F493946
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1436 | 449 | 2872 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100572098|Ga0070679_1005720982 |
| Length | 194 |
| Sequence | VVLSDVTIERLIAEGRIGIDPYDVSLLQPSSVDVRVDRFFRVFHNARYPYIDVKQPQEALTELVEMHDDEEPFILHPGEFVLGSTLEVVSLPNDLVARLEGKSSLGRLGLLIHSTAGFIDPGFEGNVTLELSNVANLPITIYYGMKIGQISFMQMSEPAMNPYGSGALGSKYRGQRGPTPSRYYENFEQSSKNE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 121 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 122 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 123 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 254 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 255 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 256 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 257 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 258 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 263 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 264 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 265 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 266 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 267 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 268 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 269 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 270 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 271 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 272 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 273 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 276 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 279 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 280 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 281 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 282 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 283 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 284 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 285 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 286 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 287 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 288 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 289 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 292 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 293 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 298 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 299 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 300 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 301 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 302 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 383 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 384 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 385 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 386 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 414 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 415 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 416 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 421 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 422 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 426 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 427 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 443 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 444 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 445 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 446 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 447 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 448 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 449 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.96 |
| Metatranscriptomes | 0.56 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.11 |
| Nodule | 0 |
| Rhizoplane | 8.64 |
| Rhizosphere | 88.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070679_100572098 | 3300005530 | Bacteria | 1073 |
| 2 | JGI25152J39213_1000046 | 3300002773 | Bacteria | 85532 |
| 3 | JGI25407J50210_10003857 | 3300003373 | Bacteria | 3630 |
| 4 | JGI25404J52841_10083426 | 3300003659 | Bacteria | 668 |
| 5 | Ga0055542_1006635 | 3300003762 | Bacteria | 2451 |
| 6 | Ga0065714_10155660 | 3300005288 | Bacteria | 1080 |
| 7 | Ga0070658_10014372 | 3300005327 | Bacteria | 6351 |
| 8 | Ga0070658_10034647 | 3300005327 | Bacteria | 4062 |
| 9 | Ga0070658_10097451 | 3300005327 | Bacteria | 2428 |
| 10 | Ga0070658_10177298 | 3300005327 | Bacteria | 1793 |
| 11 | Ga0070658_10184496 | 3300005327 | Bacteria | 1756 |
| 12 | Ga0070676_10089279 | 3300005328 | Bacteria | 1885 |
| 13 | Ga0070676_10236823 | 3300005328 | Bacteria | 1212 |
| 14 | Ga0070683_100003641 | 3300005329 | Bacteria | 12550 |
| 15 | Ga0070683_100012451 | 3300005329 | Bacteria | 7394 |
| 16 | Ga0070683_100070160 | 3300005329 | Bacteria | 3269 |
| 17 | Ga0070683_100197102 | 3300005329 | Bacteria | 1912 |
| 18 | Ga0070683_100401326 | 3300005329 | Bacteria | 1307 |
| 19 | Ga0070690_100021285 | 3300005330 | Bacteria | 3957 |
| 20 | Ga0070690_100084585 | 3300005330 | Bacteria | 2080 |
| 21 | Ga0070670_100246151 | 3300005331 | Bacteria | 1557 |
| 22 | Ga0070670_100377517 | 3300005331 | Bacteria | 1248 |
| 23 | Ga0068869_100089683 | 3300005334 | Bacteria | 2309 |
| 24 | Ga0068869_100108563 | 3300005334 | Bacteria | 2108 |
| 25 | Ga0070666_10011943 | 3300005335 | Bacteria | 5465 |
| 26 | Ga0070680_100009218 | 3300005336 | Bacteria | 7568 |
| 27 | Ga0070680_100113835 | 3300005336 | Bacteria | 2254 |
| 28 | Ga0070680_100139622 | 3300005336 | Bacteria | 2031 |
| 29 | Ga0070682_100045851 | 3300005337 | Bacteria | 2711 |
| 30 | Ga0070682_100053356 | 3300005337 | Bacteria | 2533 |
| 31 | Ga0070682_100123921 | 3300005337 | Bacteria | 1739 |
| 32 | Ga0070682_100151094 | 3300005337 | Unclassified | 1593 |
| 33 | Ga0068868_101232677 | 3300005338 | Bacteria | 693 |
| 34 | Ga0070660_100002284 | 3300005339 | Bacteria | 13167 |
| 35 | Ga0070660_100079320 | 3300005339 | Bacteria | 2575 |
| 36 | Ga0070660_100184708 | 3300005339 | Bacteria | 1688 |
| 37 | Ga0070660_100188711 | 3300005339 | Unclassified | 1669 |
| 38 | Ga0070660_100394327 | 3300005339 | Bacteria | 1144 |
| 39 | Ga0070689_100014123 | 3300005340 | Bacteria | 5794 |
| 40 | Ga0070689_100080810 | 3300005340 | Bacteria | 2551 |
| 41 | Ga0070691_10033053 | 3300005341 | Bacteria | 2432 |
| 42 | Ga0070687_100121059 | 3300005343 | Bacteria | 1497 |
| 43 | Ga0070687_100843173 | 3300005343 | Bacteria | 653 |
| 44 | Ga0070661_100072080 | 3300005344 | Bacteria | 2542 |
| 45 | Ga0070661_100297783 | 3300005344 | Bacteria | 1255 |
| 46 | Ga0070661_101214594 | 3300005344 | Unclassified | 631 |
| 47 | Ga0070692_10002531 | 3300005345 | Bacteria | 7111 |
| 48 | Ga0070692_10020956 | 3300005345 | Bacteria | 3176 |
| 49 | Ga0070692_10055201 | 3300005345 | Bacteria | 2076 |
| 50 | Ga0070668_100094651 | 3300005347 | Bacteria | 2358 |
| 51 | Ga0070668_100105061 | 3300005347 | Bacteria | 2242 |
| 52 | Ga0070668_100164197 | 3300005347 | Bacteria | 1804 |
| 53 | Ga0070668_100363052 | 3300005347 | Bacteria | 1228 |
| 54 | Ga0070669_100000002 | 3300005353 | Bacteria | 506497 |
| 55 | Ga0070669_101446737 | 3300005353 | Bacteria | 597 |
| 56 | Ga0070675_100197867 | 3300005354 | Bacteria | 1743 |
| 57 | Ga0070675_100295554 | 3300005354 | Bacteria | 1426 |
| 58 | Ga0070674_100008245 | 3300005356 | Bacteria | 6192 |
| 59 | Ga0070674_100022938 | 3300005356 | Bacteria | 4030 |
| 60 | Ga0070674_100855180 | 3300005356 | Bacteria | 789 |
| 61 | Ga0070673_100132374 | 3300005364 | Bacteria | 2094 |
| 62 | Ga0070673_100630558 | 3300005364 | Bacteria | 980 |
| 63 | Ga0070673_100773666 | 3300005364 | Bacteria | 885 |
| 64 | Ga0070688_100097160 | 3300005365 | Bacteria | 1935 |
| 65 | Ga0070688_100185188 | 3300005365 | Bacteria | 1447 |
| 66 | Ga0070688_100652974 | 3300005365 | Unclassified | 810 |
| 67 | Ga0070688_101290959 | 3300005365 | Unclassified | 589 |
| 68 | Ga0070659_100027699 | 3300005366 | Bacteria | 4368 |
| 69 | Ga0070659_100209762 | 3300005366 | Bacteria | 1605 |
| 70 | Ga0070659_100213661 | 3300005366 | Bacteria | 1590 |
| 71 | Ga0070667_100068362 | 3300005367 | Bacteria | 3023 |
| 72 | Ga0070667_100101719 | 3300005367 | Bacteria | 2483 |
| 73 | Ga0070667_100267268 | 3300005367 | Bacteria | 1533 |
| 74 | Ga0070703_10003466 | 3300005406 | Bacteria | 4498 |
| 75 | Ga0070709_10204981 | 3300005434 | Bacteria | 1399 |
| 76 | Ga0070709_10334055 | 3300005434 | Bacteria | 1116 |
| 77 | Ga0070714_100104428 | 3300005435 | Bacteria | 2500 |
| 78 | Ga0070714_100115887 | 3300005435 | Bacteria | 2378 |
| 79 | Ga0070713_100017467 | 3300005436 | Bacteria | 5427 |
| 80 | Ga0070713_100229014 | 3300005436 | Bacteria | 1689 |
| 81 | Ga0070713_100232044 | 3300005436 | Bacteria | 1678 |
| 82 | Ga0070713_100932769 | 3300005436 | Bacteria | 836 |
| 83 | Ga0070710_10083352 | 3300005437 | Bacteria | 1871 |
| 84 | Ga0070710_10435630 | 3300005437 | Bacteria | 885 |
| 85 | Ga0070701_10008989 | 3300005438 | Bacteria | 4355 |
| 86 | Ga0070711_100020225 | 3300005439 | Bacteria | 4286 |
| 87 | Ga0070711_100251430 | 3300005439 | Bacteria | 1387 |
| 88 | Ga0070705_100006893 | 3300005440 | Bacteria | 5580 |
| 89 | Ga0070705_100139298 | 3300005440 | Bacteria | 1594 |
| 90 | Ga0070705_100284075 | 3300005440 | Bacteria | 1178 |
| 91 | Ga0070705_100463123 | 3300005440 | Bacteria | 954 |
| 92 | Ga0070700_100086817 | 3300005441 | Bacteria | 2032 |
| 93 | Ga0070700_100401348 | 3300005441 | Bacteria | 1031 |
| 94 | Ga0070694_100027674 | 3300005444 | Bacteria | 3684 |
| 95 | Ga0070694_100077622 | 3300005444 | Bacteria | 2301 |
| 96 | Ga0070694_100242333 | 3300005444 | Bacteria | 1360 |
| 97 | Ga0070694_100918075 | 3300005444 | Bacteria | 723 |
| 98 | Ga0070708_100234521 | 3300005445 | Bacteria | 1722 |
| 99 | Ga0070663_100033893 | 3300005455 | Bacteria | 3531 |
| 100 | Ga0070663_100167475 | 3300005455 | Bacteria | 1696 |
| 101 | Ga0070663_100320768 | 3300005455 | Bacteria | 1246 |
| 102 | Ga0070678_100033436 | 3300005456 | Bacteria | 3570 |
| 103 | Ga0070678_100651361 | 3300005456 | Bacteria | 945 |
| 104 | Ga0070678_100720990 | 3300005456 | Bacteria | 900 |
| 105 | Ga0070678_100741929 | 3300005456 | Bacteria | 887 |
| 106 | Ga0070662_100013464 | 3300005457 | Bacteria | 5444 |
| 107 | Ga0070662_100032163 | 3300005457 | Bacteria | 3685 |
| 108 | Ga0070662_100046759 | 3300005457 | Bacteria | 3110 |
| 109 | Ga0070681_10007964 | 3300005458 | Bacteria | 10371 |
| 110 | Ga0070681_10016690 | 3300005458 | Bacteria | 7331 |
| 111 | Ga0070681_10023282 | 3300005458 | Bacteria | 6229 |
| 112 | Ga0070681_10036925 | 3300005458 | Bacteria | 4904 |
| 113 | Ga0070681_10257360 | 3300005458 | Bacteria | 1658 |
| 114 | Ga0070681_10305714 | 3300005458 | Bacteria | 1500 |
| 115 | Ga0068867_100072350 | 3300005459 | Bacteria | 2580 |
| 116 | Ga0068867_100077648 | 3300005459 | Bacteria | 2496 |
| 117 | Ga0070685_10003221 | 3300005466 | Bacteria | 8305 |
| 118 | Ga0070685_10004772 | 3300005466 | Bacteria | 6864 |
| 119 | Ga0070685_10356343 | 3300005466 | Bacteria | 1002 |
| 120 | Ga0070685_10396369 | 3300005466 | Bacteria | 955 |
| 121 | Ga0070706_100003660 | 3300005467 | Bacteria | 15046 |
| 122 | Ga0070706_100023763 | 3300005467 | Bacteria | 5643 |
| 123 | Ga0070706_100539888 | 3300005467 | Bacteria | 1085 |
| 124 | Ga0070707_100002146 | 3300005468 | Bacteria | 18879 |
| 125 | Ga0070707_100057963 | 3300005468 | Bacteria | 3715 |
| 126 | Ga0070707_100087877 | 3300005468 | Bacteria | 3007 |
| 127 | Ga0070707_100461895 | 3300005468 | Bacteria | 1230 |
| 128 | Ga0070698_100013048 | 3300005471 | Bacteria | 8796 |
| 129 | Ga0070698_100039664 | 3300005471 | Bacteria | 4844 |
| 130 | Ga0070698_100219532 | 3300005471 | Bacteria | 1835 |
| 131 | Ga0070698_100567816 | 3300005471 | Unclassified | 1074 |
| 132 | Ga0070699_100003545 | 3300005518 | Bacteria | 13794 |
| 133 | Ga0070699_100059708 | 3300005518 | Bacteria | 3303 |
| 134 | Ga0070699_100067160 | 3300005518 | Bacteria | 3114 |
| 135 | Ga0070699_100118178 | 3300005518 | Bacteria | 2330 |
| 136 | Ga0070699_100344883 | 3300005518 | Bacteria | 1341 |
| 137 | Ga0070679_100002180 | 3300005530 | Bacteria | 17674 |
| 138 | Ga0070679_100030712 | 3300005530 | Bacteria | 5306 |
| 139 | Ga0070679_100039874 | 3300005530 | Bacteria | 4668 |
| 140 | Ga0070679_100066942 | 3300005530 | Bacteria | 3581 |
| 141 | Ga0070679_100108072 | 3300005530 | Bacteria | 2767 |
| 142 | Ga0070679_100144007 | 3300005530 | Bacteria | 2361 |
| 143 | Ga0070684_100000887 | 3300005535 | Bacteria | 21150 |
| 144 | Ga0070684_100011152 | 3300005535 | Bacteria | 7155 |
| 145 | Ga0070684_100012096 | 3300005535 | Bacteria | 6901 |
| 146 | Ga0070684_100014289 | 3300005535 | Bacteria | 6427 |
| 147 | Ga0070684_100127407 | 3300005535 | Bacteria | 2294 |
| 148 | Ga0070684_100322747 | 3300005535 | Bacteria | 1418 |
| 149 | Ga0070697_100009908 | 3300005536 | Bacteria | 7431 |
| 150 | Ga0070697_100133987 | 3300005536 | Bacteria | 2079 |
| 151 | Ga0070697_100343641 | 3300005536 | Bacteria | 1288 |
| 152 | Ga0068853_100011384 | 3300005539 | Bacteria | 7225 |
| 153 | Ga0068853_100167137 | 3300005539 | Bacteria | 1988 |
| 154 | Ga0070672_100189287 | 3300005543 | Bacteria | 1717 |
| 155 | Ga0070686_100016719 | 3300005544 | Bacteria | 4272 |
| 156 | Ga0070686_100104765 | 3300005544 | Bacteria | 1917 |
| 157 | Ga0070686_100124717 | 3300005544 | Bacteria | 1773 |
| 158 | Ga0070686_100234527 | 3300005544 | Bacteria | 1333 |
| 159 | Ga0070686_100604799 | 3300005544 | Unclassified | 864 |
| 160 | Ga0070686_100605277 | 3300005544 | Bacteria | 864 |
| 161 | Ga0070695_100392616 | 3300005545 | Bacteria | 1050 |
| 162 | Ga0070695_101260208 | 3300005545 | Bacteria | 610 |
| 163 | Ga0070696_100019458 | 3300005546 | Bacteria | 4598 |
| 164 | Ga0070696_100043037 | 3300005546 | Bacteria | 3123 |
| 165 | Ga0070693_100367661 | 3300005547 | Bacteria | 989 |
| 166 | Ga0070665_100000625 | 3300005548 | Bacteria | 48195 |
| 167 | Ga0070665_100071423 | 3300005548 | Bacteria | 3477 |
| 168 | Ga0070665_100121490 | 3300005548 | Bacteria | 2613 |
| 169 | Ga0070704_100003404 | 3300005549 | Bacteria | 9112 |
| 170 | Ga0070704_100011285 | 3300005549 | Bacteria | 5473 |
| 171 | Ga0070704_100032794 | 3300005549 | Bacteria | 3507 |
| 172 | Ga0070704_100612672 | 3300005549 | Bacteria | 958 |
| 173 | Ga0068855_100018515 | 3300005563 | Bacteria | 8373 |
| 174 | Ga0068855_100034169 | 3300005563 | Bacteria | 6066 |
| 175 | Ga0068855_100075689 | 3300005563 | Bacteria | 3908 |
| 176 | Ga0068855_100178835 | 3300005563 | Bacteria | 2399 |
| 177 | Ga0068855_100224800 | 3300005563 | Bacteria | 2104 |
| 178 | Ga0068855_100414857 | 3300005563 | Bacteria | 1473 |
| 179 | Ga0070664_100048291 | 3300005564 | Bacteria | 3597 |
| 180 | Ga0070664_100295233 | 3300005564 | Bacteria | 1463 |
| 181 | Ga0070664_100410164 | 3300005564 | Bacteria | 1240 |
| 182 | Ga0070664_100496299 | 3300005564 | Bacteria | 1125 |
| 183 | Ga0068857_100165255 | 3300005577 | Bacteria | 2010 |
| 184 | Ga0068854_100066535 | 3300005578 | Bacteria | 2623 |
| 185 | Ga0068854_100338056 | 3300005578 | Bacteria | 1229 |
| 186 | Ga0068854_100787346 | 3300005578 | Bacteria | 828 |
| 187 | Ga0068856_100026978 | 3300005614 | Bacteria | 5603 |
| 188 | Ga0068856_100255658 | 3300005614 | Bacteria | 1767 |
| 189 | Ga0068856_100282471 | 3300005614 | Bacteria | 1677 |
| 190 | Ga0068856_100415257 | 3300005614 | Bacteria | 1366 |
| 191 | Ga0070702_100026938 | 3300005615 | Bacteria | 3096 |
| 192 | Ga0070702_100057772 | 3300005615 | Bacteria | 2245 |
| 193 | Ga0068852_100043382 | 3300005616 | Bacteria | 3815 |
| 194 | Ga0068852_100069567 | 3300005616 | Bacteria | 3086 |
| 195 | Ga0068852_100135911 | 3300005616 | Bacteria | 2270 |
| 196 | Ga0068852_100150981 | 3300005616 | Bacteria | 2160 |
| 197 | Ga0068859_100110232 | 3300005617 | Bacteria | 2814 |
| 198 | Ga0068859_100751744 | 3300005617 | Bacteria | 1064 |
| 199 | Ga0068864_100269055 | 3300005618 | Bacteria | 1587 |
| 200 | Ga0068866_10310043 | 3300005718 | Bacteria | 989 |
| 201 | Ga0068861_100103306 | 3300005719 | Bacteria | 2271 |
| 202 | Ga0068861_100375190 | 3300005719 | Unclassified | 1255 |
| 203 | Ga0068861_101045854 | 3300005719 | Bacteria | 782 |
| 204 | Ga0068851_10094026 | 3300005834 | Bacteria | 1582 |
| 205 | Ga0068851_10388740 | 3300005834 | Bacteria | 819 |
| 206 | Ga0068870_10021664 | 3300005840 | Bacteria | 3148 |
| 207 | Ga0068870_10954642 | 3300005840 | Bacteria | 609 |
| 208 | Ga0068863_100263196 | 3300005841 | Bacteria | 1668 |
| 209 | Ga0068858_100027442 | 3300005842 | Bacteria | 5289 |
| 210 | Ga0068858_100278716 | 3300005842 | Bacteria | 1592 |
| 211 | Ga0068858_101565851 | 3300005842 | Unclassified | 650 |
| 212 | Ga0068858_102184061 | 3300005842 | Bacteria | 547 |
| 213 | Ga0068860_100019464 | 3300005843 | Bacteria | 6581 |
| 214 | Ga0068860_100037378 | 3300005843 | Bacteria | 4648 |
| 215 | Ga0068862_100001063 | 3300005844 | Bacteria | 26294 |
| 216 | Ga0068862_100246359 | 3300005844 | Bacteria | 1627 |
| 217 | Ga0068862_100247710 | 3300005844 | Bacteria | 1623 |
| 218 | Ga0068862_100643914 | 3300005844 | Bacteria | 1022 |
