046542 Bacteria 705
1004 Ga0495645_0008819 3300046543 Bacteria 7043
1005 Ga0495645_0151015 3300046543 Bacteria 1614
1006 Ga0495667_0031825 3300046559 Bacteria 3537
1007 Ga0495667_0102772 3300046559 Bacteria 1848
1008 Ga0495667_0474424 3300046559 Bacteria 785
1009 Ga0495656_0015894 3300046615 Bacteria 2849
1010 Ga0495656_0061734 3300046615 Bacteria 1638
1011 Ga0495656_0069947 3300046615 Bacteria 1556
1012 Ga0495668_0063832 3300046616 Bacteria 2028
1013 Ga0495668_0406748 3300046616 Bacteria 748
1014 Ga0495634_0116227 3300046642 Bacteria 1716
1015 Ga0495611_0054018 3300046648 Bacteria 1815
1016 Ga0495611_0086887 3300046648 Bacteria 1443
1017 Ga0495611_0353727 3300046648 Bacteria 674
1018 Ga0495635_0367315 3300046663 Bacteria 959
1019 Ga0495659_0002547 3300046664 Bacteria 5877
1020 Ga0495659_0006374 3300046664 Bacteria 3725
1021 Ga0495588_0070652 3300046674 Bacteria 1815
1022 Ga0495588_0094490 3300046674 Bacteria 1567
1023 Ga0495588_0139940 3300046674 Bacteria 1278
1024 Ga0495588_0185781 3300046674 Bacteria 1098
1025 Ga0495657_0044514 3300046675 Bacteria 3019
1026 Ga0495657_0051705 3300046675 Bacteria 2758
1027 Ga0495657_0423173 3300046675 Bacteria 782
1028 Ga0495599_0141266 3300046678 Bacteria 1494
1029 Ga0495623_0008339 3300046679 Bacteria 6739
1030 Ga0495647_0065692 3300046681 Bacteria 1441
1031 Ga0495658_0005078 3300046683 Bacteria 6467
1032 Ga0495658_0027216 3300046683 Bacteria 3074
1033 Ga0495613_0003796 3300046689 Bacteria 11323
1034 Ga0495613_0128807 3300046689 Bacteria 1813
1035 Ga0495613_0277417 3300046689 Bacteria 1165
1036 Ga0495624_0011307 3300046690 Bacteria 6136
1037 Ga0495670_0002814 3300046691 Bacteria 8607
1038 Ga0495670_0508902 3300046691 Bacteria 654
1039 Ga0495671_0352538 3300046692 Bacteria 706
1040 Ga0495600_0180032 3300046809 Bacteria 1362
1041 Ga0495600_0208952 3300046809 Bacteria 1251
1042 Ga0495581_0001440 3300047315 Bacteria 13209
1043 Ga0495581_0007081 3300047315 Bacteria 6494
1044 Ga0495581_0071127 3300047315 Bacteria 2013
1045 Ga0495604_0064049 3300047317 Bacteria 2803
1046 Ga0495636_0012871 3300047318 Bacteria 3316
1047 Ga0495636_0144520 3300047318 Bacteria 1064
1048 Ga0495674_0020283 3300047319 Bacteria 6156
1049 Ga0495674_0086940 3300047319 Bacteria 2676
1050 Ga0495674_0256009 3300047319 Bacteria 1439
1051 Ga0495676_0056472 3300047321 Bacteria 3104
1052 Ga0495680_0039805 3300047322 Bacteria 3747
1053 Ga0495680_0086203 3300047322 Bacteria 2363
1054 Ga0495680_0238366 3300047322 Bacteria 1293
1055 Ga0495675_0235890 3300047444 Bacteria 1102
1056 Ga0495677_0036129 3300047445 Bacteria 1804
1057 Ga0495677_0120551 3300047445 Bacteria 1000
1058 Ga0495681_0113294 3300047470 Bacteria 1172
1059 Ga0495684_0032299 3300047471 Bacteria 4018
1060 Ga0495602_0279561 3300048088 Bacteria 1230
1061 Ga0495626_0167153 3300048091 Bacteria 919
1062 Ga0496100_0004896 3300048903 Bacteria 7157
1063 Ga0496100_0014091 3300048903 Bacteria 4634
1064 Ga0496100_0018966 3300048903 Bacteria 4094
1065 Ga0496100_0079001 3300048903 Bacteria 2216
1066 Ga0496100_0442488 3300048903 Bacteria 995
1067 Ga0496101_0008894 3300048904 Bacteria 6577
1068 Ga0496101_0016013 3300048904 Bacteria 5060
1069 Ga0496101_0025311 3300048904 Bacteria 4116
1070 Ga0496101_0224918 3300048904 Bacteria 1457
1071 Ga0496101_0239064 3300048904 Bacteria 1413
1072 Ga0496101_0491685 3300048904 Bacteria 969
1073 Ga0496102_0018764 3300048905 Bacteria 6083
1074 Ga0496102_0019938 3300048905 Bacteria 5915
1075 Ga0496102_0192977 3300048905 Bacteria 1919
1076 Ga0496102_0228941 3300048905 Bacteria 1752
1077 Ga0496102_0945920 3300048905 Bacteria 783
1078 Ga0496103_0002999 3300048906 Bacteria 10434
1079 Ga0496103_0016111 3300048906 Bacteria 4460
1080 Ga0496103_0059187 3300048906 Bacteria 2380
1081 Ga0496103_0135530 3300048906 Bacteria 1573
1082 Ga0496103_0343106 3300048906 Bacteria 960
1083 Ga0496104_0012176 3300048907 Bacteria 7725
1084 Ga0496104_0020628 3300048907 Bacteria 6043
1085 Ga0496104_0023001 3300048907 Bacteria 5728
1086 Ga0496104_0189050 3300048907 Bacteria 1970
1087 Ga0496104_0338271 3300048907 Bacteria 1418
1088 Ga0496105_0025687 3300048908 Bacteria 4797
1089 Ga0496105_0040567 3300048908 Bacteria 3838
1090 Ga0496105_0087548 3300048908 Bacteria 2573
1091 Ga0496105_0252189 3300048908 Bacteria 1429
1092 Ga0496105_0538305 3300048908 Bacteria 913
1093 Ga0496105_0541858 3300048908 Bacteria 909
1094 Ga0496105_0599920 3300048908 Bacteria 855
1095 Ga0496106_0009515 3300048909 Bacteria 7179
1096 Ga0496106_0032549 3300048909 Bacteria 3888
1097 Ga0496106_0152759 3300048909 Bacteria 1822
1098 Ga0496106_0174141 3300048909 Bacteria 1707
1099 Ga0496106_0243879 3300048909 Bacteria 1436
1100 Ga0496106_0423164 3300048909 Bacteria 1070
1101 Ga0496106_0599037 3300048909 Bacteria 882
1102 Ga0496107_0034036 3300048910 Bacteria 3646
1103 Ga0496107_0134688 3300048910 Bacteria 1825
1104 Ga0496107_0203368 3300048910 Bacteria 1472
1105 Ga0496108_0005647 3300048911 Bacteria 10131
1106 Ga0496108_0020153 3300048911 Bacteria 5480
1107 Ga0496108_0024660 3300048911 Bacteria 4954
1108 Ga0496108_0030496 3300048911 Bacteria 4469
1109 Ga0496108_0105497 3300048911 Bacteria 2406
1110 Ga0496108_0142051 3300048911 Bacteria 2068
1111 Ga0496108_0149193 3300048911 Bacteria 2017
1112 Ga0496108_0221419 3300048911 Bacteria 1644
1113 Ga0496108_0366804 3300048911 Bacteria 1257
1114 Ga0496108_0517678 3300048911 Bacteria 1041
1115 Ga0496109_0000913 3300048912 Bacteria 24554
1116 Ga0496109_0011225 3300048912 Bacteria 7690
1117 Ga0496109_0045636 3300048912 Bacteria 3977
1118 Ga0496109_0048258 3300048912 Bacteria 3874
1119 Ga0496109_0050316 3300048912 Bacteria 3795
1120 Ga0496109_0068168 3300048912 Bacteria 3261
1121 Ga0496109_0072125 3300048912 Bacteria 3171
1122 Ga0496109_0122267 3300048912 Bacteria 2425
1123 Ga0496109_0174949 3300048912 Bacteria 2014
1124 Ga0496109_0178720 3300048912 Bacteria 1992
1125 Ga0496109_1006068 3300048912 Bacteria 771
1126 Ga0496110_0003661 3300048913 Bacteria 11828
1127 Ga0496110_0008390 3300048913 Bacteria 8312
1128 Ga0496110_0034761 3300048913 Bacteria 4368
1129 Ga0496110_0074161 3300048913 Bacteria 3021
1130 Ga0496110_0085681 3300048913 Bacteria 2812
1131 Ga0496110_0176871 3300048913 Bacteria 1937
1132 Ga0496110_0343249 3300048913 Bacteria 1360
1133 Ga0496110_0356231 3300048913 Bacteria 1333
1134 Ga0496110_0483492 3300048913 Bacteria 1128
1135 Ga0496110_0527959 3300048913 Bacteria 1073
1136 Ga0496110_0732284 3300048913 Bacteria 891
1137 Ga0496110_0845802 3300048913 Bacteria 820
1138 Ga0496110_1165479 3300048913 Bacteria 679
1139 Ga0496111_0003623 3300048914 Bacteria 9573
1140 Ga0496111_0003720 3300048914 Bacteria 9492
1141 Ga0496111_0010934 3300048914 Bacteria 6105
1142 Ga0496111_0018694 3300048914 Bacteria 4804
1143 Ga0496111_0036855 3300048914 Bacteria 3497
1144 Ga0496111_0043737 3300048914 Bacteria 3220
1145 Ga0496111_0044395 3300048914 Bacteria 3195
1146 Ga0496111_0064517 3300048914 Bacteria 2657
1147 Ga0496111_0078428 3300048914 Bacteria 2408
1148 Ga0496111_0089871 3300048914 Bacteria 2250
1149 Ga0496111_0158427 3300048914 Bacteria 1680
1150 Ga0496111_0476003 3300048914 Bacteria 920
1151 Ga0496112_0006002 3300048915 Bacteria 10601
1152 Ga0496112_0018396 3300048915 Bacteria 6577
1153 Ga0496112_0020095 3300048915 Bacteria 6323
1154 Ga0496112_0034386 3300048915 Bacteria 4932
1155 Ga0496112_0114368 3300048915 Bacteria 2669
1156 Ga0496112_0118964 3300048915 Bacteria 2612
1157 Ga0496112_0150253 3300048915 Bacteria 2296
1158 Ga0496112_0368599 3300048915 Bacteria 1378
1159 Ga0496112_0479672 3300048915 Bacteria 1180
1160 Ga0496112_0596768 3300048915 Bacteria 1036
1161 Ga0496112_1086817 3300048915 Bacteria 718
1162 Ga0496112_1377050 3300048915 Bacteria 620
1163 Ga0496113_0003267 3300048916 Bacteria 9670
1164 Ga0496113_0042109 3300048916 Bacteria 3373
1165 Ga0496113_0116988 3300048916 Bacteria 2080
1166 Ga0496113_0178607 3300048916 Bacteria 1682
1167 Ga0496113_0196438 3300048916 Bacteria 1603
1168 Ga0496113_0644727 3300048916 Bacteria 847