| 219 | Ga0081455_10015740 | 3300005937 | Bacteria | 7325 |
| 220 | Ga0081455_10022676 | 3300005937 | Bacteria | 5859 |
| 221 | Ga0081455_10032676 | 3300005937 | Bacteria | 4687 |
| 222 | Ga0081455_10032852 | 3300005937 | Bacteria | 4670 |
| 223 | Ga0081455_10040470 | 3300005937 | Bacteria | 4109 |
| 224 | Ga0081455_10056920 | 3300005937 | Bacteria | 3317 |
| 225 | Ga0081455_10058075 | 3300005937 | Bacteria | 3276 |
| 226 | Ga0081455_10356753 | 3300005937 | Bacteria | 1029 |
| 227 | Ga0081538_10000330 | 3300005981 | Bacteria | 54129 |
| 228 | Ga0081538_10001228 | 3300005981 | Bacteria | 26896 |
| 229 | Ga0081538_10001290 | 3300005981 | Bacteria | 26012 |
| 230 | Ga0081538_10007527 | 3300005981 | Bacteria | 9410 |
| 231 | Ga0081538_10047404 | 3300005981 | Bacteria | 2635 |
| 232 | Ga0081538_10137821 | 3300005981 | Bacteria | 1132 |
| 233 | Ga0081540_1009957 | 3300005983 | Bacteria | 6482 |
| 234 | Ga0081540_1012344 | 3300005983 | Bacteria | 5636 |
| 235 | Ga0081539_10001337 | 3300005985 | Bacteria | 42952 |
| 236 | Ga0081539_10041689 | 3300005985 | Bacteria | 2681 |
| 237 | Ga0081539_10199326 | 3300005985 | Bacteria | 926 |
| 238 | Ga0070717_10041894 | 3300006028 | Bacteria | 3734 |
| 239 | Ga0075365_10003096 | 3300006038 | Bacteria | 8453 |
| 240 | Ga0075363_100089490 | 3300006048 | Bacteria | 1692 |
| 241 | Ga0075363_100246956 | 3300006048 | Bacteria | 1027 |
| 242 | Ga0075432_10004635 | 3300006058 | Bacteria | 4681 |
| 243 | Ga0075432_10012966 | 3300006058 | Bacteria | 2832 |
| 244 | Ga0075432_10037726 | 3300006058 | Bacteria | 1682 |
| 245 | Ga0070715_10138585 | 3300006163 | Bacteria | 1179 |
| 246 | Ga0070715_10197536 | 3300006163 | Bacteria | 1020 |
| 247 | Ga0070716_100091705 | 3300006173 | Bacteria | 1840 |
| 248 | Ga0070716_100146864 | 3300006173 | Bacteria | 1512 |
| 249 | Ga0070716_100176834 | 3300006173 | Unclassified | 1398 |
| 250 | Ga0070712_100028072 | 3300006175 | Bacteria | 3762 |
| 251 | Ga0070712_100033201 | 3300006175 | Bacteria | 3490 |
| 252 | Ga0070712_100045337 | 3300006175 | Bacteria | 3035 |
| 253 | Ga0070712_100224613 | 3300006175 | Bacteria | 1488 |
| 254 | Ga0075362_10055513 | 3300006177 | Bacteria | 1782 |
| 255 | Ga0075367_10185945 | 3300006178 | Bacteria | 1296 |
| 256 | Ga0097621_100233690 | 3300006237 | Bacteria | 1606 |
| 257 | Ga0097621_100309678 | 3300006237 | Bacteria | 1397 |
| 258 | Ga0075370_10161743 | 3300006353 | Bacteria | 1314 |
| 259 | Ga0068871_100111925 | 3300006358 | Bacteria | 2297 |
| 260 | Ga0068871_100174284 | 3300006358 | Bacteria | 1845 |
| 261 | Ga0068871_100266690 | 3300006358 | Bacteria | 1495 |
| 262 | Ga0075428_100002710 | 3300006844 | Bacteria | 19287 |
| 263 | Ga0075428_100081065 | 3300006844 | Bacteria | 3542 |
| 264 | Ga0075428_100159254 | 3300006844 | Bacteria | 2451 |
| 265 | Ga0075428_101009277 | 3300006844 | Bacteria | 881 |
| 266 | Ga0075428_101097533 | 3300006844 | Bacteria | 840 |
| 267 | Ga0075430_100009019 | 3300006846 | Bacteria | 8430 |
| 268 | Ga0075430_100102461 | 3300006846 | Bacteria | 2390 |
| 269 | Ga0075430_100136046 | 3300006846 | Bacteria | 2047 |
| 270 | Ga0075430_100283078 | 3300006846 | Bacteria | 1372 |
| 271 | Ga0075431_100001020 | 3300006847 | Bacteria | 24950 |
| 272 | Ga0075431_100017616 | 3300006847 | Bacteria | 7261 |
| 273 | Ga0075431_100047691 | 3300006847 | Bacteria | 4417 |
| 274 | Ga0075431_100199297 | 3300006847 | Bacteria | 2049 |
| 275 | Ga0075431_100465464 | 3300006847 | Bacteria | 1258 |
| 276 | Ga0075433_10033563 | 3300006852 | Bacteria | 4401 |
| 277 | Ga0075433_10037108 | 3300006852 | Bacteria | 4202 |
| 278 | Ga0075433_10059649 | 3300006852 | Bacteria | 3338 |
| 279 | Ga0075433_10301595 | 3300006852 | Bacteria | 1419 |
| 280 | Ga0075434_100048762 | 3300006871 | Bacteria | 4202 |
| 281 | Ga0075434_100112943 | 3300006871 | Bacteria | 2728 |
| 282 | Ga0075434_100141319 | 3300006871 | Bacteria | 2427 |
| 283 | Ga0075434_100159314 | 3300006871 | Bacteria | 2277 |
| 284 | Ga0075434_100325366 | 3300006871 | Bacteria | 1558 |
| 285 | Ga0075434_100350779 | 3300006871 | Bacteria | 1497 |
| 286 | Ga0075434_100624736 | 3300006871 | Unclassified | 1096 |
| 287 | Ga0075429_100052744 | 3300006880 | Bacteria | 3538 |
| 288 | Ga0075429_100238786 | 3300006880 | Bacteria | 1592 |
| 289 | Ga0075429_100247617 | 3300006880 | Bacteria | 1560 |
| 290 | Ga0075429_100330209 | 3300006880 | Bacteria | 1334 |
| 291 | Ga0075429_100574506 | 3300006880 | Bacteria | 988 |
| 292 | Ga0075429_101178989 | 3300006880 | Bacteria | 669 |
| 293 | Ga0068865_100022281 | 3300006881 | Bacteria | 4130 |
| 294 | Ga0068865_100024408 | 3300006881 | Bacteria | 3966 |
| 295 | Ga0068865_100334613 | 3300006881 | Bacteria | 1222 |
| 296 | Ga0068865_100427821 | 3300006881 | Bacteria | 1090 |
| 297 | Ga0075436_100001835 | 3300006914 | Bacteria | 14562 |
| 298 | Ga0075436_100006708 | 3300006914 | Bacteria | 7881 |
| 299 | Ga0075436_100011000 | 3300006914 | Bacteria | 6213 |
| 300 | Ga0075436_100020746 | 3300006914 | Bacteria | 4508 |
| 301 | Ga0075436_100053533 | 3300006914 | Bacteria | 2786 |
| 302 | Ga0075436_100142230 | 3300006914 | Bacteria | 1686 |
| 303 | Ga0075436_100186821 | 3300006914 | Bacteria | 1466 |
| 304 | Ga0097620_100110230 | 3300006931 | Bacteria | 2814 |
| 305 | Ga0097620_100751726 | 3300006931 | Bacteria | 1064 |
| 306 | Ga0075435_100007425 | 3300007076 | Bacteria | 7808 |
| 307 | Ga0075435_100037084 | 3300007076 | Bacteria | 3880 |
| 308 | Ga0075435_100324741 | 3300007076 | Bacteria | 1317 |
| 309 | Ga0075435_100472263 | 3300007076 | Bacteria | 1083 |
| 310 | Ga0075435_100593019 | 3300007076 | Bacteria | 961 |
| 311 | Ga0105244_10004212 | 3300009036 | Bacteria | 9998 |
| 312 | Ga0105240_10022063 | 3300009093 | Bacteria | 8450 |
| 313 | Ga0105240_10085266 | 3300009093 | Bacteria | 3870 |
| 314 | Ga0105240_10148064 | 3300009093 | Bacteria | 2799 |
| 315 | Ga0111539_10013119 | 3300009094 | Bacteria | 10364 |
| 316 | Ga0111539_10023472 | 3300009094 | Bacteria | 7578 |
| 317 | Ga0111539_10040970 | 3300009094 | Bacteria | 5571 |
| 318 | Ga0111539_10056335 | 3300009094 | Bacteria | 4672 |
| 319 | Ga0111539_10060296 | 3300009094 | Bacteria | 4496 |
| 320 | Ga0111539_10089782 | 3300009094 | Bacteria | 3611 |
| 321 | Ga0111539_10124544 | 3300009094 | Bacteria | 3020 |
| 322 | Ga0111539_10249129 | 3300009094 | Bacteria | 2068 |
| 323 | Ga0111539_10294990 | 3300009094 | Bacteria | 1887 |
| 324 | Ga0111539_10307348 | 3300009094 | Bacteria | 1845 |
| 325 | Ga0111539_10317039 | 3300009094 | Bacteria | 1814 |
| 326 | Ga0111539_10372505 | 3300009094 | Bacteria | 1662 |
| 327 | Ga0111539_10419597 | 3300009094 | Bacteria | 1558 |
| 328 | Ga0111539_10703241 | 3300009094 | Bacteria | 1176 |
| 329 | Ga0111539_11382177 | 3300009094 | Bacteria | 817 |
| 330 | Ga0105245_10024429 | 3300009098 | Bacteria | 5307 |
| 331 | Ga0105245_10043540 | 3300009098 | Bacteria | 4004 |
| 332 | Ga0105245_10058133 | 3300009098 | Bacteria | 3480 |
| 333 | Ga0105245_10078137 | 3300009098 | Bacteria | 3019 |
| 334 | Ga0105245_10093151 | 3300009098 | Bacteria | 2776 |
| 335 | Ga0105245_10131590 | 3300009098 | Bacteria | 2347 |
| 336 | Ga0105245_10169296 | 3300009098 | Bacteria | 2079 |
| 337 | Ga0105245_10202285 | 3300009098 | Bacteria | 1908 |
| 338 | Ga0105247_10058184 | 3300009101 | Bacteria | 2391 |
| 339 | Ga0114129_10017930 | 3300009147 | Bacteria | 10079 |
| 340 | Ga0114129_10076752 | 3300009147 | Bacteria | 4651 |
| 341 | Ga0114129_10164573 | 3300009147 | Bacteria | 3028 |
| 342 | Ga0114129_10458833 | 3300009147 | Bacteria | 1670 |
| 343 | Ga0114129_10487702 | 3300009147 | Bacteria | 1611 |
| 344 | Ga0114129_11018607 | 3300009147 | Bacteria | 1042 |
| 345 | Ga0114129_11045073 | 3300009147 | Bacteria | 1026 |
| 346 | Ga0114129_11091867 | 3300009147 | Bacteria | 999 |
| 347 | Ga0114129_12300428 | 3300009147 | Bacteria | 647 |
| 348 | Ga0105243_10013026 | 3300009148 | Bacteria | 6283 |
| 349 | Ga0105243_10018258 | 3300009148 | Bacteria | 5311 |
| 350 | Ga0105243_10020325 | 3300009148 | Bacteria | 5035 |
| 351 | Ga0105243_10033330 | 3300009148 | Bacteria | 3983 |
| 352 | Ga0105243_10036838 | 3300009148 | Bacteria | 3799 |
| 353 | Ga0105243_10050214 | 3300009148 | Bacteria | 3294 |
| 354 | Ga0105243_11318847 | 3300009148 | Bacteria | 739 |
| 355 | Ga0105241_10222536 | 3300009174 | Bacteria | 1587 |
| 356 | Ga0105241_10905214 | 3300009174 | Bacteria | 819 |
| 357 | Ga0105242_10049351 | 3300009176 | Bacteria | 3425 |
| 358 | Ga0105242_10085512 | 3300009176 | Bacteria | 2645 |
| 359 | Ga0105242_10103539 | 3300009176 | Bacteria | 2415 |
| 360 | Ga0105242_10140911 | 3300009176 | Bacteria | 2092 |
| 361 | Ga0105242_10287482 | 3300009176 | Bacteria | 1496 |
| 362 | Ga0105242_10727460 | 3300009176 | Bacteria | 974 |
| 363 | Ga0105242_10847123 | 3300009176 | Bacteria | 909 |
| 364 | Ga0105242_11032000 | 3300009176 | Bacteria | 832 |
| 365 | Ga0105248_10046557 | 3300009177 | Bacteria | 4861 |
| 366 | Ga0105248_10134961 | 3300009177 | Bacteria | 2784 |
| 367 | Ga0105248_10193695 | 3300009177 | Bacteria | 2290 |
| 368 | Ga0105248_10786702 | 3300009177 | Unclassified | 1074 |
| 369 | Ga0105238_10337870 | 3300009551 | Bacteria | 1494 |
| 370 | Ga0105238_10396582 | 3300009551 | Bacteria | 1373 |
| 371 | Ga0105238_10983483 | 3300009551 | Bacteria | 864 |
| 372 | Ga0105249_10070967 | 3300009553 | Bacteria | 3217 |
| 373 | Ga0105249_10096470 | 3300009553 | Bacteria | 2774 |
| 374 | Ga0105249_10152408 | 3300009553 | Unclassified | 2227 |
| 375 | Ga0105249_10201390 | 3300009553 | Bacteria | 1948 |
| 376 | Ga0105249_10250976 | 3300009553 | Bacteria | 1754 |
| 377 | Ga0105249_12872056 | 3300009553 | Bacteria | 553 |
| 378 | Ga0105030_114543 | 3300009987 | Bacteria | 692 |
| 379 | Ga0105239_10013046 | 3300010375 | Bacteria | 9236 |
| 380 | Ga0105239_10124667 | 3300010375 | Bacteria | 2862 |
| 381 | Ga0105239_10165737 | 3300010375 | Bacteria | 2470 |
| 382 | Ga0105239_10168474 | 3300010375 | Bacteria | 2449 |
| 383 | Ga0105239_10634248 | 3300010375 | Bacteria | 1220 |
| 384 | Ga0105246_10005235 | 3300011119 | Bacteria | 7886 |
| 385 | Ga0105246_10036011 | 3300011119 | Bacteria | 3312 |
| 386 | Ga0105246_10113067 | 3300011119 | Bacteria | 1998 |
| 387 | Ga0105246_10184971 | 3300011119 | Bacteria | 1607 |
| 388 | Ga0105246_10226621 | 3300011119 | Bacteria | 1469 |
| 389 | Ga0105246_10566060 | 3300011119 | Bacteria | 976 |
| 390 | Ga0105246_11173788 | 3300011119 | Bacteria | 705 |
| 391 | Ga0157346_1003880 | 3300012480 | Bacteria | 858 |
| 392 | Ga0157341_1010607 | 3300012494 | Bacteria | 785 |
| 393 | Ga0157319_1016381 | 3300012497 | Bacteria | 673 |
| 394 | Ga0157347_1010583 | 3300012502 | Bacteria | 970 |
| 395 | Ga0157373_10095877 | 3300013100 | Bacteria | 2088 |
| 396 | Ga0157373_10141235 | 3300013100 | Bacteria | 1694 |
| 397 | Ga0157371_10055114 | 3300013102 | Bacteria | 2821 |
| 398 | Ga0157371_10067574 | 3300013102 | Bacteria | 2530 |
| 399 | Ga0157371_10349834 | 3300013102 | Bacteria | 1076 |
| 400 | Ga0157371_10359882 | 3300013102 | Bacteria | 1060 |
| 401 | Ga0157370_10024054 | 3300013104 | Bacteria | 6039 |
| 402 | Ga0157370_10030046 | 3300013104 | Bacteria | 5326 |
| 403 | Ga0157370_10087914 | 3300013104 | Bacteria | 2919 |
| 404 | Ga0157370_10212494 | 3300013104 | Bacteria | 1793 |
| 405 | Ga0157370_11131434 | 3300013104 | Bacteria | 707 |
| 406 | Ga0157369_10029044 | 3300013105 | Bacteria | 6114 |
| 407 | Ga0157369_10081190 | 3300013105 | Bacteria | 3470 |
| 408 | Ga0157369_10124154 | 3300013105 | Bacteria | 2738 |
| 409 | Ga0157369_10325986 | 3300013105 | Bacteria | 1596 |
| 410 | Ga0157369_11538031 | 3300013105 | Bacteria | 677 |
| 411 | Ga0157374_11438495 | 3300013296 | Bacteria | 712 |
| 412 | Ga0157374_11800228 | 3300013296 | Bacteria | 638 |
| 413 | Ga0157378_10205213 | 3300013297 | Bacteria | 1866 |
| 414 | Ga0157378_10328522 | 3300013297 | Bacteria | 1488 |
| 415 | Ga0157378_10659266 | 3300013297 | Bacteria | 1063 |
| 416 | Ga0157378_11769749 | 3300013297 | Bacteria | 666 |
| 417 | Ga0163162_10429511 | 3300013306 | Bacteria | 1453 |
| 418 | Ga0163162_10611694 | 3300013306 | Bacteria | 1215 |
| 419 | Ga0157372_10196373 | 3300013307 | Bacteria | 2337 |
| 420 | Ga0157372_10624960 | 3300013307 | Bacteria | 1255 |
| 421 | Ga0157372_10698334 | 3300013307 | Bacteria | 1181 |
| 422 | Ga0157372_11714419 | 3300013307 | Bacteria | 723 |
| 423 | Ga0157375_10014646 | 3300013308 | Bacteria | 7004 |
| 424 | Ga0157375_10028657 | 3300013308 | Bacteria | 5224 |
| 425 | Ga0157375_10099855 | 3300013308 | Bacteria | 2982 |
| 426 | Ga0157375_10142516 | 3300013308 | Bacteria | 2525 |
| 427 | Ga0157375_11552403 | 3300013308 | Bacteria | 782 |
| 428 | Ga0157375_11793610 | 3300013308 | Bacteria | 727 |
| 429 | Ga0163163_10588459 | 3300014325 | Bacteria | 1176 |
| 430 | Ga0163163_11052540 | 3300014325 | Bacteria | 877 |
| 431 | Ga0157380_10034297 | 3300014326 | Bacteria | 3914 |
| 432 | Ga0157380_10436093 | 3300014326 | Bacteria | 1254 |
| 433 | Ga0157380_11109054 | 3300014326 | Unclassified | 831 |
| 434 | Ga0157377_10008757 | 3300014745 | Bacteria | 4947 |
| 435 | Ga0157377_10010749 | 3300014745 | Bacteria | 4541 |
| 436 | Ga0157377_10030589 | 3300014745 | Bacteria | 2918 |
| 437 | Ga0157377_10065648 | 3300014745 | Bacteria | 2086 |
| 438 | Ga0157377_10073352 | 3300014745 | Bacteria | 1983 |
| 439 | Ga0157377_10864173 | 3300014745 | Unclassified | 673 |
| 440 | Ga0157379_10007228 | 3300014968 | Bacteria | 9606 |
| 441 | Ga0157379_10501277 | 3300014968 | Bacteria | 1125 |
| 442 | Ga0157376_10048687 | 3300014969 | Bacteria | 3507 |
| 443 | Ga0157376_10345642 | 3300014969 | Bacteria | 1422 |
| 444 | Ga0157376_10442703 | 3300014969 | Bacteria | 1266 |
| 445 | Ga0163161_10151557 | 3300017792 | Bacteria | 1762 |
| 446 | Ga0197907_11161130 | 3300020069 | Bacteria | 1744 |
| 447 | Ga0206356_11461127 | 3300020070 | Bacteria | 1908 |
| 448 | Ga0206353_10651167 | 3300020082 | Bacteria | 1562 |
| 449 | Ga0213871_10005066 | 3300021441 | Bacteria | 2692 |
| 450 | Ga0209025_1001520 | 3300025294 | Bacteria | 29676 |
| 451 | Ga0207697_10131474 | 3300025315 | Bacteria | 1082 |
| 452 | Ga0207655_1005376 | 3300025728 | Bacteria | 8722 |
| 453 | Ga0207653_10009987 | 3300025885 | Bacteria | 2960 |
| 454 | Ga0207653_10020231 | 3300025885 | Bacteria | 2106 |
| 455 | Ga0207682_10159245 | 3300025893 | Bacteria | 1022 |
| 456 | Ga0207692_10461076 | 3300025898 | Bacteria | 801 |
| 457 | Ga0207642_10019819 | 3300025899 | Bacteria | 2613 |
| 458 | Ga0207642_10127440 | 3300025899 | Bacteria | 1323 |
| 459 | Ga0207642_10352436 | 3300025899 | Bacteria | 869 |
| 460 | Ga0207710_10118652 | 3300025900 | Bacteria | 1262 |
| 461 | Ga0207688_10009478 | 3300025901 | Bacteria | 5299 |
| 462 | Ga0207688_10016919 | 3300025901 | Bacteria | 3961 |
| 463 | Ga0207688_10031092 | 3300025901 | Bacteria | 2946 |
| 464 | Ga0207688_10056477 | 3300025901 | Bacteria | 2205 |
| 465 | Ga0207680_10055089 | 3300025903 | Bacteria | 2395 |
| 466 | Ga0207685_10087521 | 3300025905 | Bacteria | 1304 |
| 467 | Ga0207699_10147167 | 3300025906 | Unclassified | 1554 |
| 468 | Ga0207699_10253676 | 3300025906 | Bacteria | 1213 |
| 469 | Ga0207645_10024069 | 3300025907 | Bacteria | 3951 |
| 470 | Ga0207645_10329080 | 3300025907 | Bacteria | 1020 |
| 471 | Ga0207643_10036703 | 3300025908 | Bacteria | 2748 |
| 472 | Ga0207643_10044089 | 3300025908 | Bacteria | 2518 |
| 473 | Ga0207643_10598079 | 3300025908 | Bacteria | 710 |
| 474 | Ga0207705_10018897 | 3300025909 | Bacteria | 4927 |
| 475 | Ga0207705_10036877 | 3300025909 | Bacteria | 3499 |
| 476 | Ga0207705_10151140 | 3300025909 | Bacteria | 1740 |
| 477 | Ga0207705_10533679 | 3300025909 | Bacteria | 912 |
| 478 | Ga0207684_10029662 | 3300025910 | Bacteria | 4656 |
| 479 | Ga0207684_10085533 | 3300025910 | Bacteria | 2686 |
| 480 | Ga0207684_10087289 | 3300025910 | Bacteria | 2658 |
| 481 | Ga0207684_10110095 | 3300025910 | Bacteria | 2357 |
| 482 | Ga0207684_10439595 | 3300025910 | Bacteria | 1120 |
| 483 | Ga0207684_10482913 | 3300025910 | Bacteria | 1063 |
| 484 | Ga0207654_10101867 | 3300025911 | Bacteria | 1770 |
| 485 | Ga0207654_10268518 | 3300025911 | Bacteria | 1150 |
| 486 | Ga0207654_10362818 | 3300025911 | Bacteria | 1000 |
| 487 | Ga0207707_10006590 | 3300025912 | Bacteria | 10127 |
| 488 | Ga0207707_10087499 | 3300025912 | Bacteria | 2722 |
| 489 | Ga0207707_10216454 | 3300025912 | Bacteria | 1668 |
| 490 | Ga0207695_10114142 | 3300025913 | Bacteria | 2677 |
| 491 | Ga0207695_10572011 | 3300025913 | Bacteria | 1011 |
| 492 | Ga0207693_10003963 | 3300025915 | Bacteria | 12582 |
| 493 | Ga0207693_10013076 | 3300025915 | Bacteria | 6697 |
| 494 | Ga0207693_10030694 | 3300025915 | Bacteria | 4246 |
| 495 | Ga0207693_10243380 | 3300025915 | Bacteria | 1412 |
| 496 | Ga0207663_10215405 | 3300025916 | Bacteria | 1394 |
| 497 | Ga0207663_10271885 | 3300025916 | Bacteria | 1255 |
| 498 | Ga0207663_10617528 | 3300025916 | Bacteria | 853 |
| 499 | Ga0207660_10020089 | 3300025917 | Bacteria | 4478 |
| 500 | Ga0207660_10049701 | 3300025917 | Bacteria | 2975 |
| 501 | Ga0207662_10014292 | 3300025918 | Bacteria | 4452 |
| 502 | Ga0207662_10024351 | 3300025918 | Bacteria | 3484 |
| 503 | Ga0207662_10405653 | 3300025918 | Unclassified | 925 |
| 504 | Ga0207657_10042742 | 3300025919 | Bacteria | 3996 |
| 505 | Ga0207657_10172473 | 3300025919 | Bacteria | 1752 |
| 506 | Ga0207657_10249173 | 3300025919 | Bacteria | 1416 |
| 507 | Ga0207657_10472122 | 3300025919 | Bacteria | 984 |
| 508 | Ga0207649_10107186 | 3300025920 | Bacteria | 1860 |
| 509 | Ga0207649_10295841 | 3300025920 | Bacteria | 1182 |
| 510 | Ga0207649_10407607 | 3300025920 | Bacteria | 1018 |
| 511 | Ga0207649_10742971 | 3300025920 | Bacteria | 763 |
| 512 | Ga0207652_10043531 | 3300025921 | Bacteria | 3823 |
| 513 | Ga0207652_10046187 | 3300025921 | Bacteria | 3715 |
| 514 | Ga0207652_10178087 | 3300025921 | Bacteria | 1910 |
| 515 | Ga0207646_10006140 | 3300025922 | Bacteria | 12497 |
| 516 | Ga0207646_10006269 | 3300025922 | Bacteria | 12335 |
| 517 | Ga0207646_10152180 | 3300025922 | Bacteria | 2086 |
| 518 | Ga0207646_10518412 | 3300025922 | Bacteria | 1073 |
| 519 | Ga0207681_10000009 | 3300025923 | Bacteria | 410736 |
| 520 | Ga0207681_10028072 | 3300025923 | Bacteria | 3644 |
| 521 | Ga0207694_10309333 | 3300025924 | Bacteria | 1302 |
| 522 | Ga0207659_10617011 | 3300025926 | Bacteria | 925 |
| 523 | Ga0207687_10474482 | 3300025927 | Bacteria | 1041 |
| 524 | Ga0207687_10826073 | 3300025927 | Bacteria | 791 |
| 525 | Ga0207700_10000012 | 3300025928 | Bacteria | 231712 |
| 526 | Ga0207700_10182759 | 3300025928 | Bacteria | 1757 |
| 527 | Ga0207700_10397258 | 3300025928 | Bacteria | 1208 |
| 528 | Ga0207664_10019978 | 3300025929 | Bacteria | 4959 |
| 529 | Ga0207664_10046280 | 3300025929 | Bacteria | 3414 |
| 530 | Ga0207664_10084696 | 3300025929 | Bacteria | 2586 |
| 531 | Ga0207664_10090170 | 3300025929 | Bacteria | 2512 |
| 532 | Ga0207644_10066422 | 3300025931 | Bacteria | 2626 |
| 533 | Ga0207690_10045941 | 3300025932 | Bacteria | 2889 |
| 534 | Ga0207690_10168263 | 3300025932 | Bacteria | 1640 |
| 535 | Ga0207690_10195708 | 3300025932 | Bacteria | 1532 |
| 536 | Ga0207690_10349101 | 3300025932 | Bacteria | 1169 |
| 537 | Ga0207690_10400496 | 3300025932 | Bacteria | 1094 |
| 538 | Ga0207706_10054003 | 3300025933 | Bacteria | 3546 |
| 539 | Ga0207706_10068330 | 3300025933 | Bacteria | 3127 |
| 540 | Ga0207706_10073483 | 3300025933 | Bacteria | 3007 |
| 541 | Ga0207706_10374187 | 3300025933 | Bacteria | 1237 |
| 542 | Ga0207686_10097318 | 3300025934 | Bacteria | 1957 |
| 543 | Ga0207686_10119830 | 3300025934 | Bacteria | 1789 |
| 544 | Ga0207686_10156703 | 3300025934 | Bacteria | 1592 |
| 545 | Ga0207686_10174868 | 3300025934 | Bacteria | 1517 |
| 546 | Ga0207686_10235578 | 3300025934 | Unclassified | 1330 |
| 547 | Ga0207686_10368014 | 3300025934 | Bacteria | 1087 |
| 548 | Ga0207686_10823808 | 3300025934 | Bacteria | 745 |
| 549 | Ga0207709_10147765 | 3300025935 | Bacteria | 1624 |
| 550 | Ga0207709_10155025 | 3300025935 | Bacteria | 1591 |
| 551 | Ga0207709_10328843 | 3300025935 | Bacteria | 1147 |
| 552 | Ga0207709_10770385 | 3300025935 | Bacteria | 775 |
| 553 | Ga0207670_10014342 | 3300025936 | Bacteria | 4702 |
| 554 | Ga0207670_10163280 | 3300025936 | Bacteria | 1664 |
| 555 | Ga0207669_10032569 | 3300025937 | Bacteria | 2929 |
| 556 | Ga0207669_10121630 | 3300025937 | Bacteria | 1773 |
| 557 | Ga0207669_10153559 | 3300025937 | Bacteria | 1616 |
| 558 | Ga0207669_10252298 | 3300025937 | Bacteria | 1314 |
| 559 | Ga0207669_10269832 | 3300025937 | Bacteria | 1277 |
| 560 | Ga0207704_10054060 | 3300025938 | Bacteria | 2445 |
| 561 | Ga0207704_10455730 | 3300025938 | Bacteria | 1022 |
| 562 | Ga0207704_10473042 | 3300025938 | Bacteria | 1004 |
| 563 | Ga0207704_10493406 | 3300025938 | Bacteria | 985 |
| 564 | Ga0207704_10966458 | 3300025938 | Bacteria | 719 |
| 565 | Ga0207704_11153135 | 3300025938 | Bacteria | 660 |
| 566 | Ga0207665_10001466 | 3300025939 | Bacteria | 15877 |
| 567 | Ga0207665_10004281 | 3300025939 | Bacteria | 9485 |
| 568 | Ga0207665_10117622 | 3300025939 | Bacteria | 1875 |
| 569 | Ga0207665_10126859 | 3300025939 | Bacteria | 1808 |
| 570 | Ga0207665_10243368 | 3300025939 | Bacteria | 1326 |
| 571 | Ga0207691_10051487 | 3300025940 | Bacteria | 3764 |
| 572 | Ga0207711_10164420 | 3300025941 | Bacteria | 2011 |
| 573 | Ga0207711_10215226 | 3300025941 | Bacteria | 1756 |
| 574 | Ga0207711_10465724 | 3300025941 | Bacteria | 1177 |
| 575 | Ga0207689_10014420 | 3300025942 | Bacteria | 6723 |
| 576 | Ga0207689_10192159 | 3300025942 | Bacteria | 1684 |
| 577 | Ga0207689_10207145 | 3300025942 | Bacteria | 1620 |
| 578 | Ga0207689_10347525 | 3300025942 | Bacteria | 1233 |
| 579 | Ga0207661_10014827 | 3300025944 | Bacteria | 5716 |
| 580 | Ga0207661_10092504 | 3300025944 | Bacteria | 2521 |
| 581 | Ga0207661_10153507 | 3300025944 | Bacteria | 1992 |
| 582 | Ga0207661_10489862 | 3300025944 | Bacteria | 1123 |
| 583 | Ga0207661_10558259 | 3300025944 | Bacteria | 1049 |
| 584 | Ga0207661_11211843 | 3300025944 | Bacteria | 694 |
| 585 | Ga0207679_10057167 | 3300025945 | Bacteria | 2884 |
| 586 | Ga0207667_10166754 | 3300025949 | Bacteria | 2264 |
| 587 | Ga0207667_10253124 | 3300025949 | Bacteria | 1802 |
| 588 | Ga0207667_10266607 | 3300025949 | Bacteria | 1751 |
| 589 | Ga0207667_10554228 | 3300025949 | Bacteria | 1162 |
| 590 | Ga0207651_10261091 | 3300025960 | Bacteria | 1422 |
| 591 | Ga0207651_10445264 | 3300025960 | Bacteria | 1110 |
| 592 | Ga0207712_10166684 | 3300025961 | Bacteria | 1718 |
| 593 | Ga0207712_10203101 | 3300025961 | Bacteria | 1573 |
| 594 | Ga0207668_10037124 | 3300025972 | Bacteria | 3259 |
| 595 | Ga0207668_10037177 | 3300025972 | Bacteria | 3257 |
| 596 | Ga0207668_10139115 | 3300025972 | Bacteria | 1864 |
| 597 | Ga0207668_10608913 | 3300025972 | Bacteria | 952 |
| 598 | Ga0207668_11064917 | 3300025972 | Bacteria | 724 |
| 599 | Ga0207640_10168942 | 3300025981 | Bacteria | 1627 |
| 600 | Ga0207658_10008375 | 3300025986 | Bacteria | 7039 |
| 601 | Ga0207658_10071669 | 3300025986 | Bacteria | 2624 |
| 602 | Ga0207677_10023358 | 3300026023 | Bacteria | 3819 |
| 603 | Ga0207677_10139988 | 3300026023 | Bacteria | 1851 |
| 604 | Ga0207703_10148390 | 3300026035 | Bacteria | 2042 |
| 605 | Ga0207703_11490538 | 3300026035 | Unclassified | 651 |
| 606 | Ga0207639_10287038 | 3300026041 | Bacteria | 1449 |
| 607 | Ga0207678_10111101 | 3300026067 | Bacteria | 2338 |
| 608 | Ga0207678_10162357 | 3300026067 | Bacteria | 1908 |
| 609 | Ga0207678_11123023 | 3300026067 | Bacteria | 696 |
| 610 | Ga0207708_10008954 | 3300026075 | Bacteria | 7406 |
| 611 | Ga0207708_10023773 | 3300026075 | Bacteria | 4632 |
| 612 | Ga0207708_10103974 | 3300026075 | Bacteria | 2200 |
| 613 | Ga0207708_10478560 | 3300026075 | Bacteria | 1041 |
| 614 | Ga0207702_10235700 | 3300026078 | Bacteria | 1712 |
| 615 | Ga0207648_10014277 | 3300026089 | Bacteria | 7341 |
| 616 | Ga0207648_10088100 | 3300026089 | Bacteria | 2710 |
| 617 | Ga0207648_10117253 | 3300026089 | Bacteria | 2340 |
| 618 | Ga0207648_10171797 | 3300026089 | Bacteria | 1916 |
| 619 | Ga0207676_10071562 | 3300026095 | Bacteria | 2785 |
| 620 | Ga0207674_10019100 | 3300026116 | Bacteria | 7430 |
| 621 | Ga0207674_10041180 | 3300026116 | Bacteria | 4779 |
| 622 | Ga0207674_10072059 | 3300026116 | Bacteria | 3471 |
| 623 | Ga0207674_10199522 | 3300026116 | Bacteria | 1950 |
| 624 | Ga0207675_100006399 | 3300026118 | Bacteria | 11157 |
| 625 | Ga0207675_100012983 | 3300026118 | Bacteria | 7776 |
| 626 | Ga0207675_100220507 | 3300026118 | Bacteria | 1827 |
| 627 | Ga0207675_100242608 | 3300026118 | Bacteria | 1742 |
| 628 | Ga0207675_100393206 | 3300026118 | Bacteria | 1365 |
| 629 | Ga0207683_10011235 | 3300026121 | Bacteria | 7633 |
| 630 | Ga0207683_10021405 | 3300026121 | Bacteria | 5536 |
| 631 | Ga0207683_10398445 | 3300026121 | Bacteria | 1266 |
| 632 | Ga0207683_10480373 | 3300026121 | Bacteria | 1147 |
| 633 | Ga0207683_10645067 | 3300026121 | Bacteria | 981 |
| 634 | Ga0207683_10751405 | 3300026121 | Bacteria | 905 |
| 635 | Ga0207698_10017055 | 3300026142 | Bacteria | 4917 |
| 636 | Ga0207698_10039101 | 3300026142 | Bacteria | 3511 |
| 637 | Ga0207698_10148666 | 3300026142 | Bacteria | 2030 |
| 638 | Ga0207698_10377230 | 3300026142 | Bacteria | 1348 |
| 639 | Ga0207698_11609064 | 3300026142 | Bacteria | 665 |
| 640 | Ga0209998_10018860 | 3300027717 | Bacteria | 1467 |
| 641 | Ga0209998_10035881 | 3300027717 | Bacteria | 1112 |
| 642 | Ga0209974_10065380 | 3300027876 | Bacteria | 1235 |
| 643 | Ga0207428_10000393 | 3300027907 | Bacteria | 54718 |
| 644 | Ga0207428_10011660 | 3300027907 | Bacteria | 7755 |
| 645 | Ga0207428_10021808 | 3300027907 | Bacteria | 5419 |
| 646 | Ga0207428_10025802 | 3300027907 | Bacteria | 4913 |
| 647 | Ga0207428_10105175 | 3300027907 | Bacteria | 2177 |
| 648 | Ga0207428_10137362 | 3300027907 | Bacteria | 1868 |
| 649 | Ga0207428_10150273 | 3300027907 | Bacteria | 1773 |
| 650 | Ga0268266_10000799 | 3300028379 | Bacteria | 41836 |
| 651 | Ga0268266_10385049 | 3300028379 | Bacteria | 1323 |
| 652 | Ga0268265_10004154 | 3300028380 | Bacteria | 10148 |
| 653 | Ga0268265_10473170 | 3300028380 | Bacteria | 1175 |
| 654 | Ga0268264_10006890 | 3300028381 | Bacteria | 9537 |
| 655 | Ga0268264_10104738 | 3300028381 | Bacteria | 2466 |
| 656 | Ga0265338_10225043 | 3300028800 | Bacteria | 1399 |
| 657 | Ga0265340_10217169 | 3300031247 | Bacteria | 857 |
| 658 | Ga0307408_100001088 | 3300031548 | Bacteria | 20782 |
| 659 | Ga0307408_100076319 | 3300031548 | Bacteria | 2492 |
| 660 | Ga0307408_100121428 | 3300031548 | Bacteria | 2024 |
| 661 | Ga0307408_100314547 | 3300031548 | Bacteria | 1317 |
| 662 | Ga0307408_100332868 | 3300031548 | Bacteria | 1283 |
| 663 | Ga0307408_100391749 | 3300031548 | Bacteria | 1190 |
| 664 | Ga0307408_100480590 | 3300031548 | Bacteria | 1084 |
| 665 | Ga0307408_100833353 | 3300031548 | Bacteria | 839 |
| 666 | Ga0307508_10004869 | 3300031616 | Bacteria | 12920 |
| 667 | Ga0307405_10000639 | 3300031731 | Bacteria | 13463 |
| 668 | Ga0307405_10048244 | 3300031731 | Bacteria | 2625 |
| 669 | Ga0307405_10137020 | 3300031731 | Bacteria | 1701 |
| 670 | Ga0307405_10140625 | 3300031731 | Bacteria | 1682 |
| 671 | Ga0307405_10240922 | 3300031731 | Bacteria | 1339 |
| 672 | Ga0307413_10024410 | 3300031824 | Bacteria | 3296 |
| 673 | Ga0307413_10027481 | 3300031824 | Bacteria | 3153 |
| 674 | Ga0307413_11036895 | 3300031824 | Bacteria | 705 |
| 675 | Ga0307410_10020515 | 3300031852 | Bacteria | 4043 |
| 676 | Ga0307410_10031542 | 3300031852 | Bacteria | 3402 |
| 677 | Ga0307410_10163098 | 3300031852 | Bacteria | 1672 |
| 678 | Ga0307410_10530092 | 3300031852 | Bacteria | 973 |
| 679 | Ga0307410_10590847 | 3300031852 | Bacteria | 925 |
| 680 | Ga0307406_10058992 | 3300031901 | Bacteria | 2468 |
| 681 | Ga0307406_10145267 | 3300031901 | Bacteria | 1685 |
| 682 | Ga0307406_10220153 | 3300031901 | Bacteria | 1410 |
| 683 | Ga0307406_10379537 | 3300031901 | Bacteria | 1114 |
| 684 | Ga0307406_10496182 | 3300031901 | Bacteria | 989 |
| 685 | Ga0307407_10021264 | 3300031903 | Bacteria | 3342 |
| 686 | Ga0307407_10255038 | 3300031903 | Bacteria | 1204 |
| 687 | Ga0307407_10257131 | 3300031903 | Bacteria | 1199 |
| 688 | Ga0307407_10292844 | 3300031903 | Bacteria | 1132 |
| 689 | Ga0307412_10000473 | 3300031911 | Bacteria | 24063 |
| 690 | Ga0307412_10050650 | 3300031911 | Bacteria | 2741 |
| 691 | Ga0307412_10186629 | 3300031911 | Bacteria | 1564 |
| 692 | Ga0307412_10194322 | 3300031911 | Bacteria | 1536 |
| 693 | Ga0307409_100024998 | 3300031995 | Bacteria | 4179 |
| 694 | Ga0307409_100053445 | 3300031995 | Bacteria | 3103 |
| 695 | Ga0307409_100058035 | 3300031995 | Bacteria | 3003 |
| 696 | Ga0307409_100101699 | 3300031995 | Bacteria | 2385 |
| 697 | Ga0307409_100255964 | 3300031995 | Bacteria | 1603 |
| 698 | Ga0307409_100288647 | 3300031995 | Bacteria | 1520 |
| 699 | Ga0307409_100441587 | 3300031995 | Bacteria | 1254 |
| 700 | Ga0307409_101067616 | 3300031995 | Bacteria | 828 |
| 701 | Ga0307416_100000543 | 3300032002 | Bacteria | 19195 |
| 702 | Ga0307416_100055876 | 3300032002 | Bacteria | 3182 |
| 703 | Ga0307416_100126252 | 3300032002 | Bacteria | 2292 |
| 704 | Ga0307416_100187412 | 3300032002 | Bacteria | 1946 |
| 705 | Ga0307416_100231661 | 3300032002 | Bacteria | 1781 |
| 706 | Ga0307416_100251116 | 3300032002 | Bacteria | 1721 |
| 707 | Ga0307416_100768014 | 3300032002 | Bacteria | 1057 |
| 708 | Ga0307416_100991623 | 3300032002 | Bacteria | 943 |
| 709 | Ga0307416_101484993 | 3300032002 | Bacteria | 783 |
| 710 | Ga0307411_10116137 | 3300032005 | Bacteria | 1926 |
| 711 | Ga0307415_100050111 | 3300032126 | Bacteria | 2827 |
| 712 | Ga0307415_100076399 | 3300032126 | Bacteria | 2374 |
| 713 | Ga0307415_100082431 | 3300032126 | Bacteria | 2301 |
| 714 | Ga0307415_100191310 | 3300032126 | Bacteria | 1615 |
| 715 | Ga0307415_100229659 | 3300032126 | Bacteria | 1493 |
| 716 | Ga0307415_100499817 | 3300032126 | Bacteria | 1063 |
| 717 | Ga0307415_100534689 | 3300032126 | Bacteria | 1031 |
| 718 | Ga0307415_101294694 | 3300032126 | Bacteria | 690 |
| 719 | Ga0316583_10064237 | 3300032133 | Unclassified | 1285 |
| 720 | Ga0373948_0036000 | 3300034817 | Bacteria | 1018 |
| 721 | Ga0373929_0000008 | 3300035085 | Bacteria | 298561 |
| 722 | Ga0373929_0001933 | 3300035085 | Bacteria | 3876 |
| 723 | Ga0373929_0010886 | 3300035085 | Bacteria | 1705 |
| 724 | Ga0373949_0003001 | 3300035090 | Bacteria | 4145 |
| 725 | Ga0373951_0002983 | 3300035091 | Bacteria | 4195 |
| 726 | Ga0373952_0010209 | 3300035092 | Bacteria | 1811 |
| 727 | Ga0373932_0001874 | 3300035112 | Bacteria | 5627 |
| 728 | Ga0373932_0116961 | 3300035112 | Unclassified | 885 |
| 729 | Ga0373939_0050909 | 3300035114 | Bacteria | 1286 |
| 730 | Ga0373941_0000689 | 3300035115 | Bacteria | 6870 |
| 731 | Ga0373941_0004348 | 3300035115 | Bacteria | 3266 |
| 732 | Ga0373960_0005466 | 3300035121 | Bacteria | 2945 |
| 733 | Ga0373942_0011614 | 3300035207 | Bacteria | 2091 |
| 734 | Ga0373961_0000425 | 3300035241 | Bacteria | 17488 |
| 735 | Ga0373961_0003054 | 3300035241 | Bacteria | 4212 |
| 736 | Ga0373962_0006858 | 3300035242 | Bacteria | 2773 |
| 737 | Ga0373962_0020160 | 3300035242 | Bacteria | 1749 |
| 738 | Ga0373962_0176029 | 3300035242 | Bacteria | 713 |
| 739 | Ga0373931_0005957 | 3300035691 | Bacteria | 5668 |
| 740 | Ga0373931_0013889 | 3300035691 | Bacteria | 3929 |
| 741 | Ga0373931_0065932 | 3300035691 | Bacteria | 1964 |
| 742 | Ga0373931_0078445 | 3300035691 | Bacteria | 1817 |
| 743 | Ga0373935_0810975 | 3300035692 | Unclassified | 691 |
| 744 | Ga0373947_0126634 | 3300035725 | Bacteria | 1627 |
| 745 | Ga0395899_0009205 | 3300037312 | Bacteria | 7584 |
| 746 | Ga0395899_0013482 | 3300037312 | Bacteria | 6249 |
| 747 | Ga0395899_0014372 | 3300037312 | Bacteria | 6044 |
| 748 | Ga0395899_0017690 | 3300037312 | Bacteria | 5429 |
| 749 | Ga0395899_0020071 | 3300037312 | Bacteria | 5070 |
| 750 | Ga0395899_0025092 | 3300037312 | Bacteria | 4501 |
| 751 | Ga0395899_0053111 | 3300037312 | Bacteria | 3001 |
| 752 | Ga0395899_0070601 | 3300037312 | Bacteria | 2556 |
| 753 | Ga0395899_0097457 | 3300037312 | Bacteria | 2126 |
| 754 | Ga0395899_0108426 | 3300037312 | Bacteria | 1998 |
| 755 | Ga0395899_0117893 | 3300037312 | Bacteria | 1904 |
| 756 | Ga0395899_0159560 | 3300037312 | Bacteria | 1594 |
| 757 | Ga0395899_0178205 | 3300037312 | Bacteria | 1493 |
| 758 | Ga0395899_0216038 | 3300037312 | Bacteria | 1330 |
| 759 | Ga0395900_0001263 | 3300037418 | Bacteria | 30958 |
| 760 | Ga0395900_0011737 | 3300037418 | Bacteria | 8957 |
| 761 | Ga0395900_0015802 | 3300037418 | Bacteria | 7694 |
| 762 | Ga0395900_0016029 | 3300037418 | Bacteria | 7635 |
| 763 | Ga0395900_0027139 | 3300037418 | Bacteria | 5862 |
| 764 | Ga0395900_0035139 | 3300037418 | Bacteria | 5163 |
| 765 | Ga0395900_0040863 | 3300037418 | Bacteria | 4780 |
| 766 | Ga0395900_0041226 | 3300037418 | Bacteria | 4760 |
| 767 | Ga0395900_0056727 | 3300037418 | Bacteria | 4031 |
| 768 | Ga0395900_0065413 | 3300037418 | Bacteria | 3735 |
| 769 | Ga0395900_0098219 | 3300037418 | Bacteria | 3008 |
| 770 | Ga0395900_0106115 | 3300037418 | Bacteria | 2885 |
| 771 | Ga0395900_0113159 | 3300037418 | Bacteria | 2785 |
| 772 | Ga0395900_0140192 | 3300037418 | Bacteria | 2476 |
| 773 | Ga0395900_0142711 | 3300037418 | Bacteria | 2451 |
| 774 | Ga0395900_0179388 | 3300037418 | Bacteria | 2153 |
| 775 | Ga0395900_0218136 | 3300037418 | Bacteria | 1924 |
| 776 | Ga0395900_0223040 | 3300037418 | Bacteria | 1899 |
| 777 | Ga0395900_0248420 | 3300037418 | Bacteria | 1781 |
| 778 | Ga0395900_0250179 | 3300037418 | Bacteria | 1774 |
| 779 | Ga0395900_0256178 | 3300037418 | Bacteria | 1749 |
| 780 | Ga0395900_0350431 | 3300037418 | Bacteria | 1450 |
| 781 | Ga0395900_0369851 | 3300037418 | Bacteria | 1403 |
| 782 | Ga0395900_0378871 | 3300037418 | Bacteria | 1383 |
| 783 | Ga0395900_0446469 | 3300037418 | Bacteria | 1250 |
| 784 | Ga0395900_0591880 | 3300037418 | Bacteria | 1050 |
| 785 | Ga0395898_0000795 | 3300037466 | Bacteria | 53570 |
| 786 | Ga0395898_0002292 | 3300037466 | Bacteria | 23000 |
| 787 | Ga0395898_0005555 | 3300037466 | Bacteria | 13599 |