1169 Ga0496114_0000073 3300048917 Bacteria 71711
1170 Ga0496114_0010517 3300048917 Bacteria 7364
1171 Ga0496114_0012084 3300048917 Bacteria 6909
1172 Ga0496114_0034641 3300048917 Bacteria 4166
1173 Ga0496114_0066003 3300048917 Bacteria 3033
1174 Ga0496114_0119666 3300048917 Bacteria 2264
1175 Ga0496115_0057615 3300048918 Bacteria 3125
1176 Ga0496115_0252868 3300048918 Bacteria 1450
1177 Ga0496115_0412223 3300048918 Bacteria 1095
1178 Ga0496115_0460898 3300048918 Bacteria 1025
1179 Ga0496122_0000427 3300048925 Bacteria 88913
1180 Ga0496123_0001011 3300048926 Bacteria 42966
1181 Ga0496124_0002673 3300048927 Bacteria 22841
1182 Ga0496125_0000558 3300048928 Bacteria 64136
1183 Ga0496125_0138813 3300048928 Bacteria 1694
1184 Ga0501317_026060 3300049533 Bacteria 823
1185 Ga0501317_027196 3300049533 Bacteria 811
1186 Ga0501324_010065 3300049540 Bacteria 857
1187 Ga0501324_026137 3300049540 Bacteria 618
1188 Ga0501031_0002646 3300049568 Bacteria 11395
1189 Ga0501031_0004843 3300049568 Bacteria 8746
1190 Ga0501031_0075736 3300049568 Bacteria 2191
1191 Ga0501032_0000158 3300049569 Bacteria 54794
1192 Ga0501032_0004426 3300049569 Bacteria 10590
1193 Ga0501032_0175909 3300049569 Bacteria 1402
1194 Ga0501032_0191664 3300049569 Bacteria 1336
1195 Ga0501032_0325055 3300049569 Bacteria 992
1196 Ga0501033_0007557 3300049570 Bacteria 8456
1197 Ga0501033_0046670 3300049570 Bacteria 3221
1198 Ga0501034_0000141 3300049571 Bacteria 134974
1199 Ga0501036_0001775 3300049572 Bacteria 16746
1200 Ga0501036_0035440 3300049572 Bacteria 4223
1201 Ga0501036_0080888 3300049572 Bacteria 2746
1202 Ga0501036_0146730 3300049572 Bacteria 1990
1203 Ga0501038_0005105 3300049574 Bacteria 12201
1204 Ga0501038_0010377 3300049574 Bacteria 8519
1205 Ga0501038_0063650 3300049574 Bacteria 3147
1206 Ga0501038_0119318 3300049574 Bacteria 2177
1207 Ga0501038_0163802 3300049574 Bacteria 1805
1208 Ga0501039_0027976 3300049575 Bacteria 4337
1209 Ga0501039_0348588 3300049575 Bacteria 1163
1210 Ga0501040_0006969 3300049576 Bacteria 7320
1211 Ga0501040_0139350 3300049576 Bacteria 1708
1212 Ga0501040_0144740 3300049576 Bacteria 1675
1213 Ga0501040_0228509 3300049576 Bacteria 1325
1214 Ga0501041_0008144 3300049577 Bacteria 6167
1215 Ga0501041_0051941 3300049577 Bacteria 2499
1216 Ga0501041_0070571 3300049577 Bacteria 2144
1217 Ga0501041_0549791 3300049577 Bacteria 736
1218 Ga0501042_0019090 3300049578 Bacteria 4757
1219 Ga0501042_0024287 3300049578 Bacteria 4251
1220 Ga0501042_0085537 3300049578 Bacteria 2261
1221 Ga0501042_0090478 3300049578 Bacteria 2196
1222 Ga0501042_0099943 3300049578 Bacteria 2085
1223 Ga0501042_0310153 3300049578 Bacteria 1140
1224 Ga0501042_1260572 3300049578 Bacteria 539
1225 Ga0501043_0002861 3300049579 Bacteria 14412
1226 Ga0501043_0018421 3300049579 Bacteria 5476
1227 Ga0501043_0116703 3300049579 Bacteria 2094
1228 Ga0501043_0128522 3300049579 Bacteria 1986
1229 Ga0501043_0145751 3300049579 Bacteria 1854
1230 Ga0501043_0804677 3300049579 Unclassified 680
1231 Ga0501046_0008318 3300049580 Bacteria 9050
1232 Ga0501046_0013675 3300049580 Bacteria 6863
1233 Ga0501046_0243456 3300049580 Bacteria 1326
1234 Ga0501047_0902762 3300049581 Bacteria 697
1235 Ga0501048_0039171 3300049582 Bacteria 3400
1236 Ga0501048_0119473 3300049582 Bacteria 1862
1237 Ga0501048_0135899 3300049582 Bacteria 1737
1238 Ga0501048_0148590 3300049582 Bacteria 1657
1239 Ga0501048_0153913 3300049582 Bacteria 1626
1240 Ga0501067_0026343 3300049583 Bacteria 3220
1241 Ga0501067_0225698 3300049583 Bacteria 1043
1242 Ga0501068_0000514 3300049584 Bacteria 19601
1243 Ga0501068_0012529 3300049584 Bacteria 4812
1244 Ga0501068_0040285 3300049584 Bacteria 2804
1245 Ga0501068_0063650 3300049584 Bacteria 2243
1246 Ga0501068_0203249 3300049584 Bacteria 1257
1247 Ga0501068_0341923 3300049584 Bacteria 961
1248 Ga0501069_0023524 3300049585 Bacteria 3360
1249 Ga0501069_0060023 3300049585 Bacteria 2123
1250 Ga0501069_0112565 3300049585 Bacteria 1551
1251 Ga0501069_0192951 3300049585 Bacteria 1179
1252 Ga0501070_0019413 3300049586 Bacteria 5699
1253 Ga0501070_0021603 3300049586 Bacteria 5398
1254 Ga0501070_0032073 3300049586 Bacteria 4398
1255 Ga0501071_0003854 3300049587 Bacteria 9442
1256 Ga0501071_0004163 3300049587 Bacteria 9154
1257 Ga0501071_0012653 3300049587 Bacteria 5732
1258 Ga0501071_0069995 3300049587 Bacteria 2555
1259 Ga0501071_0178201 3300049587 Bacteria 1592
1260 Ga0501071_0238836 3300049587 Bacteria 1370
1261 Ga0501071_0250655 3300049587 Bacteria 1336
1262 Ga0501072_0009755 3300049588 Bacteria 7301
1263 Ga0501072_0023700 3300049588 Bacteria 4768
1264 Ga0501072_0077038 3300049588 Bacteria 2639
1265 Ga0501072_0088751 3300049588 Bacteria 2453
1266 Ga0501072_0117070 3300049588 Bacteria 2122
1267 Ga0501072_0161140 3300049588 Bacteria 1789
1268 Ga0501072_0242432 3300049588 Bacteria 1436
1269 Ga0501072_0333942 3300049588 Bacteria 1204
1270 Ga0501072_1070794 3300049588 Unclassified 628
1271 Ga0501073_0001537 3300049589 Bacteria 17091
1272 Ga0501073_0007238 3300049589 Bacteria 8263
1273 Ga0501073_0241273 3300049589 Bacteria 1248
1274 Ga0501073_0323695 3300049589 Bacteria 1064
1275 Ga0501074_0001777 3300049590 Bacteria 14742
1276 Ga0501074_0003435 3300049590 Bacteria 11232
1277 Ga0501074_0070397 3300049590 Bacteria 2515
1278 Ga0501074_0153514 3300049590 Bacteria 1646
1279 Ga0501074_0335740 3300049590 Bacteria 1073
1280 Ga0501075_0000318 3300049591 Bacteria 26984
1281 Ga0501075_0013143 3300049591 Bacteria 5902
1282 Ga0501075_0033028 3300049591 Bacteria 3848
1283 Ga0501075_0068115 3300049591 Bacteria 2688
1284 Ga0501075_0217360 3300049591 Bacteria 1458
1285 Ga0501075_0574982 3300049591 Bacteria 860
1286 Ga0501076_0012413 3300049592 Bacteria 6366
1287 Ga0501076_0030863 3300049592 Bacteria 4175
1288 Ga0501076_0031835 3300049592 Bacteria 4115
1289 Ga0501076_0043708 3300049592 Bacteria 3531
1290 Ga0501076_0045049 3300049592 Bacteria 3481
1291 Ga0501076_0129445 3300049592 Bacteria 2047
1292 Ga0501076_0202578 3300049592 Bacteria 1621
1293 Ga0501076_0489681 3300049592 Bacteria 1013
1294 Ga0501077_0002406 3300049593 Bacteria 11229
1295 Ga0501077_0033658 3300049593 Bacteria 3261
1296 Ga0501077_0034848 3300049593 Bacteria 3204
1297 Ga0501077_0046784 3300049593 Bacteria 2748
1298 Ga0501077_0063333 3300049593 Bacteria 2346
1299 Ga0501077_0101908 3300049593 Bacteria 1819
1300 Ga0501227_033330 3300049665 Bacteria 1246
1301 Ga0501247_009835 3300049677 Unclassified 1133
1302 Ga0501253_022460 3300049683 Bacteria 1124
1303 Ga0501079_0004813 3300049741 Bacteria 10003
1304 Ga0501079_0004932 3300049741 Bacteria 9893
1305 Ga0501079_0006316 3300049741 Bacteria 8888
1306 Ga0501079_0139639 3300049741 Bacteria 1887
1307 Ga0501079_0258634 3300049741 Bacteria 1361
1308 Ga0501079_0317474 3300049741 Bacteria 1220
1309 Ga0501079_0472073 3300049741 Bacteria 986
1310 Ga0501079_0607053 3300049741 Bacteria 861
1311 Ga0501079_0957743 3300049741 Bacteria 674
1312 Ga0501080_0010019 3300049742 Bacteria 8663
1313 Ga0501080_0025475 3300049742 Bacteria 5490
1314 Ga0501080_0079970 3300049742 Bacteria 3038
1315 Ga0501080_0097163 3300049742 Bacteria 2734
1316 Ga0501080_0224667 3300049742 Bacteria 1717
1317 Ga0501081_0010443 3300049743 Bacteria 6057
1318 Ga0501081_0011323 3300049743 Bacteria 5836
1319 Ga0501081_0031416 3300049743 Bacteria 3599
1320 Ga0501081_0036589 3300049743 Bacteria 3348
1321 Ga0501081_0107777 3300049743 Bacteria 1975
1322 Ga0501081_0254567 3300049743 Bacteria 1282
1323 Ga0501081_0271699 3300049743 Bacteria 1240
1324 Ga0501083_0001510 3300049744 Bacteria 15903
1325 Ga0501083_0002103 3300049744 Bacteria 13674
1326 Ga0501083_0003155 3300049744 Bacteria 11469
1327 Ga0501083_0005310 3300049744 Bacteria 9112
1328 Ga0501083_0083373 3300049744 Bacteria 2118
1329 Ga0501264_023486 3300049761 Bacteria 669
1330 Ga0501279_003264 3300049775 Bacteria 2112
1331 Ga0501035_0005138 3300049822 Bacteria 12384
1332 Ga0501035_0157653 3300049822 Bacteria 1966
1333 Ga0501035_0363860 3300049822 Bacteria 1208
1334 Ga0501035_0475511 3300049822 Bacteria 1031
1335 Ga0501044_0009712 3300049823 Bacteria 10468
1336 Ga0501044_0057767 3300049823 Bacteria 3981
1337 Ga0501045_0000615 3300049824 Bacteria 22479
1338 Ga0501045_0004328 3300049824 Bacteria 9790
1339 Ga0501045_0008281 3300049824 Bacteria 7238
1340 Ga0501045_0193242 3300049824 Bacteria 1516
1341 Ga0501045_0866228 3300049824 Bacteria 664
1342 nmdc:mga03n38_9964_c1 3300050490 Bacteria 3477
1343 nmdc:mga00v17_342506_c1 3300050491 Bacteria 972
1344 nmdc:mga00v17_9451_c1 3300050491 Bacteria 5278
1345 nmdc:mga0yw44_127178_c1 3300050492 Bacteria 1647
1346 nmdc:mga0yw44_399598_c1 3300050492 Bacteria 929
1347 nmdc:mga0yw44_52492_c1 3300050492 Bacteria 2472
1348 nmdc:mga0yw44_712873_c1 3300050492 Bacteria 681
1349 nmdc:mga05p37_1395582_c1 3300050507 Bacteria 706
1350 nmdc:mga05p37_145010_c1 3300050507 Bacteria 2908
1351 nmdc:mga05p37_1569855_c1 3300050507 Bacteria 650
1352 nmdc:mga05p37_1635713_c1 3300050507 Bacteria 632
1353 nmdc:mga05p37_178562_c1 3300050507 Bacteria 2585
1354 nmdc:mga05p37_299781_c1 3300050507 Bacteria 1910
1355 nmdc:mga05p37_479790_c1 3300050507 Bacteria 1432
1356 nmdc:mga05p37_49969_c1 3300050507 Bacteria 5144
1357 nmdc:mga05p37_600807_c1 3300050507 Bacteria 1242
1358 nmdc:mga05p37_69160_c1 3300050507 Bacteria 4343
1359 nmdc:mga09592_1010633_c1 3300050508 Bacteria 695
1360 nmdc:mga09592_176122_c1 3300050508 Bacteria 1850
1361 nmdc:mga09592_224529_c1 3300050508 Bacteria 1627
1362 nmdc:mga09592_60186_c1 3300050508 Bacteria 3211
1363 nmdc:mga09592_89167_c1 3300050508 Bacteria 2634
1364 nmdc:mga0qj67_10209_c1 3300050509 Bacteria 7010
1365 nmdc:mga0qj67_162012_c1 3300050509 Bacteria 1816
1366 nmdc:mga0qj67_297864_c1 3300050509 Bacteria 1307
1367 nmdc:mga0qj67_630985_c1 3300050509 Bacteria 856
1368 nmdc:mga06r32_127606_c1 3300050510 Bacteria 2513
1369 nmdc:mga06r32_188480_c1 3300050510 Bacteria 2050
1370 nmdc:mga06r32_52748_c1 3300050510 Bacteria 3895
1371 nmdc:mga06r32_81576_c1 3300050510 Bacteria 3150
1372 nmdc:mga08y16_1029998_c1 3300050511 Bacteria 802
1373 nmdc:mga08y16_111806_c1 3300050511 Bacteria 2844
1374 nmdc:mga08y16_117153_c1 3300050511 Bacteria 2773
1375 nmdc:mga08y16_156439_c1 3300050511 Bacteria 2368
1376 nmdc:mga08y16_27126_c1 3300050511 Bacteria 6036
1377 nmdc:mga08y16_50086_c1 3300050511 Bacteria 4371
1378 nmdc:mga08y16_631467_c1 3300050511 Bacteria 1077
1379 nmdc:mga08y16_80356_c1 3300050511 Bacteria 3399
1380 nmdc:mga0n895_144540_c1 3300050512 Bacteria 2408
1381 nmdc:mga0n895_147802_c1 3300050512 Bacteria 2380
1382 nmdc:mga0n895_271932_c1 3300050512 Unclassified 1719
1383 nmdc:mga0n895_300404_c1 3300050512 Bacteria 1627
1384 nmdc:mga0n895_394614_c1 3300050512 Bacteria 1400
1385 nmdc:mga0n895_639982_c1 3300050512 Bacteria 1063
1386 nmdc:mga0n895_66856_c1 3300050512 Bacteria 3559
1387 nmdc:mga0n895_70967_c1 3300050512 Bacteria 3453
1388 nmdc:mga0n895_712362_c1 3300050512 Bacteria 999
1389 nmdc:mga0n895_871526_c1 3300050512 Bacteria 887
1390 nmdc:mga0rr50_21282_c1 3300050513 Bacteria 4424
1391 nmdc:mga0rr50_247054_c1 3300050513 Bacteria 1481
1392 nmdc:mga08x19_105160_c1 3300050514 Bacteria 1877
1393 nmdc:mga08x19_22590_c1 3300050514 Bacteria 3897
1394 nmdc:mga08x19_23001_c1 3300050514 Bacteria 3865
1395 nmdc:mga08x19_26956_c1 3300050514 Bacteria 3591
1396 nmdc:mga08x19_37657_c1 3300050514 Bacteria 3071
1397 nmdc:mga08x19_4565_c1 3300050514 Bacteria 8219
1398 nmdc:mga0a205_156520_c1 3300050515 Bacteria 2177
1399 nmdc:mga0a205_172887_c1 3300050515 Bacteria 2056
1400 nmdc:mga0a205_32521_c1 3300050515 Bacteria 5001
1401 nmdc:mga0a205_352026_c1 3300050515 Bacteria 1340
1402 nmdc:mga0a205_41155_c1 3300050515 Bacteria 2093
1403 nmdc:mga0a205_441599_c1 3300050515 Bacteria 1162
1404 nmdc:mga0a205_9333_c2 3300050515 Bacteria 7475
1405 Ga0495601_0180556 3300053077 Bacteria 1380
1406 Ga0495619_0071754 3300053085 Bacteria 2318
1407 Ga0495619_0495695 3300053085 Bacteria 840
1408 Ga0501084_0007220 3300054114 Bacteria 9156
1409 Ga0501084_0032455 3300054114 Bacteria 4368
1410 Ga0501084_0060012 3300054114 Bacteria 3184
1411 Ga0501084_0231548 3300054114 Bacteria 1559
1412 Ga0501084_0265726 3300054114 Bacteria 1448
1413 Ga0501084_0320345 3300054114 Bacteria 1309
1414 Ga0501084_0458524 3300054114 Bacteria 1077
1415 Ga0501084_0717732 3300054114 Bacteria 843
1416 Ga0587090_037235 3300059510 Bacteria 841
1417 Ga0501082_0001521 3300060353 Bacteria 20389
1418 Ga0501082_0035827 3300060353 Bacteria 4276
1419 Ga0501082_0060429 3300060353 Bacteria 3263
1420 Ga0501082_0068456 3300060353 Bacteria 3056
1421 Ga0501082_0071244 3300060353 Bacteria 2993
1422 Ga0501082_0099068 3300060353 Bacteria 2520
1423 Ga0501082_0420130 3300060353 Unclassified 1168
1424 Ga0501082_0910596 3300060353 Bacteria 769
1425 Ga0530510_0075602 3300061734 Bacteria 2446
1426 Ga0530510_0083097 3300061734 Bacteria 2332
1427 Ga0530510_0174248 3300061734 Bacteria 1594
1428 Ga0530510_0352520 3300061734 Bacteria 1105
1429 Ga0530510_0407865 3300061734 Bacteria 1025
1430 2906802893 2906799679 Bacteria 4031749
1431 2932430801 2932426870 Bacteria 4547726
1432 2933419480 2933418574 Bacteria 4476724
1433 2939650875 2939647034 Bacteria 4681660
1434 2939675649 2939674588 Bacteria 4844420
1435 2946060958 2946059875 Bacteria 4386623
1436 8054108670 8054107350 Bacteria 5022511
1437 Ga0070679_100572098
1438 JGI25152J39213_1000046
1439 JGI25407J50210_10003857
1440 JGI25404J52841_10083426
1441 Ga0055542_1006635
1442 Ga0065714_10155660
1443 Ga0070658_10014372
1444 Ga0070658_10034647
1445 Ga0070658_10097451
1446 Ga0070658_10177298
1447 Ga0070658_10184496
1448 Ga0070676_10089279
1449 Ga0070676_10236823
1450 Ga0070683_100003641
1451 Ga0070683_100012451
1452 Ga0070683_100070160
1453 Ga0070683_100197102
1454 Ga0070683_100401326
1455 Ga0070690_100021285
1456 Ga0070690_100084585
1457 Ga0070670_100246151
1458 Ga0070670_100377517
1459 Ga0068869_100089683
1460 Ga0068869_100108563
1461 Ga0070666_10011943
1462 Ga0070680_100009218
1463 Ga0070680_100113835
1464 Ga0070680_100139622
1465 Ga0070682_100045851
1466 Ga0070682_100053356
1467 Ga0070682_100123921
1468 Ga0070682_100151094
1469 Ga0068868_101232677
1470 Ga0070660_100002284
1471 Ga0070660_100079320
1472 Ga0070660_100184708
1473 Ga0070660_100188711
1474 Ga0070660_100394327
1475 Ga0070689_100014123
1476 Ga0070689_100080810
1477 Ga0070691_10033053
1478 Ga0070687_100121059
1479 Ga0070687_100843173
1480 Ga0070661_100072080
1481 Ga0070661_100297783
1482 Ga0070661_101214594
1483 Ga0070692_10002531
1484 Ga0070692_10020956
1485 Ga0070692_10055201
1486 Ga0070668_100094651
1487 Ga0070668_100105061
1488 Ga0070668_100164197
1489 Ga0070668_100363052
1490 Ga0070669_100000002
1491 Ga0070669_101446737
1492 Ga0070675_100197867
1493 Ga0070675_100295554
1494 Ga0070674_100008245
1495 Ga0070674_100022938
1496 Ga0070674_100855180
1497 Ga0070673_100132374
1498 Ga0070673_100630558
1499 Ga0070673_100773666
1500 Ga0070688_100097160
1501 Ga0070688_100185188
1502 Ga0070688_100652974
1503 Ga0070688_101290959
1504 Ga0070659_100027699
1505 Ga0070659_100209762
1506 Ga0070659_100213661
1507 Ga0070667_100068362
1508 Ga0070667_100101719
1509 Ga0070667_100267268
1510 Ga0070703_10003466
1511 Ga0070709_10204981
1512 Ga0070709_10334055
1513 Ga0070714_100104428
1514 Ga0070714_100115887
1515 Ga0070713_100017467
1516 Ga0070713_100229014
1517 Ga0070713_100232044
1518 Ga0070713_100932769
1519 Ga0070710_10083352
1520 Ga0070710_10435630
1521 Ga0070701_10008989
1522 Ga0070711_100020225
1523 Ga0070711_100251430
1524 Ga0070705_100006893
1525 Ga0070705_100139298
1526 Ga0070705_100284075
1527 Ga0070705_100463123
1528 Ga0070700_100086817
1529 Ga0070700_100401348
1530 Ga0070694_100027674
1531 Ga0070694_100077622
1532 Ga0070694_100242333
1533 Ga0070694_100918075
1534 Ga0070708_100234521
1535 Ga0070663_100033893
1536 Ga0070663_100167475
1537 Ga0070663_100320768
1538 Ga0070678_100033436
1539 Ga0070678_100651361
1540 Ga0070678_100720990
1541 Ga0070678_100741929
1542 Ga0070662_100013464