| 788 | Ga0395898_0006822 | 3300037466 | Bacteria | 12142 |
| 789 | Ga0395898_0018229 | 3300037466 | Bacteria | 7161 |
| 790 | Ga0395898_0018559 | 3300037466 | Bacteria | 7091 |
| 791 | Ga0395898_0020122 | 3300037466 | Bacteria | 6780 |
| 792 | Ga0395898_0024209 | 3300037466 | Bacteria | 6125 |
| 793 | Ga0395898_0031257 | 3300037466 | Bacteria | 5322 |
| 794 | Ga0395898_0041411 | 3300037466 | Bacteria | 4549 |
| 795 | Ga0395898_0055457 | 3300037466 | Bacteria | 3865 |
| 796 | Ga0395898_0067582 | 3300037466 | Bacteria | 3460 |
| 797 | Ga0395898_0086767 | 3300037466 | Bacteria | 3015 |
| 798 | Ga0395898_0100355 | 3300037466 | Bacteria | 2780 |
| 799 | Ga0395898_0152830 | 3300037466 | Bacteria | 2208 |
| 800 | Ga0395898_0232401 | 3300037466 | Bacteria | 1758 |
| 801 | Ga0395898_0274394 | 3300037466 | Bacteria | 1608 |
| 802 | Ga0395898_0361869 | 3300037466 | Bacteria | 1383 |
| 803 | Ga0395898_0373678 | 3300037466 | Bacteria | 1359 |
| 804 | Ga0395898_0502531 | 3300037466 | Bacteria | 1153 |
| 805 | Ga0395898_0887478 | 3300037466 | Bacteria | 830 |
| 806 | Ga0395898_0890394 | 3300037466 | Bacteria | 828 |
| 807 | Ga0395898_0970095 | 3300037466 | Bacteria | 787 |
| 808 | Ga0395905_0001754 | 3300037471 | Bacteria | 25323 |
| 809 | Ga0395905_0008154 | 3300037471 | Bacteria | 10346 |
| 810 | Ga0395905_0009489 | 3300037471 | Bacteria | 9510 |
| 811 | Ga0395905_0045175 | 3300037471 | Bacteria | 4131 |
| 812 | Ga0395905_0051315 | 3300037471 | Bacteria | 3863 |
| 813 | Ga0395905_0101635 | 3300037471 | Bacteria | 2699 |
| 814 | Ga0395905_0128043 | 3300037471 | Bacteria | 2388 |
| 815 | Ga0395905_0138021 | 3300037471 | Bacteria | 2294 |
| 816 | Ga0395905_0188335 | 3300037471 | Bacteria | 1936 |
| 817 | Ga0395905_0215358 | 3300037471 | Bacteria | 1799 |
| 818 | Ga0395905_0629562 | 3300037471 | Bacteria | 975 |
| 819 | Ga0395905_0665904 | 3300037471 | Bacteria | 943 |
| 820 | Ga0395905_0725317 | 3300037471 | Bacteria | 896 |
| 821 | Ga0395905_0950274 | 3300037471 | Bacteria | 762 |
| 822 | Ga0395901_0003357 | 3300038443 | Bacteria | 16129 |
| 823 | Ga0395901_0003708 | 3300038443 | Bacteria | 15401 |
| 824 | Ga0395901_0008348 | 3300038443 | Bacteria | 10469 |
| 825 | Ga0395901_0009956 | 3300038443 | Bacteria | 9634 |
| 826 | Ga0395901_0013971 | 3300038443 | Bacteria | 8171 |
| 827 | Ga0395901_0016014 | 3300038443 | Bacteria | 7638 |
| 828 | Ga0395901_0016308 | 3300038443 | Bacteria | 7567 |
| 829 | Ga0395901_0021053 | 3300038443 | Bacteria | 6680 |
| 830 | Ga0395901_0024337 | 3300038443 | Bacteria | 6214 |
| 831 | Ga0395901_0051113 | 3300038443 | Bacteria | 4296 |
| 832 | Ga0395901_0053638 | 3300038443 | Bacteria | 4189 |
| 833 | Ga0395901_0056433 | 3300038443 | Bacteria | 4085 |
| 834 | Ga0395901_0082039 | 3300038443 | Bacteria | 3368 |
| 835 | Ga0395901_0085355 | 3300038443 | Bacteria | 3300 |
| 836 | Ga0395901_0085853 | 3300038443 | Bacteria | 3290 |
| 837 | Ga0395901_0087776 | 3300038443 | Bacteria | 3252 |
| 838 | Ga0395901_0091646 | 3300038443 | Bacteria | 3181 |
| 839 | Ga0395901_0092079 | 3300038443 | Bacteria | 3173 |
| 840 | Ga0395901_0142606 | 3300038443 | Bacteria | 2518 |
| 841 | Ga0395901_0152876 | 3300038443 | Bacteria | 2424 |
| 842 | Ga0395901_0160495 | 3300038443 | Bacteria | 2361 |
| 843 | Ga0395901_0202777 | 3300038443 | Bacteria | 2079 |
| 844 | Ga0395901_0230542 | 3300038443 | Bacteria | 1933 |
| 845 | Ga0395901_0271436 | 3300038443 | Bacteria | 1764 |
| 846 | Ga0395901_0277332 | 3300038443 | Bacteria | 1743 |
| 847 | Ga0395901_0349681 | 3300038443 | Bacteria | 1525 |
| 848 | Ga0395901_0364943 | 3300038443 | Bacteria | 1488 |
| 849 | Ga0395901_0386202 | 3300038443 | Bacteria | 1440 |
| 850 | Ga0395901_0419350 | 3300038443 | Bacteria | 1373 |
| 851 | Ga0395901_0422654 | 3300038443 | Bacteria | 1366 |
| 852 | Ga0395901_0422805 | 3300038443 | Bacteria | 1366 |
| 853 | Ga0395901_0510835 | 3300038443 | Bacteria | 1222 |
| 854 | Ga0395901_0524317 | 3300038443 | Bacteria | 1203 |
| 855 | Ga0395901_1084680 | 3300038443 | Bacteria | 772 |
| 856 | Ga0395901_1148773 | 3300038443 | Bacteria | 745 |
| 857 | Ga0395901_1161623 | 3300038443 | Bacteria | 739 |
| 858 | Ga0395901_1185782 | 3300038443 | Bacteria | 730 |
| 859 | Ga0395901_1418546 | 3300038443 | Bacteria | 652 |
| 860 | Ga0242420_017464 | 3300038996 | Bacteria | 1256 |
| 861 | Ga0242420_033140 | 3300038996 | Bacteria | 965 |
| 862 | Ga0436365_1112078 | 3300039437 | Bacteria | 1796 |
| 863 | Ga0436360_0817146 | 3300039438 | Bacteria | 4150 |
| 864 | Ga0436362_0193206 | 3300039453 | Bacteria | 728 |
| 865 | Ga0439436_0003181 | 3300041404 | Bacteria | 4979 |
| 866 | Ga0439436_0024523 | 3300041404 | Bacteria | 1780 |
| 867 | Ga0439438_001298 | 3300041405 | Bacteria | 11055 |
| 868 | Ga0439438_045989 | 3300041405 | Bacteria | 1122 |
| 869 | Ga0439439_0002905 | 3300041406 | Bacteria | 3723 |
| 870 | Ga0439461_0000713 | 3300041410 | Bacteria | 4842 |
| 871 | Ga0439466_0007871 | 3300041411 | Bacteria | 4022 |
| 872 | Ga0439466_0022763 | 3300041411 | Bacteria | 2209 |
| 873 | Ga0451789_1064853 | 3300041443 | Bacteria | 835 |
| 874 | Ga0451797_0102084 | 3300041453 | Bacteria | 659 |
| 875 | Ga0451797_1111866 | 3300041453 | Bacteria | 959 |
| 876 | Ga0451802_1776733 | 3300041460 | Unclassified | 725 |
| 877 | Ga0451807_0155102 | 3300041486 | Bacteria | 599 |
| 878 | Ga0451807_1961644 | 3300041486 | Bacteria | 2528 |
| 879 | Ga0451807_2346038 | 3300041486 | Bacteria | 1744 |
| 880 | Ga0451835_0543550 | 3300041492 | Bacteria | 1770 |
| 881 | Ga0451839_0581077 | 3300041496 | Bacteria | 4068 |
| 882 | Ga0451847_0773695 | 3300041503 | Unclassified | 710 |
| 883 | Ga0451849_1358585 | 3300041505 | Bacteria | 1470 |
| 884 | Ga0451849_1483773 | 3300041505 | Bacteria | 2585 |
| 885 | Ga0451843_0519664 | 3300041509 | Unclassified | 1480 |
| 886 | Ga0451855_0835047 | 3300041511 | Bacteria | 1375 |
| 887 | Ga0451855_1460886 | 3300041511 | Bacteria | 716 |
| 888 | Ga0451853_0870872 | 3300041512 | Unclassified | 806 |
| 889 | Ga0451853_1343855 | 3300041512 | Bacteria | 751 |
| 890 | Ga0451853_1819789 | 3300041512 | Bacteria | 1080 |
| 891 | Ga0451853_2510936 | 3300041512 | Bacteria | 1487 |
| 892 | Ga0451853_3695274 | 3300041512 | Bacteria | 1163 |
| 893 | Ga0439433_0000133 | 3300041999 | Bacteria | 11002 |
| 894 | Ga0439433_0016104 | 3300041999 | Bacteria | 1653 |
| 895 | Ga0439442_003160 | 3300042002 | Bacteria | 3259 |
| 896 | Ga0439442_006217 | 3300042002 | Bacteria | 2395 |
| 897 | Ga0439442_017543 | 3300042002 | Bacteria | 1477 |
| 898 | Ga0439442_034164 | 3300042002 | Bacteria | 1063 |
| 899 | Ga0439432_000702 | 3300042006 | Bacteria | 12536 |
| 900 | Ga0439449_0000267 | 3300042007 | Bacteria | 18795 |
| 901 | Ga0439449_0005707 | 3300042007 | Bacteria | 4758 |
| 902 | Ga0439449_0027218 | 3300042007 | Bacteria | 2133 |
| 903 | Ga0439449_0040295 | 3300042007 | Bacteria | 1736 |
| 904 | Ga0439451_008645 | 3300042009 | Bacteria | 2064 |
| 905 | Ga0439452_000706 | 3300042010 | Bacteria | 16293 |
| 906 | Ga0439454_000546 | 3300042011 | Bacteria | 3088 |
| 907 | Ga0439454_016557 | 3300042011 | Bacteria | 1044 |
| 908 | Ga0439457_002732 | 3300042014 | Bacteria | 4959 |
| 909 | Ga0439457_014431 | 3300042014 | Bacteria | 1768 |
| 910 | Ga0439462_0005141 | 3300042015 | Bacteria | 3212 |
| 911 | Ga0450911_005829 | 3300042115 | Bacteria | 1879 |
| 912 | Ga0450913_020486 | 3300042117 | Bacteria | 604 |
| 913 | Ga0450919_010325 | 3300042121 | Bacteria | 1068 |
| 914 | Ga0450920_000295 | 3300042122 | Bacteria | 7557 |
| 915 | Ga0450920_000669 | 3300042122 | Bacteria | 5484 |
| 916 | Ga0450897_009819 | 3300042128 | Bacteria | 912 |
| 917 | Ga0450906_029724 | 3300042145 | Bacteria | 966 |
| 918 | Ga0439446_0004453 | 3300042156 | Bacteria | 3552 |
| 919 | Ga0450908_001583 | 3300042184 | Bacteria | 4422 |
| 920 | Ga0439434_0022050 | 3300042435 | Bacteria | 1914 |
| 921 | Ga0439444_0093361 | 3300042437 | Bacteria | 674 |
| 922 | Ga0450918_032822 | 3300042531 | Bacteria | 919 |
| 923 | Ga0450893_0032163 | 3300042532 | Bacteria | 939 |
| 924 | Ga0451577_0025642 | 3300042876 | Bacteria | 5348 |
| 925 | Ga0439440_0123077 | 3300042993 | Bacteria | 724 |
| 926 | Ga0466972_0520052 | 3300044658 | Unclassified | 561 |
| 927 | Ga0466965_0174223 | 3300044683 | Bacteria | 1133 |
| 928 | Ga0466966_0379690 | 3300044684 | Bacteria | 849 |
| 929 | Ga0466961_0077795 | 3300044693 | Bacteria | 2101 |
| 930 | Ga0466963_0001595 | 3300044694 | Bacteria | 12321 |
| 931 | Ga0466963_0018211 | 3300044694 | Bacteria | 4387 |
| 932 | Ga0466963_0024634 | 3300044694 | Bacteria | 3831 |
| 933 | Ga0466964_0013917 | 3300044706 | Bacteria | 3055 |
| 934 | Ga0466964_0148855 | 3300044706 | Bacteria | 1083 |
| 935 | Ga0453684_0044176 | 3300044712 | Bacteria | 5970 |
| 936 | Ga0453684_0707931 | 3300044712 | Bacteria | 1094 |
| 937 | Ga0466968_0022051 | 3300044735 | Bacteria | 2585 |
| 938 | Ga0466970_0017892 | 3300044765 | Bacteria | 3665 |
| 939 | Ga0466970_0142624 | 3300044765 | Bacteria | 1320 |
| 940 | Ga0466970_0169428 | 3300044765 | Bacteria | 1210 |
| 941 | Ga0466957_0050530 | 3300044842 | Bacteria | 2530 |
| 942 | Ga0466960_0003429 | 3300044901 | Bacteria | 6097 |
| 943 | Ga0466960_0016338 | 3300044901 | Bacteria | 3217 |
| 944 | Ga0466958_0482519 | 3300045836 | Bacteria | 804 |
| 945 | Ga0466967_0000028 | 3300045976 | Bacteria | 59545 |
| 946 | Ga0466967_0001037 | 3300045976 | Bacteria | 15243 |
| 947 | Ga0466967_0015794 | 3300045976 | Bacteria | 5931 |
| 948 | Ga0466967_1026256 | 3300045976 | Bacteria | 821 |
| 949 | Ga0495592_0029720 | 3300046454 | Bacteria | 4137 |
| 950 | Ga0495603_0022783 | 3300046455 | Bacteria | 3790 |
| 951 | Ga0495603_0152852 | 3300046455 | Bacteria | 1340 |
| 952 | Ga0495603_0176632 | 3300046455 | Bacteria | 1236 |
| 953 | Ga0495590_0099476 | 3300046457 | Bacteria | 1033 |
| 954 | Ga0495590_0159729 | 3300046457 | Bacteria | 819 |
| 955 | Ga0495629_0043473 | 3300046459 | Bacteria | 3154 |
| 956 | Ga0495629_0120149 | 3300046459 | Bacteria | 1830 |
| 957 | Ga0495641_0013713 | 3300046461 | Bacteria | 4432 |
| 958 | Ga0495651_0057234 | 3300046462 | Bacteria | 2993 |
| 959 | Ga0495653_0000468 | 3300046463 | Bacteria | 31243 |
| 960 | Ga0495653_0031269 | 3300046463 | Bacteria | 4232 |
| 961 | Ga0495580_0237772 | 3300046472 | Bacteria | 1249 |
| 962 | Ga0495582_0029166 | 3300046473 | Bacteria | 3029 |
| 963 | Ga0495582_0071781 | 3300046473 | Bacteria | 1915 |
| 964 | Ga0495582_0266851 | 3300046473 | Bacteria | 982 |
| 965 | Ga0495582_0533634 | 3300046473 | Bacteria | 679 |
| 966 | Ga0495605_0050585 | 3300046474 | Bacteria | 2027 |
| 967 | Ga0495605_0289369 | 3300046474 | Bacteria | 695 |
| 968 | Ga0495605_0310538 | 3300046474 | Bacteria | 666 |
| 969 | Ga0495639_0002895 | 3300046475 | Bacteria | 7472 |
| 970 | Ga0495639_0220327 | 3300046475 | Bacteria | 933 |
| 971 | Ga0495662_0055307 | 3300046476 | Bacteria | 1917 |
| 972 | Ga0495662_0076298 | 3300046476 | Bacteria | 1627 |
| 973 | Ga0495664_0053009 | 3300046477 | Bacteria | 2412 |
| 974 | Ga0495584_0080076 | 3300046491 | Bacteria | 1643 |
| 975 | Ga0495584_0090453 | 3300046491 | Bacteria | 1543 |
| 976 | Ga0495584_0437258 | 3300046491 | Bacteria | 665 |
| 977 | Ga0495585_0169633 | 3300046492 | Bacteria | 1128 |
| 978 | Ga0495585_0349262 | 3300046492 | Bacteria | 719 |
| 979 | Ga0495594_0048752 | 3300046499 | Bacteria | 2327 |
| 980 | Ga0495594_0066109 | 3300046499 | Bacteria | 2006 |
| 981 | Ga0495596_0177482 | 3300046500 | Bacteria | 828 |
| 982 | Ga0495608_0130158 | 3300046511 | Bacteria | 1611 |
| 983 | Ga0495608_0140439 | 3300046511 | Bacteria | 1542 |
| 984 | Ga0495618_0031364 | 3300046514 | Bacteria | 3325 |
| 985 | Ga0495618_0198257 | 3300046514 | Bacteria | 1271 |
| 986 | Ga0495630_0006446 | 3300046517 | Bacteria | 8348 |
| 987 | Ga0495630_0065030 | 3300046517 | Bacteria | 2741 |
| 988 | Ga0495630_0925674 | 3300046517 | Bacteria | 664 |
| 989 | Ga0495631_0053942 | 3300046518 | Bacteria | 1754 |
| 990 | Ga0495631_0209104 | 3300046518 | Bacteria | 834 |
| 991 | Ga0495663_0008411 | 3300046525 | Bacteria | 2859 |
| 992 | Ga0495663_0019481 | 3300046525 | Bacteria | 1943 |
| 993 | Ga0495666_0074730 | 3300046526 | Bacteria | 1607 |
| 994 | Ga0495642_0064715 | 3300046528 | Bacteria | 1521 |
| 995 | Ga0495642_0271076 | 3300046528 | Bacteria | 743 |
| 996 | Ga0495665_0000658 | 3300046531 | Bacteria | 17722 |
| 997 | Ga0495665_0030148 | 3300046531 | Bacteria | 2903 |
| 998 | Ga0495640_0448158 | 3300046533 | Bacteria | 789 |
| 999 | Ga0495586_0187369 | 3300046535 | Bacteria | 1171 |
| 1000 | Ga0495586_0192398 | 3300046535 | Bacteria | 1155 |
| 1001 | Ga0495587_0003469 | 3300046536 | Bacteria | 10505 |
| 1002 | Ga0495609_0020981 | 3300046538 | Bacteria | 3015 |
| 1003 | Ga0495597_0245477 | 3300046542 | Bacteria | 705 |
| 1004 | Ga0495645_0008819 | 3300046543 | Bacteria | 7043 |
| 1005 | Ga0495645_0151015 | 3300046543 | Bacteria | 1614 |
| 1006 | Ga0495667_0031825 | 3300046559 | Bacteria | 3537 |
| 1007 | Ga0495667_0102772 | 3300046559 | Bacteria | 1848 |
| 1008 | Ga0495667_0474424 | 3300046559 | Bacteria | 785 |
| 1009 | Ga0495656_0015894 | 3300046615 | Bacteria | 2849 |
| 1010 | Ga0495656_0061734 | 3300046615 | Bacteria | 1638 |
| 1011 | Ga0495656_0069947 | 3300046615 | Bacteria | 1556 |
| 1012 | Ga0495668_0063832 | 3300046616 | Bacteria | 2028 |
| 1013 | Ga0495668_0406748 | 3300046616 | Bacteria | 748 |
| 1014 | Ga0495634_0116227 | 3300046642 | Bacteria | 1716 |
| 1015 | Ga0495611_0054018 | 3300046648 | Bacteria | 1815 |
| 1016 | Ga0495611_0086887 | 3300046648 | Bacteria | 1443 |
| 1017 | Ga0495611_0353727 | 3300046648 | Bacteria | 674 |
| 1018 | Ga0495635_0367315 | 3300046663 | Bacteria | 959 |
| 1019 | Ga0495659_0002547 | 3300046664 | Bacteria | 5877 |
| 1020 | Ga0495659_0006374 | 3300046664 | Bacteria | 3725 |
| 1021 | Ga0495588_0070652 | 3300046674 | Bacteria | 1815 |
| 1022 | Ga0495588_0094490 | 3300046674 | Bacteria | 1567 |
| 1023 | Ga0495588_0139940 | 3300046674 | Bacteria | 1278 |
| 1024 | Ga0495588_0185781 | 3300046674 | Bacteria | 1098 |
| 1025 | Ga0495657_0044514 | 3300046675 | Bacteria | 3019 |
| 1026 | Ga0495657_0051705 | 3300046675 | Bacteria | 2758 |
| 1027 | Ga0495657_0423173 | 3300046675 | Bacteria | 782 |
| 1028 | Ga0495599_0141266 | 3300046678 | Bacteria | 1494 |
| 1029 | Ga0495623_0008339 | 3300046679 | Bacteria | 6739 |
| 1030 | Ga0495647_0065692 | 3300046681 | Bacteria | 1441 |
| 1031 | Ga0495658_0005078 | 3300046683 | Bacteria | 6467 |
| 1032 | Ga0495658_0027216 | 3300046683 | Bacteria | 3074 |
| 1033 | Ga0495613_0003796 | 3300046689 | Bacteria | 11323 |
| 1034 | Ga0495613_0128807 | 3300046689 | Bacteria | 1813 |
| 1035 | Ga0495613_0277417 | 3300046689 | Bacteria | 1165 |
| 1036 | Ga0495624_0011307 | 3300046690 | Bacteria | 6136 |
| 1037 | Ga0495670_0002814 | 3300046691 | Bacteria | 8607 |
| 1038 | Ga0495670_0508902 | 3300046691 | Bacteria | 654 |
| 1039 | Ga0495671_0352538 | 3300046692 | Bacteria | 706 |
| 1040 | Ga0495600_0180032 | 3300046809 | Bacteria | 1362 |
| 1041 | Ga0495600_0208952 | 3300046809 | Bacteria | 1251 |
| 1042 | Ga0495581_0001440 | 3300047315 | Bacteria | 13209 |
| 1043 | Ga0495581_0007081 | 3300047315 | Bacteria | 6494 |
| 1044 | Ga0495581_0071127 | 3300047315 | Bacteria | 2013 |
| 1045 | Ga0495604_0064049 | 3300047317 | Bacteria | 2803 |
| 1046 | Ga0495636_0012871 | 3300047318 | Bacteria | 3316 |
| 1047 | Ga0495636_0144520 | 3300047318 | Bacteria | 1064 |
| 1048 | Ga0495674_0020283 | 3300047319 | Bacteria | 6156 |
| 1049 | Ga0495674_0086940 | 3300047319 | Bacteria | 2676 |
| 1050 | Ga0495674_0256009 | 3300047319 | Bacteria | 1439 |
| 1051 | Ga0495676_0056472 | 3300047321 | Bacteria | 3104 |
| 1052 | Ga0495680_0039805 | 3300047322 | Bacteria | 3747 |
| 1053 | Ga0495680_0086203 | 3300047322 | Bacteria | 2363 |
| 1054 | Ga0495680_0238366 | 3300047322 | Bacteria | 1293 |
| 1055 | Ga0495675_0235890 | 3300047444 | Bacteria | 1102 |
| 1056 | Ga0495677_0036129 | 3300047445 | Bacteria | 1804 |
| 1057 | Ga0495677_0120551 | 3300047445 | Bacteria | 1000 |
| 1058 | Ga0495681_0113294 | 3300047470 | Bacteria | 1172 |
| 1059 | Ga0495684_0032299 | 3300047471 | Bacteria | 4018 |
| 1060 | Ga0495602_0279561 | 3300048088 | Bacteria | 1230 |
| 1061 | Ga0495626_0167153 | 3300048091 | Bacteria | 919 |
| 1062 | Ga0496100_0004896 | 3300048903 | Bacteria | 7157 |
| 1063 | Ga0496100_0014091 | 3300048903 | Bacteria | 4634 |
| 1064 | Ga0496100_0018966 | 3300048903 | Bacteria | 4094 |
| 1065 | Ga0496100_0079001 | 3300048903 | Bacteria | 2216 |
| 1066 | Ga0496100_0442488 | 3300048903 | Bacteria | 995 |
| 1067 | Ga0496101_0008894 | 3300048904 | Bacteria | 6577 |
| 1068 | Ga0496101_0016013 | 3300048904 | Bacteria | 5060 |
| 1069 | Ga0496101_0025311 | 3300048904 | Bacteria | 4116 |
| 1070 | Ga0496101_0224918 | 3300048904 | Bacteria | 1457 |
| 1071 | Ga0496101_0239064 | 3300048904 | Bacteria | 1413 |
| 1072 | Ga0496101_0491685 | 3300048904 | Bacteria | 969 |
| 1073 | Ga0496102_0018764 | 3300048905 | Bacteria | 6083 |
| 1074 | Ga0496102_0019938 | 3300048905 | Bacteria | 5915 |
| 1075 | Ga0496102_0192977 | 3300048905 | Bacteria | 1919 |
| 1076 | Ga0496102_0228941 | 3300048905 | Bacteria | 1752 |
| 1077 | Ga0496102_0945920 | 3300048905 | Bacteria | 783 |
| 1078 | Ga0496103_0002999 | 3300048906 | Bacteria | 10434 |
| 1079 | Ga0496103_0016111 | 3300048906 | Bacteria | 4460 |
| 1080 | Ga0496103_0059187 | 3300048906 | Bacteria | 2380 |
| 1081 | Ga0496103_0135530 | 3300048906 | Bacteria | 1573 |
| 1082 | Ga0496103_0343106 | 3300048906 | Bacteria | 960 |
| 1083 | Ga0496104_0012176 | 3300048907 | Bacteria | 7725 |
| 1084 | Ga0496104_0020628 | 3300048907 | Bacteria | 6043 |
| 1085 | Ga0496104_0023001 | 3300048907 | Bacteria | 5728 |
| 1086 | Ga0496104_0189050 | 3300048907 | Bacteria | 1970 |
| 1087 | Ga0496104_0338271 | 3300048907 | Bacteria | 1418 |
| 1088 | Ga0496105_0025687 | 3300048908 | Bacteria | 4797 |
| 1089 | Ga0496105_0040567 | 3300048908 | Bacteria | 3838 |
| 1090 | Ga0496105_0087548 | 3300048908 | Bacteria | 2573 |
| 1091 | Ga0496105_0252189 | 3300048908 | Bacteria | 1429 |
| 1092 | Ga0496105_0538305 | 3300048908 | Bacteria | 913 |
| 1093 | Ga0496105_0541858 | 3300048908 | Bacteria | 909 |
| 1094 | Ga0496105_0599920 | 3300048908 | Bacteria | 855 |
| 1095 | Ga0496106_0009515 | 3300048909 | Bacteria | 7179 |
| 1096 | Ga0496106_0032549 | 3300048909 | Bacteria | 3888 |
| 1097 | Ga0496106_0152759 | 3300048909 | Bacteria | 1822 |
| 1098 | Ga0496106_0174141 | 3300048909 | Bacteria | 1707 |
| 1099 | Ga0496106_0243879 | 3300048909 | Bacteria | 1436 |
| 1100 | Ga0496106_0423164 | 3300048909 | Bacteria | 1070 |
| 1101 | Ga0496106_0599037 | 3300048909 | Bacteria | 882 |
| 1102 | Ga0496107_0034036 | 3300048910 | Bacteria | 3646 |
| 1103 | Ga0496107_0134688 | 3300048910 | Bacteria | 1825 |
| 1104 | Ga0496107_0203368 | 3300048910 | Bacteria | 1472 |
| 1105 | Ga0496108_0005647 | 3300048911 | Bacteria | 10131 |
| 1106 | Ga0496108_0020153 | 3300048911 | Bacteria | 5480 |
| 1107 | Ga0496108_0024660 | 3300048911 | Bacteria | 4954 |
| 1108 | Ga0496108_0030496 | 3300048911 | Bacteria | 4469 |
| 1109 | Ga0496108_0105497 | 3300048911 | Bacteria | 2406 |
| 1110 | Ga0496108_0142051 | 3300048911 | Bacteria | 2068 |
| 1111 | Ga0496108_0149193 | 3300048911 | Bacteria | 2017 |
| 1112 | Ga0496108_0221419 | 3300048911 | Bacteria | 1644 |
| 1113 | Ga0496108_0366804 | 3300048911 | Bacteria | 1257 |
| 1114 | Ga0496108_0517678 | 3300048911 | Bacteria | 1041 |
| 1115 | Ga0496109_0000913 | 3300048912 | Bacteria | 24554 |
| 1116 | Ga0496109_0011225 | 3300048912 | Bacteria | 7690 |
| 1117 | Ga0496109_0045636 | 3300048912 | Bacteria | 3977 |
| 1118 | Ga0496109_0048258 | 3300048912 | Bacteria | 3874 |
| 1119 | Ga0496109_0050316 | 3300048912 | Bacteria | 3795 |
| 1120 | Ga0496109_0068168 | 3300048912 | Bacteria | 3261 |
| 1121 | Ga0496109_0072125 | 3300048912 | Bacteria | 3171 |
| 1122 | Ga0496109_0122267 | 3300048912 | Bacteria | 2425 |
| 1123 | Ga0496109_0174949 | 3300048912 | Bacteria | 2014 |
| 1124 | Ga0496109_0178720 | 3300048912 | Bacteria | 1992 |
| 1125 | Ga0496109_1006068 | 3300048912 | Bacteria | 771 |
| 1126 | Ga0496110_0003661 | 3300048913 | Bacteria | 11828 |
| 1127 | Ga0496110_0008390 | 3300048913 | Bacteria | 8312 |
| 1128 | Ga0496110_0034761 | 3300048913 | Bacteria | 4368 |
| 1129 | Ga0496110_0074161 | 3300048913 | Bacteria | 3021 |
| 1130 | Ga0496110_0085681 | 3300048913 | Bacteria | 2812 |
| 1131 | Ga0496110_0176871 | 3300048913 | Bacteria | 1937 |
| 1132 | Ga0496110_0343249 | 3300048913 | Bacteria | 1360 |
| 1133 | Ga0496110_0356231 | 3300048913 | Bacteria | 1333 |
| 1134 | Ga0496110_0483492 | 3300048913 | Bacteria | 1128 |
| 1135 | Ga0496110_0527959 | 3300048913 | Bacteria | 1073 |
| 1136 | Ga0496110_0732284 | 3300048913 | Bacteria | 891 |
| 1137 | Ga0496110_0845802 | 3300048913 | Bacteria | 820 |
| 1138 | Ga0496110_1165479 | 3300048913 | Bacteria | 679 |
| 1139 | Ga0496111_0003623 | 3300048914 | Bacteria | 9573 |
| 1140 | Ga0496111_0003720 | 3300048914 | Bacteria | 9492 |
| 1141 | Ga0496111_0010934 | 3300048914 | Bacteria | 6105 |
| 1142 | Ga0496111_0018694 | 3300048914 | Bacteria | 4804 |
| 1143 | Ga0496111_0036855 | 3300048914 | Bacteria | 3497 |
| 1144 | Ga0496111_0043737 | 3300048914 | Bacteria | 3220 |
| 1145 | Ga0496111_0044395 | 3300048914 | Bacteria | 3195 |
| 1146 | Ga0496111_0064517 | 3300048914 | Bacteria | 2657 |
| 1147 | Ga0496111_0078428 | 3300048914 | Bacteria | 2408 |
| 1148 | Ga0496111_0089871 | 3300048914 | Bacteria | 2250 |
| 1149 | Ga0496111_0158427 | 3300048914 | Bacteria | 1680 |
| 1150 | Ga0496111_0476003 | 3300048914 | Bacteria | 920 |
| 1151 | Ga0496112_0006002 | 3300048915 | Bacteria | 10601 |
| 1152 | Ga0496112_0018396 | 3300048915 | Bacteria | 6577 |
| 1153 | Ga0496112_0020095 | 3300048915 | Bacteria | 6323 |
| 1154 | Ga0496112_0034386 | 3300048915 | Bacteria | 4932 |
| 1155 | Ga0496112_0114368 | 3300048915 | Bacteria | 2669 |
| 1156 | Ga0496112_0118964 | 3300048915 | Bacteria | 2612 |
| 1157 | Ga0496112_0150253 | 3300048915 | Bacteria | 2296 |
| 1158 | Ga0496112_0368599 | 3300048915 | Bacteria | 1378 |
| 1159 | Ga0496112_0479672 | 3300048915 | Bacteria | 1180 |
| 1160 | Ga0496112_0596768 | 3300048915 | Bacteria | 1036 |
| 1161 | Ga0496112_1086817 | 3300048915 | Bacteria | 718 |
| 1162 | Ga0496112_1377050 | 3300048915 | Bacteria | 620 |
| 1163 | Ga0496113_0003267 | 3300048916 | Bacteria | 9670 |
| 1164 | Ga0496113_0042109 | 3300048916 | Bacteria | 3373 |
| 1165 | Ga0496113_0116988 | 3300048916 | Bacteria | 2080 |
| 1166 | Ga0496113_0178607 | 3300048916 | Bacteria | 1682 |
| 1167 | Ga0496113_0196438 | 3300048916 | Bacteria | 1603 |
| 1168 | Ga0496113_0644727 | 3300048916 | Bacteria | 847 |
| 1169 | Ga0496114_0000073 | 3300048917 | Bacteria | 71711 |
| 1170 | Ga0496114_0010517 | 3300048917 | Bacteria | 7364 |
| 1171 | Ga0496114_0012084 | 3300048917 | Bacteria | 6909 |
| 1172 | Ga0496114_0034641 | 3300048917 | Bacteria | 4166 |
| 1173 | Ga0496114_0066003 | 3300048917 | Bacteria | 3033 |
| 1174 | Ga0496114_0119666 | 3300048917 | Bacteria | 2264 |
| 1175 | Ga0496115_0057615 | 3300048918 | Bacteria | 3125 |
| 1176 | Ga0496115_0252868 | 3300048918 | Bacteria | 1450 |
| 1177 | Ga0496115_0412223 | 3300048918 | Bacteria | 1095 |
| 1178 | Ga0496115_0460898 | 3300048918 | Bacteria | 1025 |
| 1179 | Ga0496122_0000427 | 3300048925 | Bacteria | 88913 |
| 1180 | Ga0496123_0001011 | 3300048926 | Bacteria | 42966 |
| 1181 | Ga0496124_0002673 | 3300048927 | Bacteria | 22841 |
| 1182 | Ga0496125_0000558 | 3300048928 | Bacteria | 64136 |
| 1183 | Ga0496125_0138813 | 3300048928 | Bacteria | 1694 |
| 1184 | Ga0501317_026060 | 3300049533 | Bacteria | 823 |
| 1185 | Ga0501317_027196 | 3300049533 | Bacteria | 811 |
| 1186 | Ga0501324_010065 | 3300049540 | Bacteria | 857 |
| 1187 | Ga0501324_026137 | 3300049540 | Bacteria | 618 |
| 1188 | Ga0501031_0002646 | 3300049568 | Bacteria | 11395 |
| 1189 | Ga0501031_0004843 | 3300049568 | Bacteria | 8746 |
| 1190 | Ga0501031_0075736 | 3300049568 | Bacteria | 2191 |
| 1191 | Ga0501032_0000158 | 3300049569 | Bacteria | 54794 |
| 1192 | Ga0501032_0004426 | 3300049569 | Bacteria | 10590 |
| 1193 | Ga0501032_0175909 | 3300049569 | Bacteria | 1402 |
| 1194 | Ga0501032_0191664 | 3300049569 | Bacteria | 1336 |
| 1195 | Ga0501032_0325055 | 3300049569 | Bacteria | 992 |
| 1196 | Ga0501033_0007557 | 3300049570 | Bacteria | 8456 |
| 1197 | Ga0501033_0046670 | 3300049570 | Bacteria | 3221 |
| 1198 | Ga0501034_0000141 | 3300049571 | Bacteria | 134974 |
| 1199 | Ga0501036_0001775 | 3300049572 | Bacteria | 16746 |
| 1200 | Ga0501036_0035440 | 3300049572 | Bacteria | 4223 |
| 1201 | Ga0501036_0080888 | 3300049572 | Bacteria | 2746 |
| 1202 | Ga0501036_0146730 | 3300049572 | Bacteria | 1990 |
| 1203 | Ga0501038_0005105 | 3300049574 | Bacteria | 12201 |
| 1204 | Ga0501038_0010377 | 3300049574 | Bacteria | 8519 |
| 1205 | Ga0501038_0063650 | 3300049574 | Bacteria | 3147 |
| 1206 | Ga0501038_0119318 | 3300049574 | Bacteria | 2177 |
| 1207 | Ga0501038_0163802 | 3300049574 | Bacteria | 1805 |
| 1208 | Ga0501039_0027976 | 3300049575 | Bacteria | 4337 |
| 1209 | Ga0501039_0348588 | 3300049575 | Bacteria | 1163 |
| 1210 | Ga0501040_0006969 | 3300049576 | Bacteria | 7320 |
| 1211 | Ga0501040_0139350 | 3300049576 | Bacteria | 1708 |
| 1212 | Ga0501040_0144740 | 3300049576 | Bacteria | 1675 |
| 1213 | Ga0501040_0228509 | 3300049576 | Bacteria | 1325 |
| 1214 | Ga0501041_0008144 | 3300049577 | Bacteria | 6167 |
| 1215 | Ga0501041_0051941 | 3300049577 | Bacteria | 2499 |
| 1216 | Ga0501041_0070571 | 3300049577 | Bacteria | 2144 |
| 1217 | Ga0501041_0549791 | 3300049577 | Bacteria | 736 |
| 1218 | Ga0501042_0019090 | 3300049578 | Bacteria | 4757 |
| 1219 | Ga0501042_0024287 | 3300049578 | Bacteria | 4251 |
| 1220 | Ga0501042_0085537 | 3300049578 | Bacteria | 2261 |
| 1221 | Ga0501042_0090478 | 3300049578 | Bacteria | 2196 |
| 1222 | Ga0501042_0099943 | 3300049578 | Bacteria | 2085 |
| 1223 | Ga0501042_0310153 | 3300049578 | Bacteria | 1140 |
| 1224 | Ga0501042_1260572 | 3300049578 | Bacteria | 539 |
| 1225 | Ga0501043_0002861 | 3300049579 | Bacteria | 14412 |
| 1226 | Ga0501043_0018421 | 3300049579 | Bacteria | 5476 |
| 1227 | Ga0501043_0116703 | 3300049579 | Bacteria | 2094 |
| 1228 | Ga0501043_0128522 | 3300049579 | Bacteria | 1986 |
| 1229 | Ga0501043_0145751 | 3300049579 | Bacteria | 1854 |
| 1230 | Ga0501043_0804677 | 3300049579 | Unclassified | 680 |
| 1231 | Ga0501046_0008318 | 3300049580 | Bacteria | 9050 |
| 1232 | Ga0501046_0013675 | 3300049580 | Bacteria | 6863 |
| 1233 | Ga0501046_0243456 | 3300049580 | Bacteria | 1326 |
| 1234 | Ga0501047_0902762 | 3300049581 | Bacteria | 697 |
| 1235 | Ga0501048_0039171 | 3300049582 | Bacteria | 3400 |
| 1236 | Ga0501048_0119473 | 3300049582 | Bacteria | 1862 |
| 1237 | Ga0501048_0135899 | 3300049582 | Bacteria | 1737 |
| 1238 | Ga0501048_0148590 | 3300049582 | Bacteria | 1657 |
| 1239 | Ga0501048_0153913 | 3300049582 | Bacteria | 1626 |
| 1240 | Ga0501067_0026343 | 3300049583 | Bacteria | 3220 |
| 1241 | Ga0501067_0225698 | 3300049583 | Bacteria | 1043 |
| 1242 | Ga0501068_0000514 | 3300049584 | Bacteria | 19601 |
| 1243 | Ga0501068_0012529 | 3300049584 | Bacteria | 4812 |
| 1244 | Ga0501068_0040285 | 3300049584 | Bacteria | 2804 |
| 1245 | Ga0501068_0063650 | 3300049584 | Bacteria | 2243 |
| 1246 | Ga0501068_0203249 | 3300049584 | Bacteria | 1257 |
| 1247 | Ga0501068_0341923 | 3300049584 | Bacteria | 961 |
| 1248 | Ga0501069_0023524 | 3300049585 | Bacteria | 3360 |
| 1249 | Ga0501069_0060023 | 3300049585 | Bacteria | 2123 |
| 1250 | Ga0501069_0112565 | 3300049585 | Bacteria | 1551 |
| 1251 | Ga0501069_0192951 | 3300049585 | Bacteria | 1179 |
| 1252 | Ga0501070_0019413 | 3300049586 | Bacteria | 5699 |
| 1253 | Ga0501070_0021603 | 3300049586 | Bacteria | 5398 |
| 1254 | Ga0501070_0032073 | 3300049586 | Bacteria | 4398 |
| 1255 | Ga0501071_0003854 | 3300049587 | Bacteria | 9442 |
| 1256 | Ga0501071_0004163 | 3300049587 | Bacteria | 9154 |
| 1257 | Ga0501071_0012653 | 3300049587 | Bacteria | 5732 |
| 1258 | Ga0501071_0069995 | 3300049587 | Bacteria | 2555 |
| 1259 | Ga0501071_0178201 | 3300049587 | Bacteria | 1592 |
| 1260 | Ga0501071_0238836 | 3300049587 | Bacteria | 1370 |
| 1261 | Ga0501071_0250655 | 3300049587 | Bacteria | 1336 |
| 1262 | Ga0501072_0009755 | 3300049588 | Bacteria | 7301 |
| 1263 | Ga0501072_0023700 | 3300049588 | Bacteria | 4768 |
| 1264 | Ga0501072_0077038 | 3300049588 | Bacteria | 2639 |
| 1265 | Ga0501072_0088751 | 3300049588 | Bacteria | 2453 |
| 1266 | Ga0501072_0117070 | 3300049588 | Bacteria | 2122 |
| 1267 | Ga0501072_0161140 | 3300049588 | Bacteria | 1789 |
| 1268 | Ga0501072_0242432 | 3300049588 | Bacteria | 1436 |
| 1269 | Ga0501072_0333942 | 3300049588 | Bacteria | 1204 |
| 1270 | Ga0501072_1070794 | 3300049588 | Unclassified | 628 |
| 1271 | Ga0501073_0001537 | 3300049589 | Bacteria | 17091 |
| 1272 | Ga0501073_0007238 | 3300049589 | Bacteria | 8263 |
| 1273 | Ga0501073_0241273 | 3300049589 | Bacteria | 1248 |
| 1274 | Ga0501073_0323695 | 3300049589 | Bacteria | 1064 |
| 1275 | Ga0501074_0001777 | 3300049590 | Bacteria | 14742 |
| 1276 | Ga0501074_0003435 | 3300049590 | Bacteria | 11232 |
| 1277 | Ga0501074_0070397 | 3300049590 | Bacteria | 2515 |
| 1278 | Ga0501074_0153514 | 3300049590 | Bacteria | 1646 |
| 1279 | Ga0501074_0335740 | 3300049590 | Bacteria | 1073 |
| 1280 | Ga0501075_0000318 | 3300049591 | Bacteria | 26984 |
| 1281 | Ga0501075_0013143 | 3300049591 | Bacteria | 5902 |
| 1282 | Ga0501075_0033028 | 3300049591 | Bacteria | 3848 |
| 1283 | Ga0501075_0068115 | 3300049591 | Bacteria | 2688 |
| 1284 | Ga0501075_0217360 | 3300049591 | Bacteria | 1458 |
| 1285 | Ga0501075_0574982 | 3300049591 | Bacteria | 860 |
| 1286 | Ga0501076_0012413 | 3300049592 | Bacteria | 6366 |
| 1287 | Ga0501076_0030863 | 3300049592 | Bacteria | 4175 |
| 1288 | Ga0501076_0031835 | 3300049592 | Bacteria | 4115 |
| 1289 | Ga0501076_0043708 | 3300049592 | Bacteria | 3531 |
| 1290 | Ga0501076_0045049 | 3300049592 | Bacteria | 3481 |
| 1291 | Ga0501076_0129445 | 3300049592 | Bacteria | 2047 |
| 1292 | Ga0501076_0202578 | 3300049592 | Bacteria | 1621 |
| 1293 | Ga0501076_0489681 | 3300049592 | Bacteria | 1013 |
| 1294 | Ga0501077_0002406 | 3300049593 | Bacteria | 11229 |
| 1295 | Ga0501077_0033658 | 3300049593 | Bacteria | 3261 |
| 1296 | Ga0501077_0034848 | 3300049593 | Bacteria | 3204 |
| 1297 | Ga0501077_0046784 | 3300049593 | Bacteria | 2748 |
| 1298 | Ga0501077_0063333 | 3300049593 | Bacteria | 2346 |
| 1299 | Ga0501077_0101908 | 3300049593 | Bacteria | 1819 |
| 1300 | Ga0501227_033330 | 3300049665 | Bacteria | 1246 |
| 1301 | Ga0501247_009835 | 3300049677 | Unclassified | 1133 |
| 1302 | Ga0501253_022460 | 3300049683 | Bacteria | 1124 |
| 1303 | Ga0501079_0004813 | 3300049741 | Bacteria | 10003 |
| 1304 | Ga0501079_0004932 | 3300049741 | Bacteria | 9893 |
| 1305 | Ga0501079_0006316 | 3300049741 | Bacteria | 8888 |
| 1306 | Ga0501079_0139639 | 3300049741 | Bacteria | 1887 |
| 1307 | Ga0501079_0258634 | 3300049741 | Bacteria | 1361 |
| 1308 | Ga0501079_0317474 | 3300049741 | Bacteria | 1220 |
| 1309 | Ga0501079_0472073 | 3300049741 | Bacteria | 986 |
| 1310 | Ga0501079_0607053 | 3300049741 | Bacteria | 861 |
| 1311 | Ga0501079_0957743 | 3300049741 | Bacteria | 674 |
| 1312 | Ga0501080_0010019 | 3300049742 | Bacteria | 8663 |
| 1313 | Ga0501080_0025475 | 3300049742 | Bacteria | 5490 |
| 1314 | Ga0501080_0079970 | 3300049742 | Bacteria | 3038 |
| 1315 | Ga0501080_0097163 | 3300049742 | Bacteria | 2734 |
| 1316 | Ga0501080_0224667 | 3300049742 | Bacteria | 1717 |
| 1317 | Ga0501081_0010443 | 3300049743 | Bacteria | 6057 |
| 1318 | Ga0501081_0011323 | 3300049743 | Bacteria | 5836 |
| 1319 | Ga0501081_0031416 | 3300049743 | Bacteria | 3599 |
| 1320 | Ga0501081_0036589 | 3300049743 | Bacteria | 3348 |
| 1321 | Ga0501081_0107777 | 3300049743 | Bacteria | 1975 |
| 1322 | Ga0501081_0254567 | 3300049743 | Bacteria | 1282 |
| 1323 | Ga0501081_0271699 | 3300049743 | Bacteria | 1240 |
| 1324 | Ga0501083_0001510 | 3300049744 | Bacteria | 15903 |
| 1325 | Ga0501083_0002103 | 3300049744 | Bacteria | 13674 |
| 1326 | Ga0501083_0003155 | 3300049744 | Bacteria | 11469 |
| 1327 | Ga0501083_0005310 | 3300049744 | Bacteria | 9112 |
| 1328 | Ga0501083_0083373 | 3300049744 | Bacteria | 2118 |
| 1329 | Ga0501264_023486 | 3300049761 | Bacteria | 669 |
| 1330 | Ga0501279_003264 | 3300049775 | Bacteria | 2112 |
| 1331 | Ga0501035_0005138 | 3300049822 | Bacteria | 12384 |
| 1332 | Ga0501035_0157653 | 3300049822 | Bacteria | 1966 |
| 1333 | Ga0501035_0363860 | 3300049822 | Bacteria | 1208 |
| 1334 | Ga0501035_0475511 | 3300049822 | Bacteria | 1031 |
| 1335 | Ga0501044_0009712 | 3300049823 | Bacteria | 10468 |
| 1336 | Ga0501044_0057767 | 3300049823 | Bacteria | 3981 |
| 1337 | Ga0501045_0000615 | 3300049824 | Bacteria | 22479 |
| 1338 | Ga0501045_0004328 | 3300049824 | Bacteria | 9790 |
| 1339 | Ga0501045_0008281 | 3300049824 | Bacteria | 7238 |
| 1340 | Ga0501045_0193242 | 3300049824 | Bacteria | 1516 |
| 1341 | Ga0501045_0866228 | 3300049824 | Bacteria | 664 |
| 1342 | nmdc:mga03n38_9964_c1 | 3300050490 | Bacteria | 3477 |
| 1343 | nmdc:mga00v17_342506_c1 | 3300050491 | Bacteria | 972 |
| 1344 | nmdc:mga00v17_9451_c1 | 3300050491 | Bacteria | 5278 |
| 1345 | nmdc:mga0yw44_127178_c1 | 3300050492 | Bacteria | 1647 |
| 1346 | nmdc:mga0yw44_399598_c1 | 3300050492 | Bacteria | 929 |
| 1347 | nmdc:mga0yw44_52492_c1 | 3300050492 | Bacteria | 2472 |
| 1348 | nmdc:mga0yw44_712873_c1 | 3300050492 | Bacteria | 681 |
| 1349 | nmdc:mga05p37_1395582_c1 | 3300050507 | Bacteria | 706 |
| 1350 | nmdc:mga05p37_145010_c1 | 3300050507 | Bacteria | 2908 |
| 1351 | nmdc:mga05p37_1569855_c1 | 3300050507 | Bacteria | 650 |
| 1352 | nmdc:mga05p37_1635713_c1 | 3300050507 | Bacteria | 632 |
| 1353 | nmdc:mga05p37_178562_c1 | 3300050507 | Bacteria | 2585 |
| 1354 | nmdc:mga05p37_299781_c1 | 3300050507 | Bacteria | 1910 |
| 1355 | nmdc:mga05p37_479790_c1 | 3300050507 | Bacteria | 1432 |
| 1356 | nmdc:mga05p37_49969_c1 | 3300050507 | Bacteria | 5144 |
| 1357 | nmdc:mga05p37_600807_c1 | 3300050507 | Bacteria | 1242 |
| 1358 | nmdc:mga05p37_69160_c1 | 3300050507 | Bacteria | 4343 |
| 1359 | nmdc:mga09592_1010633_c1 | 3300050508 | Bacteria | 695 |