1543 Ga0070662_100032163
1544 Ga0070662_100046759
1545 Ga0070681_10007964
1546 Ga0070681_10016690
1547 Ga0070681_10023282
1548 Ga0070681_10036925
1549 Ga0070681_10257360
1550 Ga0070681_10305714
1551 Ga0068867_100072350
1552 Ga0068867_100077648
1553 Ga0070685_10003221
1554 Ga0070685_10004772
1555 Ga0070685_10356343
1556 Ga0070685_10396369
1557 Ga0070706_100003660
1558 Ga0070706_100023763
1559 Ga0070706_100539888
1560 Ga0070707_100002146
1561 Ga0070707_100057963
1562 Ga0070707_100087877
1563 Ga0070707_100461895
1564 Ga0070698_100013048
1565 Ga0070698_100039664
1566 Ga0070698_100219532
1567 Ga0070698_100567816
1568 Ga0070699_100003545
1569 Ga0070699_100059708
1570 Ga0070699_100067160
1571 Ga0070699_100118178
1572 Ga0070699_100344883
1573 Ga0070679_100002180
1574 Ga0070679_100030712
1575 Ga0070679_100039874
1576 Ga0070679_100066942
1577 Ga0070679_100108072
1578 Ga0070679_100144007
1579 Ga0070684_100000887
1580 Ga0070684_100011152
1581 Ga0070684_100012096
1582 Ga0070684_100014289
1583 Ga0070684_100127407
1584 Ga0070684_100322747
1585 Ga0070697_100009908
1586 Ga0070697_100133987
1587 Ga0070697_100343641
1588 Ga0068853_100011384
1589 Ga0068853_100167137
1590 Ga0070672_100189287
1591 Ga0070686_100016719
1592 Ga0070686_100104765
1593 Ga0070686_100124717
1594 Ga0070686_100234527
1595 Ga0070686_100604799
1596 Ga0070686_100605277
1597 Ga0070695_100392616
1598 Ga0070695_101260208
1599 Ga0070696_100019458
1600 Ga0070696_100043037
1601 Ga0070693_100367661
1602 Ga0070665_100000625
1603 Ga0070665_100071423
1604 Ga0070665_100121490
1605 Ga0070704_100003404
1606 Ga0070704_100011285
1607 Ga0070704_100032794
1608 Ga0070704_100612672
1609 Ga0068855_100018515
1610 Ga0068855_100034169
1611 Ga0068855_100075689
1612 Ga0068855_100178835
1613 Ga0068855_100224800
1614 Ga0068855_100414857
1615 Ga0070664_100048291
1616 Ga0070664_100295233
1617 Ga0070664_100410164
1618 Ga0070664_100496299
1619 Ga0068857_100165255
1620 Ga0068854_100066535
1621 Ga0068854_100338056
1622 Ga0068854_100787346
1623 Ga0068856_100026978
1624 Ga0068856_100255658
1625 Ga0068856_100282471
1626 Ga0068856_100415257
1627 Ga0070702_100026938
1628 Ga0070702_100057772
1629 Ga0068852_100043382
1630 Ga0068852_100069567
1631 Ga0068852_100135911
1632 Ga0068852_100150981
1633 Ga0068859_100110232
1634 Ga0068859_100751744
1635 Ga0068864_100269055
1636 Ga0068866_10310043
1637 Ga0068861_100103306
1638 Ga0068861_100375190
1639 Ga0068861_101045854
1640 Ga0068851_10094026
1641 Ga0068851_10388740
1642 Ga0068870_10021664
1643 Ga0068870_10954642
1644 Ga0068863_100263196
1645 Ga0068858_100027442
1646 Ga0068858_100278716
1647 Ga0068858_101565851
1648 Ga0068858_102184061
1649 Ga0068860_100019464
1650 Ga0068860_100037378
1651 Ga0068862_100001063
1652 Ga0068862_100246359
1653 Ga0068862_100247710
1654 Ga0068862_100643914
1655 Ga0081455_10015740
1656 Ga0081455_10022676
1657 Ga0081455_10032676
1658 Ga0081455_10032852
1659 Ga0081455_10040470
1660 Ga0081455_10056920
1661 Ga0081455_10058075
1662 Ga0081455_10356753
1663 Ga0081538_10000330
1664 Ga0081538_10001228
1665 Ga0081538_10001290
1666 Ga0081538_10007527
1667 Ga0081538_10047404
1668 Ga0081538_10137821
1669 Ga0081540_1009957
1670 Ga0081540_1012344
1671 Ga0081539_10001337
1672 Ga0081539_10041689
1673 Ga0081539_10199326
1674 Ga0070717_10041894
1675 Ga0075365_10003096
1676 Ga0075363_100089490
1677 Ga0075363_100246956
1678 Ga0075432_10004635
1679 Ga0075432_10012966
1680 Ga0075432_10037726
1681 Ga0070715_10138585
1682 Ga0070715_10197536
1683 Ga0070716_100091705
1684 Ga0070716_100146864
1685 Ga0070716_100176834
1686 Ga0070712_100028072
1687 Ga0070712_100033201
1688 Ga0070712_100045337
1689 Ga0070712_100224613
1690 Ga0075362_10055513
1691 Ga0075367_10185945
1692 Ga0097621_100233690
1693 Ga0097621_100309678
1694 Ga0075370_10161743
1695 Ga0068871_100111925
1696 Ga0068871_100174284
1697 Ga0068871_100266690
1698 Ga0075428_100002710
1699 Ga0075428_100081065
1700 Ga0075428_100159254
1701 Ga0075428_101009277
1702 Ga0075428_101097533
1703 Ga0075430_100009019
1704 Ga0075430_100102461
1705 Ga0075430_100136046
1706 Ga0075430_100283078
1707 Ga0075431_100001020
1708 Ga0075431_100017616
1709 Ga0075431_100047691
1710 Ga0075431_100199297
1711 Ga0075431_100465464
1712 Ga0075433_10033563
1713 Ga0075433_10037108
1714 Ga0075433_10059649
1715 Ga0075433_10301595
1716 Ga0075434_100048762
1717 Ga0075434_100112943
1718 Ga0075434_100141319
1719 Ga0075434_100159314
1720 Ga0075434_100325366
1721 Ga0075434_100350779
1722 Ga0075434_100624736
1723 Ga0075429_100052744
1724 Ga0075429_100238786
1725 Ga0075429_100247617
1726 Ga0075429_100330209
1727 Ga0075429_100574506
1728 Ga0075429_101178989
1729 Ga0068865_100022281
1730 Ga0068865_100024408
1731 Ga0068865_100334613
1732 Ga0068865_100427821
1733 Ga0075436_100001835
1734 Ga0075436_100006708
1735 Ga0075436_100011000
1736 Ga0075436_100020746
1737 Ga0075436_100053533
1738 Ga0075436_100142230
1739 Ga0075436_100186821
1740 Ga0097620_100110230
1741 Ga0097620_100751726
1742 Ga0075435_100007425
1743 Ga0075435_100037084
1744 Ga0075435_100324741
1745 Ga0075435_100472263
1746 Ga0075435_100593019
1747 Ga0105244_10004212
1748 Ga0105240_10022063
1749 Ga0105240_10085266
1750 Ga0105240_10148064
1751 Ga0111539_10013119
1752 Ga0111539_10023472
1753 Ga0111539_10040970
1754 Ga0111539_10056335
1755 Ga0111539_10060296
1756 Ga0111539_10089782
1757 Ga0111539_10124544
1758 Ga0111539_10249129
1759 Ga0111539_10294990
1760 Ga0111539_10307348
1761 Ga0111539_10317039
1762 Ga0111539_10372505
1763 Ga0111539_10419597
1764 Ga0111539_10703241
1765 Ga0111539_11382177
1766 Ga0105245_10024429
1767 Ga0105245_10043540
1768 Ga0105245_10058133
1769 Ga0105245_10078137
1770 Ga0105245_10093151
1771 Ga0105245_10131590
1772 Ga0105245_10169296
1773 Ga0105245_10202285
1774 Ga0105247_10058184
1775 Ga0114129_10017930
1776 Ga0114129_10076752
1777 Ga0114129_10164573
1778 Ga0114129_10458833
1779 Ga0114129_10487702
1780 Ga0114129_11018607
1781 Ga0114129_11045073
1782 Ga0114129_11091867
1783 Ga0114129_12300428
1784 Ga0105243_10013026
1785 Ga0105243_10018258
1786 Ga0105243_10020325
1787 Ga0105243_10033330
1788 Ga0105243_10036838
1789 Ga0105243_10050214
1790 Ga0105243_11318847
1791 Ga0105241_10222536
1792 Ga0105241_10905214
1793 Ga0105242_10049351
1794 Ga0105242_10085512
1795 Ga0105242_10103539
1796 Ga0105242_10140911
1797 Ga0105242_10287482
1798 Ga0105242_10727460
1799 Ga0105242_10847123
1800 Ga0105242_11032000
1801 Ga0105248_10046557
1802 Ga0105248_10134961
1803 Ga0105248_10193695
1804 Ga0105248_10786702
1805 Ga0105238_10337870
1806 Ga0105238_10396582
1807 Ga0105238_10983483
1808 Ga0105249_10070967
1809 Ga0105249_10096470
1810 Ga0105249_10152408
1811 Ga0105249_10201390
1812 Ga0105249_10250976
1813 Ga0105249_12872056
1814 Ga0105030_114543
1815 Ga0105239_10013046
1816 Ga0105239_10124667
1817 Ga0105239_10165737
1818 Ga0105239_10168474
1819 Ga0105239_10634248
1820 Ga0105246_10005235
1821 Ga0105246_10036011
1822 Ga0105246_10113067
1823 Ga0105246_10184971
1824 Ga0105246_10226621
1825 Ga0105246_10566060
1826 Ga0105246_11173788
1827 Ga0157346_1003880
1828 Ga0157341_1010607
1829 Ga0157319_1016381
1830 Ga0157347_1010583
1831 Ga0157373_10095877
1832 Ga0157373_10141235
1833 Ga0157371_10055114
1834 Ga0157371_10067574
1835 Ga0157371_10349834
1836 Ga0157371_10359882
1837 Ga0157370_10024054
1838 Ga0157370_10030046
1839 Ga0157370_10087914
1840 Ga0157370_10212494
1841 Ga0157370_11131434
1842 Ga0157369_10029044
1843 Ga0157369_10081190
1844 Ga0157369_10124154
1845 Ga0157369_10325986
1846 Ga0157369_11538031
1847 Ga0157374_11438495
1848 Ga0157374_11800228
1849 Ga0157378_10205213
1850 Ga0157378_10328522
1851 Ga0157378_10659266
1852 Ga0157378_11769749
1853 Ga0163162_10429511
1854 Ga0163162_10611694
1855 Ga0157372_10196373
1856 Ga0157372_10624960
1857 Ga0157372_10698334
1858 Ga0157372_11714419
1859 Ga0157375_10014646
1860 Ga0157375_10028657
1861 Ga0157375_10099855
1862 Ga0157375_10142516
1863 Ga0157375_11552403
1864 Ga0157375_11793610
1865 Ga0163163_10588459