| 1360 | nmdc:mga09592_176122_c1 | 3300050508 | Bacteria | 1850 |
| 1361 | nmdc:mga09592_224529_c1 | 3300050508 | Bacteria | 1627 |
| 1362 | nmdc:mga09592_60186_c1 | 3300050508 | Bacteria | 3211 |
| 1363 | nmdc:mga09592_89167_c1 | 3300050508 | Bacteria | 2634 |
| 1364 | nmdc:mga0qj67_10209_c1 | 3300050509 | Bacteria | 7010 |
| 1365 | nmdc:mga0qj67_162012_c1 | 3300050509 | Bacteria | 1816 |
| 1366 | nmdc:mga0qj67_297864_c1 | 3300050509 | Bacteria | 1307 |
| 1367 | nmdc:mga0qj67_630985_c1 | 3300050509 | Bacteria | 856 |
| 1368 | nmdc:mga06r32_127606_c1 | 3300050510 | Bacteria | 2513 |
| 1369 | nmdc:mga06r32_188480_c1 | 3300050510 | Bacteria | 2050 |
| 1370 | nmdc:mga06r32_52748_c1 | 3300050510 | Bacteria | 3895 |
| 1371 | nmdc:mga06r32_81576_c1 | 3300050510 | Bacteria | 3150 |
| 1372 | nmdc:mga08y16_1029998_c1 | 3300050511 | Bacteria | 802 |
| 1373 | nmdc:mga08y16_111806_c1 | 3300050511 | Bacteria | 2844 |
| 1374 | nmdc:mga08y16_117153_c1 | 3300050511 | Bacteria | 2773 |
| 1375 | nmdc:mga08y16_156439_c1 | 3300050511 | Bacteria | 2368 |
| 1376 | nmdc:mga08y16_27126_c1 | 3300050511 | Bacteria | 6036 |
| 1377 | nmdc:mga08y16_50086_c1 | 3300050511 | Bacteria | 4371 |
| 1378 | nmdc:mga08y16_631467_c1 | 3300050511 | Bacteria | 1077 |
| 1379 | nmdc:mga08y16_80356_c1 | 3300050511 | Bacteria | 3399 |
| 1380 | nmdc:mga0n895_144540_c1 | 3300050512 | Bacteria | 2408 |
| 1381 | nmdc:mga0n895_147802_c1 | 3300050512 | Bacteria | 2380 |
| 1382 | nmdc:mga0n895_271932_c1 | 3300050512 | Unclassified | 1719 |
| 1383 | nmdc:mga0n895_300404_c1 | 3300050512 | Bacteria | 1627 |
| 1384 | nmdc:mga0n895_394614_c1 | 3300050512 | Bacteria | 1400 |
| 1385 | nmdc:mga0n895_639982_c1 | 3300050512 | Bacteria | 1063 |
| 1386 | nmdc:mga0n895_66856_c1 | 3300050512 | Bacteria | 3559 |
| 1387 | nmdc:mga0n895_70967_c1 | 3300050512 | Bacteria | 3453 |
| 1388 | nmdc:mga0n895_712362_c1 | 3300050512 | Bacteria | 999 |
| 1389 | nmdc:mga0n895_871526_c1 | 3300050512 | Bacteria | 887 |
| 1390 | nmdc:mga0rr50_21282_c1 | 3300050513 | Bacteria | 4424 |
| 1391 | nmdc:mga0rr50_247054_c1 | 3300050513 | Bacteria | 1481 |
| 1392 | nmdc:mga08x19_105160_c1 | 3300050514 | Bacteria | 1877 |
| 1393 | nmdc:mga08x19_22590_c1 | 3300050514 | Bacteria | 3897 |
| 1394 | nmdc:mga08x19_23001_c1 | 3300050514 | Bacteria | 3865 |
| 1395 | nmdc:mga08x19_26956_c1 | 3300050514 | Bacteria | 3591 |
| 1396 | nmdc:mga08x19_37657_c1 | 3300050514 | Bacteria | 3071 |
| 1397 | nmdc:mga08x19_4565_c1 | 3300050514 | Bacteria | 8219 |
| 1398 | nmdc:mga0a205_156520_c1 | 3300050515 | Bacteria | 2177 |
| 1399 | nmdc:mga0a205_172887_c1 | 3300050515 | Bacteria | 2056 |
| 1400 | nmdc:mga0a205_32521_c1 | 3300050515 | Bacteria | 5001 |
| 1401 | nmdc:mga0a205_352026_c1 | 3300050515 | Bacteria | 1340 |
| 1402 | nmdc:mga0a205_41155_c1 | 3300050515 | Bacteria | 2093 |
| 1403 | nmdc:mga0a205_441599_c1 | 3300050515 | Bacteria | 1162 |
| 1404 | nmdc:mga0a205_9333_c2 | 3300050515 | Bacteria | 7475 |
| 1405 | Ga0495601_0180556 | 3300053077 | Bacteria | 1380 |
| 1406 | Ga0495619_0071754 | 3300053085 | Bacteria | 2318 |
| 1407 | Ga0495619_0495695 | 3300053085 | Bacteria | 840 |
| 1408 | Ga0501084_0007220 | 3300054114 | Bacteria | 9156 |
| 1409 | Ga0501084_0032455 | 3300054114 | Bacteria | 4368 |
| 1410 | Ga0501084_0060012 | 3300054114 | Bacteria | 3184 |
| 1411 | Ga0501084_0231548 | 3300054114 | Bacteria | 1559 |
| 1412 | Ga0501084_0265726 | 3300054114 | Bacteria | 1448 |
| 1413 | Ga0501084_0320345 | 3300054114 | Bacteria | 1309 |
| 1414 | Ga0501084_0458524 | 3300054114 | Bacteria | 1077 |
| 1415 | Ga0501084_0717732 | 3300054114 | Bacteria | 843 |
| 1416 | Ga0587090_037235 | 3300059510 | Bacteria | 841 |
| 1417 | Ga0501082_0001521 | 3300060353 | Bacteria | 20389 |
| 1418 | Ga0501082_0035827 | 3300060353 | Bacteria | 4276 |
| 1419 | Ga0501082_0060429 | 3300060353 | Bacteria | 3263 |
| 1420 | Ga0501082_0068456 | 3300060353 | Bacteria | 3056 |
| 1421 | Ga0501082_0071244 | 3300060353 | Bacteria | 2993 |
| 1422 | Ga0501082_0099068 | 3300060353 | Bacteria | 2520 |
| 1423 | Ga0501082_0420130 | 3300060353 | Unclassified | 1168 |
| 1424 | Ga0501082_0910596 | 3300060353 | Bacteria | 769 |
| 1425 | Ga0530510_0075602 | 3300061734 | Bacteria | 2446 |
| 1426 | Ga0530510_0083097 | 3300061734 | Bacteria | 2332 |
| 1427 | Ga0530510_0174248 | 3300061734 | Bacteria | 1594 |
| 1428 | Ga0530510_0352520 | 3300061734 | Bacteria | 1105 |
| 1429 | Ga0530510_0407865 | 3300061734 | Bacteria | 1025 |
| 1430 | 2906802893 | 2906799679 | Bacteria | 4031749 |
| 1431 | 2932430801 | 2932426870 | Bacteria | 4547726 |
| 1432 | 2933419480 | 2933418574 | Bacteria | 4476724 |
| 1433 | 2939650875 | 2939647034 | Bacteria | 4681660 |
| 1434 | 2939675649 | 2939674588 | Bacteria | 4844420 |
| 1435 | 2946060958 | 2946059875 | Bacteria | 4386623 |
| 1436 | 8054108670 | 8054107350 | Bacteria | 5022511 |
| 1437 | Ga0070679_100572098 | |||
| 1438 | JGI25152J39213_1000046 | |||
| 1439 | JGI25407J50210_10003857 | |||
| 1440 | JGI25404J52841_10083426 | |||
| 1441 | Ga0055542_1006635 | |||
| 1442 | Ga0065714_10155660 | |||
| 1443 | Ga0070658_10014372 | |||
| 1444 | Ga0070658_10034647 | |||
| 1445 | Ga0070658_10097451 | |||
| 1446 | Ga0070658_10177298 | |||
| 1447 | Ga0070658_10184496 | |||
| 1448 | Ga0070676_10089279 | |||
| 1449 | Ga0070676_10236823 | |||
| 1450 | Ga0070683_100003641 | |||
| 1451 | Ga0070683_100012451 | |||
| 1452 | Ga0070683_100070160 | |||
| 1453 | Ga0070683_100197102 | |||
| 1454 | Ga0070683_100401326 | |||
| 1455 | Ga0070690_100021285 | |||
| 1456 | Ga0070690_100084585 | |||
| 1457 | Ga0070670_100246151 | |||
| 1458 | Ga0070670_100377517 | |||
| 1459 | Ga0068869_100089683 | |||
| 1460 | Ga0068869_100108563 | |||
| 1461 | Ga0070666_10011943 | |||
| 1462 | Ga0070680_100009218 | |||
| 1463 | Ga0070680_100113835 | |||
| 1464 | Ga0070680_100139622 | |||
| 1465 | Ga0070682_100045851 | |||
| 1466 | Ga0070682_100053356 | |||
| 1467 | Ga0070682_100123921 | |||
| 1468 | Ga0070682_100151094 | |||
| 1469 | Ga0068868_101232677 | |||
| 1470 | Ga0070660_100002284 | |||
| 1471 | Ga0070660_100079320 | |||
| 1472 | Ga0070660_100184708 | |||
| 1473 | Ga0070660_100188711 | |||
| 1474 | Ga0070660_100394327 | |||
| 1475 | Ga0070689_100014123 | |||
| 1476 | Ga0070689_100080810 | |||
| 1477 | Ga0070691_10033053 | |||
| 1478 | Ga0070687_100121059 | |||
| 1479 | Ga0070687_100843173 | |||
| 1480 | Ga0070661_100072080 | |||
| 1481 | Ga0070661_100297783 | |||
| 1482 | Ga0070661_101214594 | |||
| 1483 | Ga0070692_10002531 | |||
| 1484 | Ga0070692_10020956 | |||
| 1485 | Ga0070692_10055201 | |||
| 1486 | Ga0070668_100094651 | |||
| 1487 | Ga0070668_100105061 | |||
| 1488 | Ga0070668_100164197 | |||
| 1489 | Ga0070668_100363052 | |||
| 1490 | Ga0070669_100000002 | |||
| 1491 | Ga0070669_101446737 | |||
| 1492 | Ga0070675_100197867 | |||
| 1493 | Ga0070675_100295554 | |||
| 1494 | Ga0070674_100008245 | |||
| 1495 | Ga0070674_100022938 | |||
| 1496 | Ga0070674_100855180 | |||
| 1497 | Ga0070673_100132374 | |||
| 1498 | Ga0070673_100630558 | |||
| 1499 | Ga0070673_100773666 | |||
| 1500 | Ga0070688_100097160 | |||
| 1501 | Ga0070688_100185188 | |||
| 1502 | Ga0070688_100652974 | |||
| 1503 | Ga0070688_101290959 | |||
| 1504 | Ga0070659_100027699 | |||
| 1505 | Ga0070659_100209762 | |||
| 1506 | Ga0070659_100213661 | |||
| 1507 | Ga0070667_100068362 | |||
| 1508 | Ga0070667_100101719 | |||
| 1509 | Ga0070667_100267268 | |||
| 1510 | Ga0070703_10003466 | |||
| 1511 | Ga0070709_10204981 | |||
| 1512 | Ga0070709_10334055 | |||
| 1513 | Ga0070714_100104428 | |||
| 1514 | Ga0070714_100115887 | |||
| 1515 | Ga0070713_100017467 | |||
| 1516 | Ga0070713_100229014 | |||
| 1517 | Ga0070713_100232044 | |||
| 1518 | Ga0070713_100932769 | |||
| 1519 | Ga0070710_10083352 | |||
| 1520 | Ga0070710_10435630 | |||
| 1521 | Ga0070701_10008989 | |||
| 1522 | Ga0070711_100020225 | |||
| 1523 | Ga0070711_100251430 | |||
| 1524 | Ga0070705_100006893 | |||
| 1525 | Ga0070705_100139298 | |||
| 1526 | Ga0070705_100284075 | |||
| 1527 | Ga0070705_100463123 | |||
| 1528 | Ga0070700_100086817 | |||
| 1529 | Ga0070700_100401348 | |||
| 1530 | Ga0070694_100027674 | |||
| 1531 | Ga0070694_100077622 | |||
| 1532 | Ga0070694_100242333 | |||
| 1533 | Ga0070694_100918075 | |||
| 1534 | Ga0070708_100234521 | |||
| 1535 | Ga0070663_100033893 | |||
| 1536 | Ga0070663_100167475 | |||
| 1537 | Ga0070663_100320768 | |||
| 1538 | Ga0070678_100033436 | |||
| 1539 | Ga0070678_100651361 | |||
| 1540 | Ga0070678_100720990 | |||
| 1541 | Ga0070678_100741929 | |||
| 1542 | Ga0070662_100013464 | |||
| 1543 | Ga0070662_100032163 | |||
| 1544 | Ga0070662_100046759 | |||
| 1545 | Ga0070681_10007964 | |||
| 1546 | Ga0070681_10016690 | |||
| 1547 | Ga0070681_10023282 | |||
| 1548 | Ga0070681_10036925 | |||
| 1549 | Ga0070681_10257360 | |||
| 1550 | Ga0070681_10305714 | |||
| 1551 | Ga0068867_100072350 | |||
| 1552 | Ga0068867_100077648 | |||
| 1553 | Ga0070685_10003221 | |||
| 1554 | Ga0070685_10004772 | |||
| 1555 | Ga0070685_10356343 | |||
| 1556 | Ga0070685_10396369 | |||
| 1557 | Ga0070706_100003660 | |||
| 1558 | Ga0070706_100023763 | |||
| 1559 | Ga0070706_100539888 | |||
| 1560 | Ga0070707_100002146 | |||
| 1561 | Ga0070707_100057963 | |||
| 1562 | Ga0070707_100087877 | |||
| 1563 | Ga0070707_100461895 | |||
| 1564 | Ga0070698_100013048 | |||
| 1565 | Ga0070698_100039664 | |||
| 1566 | Ga0070698_100219532 | |||
| 1567 | Ga0070698_100567816 | |||
| 1568 | Ga0070699_100003545 | |||
| 1569 | Ga0070699_100059708 | |||
| 1570 | Ga0070699_100067160 | |||
| 1571 | Ga0070699_100118178 | |||
| 1572 | Ga0070699_100344883 | |||
| 1573 | Ga0070679_100002180 | |||
| 1574 | Ga0070679_100030712 | |||
| 1575 | Ga0070679_100039874 | |||
| 1576 | Ga0070679_100066942 | |||
| 1577 | Ga0070679_100108072 | |||
| 1578 | Ga0070679_100144007 | |||
| 1579 | Ga0070684_100000887 | |||
| 1580 | Ga0070684_100011152 | |||
| 1581 | Ga0070684_100012096 | |||
| 1582 | Ga0070684_100014289 | |||
| 1583 | Ga0070684_100127407 | |||
| 1584 | Ga0070684_100322747 | |||
| 1585 | Ga0070697_100009908 | |||
| 1586 | Ga0070697_100133987 | |||
| 1587 | Ga0070697_100343641 | |||
| 1588 | Ga0068853_100011384 | |||
| 1589 | Ga0068853_100167137 | |||
| 1590 | Ga0070672_100189287 | |||
| 1591 | Ga0070686_100016719 | |||
| 1592 | Ga0070686_100104765 | |||
| 1593 | Ga0070686_100124717 | |||
| 1594 | Ga0070686_100234527 | |||
| 1595 | Ga0070686_100604799 | |||
| 1596 | Ga0070686_100605277 | |||
| 1597 | Ga0070695_100392616 | |||
| 1598 | Ga0070695_101260208 | |||
| 1599 | Ga0070696_100019458 | |||
| 1600 | Ga0070696_100043037 | |||
| 1601 | Ga0070693_100367661 | |||
| 1602 | Ga0070665_100000625 | |||
| 1603 | Ga0070665_100071423 | |||
| 1604 | Ga0070665_100121490 | |||
| 1605 | Ga0070704_100003404 | |||
| 1606 | Ga0070704_100011285 | |||
| 1607 | Ga0070704_100032794 | |||
| 1608 | Ga0070704_100612672 | |||
| 1609 | Ga0068855_100018515 | |||
| 1610 | Ga0068855_100034169 | |||
| 1611 | Ga0068855_100075689 | |||
| 1612 | Ga0068855_100178835 | |||
| 1613 | Ga0068855_100224800 | |||
| 1614 | Ga0068855_100414857 | |||
| 1615 | Ga0070664_100048291 | |||
| 1616 | Ga0070664_100295233 | |||
| 1617 | Ga0070664_100410164 | |||
| 1618 | Ga0070664_100496299 | |||
| 1619 | Ga0068857_100165255 | |||
| 1620 | Ga0068854_100066535 | |||
| 1621 | Ga0068854_100338056 | |||
| 1622 | Ga0068854_100787346 | |||
| 1623 | Ga0068856_100026978 | |||
| 1624 | Ga0068856_100255658 | |||
| 1625 | Ga0068856_100282471 | |||
| 1626 | Ga0068856_100415257 | |||
| 1627 | Ga0070702_100026938 | |||
| 1628 | Ga0070702_100057772 | |||
| 1629 | Ga0068852_100043382 | |||
| 1630 | Ga0068852_100069567 | |||
| 1631 | Ga0068852_100135911 | |||
| 1632 | Ga0068852_100150981 | |||
| 1633 | Ga0068859_100110232 | |||
| 1634 | Ga0068859_100751744 | |||
| 1635 | Ga0068864_100269055 | |||
| 1636 | Ga0068866_10310043 | |||
| 1637 | Ga0068861_100103306 | |||
| 1638 | Ga0068861_100375190 | |||
| 1639 | Ga0068861_101045854 | |||
| 1640 | Ga0068851_10094026 | |||
| 1641 | Ga0068851_10388740 | |||
| 1642 | Ga0068870_10021664 | |||
| 1643 | Ga0068870_10954642 | |||
| 1644 | Ga0068863_100263196 | |||
| 1645 | Ga0068858_100027442 | |||
| 1646 | Ga0068858_100278716 | |||
| 1647 | Ga0068858_101565851 | |||
| 1648 | Ga0068858_102184061 | |||
| 1649 | Ga0068860_100019464 | |||
| 1650 | Ga0068860_100037378 | |||
| 1651 | Ga0068862_100001063 | |||
| 1652 | Ga0068862_100246359 | |||
| 1653 | Ga0068862_100247710 | |||
| 1654 | Ga0068862_100643914 | |||
| 1655 | Ga0081455_10015740 | |||
| 1656 | Ga0081455_10022676 | |||
| 1657 | Ga0081455_10032676 | |||
| 1658 | Ga0081455_10032852 | |||
| 1659 | Ga0081455_10040470 | |||
| 1660 | Ga0081455_10056920 | |||
| 1661 | Ga0081455_10058075 | |||
| 1662 | Ga0081455_10356753 | |||
| 1663 | Ga0081538_10000330 | |||
| 1664 | Ga0081538_10001228 | |||
| 1665 | Ga0081538_10001290 | |||
| 1666 | Ga0081538_10007527 | |||
| 1667 | Ga0081538_10047404 | |||
| 1668 | Ga0081538_10137821 | |||
| 1669 | Ga0081540_1009957 | |||
| 1670 | Ga0081540_1012344 | |||
| 1671 | Ga0081539_10001337 | |||
| 1672 | Ga0081539_10041689 | |||
| 1673 | Ga0081539_10199326 | |||
| 1674 | Ga0070717_10041894 | |||
| 1675 | Ga0075365_10003096 | |||
| 1676 | Ga0075363_100089490 | |||
| 1677 | Ga0075363_100246956 | |||
| 1678 | Ga0075432_10004635 | |||
| 1679 | Ga0075432_10012966 | |||
| 1680 | Ga0075432_10037726 | |||
| 1681 | Ga0070715_10138585 | |||
| 1682 | Ga0070715_10197536 | |||
| 1683 | Ga0070716_100091705 | |||
| 1684 | Ga0070716_100146864 | |||
| 1685 | Ga0070716_100176834 | |||
| 1686 | Ga0070712_100028072 | |||
| 1687 | Ga0070712_100033201 | |||
| 1688 | Ga0070712_100045337 | |||
| 1689 | Ga0070712_100224613 | |||
| 1690 | Ga0075362_10055513 | |||
| 1691 | Ga0075367_10185945 | |||
| 1692 | Ga0097621_100233690 | |||
| 1693 | Ga0097621_100309678 | |||
| 1694 | Ga0075370_10161743 | |||
| 1695 | Ga0068871_100111925 | |||
| 1696 | Ga0068871_100174284 | |||
| 1697 | Ga0068871_100266690 | |||
| 1698 | Ga0075428_100002710 | |||
| 1699 | Ga0075428_100081065 | |||
| 1700 | Ga0075428_100159254 | |||
| 1701 | Ga0075428_101009277 | |||
| 1702 | Ga0075428_101097533 | |||
| 1703 | Ga0075430_100009019 | |||
| 1704 | Ga0075430_100102461 | |||
| 1705 | Ga0075430_100136046 | |||
| 1706 | Ga0075430_100283078 | |||
| 1707 | Ga0075431_100001020 | |||
| 1708 | Ga0075431_100017616 | |||
| 1709 | Ga0075431_100047691 | |||
| 1710 | Ga0075431_100199297 | |||
| 1711 | Ga0075431_100465464 | |||
| 1712 | Ga0075433_10033563 | |||
| 1713 | Ga0075433_10037108 | |||
| 1714 | Ga0075433_10059649 | |||
| 1715 | Ga0075433_10301595 | |||
| 1716 | Ga0075434_100048762 | |||
| 1717 | Ga0075434_100112943 | |||
| 1718 | Ga0075434_100141319 | |||
| 1719 | Ga0075434_100159314 | |||
| 1720 | Ga0075434_100325366 | |||
| 1721 | Ga0075434_100350779 | |||
| 1722 | Ga0075434_100624736 | |||
| 1723 | Ga0075429_100052744 | |||
| 1724 | Ga0075429_100238786 | |||
| 1725 | Ga0075429_100247617 | |||
| 1726 | Ga0075429_100330209 | |||
| 1727 | Ga0075429_100574506 | |||
| 1728 | Ga0075429_101178989 | |||
| 1729 | Ga0068865_100022281 | |||
| 1730 | Ga0068865_100024408 | |||
| 1731 | Ga0068865_100334613 | |||
| 1732 | Ga0068865_100427821 | |||
| 1733 | Ga0075436_100001835 | |||
| 1734 | Ga0075436_100006708 | |||
| 1735 | Ga0075436_100011000 | |||
| 1736 | Ga0075436_100020746 | |||
| 1737 | Ga0075436_100053533 | |||
| 1738 | Ga0075436_100142230 | |||
| 1739 | Ga0075436_100186821 | |||
| 1740 | Ga0097620_100110230 | |||
| 1741 | Ga0097620_100751726 | |||
| 1742 | Ga0075435_100007425 | |||
| 1743 | Ga0075435_100037084 | |||
| 1744 | Ga0075435_100324741 | |||
| 1745 | Ga0075435_100472263 | |||
| 1746 | Ga0075435_100593019 | |||
| 1747 | Ga0105244_10004212 | |||
| 1748 | Ga0105240_10022063 | |||
| 1749 | Ga0105240_10085266 | |||
| 1750 | Ga0105240_10148064 | |||
| 1751 | Ga0111539_10013119 | |||
| 1752 | Ga0111539_10023472 | |||
| 1753 | Ga0111539_10040970 | |||
| 1754 | Ga0111539_10056335 | |||
| 1755 | Ga0111539_10060296 | |||
| 1756 | Ga0111539_10089782 | |||
| 1757 | Ga0111539_10124544 | |||
| 1758 | Ga0111539_10249129 | |||
| 1759 | Ga0111539_10294990 | |||
| 1760 | Ga0111539_10307348 | |||
| 1761 | Ga0111539_10317039 | |||
| 1762 | Ga0111539_10372505 | |||
| 1763 | Ga0111539_10419597 | |||
| 1764 | Ga0111539_10703241 | |||
| 1765 | Ga0111539_11382177 | |||
| 1766 | Ga0105245_10024429 | |||
| 1767 | Ga0105245_10043540 | |||
| 1768 | Ga0105245_10058133 | |||
| 1769 | Ga0105245_10078137 | |||
| 1770 | Ga0105245_10093151 | |||
| 1771 | Ga0105245_10131590 | |||
| 1772 | Ga0105245_10169296 | |||
| 1773 | Ga0105245_10202285 | |||
| 1774 | Ga0105247_10058184 | |||
| 1775 | Ga0114129_10017930 | |||
| 1776 | Ga0114129_10076752 | |||
| 1777 | Ga0114129_10164573 | |||
| 1778 | Ga0114129_10458833 | |||
| 1779 | Ga0114129_10487702 | |||
| 1780 | Ga0114129_11018607 | |||
| 1781 | Ga0114129_11045073 | |||
| 1782 | Ga0114129_11091867 | |||
| 1783 | Ga0114129_12300428 | |||
| 1784 | Ga0105243_10013026 | |||
| 1785 | Ga0105243_10018258 | |||
| 1786 | Ga0105243_10020325 | |||
| 1787 | Ga0105243_10033330 | |||
| 1788 | Ga0105243_10036838 | |||
| 1789 | Ga0105243_10050214 | |||
| 1790 | Ga0105243_11318847 | |||
| 1791 | Ga0105241_10222536 | |||
| 1792 | Ga0105241_10905214 | |||
| 1793 | Ga0105242_10049351 | |||
| 1794 | Ga0105242_10085512 | |||
| 1795 | Ga0105242_10103539 | |||
| 1796 | Ga0105242_10140911 | |||
| 1797 | Ga0105242_10287482 | |||
| 1798 | Ga0105242_10727460 | |||
| 1799 | Ga0105242_10847123 | |||
| 1800 | Ga0105242_11032000 | |||
| 1801 | Ga0105248_10046557 | |||
| 1802 | Ga0105248_10134961 | |||
| 1803 | Ga0105248_10193695 | |||
| 1804 | Ga0105248_10786702 | |||
| 1805 | Ga0105238_10337870 | |||
| 1806 | Ga0105238_10396582 | |||
| 1807 | Ga0105238_10983483 | |||
| 1808 | Ga0105249_10070967 | |||
| 1809 | Ga0105249_10096470 | |||
| 1810 | Ga0105249_10152408 | |||
| 1811 | Ga0105249_10201390 | |||
| 1812 | Ga0105249_10250976 | |||
| 1813 | Ga0105249_12872056 | |||
| 1814 | Ga0105030_114543 | |||
| 1815 | Ga0105239_10013046 | |||
| 1816 | Ga0105239_10124667 | |||
| 1817 | Ga0105239_10165737 | |||
| 1818 | Ga0105239_10168474 | |||
| 1819 | Ga0105239_10634248 | |||
| 1820 | Ga0105246_10005235 | |||
| 1821 | Ga0105246_10036011 | |||
| 1822 | Ga0105246_10113067 | |||
| 1823 | Ga0105246_10184971 | |||
| 1824 | Ga0105246_10226621 | |||
| 1825 | Ga0105246_10566060 | |||
| 1826 | Ga0105246_11173788 | |||
| 1827 | Ga0157346_1003880 | |||
| 1828 | Ga0157341_1010607 | |||
| 1829 | Ga0157319_1016381 | |||
| 1830 | Ga0157347_1010583 | |||
| 1831 | Ga0157373_10095877 | |||
| 1832 | Ga0157373_10141235 | |||
| 1833 | Ga0157371_10055114 | |||
| 1834 | Ga0157371_10067574 | |||
| 1835 | Ga0157371_10349834 | |||
| 1836 | Ga0157371_10359882 | |||
| 1837 | Ga0157370_10024054 | |||
| 1838 | Ga0157370_10030046 | |||
| 1839 | Ga0157370_10087914 | |||
| 1840 | Ga0157370_10212494 | |||
| 1841 | Ga0157370_11131434 | |||
| 1842 | Ga0157369_10029044 | |||
| 1843 | Ga0157369_10081190 | |||
| 1844 | Ga0157369_10124154 | |||
| 1845 | Ga0157369_10325986 | |||
| 1846 | Ga0157369_11538031 | |||
| 1847 | Ga0157374_11438495 | |||
| 1848 | Ga0157374_11800228 | |||
| 1849 | Ga0157378_10205213 | |||
| 1850 | Ga0157378_10328522 | |||
| 1851 | Ga0157378_10659266 | |||
| 1852 | Ga0157378_11769749 | |||
| 1853 | Ga0163162_10429511 | |||
| 1854 | Ga0163162_10611694 | |||
| 1855 | Ga0157372_10196373 | |||
| 1856 | Ga0157372_10624960 | |||
| 1857 | Ga0157372_10698334 | |||
| 1858 | Ga0157372_11714419 | |||
| 1859 | Ga0157375_10014646 | |||
| 1860 | Ga0157375_10028657 | |||
| 1861 | Ga0157375_10099855 | |||
| 1862 | Ga0157375_10142516 | |||
| 1863 | Ga0157375_11552403 | |||
| 1864 | Ga0157375_11793610 | |||
| 1865 | Ga0163163_10588459 | |||
| 1866 | Ga0163163_11052540 | |||
| 1867 | Ga0157380_10034297 | |||
| 1868 | Ga0157380_10436093 | |||
| 1869 | Ga0157380_11109054 | |||
| 1870 | Ga0157377_10008757 | |||
| 1871 | Ga0157377_10010749 | |||
| 1872 | Ga0157377_10030589 | |||
| 1873 | Ga0157377_10065648 | |||
| 1874 | Ga0157377_10073352 | |||
| 1875 | Ga0157377_10864173 | |||
| 1876 | Ga0157379_10007228 | |||
| 1877 | Ga0157379_10501277 | |||
| 1878 | Ga0157376_10048687 | |||
| 1879 | Ga0157376_10345642 | |||
| 1880 | Ga0157376_10442703 | |||
| 1881 | Ga0163161_10151557 | |||
| 1882 | Ga0197907_11161130 | |||
| 1883 | Ga0206356_11461127 | |||
| 1884 | Ga0206353_10651167 | |||
| 1885 | Ga0213871_10005066 | |||
| 1886 | Ga0209025_1001520 | |||
| 1887 | Ga0207697_10131474 | |||
| 1888 | Ga0207655_1005376 | |||
| 1889 | Ga0207653_10009987 | |||
| 1890 | Ga0207653_10020231 | |||
| 1891 | Ga0207682_10159245 | |||
| 1892 | Ga0207692_10461076 | |||
| 1893 | Ga0207642_10019819 | |||
| 1894 | Ga0207642_10127440 | |||
| 1895 | Ga0207642_10352436 | |||
| 1896 | Ga0207710_10118652 | |||
| 1897 | Ga0207688_10009478 | |||
| 1898 | Ga0207688_10016919 | |||
| 1899 | Ga0207688_10031092 | |||
| 1900 | Ga0207688_10056477 | |||
| 1901 | Ga0207680_10055089 | |||
| 1902 | Ga0207685_10087521 | |||
| 1903 | Ga0207699_10147167 | |||
| 1904 | Ga0207699_10253676 | |||
| 1905 | Ga0207645_10024069 | |||
| 1906 | Ga0207645_10329080 | |||
| 1907 | Ga0207643_10036703 | |||
| 1908 | Ga0207643_10044089 | |||
| 1909 | Ga0207643_10598079 | |||
| 1910 | Ga0207705_10018897 | |||
| 1911 | Ga0207705_10036877 | |||
| 1912 | Ga0207705_10151140 | |||
| 1913 | Ga0207705_10533679 | |||
| 1914 | Ga0207684_10029662 | |||
| 1915 | Ga0207684_10085533 | |||
| 1916 | Ga0207684_10087289 | |||
| 1917 | Ga0207684_10110095 | |||
| 1918 | Ga0207684_10439595 | |||
| 1919 | Ga0207684_10482913 | |||
| 1920 | Ga0207654_10101867 | |||
| 1921 | Ga0207654_10268518 | |||
| 1922 | Ga0207654_10362818 | |||
| 1923 | Ga0207707_10006590 | |||
| 1924 | Ga0207707_10087499 | |||
| 1925 | Ga0207707_10216454 | |||
| 1926 | Ga0207695_10114142 | |||
| 1927 | Ga0207695_10572011 | |||
| 1928 | Ga0207693_10003963 | |||
| 1929 | Ga0207693_10013076 | |||
| 1930 | Ga0207693_10030694 | |||
| 1931 | Ga0207693_10243380 | |||
| 1932 | Ga0207663_10215405 | |||
| 1933 | Ga0207663_10271885 | |||
| 1934 | Ga0207663_10617528 | |||
| 1935 | Ga0207660_10020089 | |||
| 1936 | Ga0207660_10049701 | |||
| 1937 | Ga0207662_10014292 | |||
| 1938 | Ga0207662_10024351 | |||
| 1939 | Ga0207662_10405653 | |||
| 1940 | Ga0207657_10042742 | |||
| 1941 | Ga0207657_10172473 | |||
| 1942 | Ga0207657_10249173 | |||
| 1943 | Ga0207657_10472122 | |||
| 1944 | Ga0207649_10107186 | |||
| 1945 | Ga0207649_10295841 | |||
| 1946 | Ga0207649_10407607 | |||
| 1947 | Ga0207649_10742971 | |||
| 1948 | Ga0207652_10043531 | |||
| 1949 | Ga0207652_10046187 | |||
| 1950 | Ga0207652_10178087 | |||
| 1951 | Ga0207646_10006140 | |||
| 1952 | Ga0207646_10006269 | |||
| 1953 | Ga0207646_10152180 | |||
| 1954 | Ga0207646_10518412 | |||
| 1955 | Ga0207681_10000009 | |||
| 1956 | Ga0207681_10028072 | |||
| 1957 | Ga0207694_10309333 | |||
| 1958 | Ga0207659_10617011 | |||
| 1959 | Ga0207687_10474482 | |||
| 1960 | Ga0207687_10826073 | |||
| 1961 | Ga0207700_10000012 | |||
| 1962 | Ga0207700_10182759 | |||
| 1963 | Ga0207700_10397258 | |||
| 1964 | Ga0207664_10019978 | |||
| 1965 | Ga0207664_10046280 | |||
| 1966 | Ga0207664_10084696 | |||
| 1967 | Ga0207664_10090170 | |||
| 1968 | Ga0207644_10066422 | |||
| 1969 | Ga0207690_10045941 | |||
| 1970 | Ga0207690_10168263 | |||
| 1971 | Ga0207690_10195708 | |||
| 1972 | Ga0207690_10349101 | |||
| 1973 | Ga0207690_10400496 | |||
| 1974 | Ga0207706_10054003 | |||
| 1975 | Ga0207706_10068330 | |||
| 1976 | Ga0207706_10073483 | |||
| 1977 | Ga0207706_10374187 | |||
| 1978 | Ga0207686_10097318 | |||
| 1979 | Ga0207686_10119830 | |||
| 1980 | Ga0207686_10156703 | |||
| 1981 | Ga0207686_10174868 | |||
| 1982 | Ga0207686_10235578 | |||
| 1983 | Ga0207686_10368014 | |||
| 1984 | Ga0207686_10823808 | |||
| 1985 | Ga0207709_10147765 | |||
| 1986 | Ga0207709_10155025 | |||
| 1987 | Ga0207709_10328843 | |||
| 1988 | Ga0207709_10770385 | |||
| 1989 | Ga0207670_10014342 | |||
| 1990 | Ga0207670_10163280 | |||
| 1991 | Ga0207669_10032569 | |||
| 1992 | Ga0207669_10121630 | |||
| 1993 | Ga0207669_10153559 | |||
| 1994 | Ga0207669_10252298 | |||
| 1995 | Ga0207669_10269832 | |||
| 1996 | Ga0207704_10054060 | |||
| 1997 | Ga0207704_10455730 | |||
| 1998 | Ga0207704_10473042 | |||
| 1999 | Ga0207704_10493406 | |||
| 2000 | Ga0207704_10966458 | |||
| 2001 | Ga0207704_11153135 | |||
| 2002 | Ga0207665_10001466 | |||
| 2003 | Ga0207665_10004281 | |||
| 2004 | Ga0207665_10117622 | |||
| 2005 | Ga0207665_10126859 | |||
| 2006 | Ga0207665_10243368 | |||
| 2007 | Ga0207691_10051487 | |||
| 2008 | Ga0207711_10164420 | |||
| 2009 | Ga0207711_10215226 | |||
| 2010 | Ga0207711_10465724 | |||
| 2011 | Ga0207689_10014420 | |||
| 2012 | Ga0207689_10192159 | |||
| 2013 | Ga0207689_10207145 | |||
| 2014 | Ga0207689_10347525 | |||
| 2015 | Ga0207661_10014827 | |||
| 2016 | Ga0207661_10092504 | |||
| 2017 | Ga0207661_10153507 | |||
| 2018 | Ga0207661_10489862 | |||
| 2019 | Ga0207661_10558259 | |||
| 2020 | Ga0207661_11211843 | |||
| 2021 | Ga0207679_10057167 | |||
| 2022 | Ga0207667_10166754 | |||
| 2023 | Ga0207667_10253124 | |||
| 2024 | Ga0207667_10266607 | |||
| 2025 | Ga0207667_10554228 | |||
| 2026 | Ga0207651_10261091 | |||
| 2027 | Ga0207651_10445264 | |||
| 2028 | Ga0207712_10166684 | |||
| 2029 | Ga0207712_10203101 | |||
| 2030 | Ga0207668_10037124 | |||
| 2031 | Ga0207668_10037177 | |||
| 2032 | Ga0207668_10139115 | |||
| 2033 | Ga0207668_10608913 | |||
| 2034 | Ga0207668_11064917 | |||
| 2035 | Ga0207640_10168942 | |||
| 2036 | Ga0207658_10008375 | |||
| 2037 | Ga0207658_10071669 | |||
| 2038 | Ga0207677_10023358 | |||
| 2039 | Ga0207677_10139988 | |||
| 2040 | Ga0207703_10148390 | |||
| 2041 | Ga0207703_11490538 | |||
| 2042 | Ga0207639_10287038 | |||
| 2043 | Ga0207678_10111101 | |||
| 2044 | Ga0207678_10162357 | |||
| 2045 | Ga0207678_11123023 | |||
| 2046 | Ga0207708_10008954 | |||
| 2047 | Ga0207708_10023773 | |||
| 2048 | Ga0207708_10103974 | |||
| 2049 | Ga0207708_10478560 | |||
| 2050 | Ga0207702_10235700 | |||
| 2051 | Ga0207648_10014277 | |||
| 2052 | Ga0207648_10088100 | |||
| 2053 | Ga0207648_10117253 | |||
| 2054 | Ga0207648_10171797 | |||
| 2055 | Ga0207676_10071562 | |||
| 2056 | Ga0207674_10019100 | |||
| 2057 | Ga0207674_10041180 | |||
| 2058 | Ga0207674_10072059 | |||
| 2059 | Ga0207674_10199522 | |||
| 2060 | Ga0207675_100006399 | |||
| 2061 | Ga0207675_100012983 | |||
| 2062 | Ga0207675_100220507 | |||
| 2063 | Ga0207675_100242608 | |||
| 2064 | Ga0207675_100393206 | |||
| 2065 | Ga0207683_10011235 | |||
| 2066 | Ga0207683_10021405 | |||
| 2067 | Ga0207683_10398445 | |||
| 2068 | Ga0207683_10480373 | |||
| 2069 | Ga0207683_10645067 | |||
| 2070 | Ga0207683_10751405 | |||
| 2071 | Ga0207698_10017055 | |||
| 2072 | Ga0207698_10039101 | |||
| 2073 | Ga0207698_10148666 | |||
| 2074 | Ga0207698_10377230 | |||
| 2075 | Ga0207698_11609064 | |||
| 2076 | Ga0209998_10018860 | |||
| 2077 | Ga0209998_10035881 | |||
| 2078 | Ga0209974_10065380 | |||
| 2079 | Ga0207428_10000393 | |||
| 2080 | Ga0207428_10011660 | |||
| 2081 | Ga0207428_10021808 | |||
| 2082 | Ga0207428_10025802 | |||
| 2083 | Ga0207428_10105175 | |||
| 2084 | Ga0207428_10137362 | |||
| 2085 | Ga0207428_10150273 | |||
| 2086 | Ga0268266_10000799 | |||
| 2087 | Ga0268266_10385049 | |||
| 2088 | Ga0268265_10004154 | |||
| 2089 | Ga0268265_10473170 | |||
| 2090 | Ga0268264_10006890 | |||
| 2091 | Ga0268264_10104738 | |||
| 2092 | Ga0265338_10225043 | |||
| 2093 | Ga0265340_10217169 | |||
| 2094 | Ga0307408_100001088 | |||
| 2095 | Ga0307408_100076319 | |||
| 2096 | Ga0307408_100121428 | |||
| 2097 | Ga0307408_100314547 | |||
| 2098 | Ga0307408_100332868 | |||
| 2099 | Ga0307408_100391749 | |||
| 2100 | Ga0307408_100480590 | |||
| 2101 | Ga0307408_100833353 | |||
| 2102 | Ga0307508_10004869 | |||
| 2103 | Ga0307405_10000639 | |||
| 2104 | Ga0307405_10048244 | |||
| 2105 | Ga0307405_10137020 | |||
| 2106 | Ga0307405_10140625 | |||
| 2107 | Ga0307405_10240922 | |||
| 2108 | Ga0307413_10024410 | |||
| 2109 | Ga0307413_10027481 | |||
| 2110 | Ga0307413_11036895 | |||
| 2111 | Ga0307410_10020515 | |||
| 2112 | Ga0307410_10031542 | |||
| 2113 | Ga0307410_10163098 | |||
| 2114 | Ga0307410_10530092 | |||
| 2115 | Ga0307410_10590847 | |||
| 2116 | Ga0307406_10058992 | |||
| 2117 | Ga0307406_10145267 | |||
| 2118 | Ga0307406_10220153 | |||
| 2119 | Ga0307406_10379537 | |||
| 2120 | Ga0307406_10496182 | |||
| 2121 | Ga0307407_10021264 | |||
| 2122 | Ga0307407_10255038 | |||
| 2123 | Ga0307407_10257131 | |||
| 2124 | Ga0307407_10292844 | |||
| 2125 | Ga0307412_10000473 | |||
| 2126 | Ga0307412_10050650 | |||
| 2127 | Ga0307412_10186629 | |||
| 2128 | Ga0307412_10194322 | |||
| 2129 | Ga0307409_100024998 | |||
| 2130 | Ga0307409_100053445 | |||
| 2131 | Ga0307409_100058035 | |||
| 2132 | Ga0307409_100101699 | |||
| 2133 | Ga0307409_100255964 | |||
| 2134 | Ga0307409_100288647 | |||
| 2135 | Ga0307409_100441587 | |||
| 2136 | Ga0307409_101067616 | |||
| 2137 | Ga0307416_100000543 | |||
| 2138 | Ga0307416_100055876 | |||
| 2139 | Ga0307416_100126252 | |||
| 2140 | Ga0307416_100187412 | |||
| 2141 | Ga0307416_100231661 | |||
| 2142 | Ga0307416_100251116 | |||
| 2143 | Ga0307416_100768014 | |||
| 2144 | Ga0307416_100991623 | |||
| 2145 | Ga0307416_101484993 | |||
| 2146 | Ga0307411_10116137 | |||
| 2147 | Ga0307415_100050111 | |||
| 2148 | Ga0307415_100076399 | |||
| 2149 | Ga0307415_100082431 | |||
| 2150 | Ga0307415_100191310 | |||
| 2151 | Ga0307415_100229659 | |||
| 2152 | Ga0307415_100499817 | |||
| 2153 | Ga0307415_100534689 | |||
| 2154 | Ga0307415_101294694 | |||
| 2155 | Ga0316583_10064237 | |||
| 2156 | Ga0373948_0036000 | |||
| 2157 | Ga0373929_0000008 | |||
| 2158 | Ga0373929_0001933 | |||
| 2159 | Ga0373929_0010886 | |||
| 2160 | Ga0373949_0003001 | |||
| 2161 | Ga0373951_0002983 | |||
| 2162 | Ga0373952_0010209 | |||
| 2163 | Ga0373932_0001874 | |||
| 2164 | Ga0373932_0116961 | |||
| 2165 | Ga0373939_0050909 | |||
| 2166 | Ga0373941_0000689 | |||
| 2167 | Ga0373941_0004348 | |||
| 2168 | Ga0373960_0005466 | |||
| 2169 | Ga0373942_0011614 | |||
| 2170 | Ga0373961_0000425 | |||
| 2171 | Ga0373961_0003054 | |||
| 2172 | Ga0373962_0006858 | |||
| 2173 | Ga0373962_0020160 | |||
| 2174 | Ga0373962_0176029 | |||
| 2175 | Ga0373931_0005957 | |||
| 2176 | Ga0373931_0013889 | |||
| 2177 | Ga0373931_0065932 | |||
| 2178 | Ga0373931_0078445 | |||
| 2179 | Ga0373935_0810975 | |||
| 2180 | Ga0373947_0126634 | |||
| 2181 | Ga0395899_0009205 | |||
| 2182 | Ga0395899_0013482 | |||
| 2183 | Ga0395899_0014372 | |||
| 2184 | Ga0395899_0017690 | |||
| 2185 | Ga0395899_0020071 | |||
| 2186 | Ga0395899_0025092 | |||
| 2187 | Ga0395899_0053111 | |||
| 2188 | Ga0395899_0070601 | |||
| 2189 | Ga0395899_0097457 | |||
| 2190 | Ga0395899_0108426 | |||
| 2191 | Ga0395899_0117893 | |||
| 2192 | Ga0395899_0159560 | |||
| 2193 | Ga0395899_0178205 | |||
| 2194 | Ga0395899_0216038 | |||
| 2195 | Ga0395900_0001263 | |||
| 2196 | Ga0395900_0011737 | |||
| 2197 | Ga0395900_0015802 | |||
| 2198 | Ga0395900_0016029 | |||
| 2199 | Ga0395900_0027139 | |||
| 2200 | Ga0395900_0035139 | |||
| 2201 | Ga0395900_0040863 | |||
| 2202 | Ga0395900_0041226 | |||
| 2203 | Ga0395900_0056727 | |||
| 2204 | Ga0395900_0065413 | |||
| 2205 | Ga0395900_0098219 | |||
| 2206 | Ga0395900_0106115 | |||
| 2207 | Ga0395900_0113159 | |||
| 2208 | Ga0395900_0140192 | |||
| 2209 | Ga0395900_0142711 | |||
| 2210 | Ga0395900_0179388 | |||
| 2211 | Ga0395900_0218136 | |||
| 2212 | Ga0395900_0223040 | |||
| 2213 | Ga0395900_0248420 | |||
| 2214 | Ga0395900_0250179 | |||
| 2215 | Ga0395900_0256178 | |||
| 2216 | Ga0395900_0350431 | |||
| 2217 | Ga0395900_0369851 | |||
| 2218 | Ga0395900_0378871 | |||
| 2219 | Ga0395900_0446469 | |||
| 2220 | Ga0395900_0591880 | |||
| 2221 | Ga0395898_0000795 | |||
| 2222 | Ga0395898_0002292 | |||
| 2223 | Ga0395898_0005555 | |||
| 2224 | Ga0395898_0006822 | |||
| 2225 | Ga0395898_0018229 | |||
| 2226 | Ga0395898_0018559 | |||
| 2227 | Ga0395898_0020122 | |||
| 2228 | Ga0395898_0024209 | |||
| 2229 | Ga0395898_0031257 | |||
| 2230 | Ga0395898_0041411 | |||
| 2231 | Ga0395898_0055457 | |||
| 2232 | Ga0395898_0067582 | |||
| 2233 | Ga0395898_0086767 | |||
| 2234 | Ga0395898_0100355 | |||
| 2235 | Ga0395898_0152830 | |||
| 2236 | Ga0395898_0232401 | |||
| 2237 | Ga0395898_0274394 | |||
| 2238 | Ga0395898_0361869 | |||
| 2239 | Ga0395898_0373678 | |||
| 2240 | Ga0395898_0502531 | |||
| 2241 | Ga0395898_0887478 | |||
| 2242 | Ga0395898_0890394 | |||
| 2243 | Ga0395898_0970095 | |||
| 2244 | Ga0395905_0001754 | |||
| 2245 | Ga0395905_0008154 | |||
| 2246 | Ga0395905_0009489 | |||
| 2247 | Ga0395905_0045175 | |||
| 2248 | Ga0395905_0051315 | |||
| 2249 | Ga0395905_0101635 | |||
| 2250 | Ga0395905_0128043 | |||
| 2251 | Ga0395905_0138021 | |||
| 2252 | Ga0395905_0188335 | |||
| 2253 | Ga0395905_0215358 | |||
| 2254 | Ga0395905_0629562 | |||
| 2255 | Ga0395905_0665904 | |||
| 2256 | Ga0395905_0725317 | |||
| 2257 | Ga0395905_0950274 | |||
| 2258 | Ga0395901_0003357 | |||
| 2259 | Ga0395901_0003708 | |||
| 2260 | Ga0395901_0008348 | |||
| 2261 | Ga0395901_0009956 | |||
| 2262 | Ga0395901_0013971 | |||
| 2263 | Ga0395901_0016014 | |||
| 2264 | Ga0395901_0016308 | |||
| 2265 | Ga0395901_0021053 | |||
| 2266 | Ga0395901_0024337 | |||
| 2267 | Ga0395901_0051113 | |||
| 2268 | Ga0395901_0053638 | |||
| 2269 | Ga0395901_0056433 | |||
| 2270 | Ga0395901_0082039 | |||
| 2271 | Ga0395901_0085355 | |||
| 2272 | Ga0395901_0085853 | |||
| 2273 | Ga0395901_0087776 | |||
| 2274 | Ga0395901_0091646 | |||
| 2275 | Ga0395901_0092079 | |||
| 2276 | Ga0395901_0142606 | |||
| 2277 | Ga0395901_0152876 | |||
| 2278 | Ga0395901_0160495 | |||
| 2279 | Ga0395901_0202777 | |||
| 2280 | Ga0395901_0230542 | |||
| 2281 | Ga0395901_0271436 | |||
| 2282 | Ga0395901_0277332 | |||
| 2283 | Ga0395901_0349681 | |||
| 2284 | Ga0395901_0364943 | |||
| 2285 | Ga0395901_0386202 | |||
| 2286 | Ga0395901_0419350 | |||
| 2287 | Ga0395901_0422654 | |||
| 2288 | Ga0395901_0422805 | |||
| 2289 | Ga0395901_0510835 | |||
| 2290 | Ga0395901_0524317 | |||
| 2291 | Ga0395901_1084680 | |||
| 2292 | Ga0395901_1148773 | |||
| 2293 | Ga0395901_1161623 | |||
| 2294 | Ga0395901_1185782 | |||
| 2295 | Ga0395901_1418546 | |||