1866 Ga0163163_11052540
1867 Ga0157380_10034297
1868 Ga0157380_10436093
1869 Ga0157380_11109054
1870 Ga0157377_10008757
1871 Ga0157377_10010749
1872 Ga0157377_10030589
1873 Ga0157377_10065648
1874 Ga0157377_10073352
1875 Ga0157377_10864173
1876 Ga0157379_10007228
1877 Ga0157379_10501277
1878 Ga0157376_10048687
1879 Ga0157376_10345642
1880 Ga0157376_10442703
1881 Ga0163161_10151557
1882 Ga0197907_11161130
1883 Ga0206356_11461127
1884 Ga0206353_10651167
1885 Ga0213871_10005066
1886 Ga0209025_1001520
1887 Ga0207697_10131474
1888 Ga0207655_1005376
1889 Ga0207653_10009987
1890 Ga0207653_10020231
1891 Ga0207682_10159245
1892 Ga0207692_10461076
1893 Ga0207642_10019819
1894 Ga0207642_10127440
1895 Ga0207642_10352436
1896 Ga0207710_10118652
1897 Ga0207688_10009478
1898 Ga0207688_10016919
1899 Ga0207688_10031092
1900 Ga0207688_10056477
1901 Ga0207680_10055089
1902 Ga0207685_10087521
1903 Ga0207699_10147167
1904 Ga0207699_10253676
1905 Ga0207645_10024069
1906 Ga0207645_10329080
1907 Ga0207643_10036703
1908 Ga0207643_10044089
1909 Ga0207643_10598079
1910 Ga0207705_10018897
1911 Ga0207705_10036877
1912 Ga0207705_10151140
1913 Ga0207705_10533679
1914 Ga0207684_10029662
1915 Ga0207684_10085533
1916 Ga0207684_10087289
1917 Ga0207684_10110095
1918 Ga0207684_10439595
1919 Ga0207684_10482913
1920 Ga0207654_10101867
1921 Ga0207654_10268518
1922 Ga0207654_10362818
1923 Ga0207707_10006590
1924 Ga0207707_10087499
1925 Ga0207707_10216454
1926 Ga0207695_10114142
1927 Ga0207695_10572011
1928 Ga0207693_10003963
1929 Ga0207693_10013076
1930 Ga0207693_10030694
1931 Ga0207693_10243380
1932 Ga0207663_10215405
1933 Ga0207663_10271885
1934 Ga0207663_10617528
1935 Ga0207660_10020089
1936 Ga0207660_10049701
1937 Ga0207662_10014292
1938 Ga0207662_10024351
1939 Ga0207662_10405653
1940 Ga0207657_10042742
1941 Ga0207657_10172473
1942 Ga0207657_10249173
1943 Ga0207657_10472122
1944 Ga0207649_10107186
1945 Ga0207649_10295841
1946 Ga0207649_10407607
1947 Ga0207649_10742971
1948 Ga0207652_10043531
1949 Ga0207652_10046187
1950 Ga0207652_10178087
1951 Ga0207646_10006140
1952 Ga0207646_10006269
1953 Ga0207646_10152180
1954 Ga0207646_10518412
1955 Ga0207681_10000009
1956 Ga0207681_10028072
1957 Ga0207694_10309333
1958 Ga0207659_10617011
1959 Ga0207687_10474482
1960 Ga0207687_10826073
1961 Ga0207700_10000012
1962 Ga0207700_10182759
1963 Ga0207700_10397258
1964 Ga0207664_10019978
1965 Ga0207664_10046280
1966 Ga0207664_10084696
1967 Ga0207664_10090170
1968 Ga0207644_10066422
1969 Ga0207690_10045941
1970 Ga0207690_10168263
1971 Ga0207690_10195708
1972 Ga0207690_10349101
1973 Ga0207690_10400496
1974 Ga0207706_10054003
1975 Ga0207706_10068330
1976 Ga0207706_10073483
1977 Ga0207706_10374187
1978 Ga0207686_10097318
1979 Ga0207686_10119830
1980 Ga0207686_10156703
1981 Ga0207686_10174868
1982 Ga0207686_10235578
1983 Ga0207686_10368014
1984 Ga0207686_10823808
1985 Ga0207709_10147765
1986 Ga0207709_10155025
1987 Ga0207709_10328843
1988 Ga0207709_10770385
1989 Ga0207670_10014342
1990 Ga0207670_10163280
1991 Ga0207669_10032569
1992 Ga0207669_10121630
1993 Ga0207669_10153559
1994 Ga0207669_10252298
1995 Ga0207669_10269832
1996 Ga0207704_10054060
1997 Ga0207704_10455730
1998 Ga0207704_10473042
1999 Ga0207704_10493406
2000 Ga0207704_10966458
2001 Ga0207704_11153135
2002 Ga0207665_10001466
2003 Ga0207665_10004281
2004 Ga0207665_10117622
2005 Ga0207665_10126859
2006 Ga0207665_10243368
2007 Ga0207691_10051487
2008 Ga0207711_10164420
2009 Ga0207711_10215226
2010 Ga0207711_10465724
2011 Ga0207689_10014420
2012 Ga0207689_10192159
2013 Ga0207689_10207145
2014 Ga0207689_10347525
2015 Ga0207661_10014827
2016 Ga0207661_10092504
2017 Ga0207661_10153507
2018 Ga0207661_10489862
2019 Ga0207661_10558259
2020 Ga0207661_11211843
2021 Ga0207679_10057167
2022 Ga0207667_10166754
2023 Ga0207667_10253124
2024 Ga0207667_10266607
2025 Ga0207667_10554228
2026 Ga0207651_10261091
2027 Ga0207651_10445264
2028 Ga0207712_10166684
2029 Ga0207712_10203101
2030 Ga0207668_10037124
2031 Ga0207668_10037177
2032 Ga0207668_10139115
2033 Ga0207668_10608913
2034 Ga0207668_11064917
2035 Ga0207640_10168942
2036 Ga0207658_10008375
2037 Ga0207658_10071669
2038 Ga0207677_10023358
2039 Ga0207677_10139988
2040 Ga0207703_10148390
2041 Ga0207703_11490538
2042 Ga0207639_10287038
2043 Ga0207678_10111101
2044 Ga0207678_10162357
2045 Ga0207678_11123023
2046 Ga0207708_10008954
2047 Ga0207708_10023773
2048 Ga0207708_10103974
2049 Ga0207708_10478560
2050 Ga0207702_10235700
2051 Ga0207648_10014277
2052 Ga0207648_10088100
2053 Ga0207648_10117253
2054 Ga0207648_10171797
2055 Ga0207676_10071562
2056 Ga0207674_10019100
2057 Ga0207674_10041180
2058 Ga0207674_10072059
2059 Ga0207674_10199522
2060 Ga0207675_100006399
2061 Ga0207675_100012983
2062 Ga0207675_100220507
2063 Ga0207675_100242608
2064 Ga0207675_100393206
2065 Ga0207683_10011235
2066 Ga0207683_10021405
2067 Ga0207683_10398445
2068 Ga0207683_10480373
2069 Ga0207683_10645067
2070 Ga0207683_10751405
2071 Ga0207698_10017055
2072 Ga0207698_10039101
2073 Ga0207698_10148666
2074 Ga0207698_10377230
2075 Ga0207698_11609064
2076 Ga0209998_10018860
2077 Ga0209998_10035881
2078 Ga0209974_10065380
2079 Ga0207428_10000393
2080 Ga0207428_10011660
2081 Ga0207428_10021808
2082 Ga0207428_10025802
2083 Ga0207428_10105175
2084 Ga0207428_10137362
2085 Ga0207428_10150273
2086 Ga0268266_10000799
2087 Ga0268266_10385049
2088 Ga0268265_10004154
2089 Ga0268265_10473170
2090 Ga0268264_10006890
2091 Ga0268264_10104738
2092 Ga0265338_10225043
2093 Ga0265340_10217169
2094 Ga0307408_100001088
2095 Ga0307408_100076319
2096 Ga0307408_100121428
2097 Ga0307408_100314547
2098 Ga0307408_100332868
2099 Ga0307408_100391749
2100 Ga0307408_100480590
2101 Ga0307408_100833353
2102 Ga0307508_10004869
2103 Ga0307405_10000639
2104 Ga0307405_10048244
2105 Ga0307405_10137020
2106 Ga0307405_10140625
2107 Ga0307405_10240922
2108 Ga0307413_10024410
2109 Ga0307413_10027481
2110 Ga0307413_11036895
2111 Ga0307410_10020515
2112 Ga0307410_10031542
2113 Ga0307410_10163098
2114 Ga0307410_10530092
2115 Ga0307410_10590847
2116 Ga0307406_10058992
2117 Ga0307406_10145267
2118 Ga0307406_10220153
2119 Ga0307406_10379537
2120 Ga0307406_10496182
2121 Ga0307407_10021264
2122 Ga0307407_10255038
2123 Ga0307407_10257131
2124 Ga0307407_10292844
2125 Ga0307412_10000473
2126 Ga0307412_10050650
2127 Ga0307412_10186629
2128 Ga0307412_10194322
2129 Ga0307409_100024998
2130 Ga0307409_100053445
2131 Ga0307409_100058035
2132 Ga0307409_100101699
2133 Ga0307409_100255964
2134 Ga0307409_100288647
2135 Ga0307409_100441587
2136 Ga0307409_101067616
2137 Ga0307416_100000543
2138 Ga0307416_100055876
2139 Ga0307416_100126252
2140 Ga0307416_100187412
2141 Ga0307416_100231661
2142 Ga0307416_100251116
2143 Ga0307416_100768014
2144 Ga0307416_100991623
2145 Ga0307416_101484993
2146 Ga0307411_10116137
2147 Ga0307415_100050111
2148 Ga0307415_100076399
2149 Ga0307415_100082431
2150 Ga0307415_100191310
2151 Ga0307415_100229659
2152 Ga0307415_100499817
2153 Ga0307415_100534689
2154 Ga0307415_101294694
2155 Ga0316583_10064237
2156 Ga0373948_0036000
2157 Ga0373929_0000008
2158 Ga0373929_0001933
2159 Ga0373929_0010886
2160 Ga0373949_0003001
2161 Ga0373951_0002983
2162 Ga0373952_0010209
2163 Ga0373932_0001874
2164 Ga0373932_0116961
2165 Ga0373939_0050909
2166 Ga0373941_0000689
2167 Ga0373941_0004348
2168 Ga0373960_0005466
2169 Ga0373942_0011614
2170 Ga0373961_0000425
2171 Ga0373961_0003054
2172 Ga0373962_0006858
2173 Ga0373962_0020160
2174 Ga0373962_0176029
2175 Ga0373931_0005957
2176 Ga0373931_0013889
2177 Ga0373931_0065932
2178 Ga0373931_0078445
2179 Ga0373935_0810975
2180 Ga0373947_0126634
2181 Ga0395899_0009205
2182 Ga0395899_0013482
2183 Ga0395899_0014372
2184 Ga0395899_0017690
2185 Ga0395899_0020071
2186 Ga0395899_0025092
2187 Ga0395899_0053111
2188 Ga0395899_0070601
2189 Ga0395899_0097457
2190 Ga0395899_0108426
2191 Ga0395899_0117893
2192 Ga0395899_0159560
2193 Ga0395899_0178205
2194 Ga0395899_0216038
2195 Ga0395900_0001263
2196 Ga0395900_0011737
2197 Ga0395900_0015802
2198 Ga0395900_0016029
2199 Ga0395900_0027139
2200 Ga0395900_0035139
2201 Ga0395900_0040863
2202 Ga0395900_0041226
2203 Ga0395900_0056727
2204 Ga0395900_0065413
2205 Ga0395900_0098219
2206 Ga0395900_0106115
2207 Ga0395900_0113159
2208 Ga0395900_0140192
2209 Ga0395900_0142711
2210 Ga0395900_0179388
2211 Ga0395900_0218136
2212 Ga0395900_0223040
2213 Ga0395900_0248420
2214 Ga0395900_0250179
2215 Ga0395900_0256178
2216 Ga0395900_0350431
2217 Ga0395900_0369851
2218 Ga0395900_0378871
2219 Ga0395900_0446469
2220 Ga0395900_0591880
2221 Ga0395898_0000795
2222 Ga0395898_0002292
2223 Ga0395898_0005555
2224 Ga0395898_0006822
2225 Ga0395898_0018229
2226 Ga0395898_0018559
2227 Ga0395898_0020122
2228 Ga0395898_0024209
2229 Ga0395898_0031257
2230 Ga0395898_0041411
2231 Ga0395898_0055457
2232 Ga0395898_0067582
2233 Ga0395898_0086767
2234 Ga0395898_0100355
2235 Ga0395898_0152830
2236 Ga0395898_0232401
2237 Ga0395898_0274394
2238 Ga0395898_0361869
2239 Ga0395898_0373678
2240 Ga0395898_0502531
2241 Ga0395898_0887478
2242 Ga0395898_0890394
2243 Ga0395898_0970095
2244 Ga0395905_0001754
2245 Ga0395905_0008154
2246 Ga0395905_0009489
2247 Ga0395905_0045175
2248 Ga0395905_0051315
2249 Ga0395905_0101635
2250 Ga0395905_0128043
2251 Ga0395905_0138021
2252 Ga0395905_0188335
2253 Ga0395905_0215358
2254 Ga0395905_0629562
2255 Ga0395905_0665904
2256 Ga0395905_0725317
2257 Ga0395905_0950274
2258 Ga0395901_0003357
2259 Ga0395901_0003708
2260 Ga0395901_0008348
2261 Ga0395901_0009956
2262 Ga0395901_0013971
2263 Ga0395901_0016014
2264 Ga0395901_0016308
2265 Ga0395901_0021053
2266 Ga0395901_0024337
2267 Ga0395901_0051113
2268 Ga0395901_0053638
2269 Ga0395901_0056433
2270 Ga0395901_0082039
2271 Ga0395901_0085355
2272 Ga0395901_0085853
2273 Ga0395901_0087776
2274 Ga0395901_0091646
2275 Ga0395901_0092079
2276 Ga0395901_0142606
2277 Ga0395901_0152876
2278 Ga0395901_0160495
2279 Ga0395901_0202777
2280 Ga0395901_0230542
2281 Ga0395901_0271436
2282 Ga0395901_0277332
2283 Ga0395901_0349681
2284 Ga0395901_0364943
2285 Ga0395901_0386202
2286 Ga0395901_0419350
2287 Ga0395901_0422654
2288 Ga0395901_0422805
2289 Ga0395901_0510835
2290 Ga0395901_0524317
2291 Ga0395901_1084680
2292 Ga0395901_1148773
2293 Ga0395901_1161623
2294 Ga0395901_1185782
2295 Ga0395901_1418546
2296 Ga0242420_017464
2297 Ga0242420_033140
2298 Ga0436365_1112078
2299 Ga0436360_0817146
2300 Ga0436362_0193206
2301 Ga0439436_0003181
2302 Ga0439436_0024523
2303 Ga0439438_001298
2304 Ga0439438_045989
2305 Ga0439439_0002905
2306 Ga0439461_0000713
2307 Ga0439466_0007871
2308 Ga0439466_0022763
2309 Ga0451789_1064853
2310 Ga0451797_0102084
2311 Ga0451797_1111866
2312 Ga0451802_1776733
2313 Ga0451807_0155102
2314 Ga0451807_1961644
2315 Ga0451807_2346038
2316 Ga0451835_0543550
2317 Ga0451839_0581077
2318 Ga0451847_0773695
2319 Ga0451849_1358585
2320 Ga0451849_1483773
2321 Ga0451843_0519664
2322 Ga0451855_0835047
2323 Ga0451855_1460886
2324 Ga0451853_0870872
2325 Ga0451853_1343855
2326 Ga0451853_1819789
2327 Ga0451853_2510936
2328 Ga0451853_3695274
2329 Ga0439433_0000133
2330 Ga0439433_0016104
2331 Ga0439442_003160
2332 Ga0439442_006217
2333 Ga0439442_017543
2334 Ga0439442_034164
2335 Ga0439432_000702
2336 Ga0439449_0000267
2337 Ga0439449_0005707
2338 Ga0439449_0027218
2339 Ga0439449_0040295
2340 Ga0439451_008645
2341 Ga0439452_000706
2342 Ga0439454_000546
2343 Ga0439454_016557
2344 Ga0439457_002732
2345 Ga0439457_014431
2346 Ga0439462_0005141
2347 Ga0450911_005829
2348 Ga0450913_020486
2349 Ga0450919_010325
2350 Ga0450920_000295
2351 Ga0450920_000669
2352 Ga0450897_009819
2353 Ga0450906_029724
2354 Ga0439446_0004453
2355 Ga0450908_001583
2356 Ga0439434_0022050
2357 Ga0439444_0093361
2358 Ga0450918_032822
2359 Ga0450893_0032163
2360 Ga0451577_0025642
2361 Ga0439440_0123077
2362 Ga0466972_0520052
2363 Ga0466965_0174223
2364 Ga0466966_0379690
2365 Ga0466961_0077795
2366 Ga0466963_0001595
2367 Ga0466963_0018211
2368 Ga0466963_0024634
2369 Ga0466964_0013917
2370 Ga0466964_0148855
2371 Ga0453684_0044176
2372 Ga0453684_0707931
2373 Ga0466968_0022051
2374 Ga0466970_0017892
2375 Ga0466970_0142624
2376 Ga0466970_0169428
2377 Ga0466957_0050530
2378 Ga0466960_0003429
2379 Ga0466960_0016338
2380 Ga0466958_0482519
2381 Ga0466967_0000028
2382 Ga0466967_0001037
2383 Ga0466967_0015794
2384 Ga0466967_1026256
2385 Ga0495592_0029720
2386 Ga0495603_0022783
2387 Ga0495603_0152852
2388 Ga0495603_0176632
2389 Ga0495590_0099476
2390 Ga0495590_0159729
2391 Ga0495629_0043473
2392 Ga0495629_0120149
2393 Ga0495641_0013713
2394 Ga0495651_0057234
2395 Ga0495653_0000468
2396 Ga0495653_0031269
2397 Ga0495580_0237772
2398 Ga0495582_0029166
2399 Ga0495582_0071781
2400 Ga0495582_0266851
2401 Ga0495582_0533634
2402 Ga0495605_0050585
2403 Ga0495605_0289369
2404 Ga0495605_0310538
2405 Ga0495639_0002895
2406 Ga0495639_0220327
2407 Ga0495662_0055307
2408 Ga0495662_0076298
2409 Ga0495664_0053009
2410 Ga0495584_0080076
2411 Ga0495584_0090453
2412 Ga0495584_0437258
2413 Ga0495585_0169633
2414 Ga0495585_0349262
2415 Ga0495594_0048752
2416 Ga0495594_0066109
2417 Ga0495596_0177482
2418 Ga0495608_0130158
2419 Ga0495608_0140439
2420 Ga0495618_0031364
2421 Ga0495618_0198257
2422 Ga0495630_0006446
2423 Ga0495630_0065030
2424 Ga0495630_0925674
2425 Ga0495631_0053942
2426 Ga0495631_0209104
2427 Ga0495663_0008411
2428 Ga0495663_0019481
2429 Ga0495666_0074730
2430 Ga0495642_0064715
2431 Ga0495642_0271076
2432 Ga0495665_0000658
2433 Ga0495665_0030148
2434 Ga0495640_0448158
2435 Ga0495586_0187369
2436 Ga0495586_0192398
2437 Ga0495587_0003469
2438 Ga0495609_0020981
2439 Ga0495597_0245477
2440 Ga0495645_0008819
2441 Ga0495645_0151015
2442 Ga0495667_0031825
2443 Ga0495667_0102772
2444 Ga0495667_0474424
2445 Ga0495656_0015894
2446 Ga0495656_0061734
2447 Ga0495656_0069947
2448 Ga0495668_0063832
2449 Ga0495668_0406748
2450 Ga0495634_0116227
2451 Ga0495611_0054018
2452 Ga0495611_0086887
2453 Ga0495611_0353727
2454 Ga0495635_0367315
2455 Ga0495659_0002547
2456 Ga0495659_0006374
2457 Ga0495588_0070652
2458 Ga0495588_0094490
2459 Ga0495588_0139940
2460 Ga0495588_0185781
2461 Ga0495657_0044514
2462 Ga0495657_0051705
2463 Ga0495657_0423173
2464 Ga0495599_0141266
2465 Ga0495623_0008339
2466 Ga0495647_0065692
2467 Ga0495658_0005078
2468 Ga0495658_0027216
2469 Ga0495613_0003796
2470 Ga0495613_0128807
2471 Ga0495613_0277417
2472 Ga0495624_0011307
2473 Ga0495670_0002814
2474 Ga0495670_0508902
2475 Ga0495671_0352538
2476 Ga0495600_0180032
2477 Ga0495600_0208952
2478 Ga0495581_0001440
2479 Ga0495581_0007081
2480 Ga0495581_0071127
2481 Ga0495604_0064049
2482 Ga0495636_0012871
2483 Ga0495636_0144520
2484 Ga0495674_0020283
2485 Ga0495674_0086940
2486 Ga0495674_0256009
2487 Ga0495676_0056472
2488 Ga0495680_0039805
2489 Ga0495680_0086203
2490 Ga0495680_0238366
2491 Ga0495675_0235890
2492 Ga0495677_0036129
2493 Ga0495677_0120551
2494 Ga0495681_0113294
2495 Ga0495684_0032299
2496 Ga0495602_0279561
2497 Ga0495626_0167153
2498 Ga0496100_0004896
2499 Ga0496100_0014091
2500 Ga0496100_0018966
2501 Ga0496100_0079001
2502 Ga0496100_0442488
2503 Ga0496101_0008894
2504 Ga0496101_0016013
2505 Ga0496101_0025311
2506 Ga0496101_0224918
2507 Ga0496101_0239064
2508 Ga0496101_0491685
2509 Ga0496102_0018764
2510 Ga0496102_0019938
2511 Ga0496102_0192977
2512 Ga0496102_0228941
2513 Ga0496102_0945920
2514 Ga0496103_0002999
2515 Ga0496103_0016111
2516 Ga0496103_0059187
2517 Ga0496103_0135530
2518 Ga0496103_0343106
2519 Ga0496104_0012176
2520 Ga0496104_0020628
2521 Ga0496104_0023001
2522 Ga0496104_0189050
2523 Ga0496104_0338271
2524 Ga0496105_0025687
2525 Ga0496105_0040567
2526 Ga0496105_0087548
2527 Ga0496105_0252189
2528 Ga0496105_0538305
2529 Ga0496105_0541858
2530 Ga0496105_0599920
2531 Ga0496106_0009515
2532 Ga0496106_0032549
2533 Ga0496106_0152759
2534 Ga0496106_0174141
2535 Ga0496106_0243879
2536 Ga0496106_0423164
2537 Ga0496106_0599037
2538 Ga0496107_0034036
2539 Ga0496107_0134688
2540 Ga0496107_0203368
2541 Ga0496108_0005647
2542 Ga0496108_0020153
2543 Ga0496108_0024660
2544 Ga0496108_0030496
2545 Ga0496108_0105497
2546 Ga0496108_0142051
2547 Ga0496108_0149193
2548 Ga0496108_0221419
2549 Ga0496108_0366804
2550 Ga0496108_0517678
2551 Ga0496109_0000913
2552 Ga0496109_0011225
2553 Ga0496109_0045636
2554 Ga0496109_0048258
2555 Ga0496109_0050316
2556 Ga0496109_0068168
2557 Ga0496109_0072125
2558 Ga0496109_0122267
2559 Ga0496109_0174949
2560 Ga0496109_0178720
2561 Ga0496109_1006068
2562 Ga0496110_0003661
2563 Ga0496110_0008390
2564 Ga0496110_0034761
2565 Ga0496110_0074161
2566 Ga0496110_0085681
2567 Ga0496110_0176871
2568 Ga0496110_0343249
2569 Ga0496110_0356231
2570 Ga0496110_0483492
2571 Ga0496110_0527959
2572 Ga0496110_0732284
2573 Ga0496110_0845802
2574 Ga0496110_1165479
2575 Ga0496111_0003623
2576 Ga0496111_0003720
2577 Ga0496111_0010934
2578 Ga0496111_0018694
2579 Ga0496111_0036855
2580 Ga0496111_0043737
2581 Ga0496111_0044395
2582 Ga0496111_0064517
2583 Ga0496111_0078428
2584 Ga0496111_0089871
2585 Ga0496111_0158427
2586 Ga0496111_0476003
2587 Ga0496112_0006002
2588 Ga0496112_0018396
2589 Ga0496112_0020095
2590 Ga0496112_0034386
2591 Ga0496112_0114368
2592 Ga0496112_0118964
2593 Ga0496112_0150253
2594 Ga0496112_0368599
2595 Ga0496112_0479672
2596 Ga0496112_0596768
2597 Ga0496112_1086817
2598 Ga0496112_1377050
2599 Ga0496113_0003267
2600 Ga0496113_0042109
2601 Ga0496113_0116988
2602 Ga0496113_0178607
2603 Ga0496113_0196438
2604 Ga0496113_0644727
2605 Ga0496114_0000073
2606 Ga0496114_0010517
2607 Ga0496114_0012084
2608 Ga0496114_0034641
2609 Ga0496114_0066003
2610 Ga0496114_0119666
2611 Ga0496115_0057615
2612 Ga0496115_0252868
2613 Ga0496115_0412223
2614 Ga0496115_0460898
2615 Ga0496122_0000427
2616 Ga0496123_0001011
2617 Ga0496124_0002673
2618 Ga0496125_0000558
2619 Ga0496125_0138813
2620 Ga0501317_026060
2621 Ga0501317_027196
2622 Ga0501324_010065
2623 Ga0501324_026137
2624 Ga0501031_0002646
2625 Ga0501031_0004843
2626 Ga0501031_0075736
2627 Ga0501032_0000158
2628 Ga0501032_0004426
2629 Ga0501032_0175909
2630 Ga0501032_0191664
2631 Ga0501032_0325055
2632 Ga0501033_0007557
2633 Ga0501033_0046670
2634 Ga0501034_0000141
2635 Ga0501036_0001775
2636 Ga0501036_0035440
2637 Ga0501036_0080888
2638 Ga0501036_0146730
2639 Ga0501038_0005105
2640 Ga0501038_0010377
2641 Ga0501038_0063650
2642 Ga0501038_0119318
2643 Ga0501038_0163802
2644 Ga0501039_0027976
2645 Ga0501039_0348588
2646 Ga0501040_0006969
2647 Ga0501040_0139350
2648 Ga0501040_0144740
2649 Ga0501040_0228509
2650 Ga0501041_0008144
2651 Ga0501041_0051941
2652 Ga0501041_0070571
2653 Ga0501041_0549791
2654 Ga0501042_0019090
2655 Ga0501042_0024287
2656 Ga0501042_0085537
2657 Ga0501042_0090478
2658 Ga0501042_0099943
2659 Ga0501042_0310153
2660 Ga0501042_1260572
2661 Ga0501043_0002861
2662 Ga0501043_0018421
2663 Ga0501043_0116703
2664 Ga0501043_0128522
2665 Ga0501043_0145751
2666 Ga0501043_0804677
2667 Ga0501046_0008318
2668 Ga0501046_0013675
2669 Ga0501046_0243456
2670 Ga0501047_0902762
2671 Ga0501048_0039171
2672 Ga0501048_0119473
2673 Ga0501048_0135899
2674 Ga0501048_0148590
2675 Ga0501048_0153913
2676 Ga0501067_0026343
2677 Ga0501067_0225698
2678 Ga0501068_0000514
2679 Ga0501068_0012529
2680 Ga0501068_0040285
2681 Ga0501068_0063650
2682 Ga0501068_0203249
2683 Ga0501068_0341923
2684 Ga0501069_0023524
2685 Ga0501069_0060023
2686 Ga0501069_0112565
2687 Ga0501069_0192951
2688 Ga0501070_0019413
2689 Ga0501070_0021603
2690 Ga0501070_0032073
2691 Ga0501071_0003854
2692 Ga0501071_0004163
2693 Ga0501071_0012653
2694 Ga0501071_0069995
2695 Ga0501071_0178201
2696 Ga0501071_0238836
2697 Ga0501071_0250655
2698 Ga0501072_0009755
2699 Ga0501072_0023700
2700 Ga0501072_0077038
2701 Ga0501072_0088751
2702 Ga0501072_0117070
2703 Ga0501072_0161140
2704 Ga0501072_0242432
2705 Ga0501072_0333942
2706 Ga0501072_1070794
2707 Ga0501073_0001537
2708 Ga0501073_0007238
2709 Ga0501073_0241273
2710 Ga0501073_0323695
2711 Ga0501074_0001777
2712 Ga0501074_0003435
2713 Ga0501074_0070397
2714 Ga0501074_0153514
2715 Ga0501074_0335740
2716 Ga0501075_0000318
2717 Ga0501075_0013143
2718 Ga0501075_0033028
2719 Ga0501075_0068115
2720 Ga0501075_0217360
2721 Ga0501075_0574982
2722 Ga0501076_0012413
2723 Ga0501076_0030863
2724 Ga0501076_0031835
2725 Ga0501076_0043708
2726 Ga0501076_0045049
2727 Ga0501076_0129445
2728 Ga0501076_0202578
2729 Ga0501076_0489681
2730 Ga0501077_0002406
2731 Ga0501077_0033658
2732 Ga0501077_0034848
2733 Ga0501077_0046784
2734 Ga0501077_0063333
2735 Ga0501077_0101908
2736 Ga0501227_033330
2737 Ga0501247_009835
2738 Ga0501253_022460
2739 Ga0501079_0004813
2740 Ga0501079_0004932
2741 Ga0501079_0006316
2742 Ga0501079_0139639
2743 Ga0501079_0258634
2744 Ga0501079_0317474
2745 Ga0501079_0472073
2746 Ga0501079_0607053
2747 Ga0501079_0957743
2748 Ga0501080_0010019
2749 Ga0501080_0025475
2750 Ga0501080_0079970
2751 Ga0501080_0097163
2752 Ga0501080_0224667
2753 Ga0501081_0010443
2754 Ga0501081_0011323
2755 Ga0501081_0031416
2756 Ga0501081_0036589
2757 Ga0501081_0107777
2758 Ga0501081_0254567
2759 Ga0501081_0271699
2760 Ga0501083_0001510
2761 Ga0501083_0002103
2762 Ga0501083_0003155
2763 Ga0501083_0005310
2764 Ga0501083_0083373
2765 Ga0501264_023486
2766 Ga0501279_003264
2767 Ga0501035_0005138
2768 Ga0501035_0157653
2769 Ga0501035_0363860
2770 Ga0501035_0475511
2771 Ga0501044_0009712
2772 Ga0501044_0057767
2773 Ga0501045_0000615
2774 Ga0501045_0004328
2775 Ga0501045_0008281
2776 Ga0501045_0193242
2777 Ga0501045_0866228
2778 nmdc:mga03n38_9964_c1
2779 nmdc:mga00v17_342506_c1
2780 nmdc:mga00v17_9451_c1
2781 nmdc:mga0yw44_127178_c1
2782 nmdc:mga0yw44_399598_c1
2783 nmdc:mga0yw44_52492_c1
2784 nmdc:mga0yw44_712873_c1
2785 nmdc:mga05p37_1395582_c1
2786 nmdc:mga05p37_145010_c1
2787 nmdc:mga05p37_1569855_c1
2788 nmdc:mga05p37_1635713_c1
2789 nmdc:mga05p37_178562_c1
2790 nmdc:mga05p37_299781_c1
2791 nmdc:mga05p37_479790_c1
2792 nmdc:mga05p37_49969_c1
2793 nmdc:mga05p37_600807_c1
2794 nmdc:mga05p37_69160_c1
2795 nmdc:mga09592_1010633_c1
2796 nmdc:mga09592_176122_c1
2797 nmdc:mga09592_224529_c1
2798 nmdc:mga09592_60186_c1
2799 nmdc:mga09592_89167_c1
2800 nmdc:mga0qj67_10209_c1
2801 nmdc:mga0qj67_162012_c1
2802 nmdc:mga0qj67_297864_c1
2803 nmdc:mga0qj67_630985_c1
2804 nmdc:mga06r32_127606_c1
2805 nmdc:mga06r32_188480_c1
2806 nmdc:mga06r32_52748_c1
2807 nmdc:mga06r32_81576_c1
2808 nmdc:mga08y16_1029998_c1
2809 nmdc:mga08y16_111806_c1
2810 nmdc:mga08y16_117153_c1
2811 nmdc:mga08y16_156439_c1
2812 nmdc:mga08y16_27126_c1
2813 nmdc:mga08y16_50086_c1
2814 nmdc:mga08y16_631467_c1
2815 nmdc:mga08y16_80356_c1
2816 nmdc:mga0n895_144540_c1
2817 nmdc:mga0n895_147802_c1
2818 nmdc:mga0n895_271932_c1
2819 nmdc:mga0n895_300404_c1
2820 nmdc:mga0n895_394614_c1
2821 nmdc:mga0n895_639982_c1
2822 nmdc:mga0n895_66856_c1
2823 nmdc:mga0n895_70967_c1
2824 nmdc:mga0n895_712362_c1
2825 nmdc:mga0n895_871526_c1
2826 nmdc:mga0rr50_21282_c1
2827 nmdc:mga0rr50_247054_c1
2828 nmdc:mga08x19_105160_c1
2829 nmdc:mga08x19_22590_c1
2830 nmdc:mga08x19_23001_c1
2831 nmdc:mga08x19_26956_c1
2832 nmdc:mga08x19_37657_c1
2833 nmdc:mga08x19_4565_c1
2834 nmdc:mga0a205_156520_c1
2835 nmdc:mga0a205_172887_c1
2836 nmdc:mga0a205_32521_c1
2837 nmdc:mga0a205_352026_c1
2838 nmdc:mga0a205_41155_c1
2839 nmdc:mga0a205_441599_c1
2840 nmdc:mga0a205_9333_c2
2841 Ga0495601_0180556
2842 Ga0495619_0071754
2843 Ga0495619_0495695
2844 Ga0501084_0007220
2845 Ga0501084_0032455
2846 Ga0501084_0060012
2847 Ga0501084_0231548
2848 Ga0501084_0265726
2849 Ga0501084_0320345
2850 Ga0501084_0458524
2851 Ga0501084_0717732
2852 Ga0587090_037235
2853 Ga0501082_0001521
2854 Ga0501082_0035827
2855 Ga0501082_0060429
2856 Ga0501082_0068456
2857 Ga0501082_0071244
2858 Ga0501082_0099068
2859 Ga0501082_0420130
2860 Ga0501082_0910596
2861 Ga0530510_0075602
2862 Ga0530510_0083097
2863 Ga0530510_0174248
2864 Ga0530510_0352520
2865 Ga0530510_0407865
2866 2906802893
2867 2932430801
2868 2933419480
2869 2939650875
2870 2939675649
2871 2946060958
2872 8054108670

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22769

DCD

dCTP deaminase-like

2

155

0.96

PF00692

dUTPase

dUTPase

69

181

0.9

PF06559

DCD_N

2'-deoxycytidine 5'-triphosphate deaminase (DCD) N-terminal domain

1

156

0.83

PF22569

DCD_C

2'-deoxycytidine 5'-triphosphate deaminase (DCD), C-terminal domain

40

182

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qxx-assembly1.cif.gz_A bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp 0.9681 1 189
4a6a-assembly1.cif.gz_F a115v variant of dctp deaminase-dutpase from mycobacterium tuberculosis in complex with dttp 0.9649 1 189
2qxx-assembly1.cif.gz_A bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp 0.9631 1 189
2qlp-assembly2.cif.gz_E bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form 0.962 1 159
4a6a-assembly1.cif.gz_F a115v variant of dctp deaminase-dutpase from mycobacterium tuberculosis in complex with dttp 0.9599 1 189
ID Description Score Start End Superfamily
4a6aA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9633 1 189 2.70.40.10
2qlpA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.96 1 154 2.70.40.10
4a6aA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9584 1 189 2.70.40.10
2qlpA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.954 1 154 2.70.40.10
4xjcF00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9333 1 183 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A7K0L9R1-F1-model_v4 deleted 0.9851 1 105
AF-A0A2H1KJL0-F1-model_v4 dCTP deaminase, dUMP-forming (EC 3.5.4.30) (Bifunctional dCTP deaminase:dUTPase) (DCD-DUT) 0.9798 1 191 GO:0000166
GO:0006226
GO:0006229
GO:0008829
GO:0015949
GO:0033973
AF-A0A5S4FKZ9-F1-model_v4 dCTP deaminase, dUMP-forming (EC 3.5.4.30) (Bifunctional dCTP deaminase:dUTPase) (DCD-DUT) 0.9794 1 191 GO:0000166
GO:0006226
GO:0006229
GO:0008829
GO:0015949
GO:0033973
AF-A0A538FBU6-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9792 1 103 GO:0006229
GO:0008829
GO:0015949
AF-A0A4Y3NNI2-F1-model_v4 dCTP deaminase, dUMP-forming (EC 3.5.4.30) (Bifunctional dCTP deaminase:dUTPase) (DCD-DUT) 0.9788 1 191 GO:0000166
GO:0006226
GO:0006229
GO:0008829
GO:0015949
GO:0033973

Map