| 2296 | Ga0242420_017464 | |||
| 2297 | Ga0242420_033140 | |||
| 2298 | Ga0436365_1112078 | |||
| 2299 | Ga0436360_0817146 | |||
| 2300 | Ga0436362_0193206 | |||
| 2301 | Ga0439436_0003181 | |||
| 2302 | Ga0439436_0024523 | |||
| 2303 | Ga0439438_001298 | |||
| 2304 | Ga0439438_045989 | |||
| 2305 | Ga0439439_0002905 | |||
| 2306 | Ga0439461_0000713 | |||
| 2307 | Ga0439466_0007871 | |||
| 2308 | Ga0439466_0022763 | |||
| 2309 | Ga0451789_1064853 | |||
| 2310 | Ga0451797_0102084 | |||
| 2311 | Ga0451797_1111866 | |||
| 2312 | Ga0451802_1776733 | |||
| 2313 | Ga0451807_0155102 | |||
| 2314 | Ga0451807_1961644 | |||
| 2315 | Ga0451807_2346038 | |||
| 2316 | Ga0451835_0543550 | |||
| 2317 | Ga0451839_0581077 | |||
| 2318 | Ga0451847_0773695 | |||
| 2319 | Ga0451849_1358585 | |||
| 2320 | Ga0451849_1483773 | |||
| 2321 | Ga0451843_0519664 | |||
| 2322 | Ga0451855_0835047 | |||
| 2323 | Ga0451855_1460886 | |||
| 2324 | Ga0451853_0870872 | |||
| 2325 | Ga0451853_1343855 | |||
| 2326 | Ga0451853_1819789 | |||
| 2327 | Ga0451853_2510936 | |||
| 2328 | Ga0451853_3695274 | |||
| 2329 | Ga0439433_0000133 | |||
| 2330 | Ga0439433_0016104 | |||
| 2331 | Ga0439442_003160 | |||
| 2332 | Ga0439442_006217 | |||
| 2333 | Ga0439442_017543 | |||
| 2334 | Ga0439442_034164 | |||
| 2335 | Ga0439432_000702 | |||
| 2336 | Ga0439449_0000267 | |||
| 2337 | Ga0439449_0005707 | |||
| 2338 | Ga0439449_0027218 | |||
| 2339 | Ga0439449_0040295 | |||
| 2340 | Ga0439451_008645 | |||
| 2341 | Ga0439452_000706 | |||
| 2342 | Ga0439454_000546 | |||
| 2343 | Ga0439454_016557 | |||
| 2344 | Ga0439457_002732 | |||
| 2345 | Ga0439457_014431 | |||
| 2346 | Ga0439462_0005141 | |||
| 2347 | Ga0450911_005829 | |||
| 2348 | Ga0450913_020486 | |||
| 2349 | Ga0450919_010325 | |||
| 2350 | Ga0450920_000295 | |||
| 2351 | Ga0450920_000669 | |||
| 2352 | Ga0450897_009819 | |||
| 2353 | Ga0450906_029724 | |||
| 2354 | Ga0439446_0004453 | |||
| 2355 | Ga0450908_001583 | |||
| 2356 | Ga0439434_0022050 | |||
| 2357 | Ga0439444_0093361 | |||
| 2358 | Ga0450918_032822 | |||
| 2359 | Ga0450893_0032163 | |||
| 2360 | Ga0451577_0025642 | |||
| 2361 | Ga0439440_0123077 | |||
| 2362 | Ga0466972_0520052 | |||
| 2363 | Ga0466965_0174223 | |||
| 2364 | Ga0466966_0379690 | |||
| 2365 | Ga0466961_0077795 | |||
| 2366 | Ga0466963_0001595 | |||
| 2367 | Ga0466963_0018211 | |||
| 2368 | Ga0466963_0024634 | |||
| 2369 | Ga0466964_0013917 | |||
| 2370 | Ga0466964_0148855 | |||
| 2371 | Ga0453684_0044176 | |||
| 2372 | Ga0453684_0707931 | |||
| 2373 | Ga0466968_0022051 | |||
| 2374 | Ga0466970_0017892 | |||
| 2375 | Ga0466970_0142624 | |||
| 2376 | Ga0466970_0169428 | |||
| 2377 | Ga0466957_0050530 | |||
| 2378 | Ga0466960_0003429 | |||
| 2379 | Ga0466960_0016338 | |||
| 2380 | Ga0466958_0482519 | |||
| 2381 | Ga0466967_0000028 | |||
| 2382 | Ga0466967_0001037 | |||
| 2383 | Ga0466967_0015794 | |||
| 2384 | Ga0466967_1026256 | |||
| 2385 | Ga0495592_0029720 | |||
| 2386 | Ga0495603_0022783 | |||
| 2387 | Ga0495603_0152852 | |||
| 2388 | Ga0495603_0176632 | |||
| 2389 | Ga0495590_0099476 | |||
| 2390 | Ga0495590_0159729 | |||
| 2391 | Ga0495629_0043473 | |||
| 2392 | Ga0495629_0120149 | |||
| 2393 | Ga0495641_0013713 | |||
| 2394 | Ga0495651_0057234 | |||
| 2395 | Ga0495653_0000468 | |||
| 2396 | Ga0495653_0031269 | |||
| 2397 | Ga0495580_0237772 | |||
| 2398 | Ga0495582_0029166 | |||
| 2399 | Ga0495582_0071781 | |||
| 2400 | Ga0495582_0266851 | |||
| 2401 | Ga0495582_0533634 | |||
| 2402 | Ga0495605_0050585 | |||
| 2403 | Ga0495605_0289369 | |||
| 2404 | Ga0495605_0310538 | |||
| 2405 | Ga0495639_0002895 | |||
| 2406 | Ga0495639_0220327 | |||
| 2407 | Ga0495662_0055307 | |||
| 2408 | Ga0495662_0076298 | |||
| 2409 | Ga0495664_0053009 | |||
| 2410 | Ga0495584_0080076 | |||
| 2411 | Ga0495584_0090453 | |||
| 2412 | Ga0495584_0437258 | |||
| 2413 | Ga0495585_0169633 | |||
| 2414 | Ga0495585_0349262 | |||
| 2415 | Ga0495594_0048752 | |||
| 2416 | Ga0495594_0066109 | |||
| 2417 | Ga0495596_0177482 | |||
| 2418 | Ga0495608_0130158 | |||
| 2419 | Ga0495608_0140439 | |||
| 2420 | Ga0495618_0031364 | |||
| 2421 | Ga0495618_0198257 | |||
| 2422 | Ga0495630_0006446 | |||
| 2423 | Ga0495630_0065030 | |||
| 2424 | Ga0495630_0925674 | |||
| 2425 | Ga0495631_0053942 | |||
| 2426 | Ga0495631_0209104 | |||
| 2427 | Ga0495663_0008411 | |||
| 2428 | Ga0495663_0019481 | |||
| 2429 | Ga0495666_0074730 | |||
| 2430 | Ga0495642_0064715 | |||
| 2431 | Ga0495642_0271076 | |||
| 2432 | Ga0495665_0000658 | |||
| 2433 | Ga0495665_0030148 | |||
| 2434 | Ga0495640_0448158 | |||
| 2435 | Ga0495586_0187369 | |||
| 2436 | Ga0495586_0192398 | |||
| 2437 | Ga0495587_0003469 | |||
| 2438 | Ga0495609_0020981 | |||
| 2439 | Ga0495597_0245477 | |||
| 2440 | Ga0495645_0008819 | |||
| 2441 | Ga0495645_0151015 | |||
| 2442 | Ga0495667_0031825 | |||
| 2443 | Ga0495667_0102772 | |||
| 2444 | Ga0495667_0474424 | |||
| 2445 | Ga0495656_0015894 | |||
| 2446 | Ga0495656_0061734 | |||
| 2447 | Ga0495656_0069947 | |||
| 2448 | Ga0495668_0063832 | |||
| 2449 | Ga0495668_0406748 | |||
| 2450 | Ga0495634_0116227 | |||
| 2451 | Ga0495611_0054018 | |||
| 2452 | Ga0495611_0086887 | |||
| 2453 | Ga0495611_0353727 | |||
| 2454 | Ga0495635_0367315 | |||
| 2455 | Ga0495659_0002547 | |||
| 2456 | Ga0495659_0006374 | |||
| 2457 | Ga0495588_0070652 | |||
| 2458 | Ga0495588_0094490 | |||
| 2459 | Ga0495588_0139940 | |||
| 2460 | Ga0495588_0185781 | |||
| 2461 | Ga0495657_0044514 | |||
| 2462 | Ga0495657_0051705 | |||
| 2463 | Ga0495657_0423173 | |||
| 2464 | Ga0495599_0141266 | |||
| 2465 | Ga0495623_0008339 | |||
| 2466 | Ga0495647_0065692 | |||
| 2467 | Ga0495658_0005078 | |||
| 2468 | Ga0495658_0027216 | |||
| 2469 | Ga0495613_0003796 | |||
| 2470 | Ga0495613_0128807 | |||
| 2471 | Ga0495613_0277417 | |||
| 2472 | Ga0495624_0011307 | |||
| 2473 | Ga0495670_0002814 | |||
| 2474 | Ga0495670_0508902 | |||
| 2475 | Ga0495671_0352538 | |||
| 2476 | Ga0495600_0180032 | |||
| 2477 | Ga0495600_0208952 | |||
| 2478 | Ga0495581_0001440 | |||
| 2479 | Ga0495581_0007081 | |||
| 2480 | Ga0495581_0071127 | |||
| 2481 | Ga0495604_0064049 | |||
| 2482 | Ga0495636_0012871 | |||
| 2483 | Ga0495636_0144520 | |||
| 2484 | Ga0495674_0020283 | |||
| 2485 | Ga0495674_0086940 | |||
| 2486 | Ga0495674_0256009 | |||
| 2487 | Ga0495676_0056472 | |||
| 2488 | Ga0495680_0039805 | |||
| 2489 | Ga0495680_0086203 | |||
| 2490 | Ga0495680_0238366 | |||
| 2491 | Ga0495675_0235890 | |||
| 2492 | Ga0495677_0036129 | |||
| 2493 | Ga0495677_0120551 | |||
| 2494 | Ga0495681_0113294 | |||
| 2495 | Ga0495684_0032299 | |||
| 2496 | Ga0495602_0279561 | |||
| 2497 | Ga0495626_0167153 | |||
| 2498 | Ga0496100_0004896 | |||
| 2499 | Ga0496100_0014091 | |||
| 2500 | Ga0496100_0018966 | |||
| 2501 | Ga0496100_0079001 | |||
| 2502 | Ga0496100_0442488 | |||
| 2503 | Ga0496101_0008894 | |||
| 2504 | Ga0496101_0016013 | |||
| 2505 | Ga0496101_0025311 | |||
| 2506 | Ga0496101_0224918 | |||
| 2507 | Ga0496101_0239064 | |||
| 2508 | Ga0496101_0491685 | |||
| 2509 | Ga0496102_0018764 | |||
| 2510 | Ga0496102_0019938 | |||
| 2511 | Ga0496102_0192977 | |||
| 2512 | Ga0496102_0228941 | |||
| 2513 | Ga0496102_0945920 | |||
| 2514 | Ga0496103_0002999 | |||
| 2515 | Ga0496103_0016111 | |||
| 2516 | Ga0496103_0059187 | |||
| 2517 | Ga0496103_0135530 | |||
| 2518 | Ga0496103_0343106 | |||
| 2519 | Ga0496104_0012176 | |||
| 2520 | Ga0496104_0020628 | |||
| 2521 | Ga0496104_0023001 | |||
| 2522 | Ga0496104_0189050 | |||
| 2523 | Ga0496104_0338271 | |||
| 2524 | Ga0496105_0025687 | |||
| 2525 | Ga0496105_0040567 | |||
| 2526 | Ga0496105_0087548 | |||
| 2527 | Ga0496105_0252189 | |||
| 2528 | Ga0496105_0538305 | |||
| 2529 | Ga0496105_0541858 | |||
| 2530 | Ga0496105_0599920 | |||
| 2531 | Ga0496106_0009515 | |||
| 2532 | Ga0496106_0032549 | |||
| 2533 | Ga0496106_0152759 | |||
| 2534 | Ga0496106_0174141 | |||
| 2535 | Ga0496106_0243879 | |||
| 2536 | Ga0496106_0423164 | |||
| 2537 | Ga0496106_0599037 | |||
| 2538 | Ga0496107_0034036 | |||
| 2539 | Ga0496107_0134688 | |||
| 2540 | Ga0496107_0203368 | |||
| 2541 | Ga0496108_0005647 | |||
| 2542 | Ga0496108_0020153 | |||
| 2543 | Ga0496108_0024660 | |||
| 2544 | Ga0496108_0030496 | |||
| 2545 | Ga0496108_0105497 | |||
| 2546 | Ga0496108_0142051 | |||
| 2547 | Ga0496108_0149193 | |||
| 2548 | Ga0496108_0221419 | |||
| 2549 | Ga0496108_0366804 | |||
| 2550 | Ga0496108_0517678 | |||
| 2551 | Ga0496109_0000913 | |||
| 2552 | Ga0496109_0011225 | |||
| 2553 | Ga0496109_0045636 | |||
| 2554 | Ga0496109_0048258 | |||
| 2555 | Ga0496109_0050316 | |||
| 2556 | Ga0496109_0068168 | |||
| 2557 | Ga0496109_0072125 | |||
| 2558 | Ga0496109_0122267 | |||
| 2559 | Ga0496109_0174949 | |||
| 2560 | Ga0496109_0178720 | |||
| 2561 | Ga0496109_1006068 | |||
| 2562 | Ga0496110_0003661 | |||
| 2563 | Ga0496110_0008390 | |||
| 2564 | Ga0496110_0034761 | |||
| 2565 | Ga0496110_0074161 | |||
| 2566 | Ga0496110_0085681 | |||
| 2567 | Ga0496110_0176871 | |||
| 2568 | Ga0496110_0343249 | |||
| 2569 | Ga0496110_0356231 | |||
| 2570 | Ga0496110_0483492 | |||
| 2571 | Ga0496110_0527959 | |||
| 2572 | Ga0496110_0732284 | |||
| 2573 | Ga0496110_0845802 | |||
| 2574 | Ga0496110_1165479 | |||
| 2575 | Ga0496111_0003623 | |||
| 2576 | Ga0496111_0003720 | |||
| 2577 | Ga0496111_0010934 | |||
| 2578 | Ga0496111_0018694 | |||
| 2579 | Ga0496111_0036855 | |||
| 2580 | Ga0496111_0043737 | |||
| 2581 | Ga0496111_0044395 | |||
| 2582 | Ga0496111_0064517 | |||
| 2583 | Ga0496111_0078428 | |||
| 2584 | Ga0496111_0089871 | |||
| 2585 | Ga0496111_0158427 | |||
| 2586 | Ga0496111_0476003 | |||
| 2587 | Ga0496112_0006002 | |||
| 2588 | Ga0496112_0018396 | |||
| 2589 | Ga0496112_0020095 | |||
| 2590 | Ga0496112_0034386 | |||
| 2591 | Ga0496112_0114368 | |||
| 2592 | Ga0496112_0118964 | |||
| 2593 | Ga0496112_0150253 | |||
| 2594 | Ga0496112_0368599 | |||
| 2595 | Ga0496112_0479672 | |||
| 2596 | Ga0496112_0596768 | |||
| 2597 | Ga0496112_1086817 | |||
| 2598 | Ga0496112_1377050 | |||
| 2599 | Ga0496113_0003267 | |||
| 2600 | Ga0496113_0042109 | |||
| 2601 | Ga0496113_0116988 | |||
| 2602 | Ga0496113_0178607 | |||
| 2603 | Ga0496113_0196438 | |||
| 2604 | Ga0496113_0644727 | |||
| 2605 | Ga0496114_0000073 | |||
| 2606 | Ga0496114_0010517 | |||
| 2607 | Ga0496114_0012084 | |||
| 2608 | Ga0496114_0034641 | |||
| 2609 | Ga0496114_0066003 | |||
| 2610 | Ga0496114_0119666 | |||
| 2611 | Ga0496115_0057615 | |||
| 2612 | Ga0496115_0252868 | |||
| 2613 | Ga0496115_0412223 | |||
| 2614 | Ga0496115_0460898 | |||
| 2615 | Ga0496122_0000427 | |||
| 2616 | Ga0496123_0001011 | |||
| 2617 | Ga0496124_0002673 | |||
| 2618 | Ga0496125_0000558 | |||
| 2619 | Ga0496125_0138813 | |||
| 2620 | Ga0501317_026060 | |||
| 2621 | Ga0501317_027196 | |||
| 2622 | Ga0501324_010065 | |||
| 2623 | Ga0501324_026137 | |||
| 2624 | Ga0501031_0002646 | |||
| 2625 | Ga0501031_0004843 | |||
| 2626 | Ga0501031_0075736 | |||
| 2627 | Ga0501032_0000158 | |||
| 2628 | Ga0501032_0004426 | |||
| 2629 | Ga0501032_0175909 | |||
| 2630 | Ga0501032_0191664 | |||
| 2631 | Ga0501032_0325055 | |||
| 2632 | Ga0501033_0007557 | |||
| 2633 | Ga0501033_0046670 | |||
| 2634 | Ga0501034_0000141 | |||
| 2635 | Ga0501036_0001775 | |||
| 2636 | Ga0501036_0035440 | |||
| 2637 | Ga0501036_0080888 | |||
| 2638 | Ga0501036_0146730 | |||
| 2639 | Ga0501038_0005105 | |||
| 2640 | Ga0501038_0010377 | |||
| 2641 | Ga0501038_0063650 | |||
| 2642 | Ga0501038_0119318 | |||
| 2643 | Ga0501038_0163802 | |||
| 2644 | Ga0501039_0027976 | |||
| 2645 | Ga0501039_0348588 | |||
| 2646 | Ga0501040_0006969 | |||
| 2647 | Ga0501040_0139350 | |||
| 2648 | Ga0501040_0144740 | |||
| 2649 | Ga0501040_0228509 | |||
| 2650 | Ga0501041_0008144 | |||
| 2651 | Ga0501041_0051941 | |||
| 2652 | Ga0501041_0070571 | |||
| 2653 | Ga0501041_0549791 | |||
| 2654 | Ga0501042_0019090 | |||
| 2655 | Ga0501042_0024287 | |||
| 2656 | Ga0501042_0085537 | |||
| 2657 | Ga0501042_0090478 | |||
| 2658 | Ga0501042_0099943 | |||
| 2659 | Ga0501042_0310153 | |||
| 2660 | Ga0501042_1260572 | |||
| 2661 | Ga0501043_0002861 | |||
| 2662 | Ga0501043_0018421 | |||
| 2663 | Ga0501043_0116703 | |||
| 2664 | Ga0501043_0128522 | |||
| 2665 | Ga0501043_0145751 | |||
| 2666 | Ga0501043_0804677 | |||
| 2667 | Ga0501046_0008318 | |||
| 2668 | Ga0501046_0013675 | |||
| 2669 | Ga0501046_0243456 | |||
| 2670 | Ga0501047_0902762 | |||
| 2671 | Ga0501048_0039171 | |||
| 2672 | Ga0501048_0119473 | |||
| 2673 | Ga0501048_0135899 | |||
| 2674 | Ga0501048_0148590 | |||
| 2675 | Ga0501048_0153913 | |||
| 2676 | Ga0501067_0026343 | |||
| 2677 | Ga0501067_0225698 | |||
| 2678 | Ga0501068_0000514 | |||
| 2679 | Ga0501068_0012529 | |||
| 2680 | Ga0501068_0040285 | |||
| 2681 | Ga0501068_0063650 | |||
| 2682 | Ga0501068_0203249 | |||
| 2683 | Ga0501068_0341923 | |||
| 2684 | Ga0501069_0023524 | |||
| 2685 | Ga0501069_0060023 | |||
| 2686 | Ga0501069_0112565 | |||
| 2687 | Ga0501069_0192951 | |||
| 2688 | Ga0501070_0019413 | |||
| 2689 | Ga0501070_0021603 | |||
| 2690 | Ga0501070_0032073 | |||
| 2691 | Ga0501071_0003854 | |||
| 2692 | Ga0501071_0004163 | |||
| 2693 | Ga0501071_0012653 | |||
| 2694 | Ga0501071_0069995 | |||
| 2695 | Ga0501071_0178201 | |||
| 2696 | Ga0501071_0238836 | |||
| 2697 | Ga0501071_0250655 | |||
| 2698 | Ga0501072_0009755 | |||
| 2699 | Ga0501072_0023700 | |||
| 2700 | Ga0501072_0077038 | |||
| 2701 | Ga0501072_0088751 | |||
| 2702 | Ga0501072_0117070 | |||
| 2703 | Ga0501072_0161140 | |||
| 2704 | Ga0501072_0242432 | |||
| 2705 | Ga0501072_0333942 | |||
| 2706 | Ga0501072_1070794 | |||
| 2707 | Ga0501073_0001537 | |||
| 2708 | Ga0501073_0007238 | |||
| 2709 | Ga0501073_0241273 | |||
| 2710 | Ga0501073_0323695 | |||
| 2711 | Ga0501074_0001777 | |||
| 2712 | Ga0501074_0003435 | |||
| 2713 | Ga0501074_0070397 | |||
| 2714 | Ga0501074_0153514 | |||
| 2715 | Ga0501074_0335740 | |||
| 2716 | Ga0501075_0000318 | |||
| 2717 | Ga0501075_0013143 | |||
| 2718 | Ga0501075_0033028 | |||
| 2719 | Ga0501075_0068115 | |||
| 2720 | Ga0501075_0217360 | |||
| 2721 | Ga0501075_0574982 | |||
| 2722 | Ga0501076_0012413 | |||
| 2723 | Ga0501076_0030863 | |||
| 2724 | Ga0501076_0031835 | |||
| 2725 | Ga0501076_0043708 | |||
| 2726 | Ga0501076_0045049 | |||
| 2727 | Ga0501076_0129445 | |||
| 2728 | Ga0501076_0202578 | |||
| 2729 | Ga0501076_0489681 | |||
| 2730 | Ga0501077_0002406 | |||
| 2731 | Ga0501077_0033658 | |||
| 2732 | Ga0501077_0034848 | |||
| 2733 | Ga0501077_0046784 | |||
| 2734 | Ga0501077_0063333 | |||
| 2735 | Ga0501077_0101908 | |||
| 2736 | Ga0501227_033330 | |||
| 2737 | Ga0501247_009835 | |||
| 2738 | Ga0501253_022460 | |||
| 2739 | Ga0501079_0004813 | |||
| 2740 | Ga0501079_0004932 | |||
| 2741 | Ga0501079_0006316 | |||
| 2742 | Ga0501079_0139639 | |||
| 2743 | Ga0501079_0258634 | |||
| 2744 | Ga0501079_0317474 | |||
| 2745 | Ga0501079_0472073 | |||
| 2746 | Ga0501079_0607053 | |||
| 2747 | Ga0501079_0957743 | |||
| 2748 | Ga0501080_0010019 | |||
| 2749 | Ga0501080_0025475 | |||
| 2750 | Ga0501080_0079970 | |||
| 2751 | Ga0501080_0097163 | |||
| 2752 | Ga0501080_0224667 | |||
| 2753 | Ga0501081_0010443 | |||
| 2754 | Ga0501081_0011323 | |||
| 2755 | Ga0501081_0031416 | |||
| 2756 | Ga0501081_0036589 | |||
| 2757 | Ga0501081_0107777 | |||
| 2758 | Ga0501081_0254567 | |||
| 2759 | Ga0501081_0271699 | |||
| 2760 | Ga0501083_0001510 | |||
| 2761 | Ga0501083_0002103 | |||
| 2762 | Ga0501083_0003155 | |||
| 2763 | Ga0501083_0005310 | |||
| 2764 | Ga0501083_0083373 | |||
| 2765 | Ga0501264_023486 | |||
| 2766 | Ga0501279_003264 | |||
| 2767 | Ga0501035_0005138 | |||
| 2768 | Ga0501035_0157653 | |||
| 2769 | Ga0501035_0363860 | |||
| 2770 | Ga0501035_0475511 | |||
| 2771 | Ga0501044_0009712 | |||
| 2772 | Ga0501044_0057767 | |||
| 2773 | Ga0501045_0000615 | |||
| 2774 | Ga0501045_0004328 | |||
| 2775 | Ga0501045_0008281 | |||
| 2776 | Ga0501045_0193242 | |||
| 2777 | Ga0501045_0866228 | |||
| 2778 | nmdc:mga03n38_9964_c1 | |||
| 2779 | nmdc:mga00v17_342506_c1 | |||
| 2780 | nmdc:mga00v17_9451_c1 | |||
| 2781 | nmdc:mga0yw44_127178_c1 | |||
| 2782 | nmdc:mga0yw44_399598_c1 | |||
| 2783 | nmdc:mga0yw44_52492_c1 | |||
| 2784 | nmdc:mga0yw44_712873_c1 | |||
| 2785 | nmdc:mga05p37_1395582_c1 | |||
| 2786 | nmdc:mga05p37_145010_c1 | |||
| 2787 | nmdc:mga05p37_1569855_c1 | |||
| 2788 | nmdc:mga05p37_1635713_c1 | |||
| 2789 | nmdc:mga05p37_178562_c1 | |||
| 2790 | nmdc:mga05p37_299781_c1 | |||
| 2791 | nmdc:mga05p37_479790_c1 | |||
| 2792 | nmdc:mga05p37_49969_c1 | |||
| 2793 | nmdc:mga05p37_600807_c1 | |||
| 2794 | nmdc:mga05p37_69160_c1 | |||
| 2795 | nmdc:mga09592_1010633_c1 | |||
| 2796 | nmdc:mga09592_176122_c1 | |||
| 2797 | nmdc:mga09592_224529_c1 | |||
| 2798 | nmdc:mga09592_60186_c1 | |||
| 2799 | nmdc:mga09592_89167_c1 | |||
| 2800 | nmdc:mga0qj67_10209_c1 | |||
| 2801 | nmdc:mga0qj67_162012_c1 | |||
| 2802 | nmdc:mga0qj67_297864_c1 | |||
| 2803 | nmdc:mga0qj67_630985_c1 | |||
| 2804 | nmdc:mga06r32_127606_c1 | |||
| 2805 | nmdc:mga06r32_188480_c1 | |||
| 2806 | nmdc:mga06r32_52748_c1 | |||
| 2807 | nmdc:mga06r32_81576_c1 | |||
| 2808 | nmdc:mga08y16_1029998_c1 | |||
| 2809 | nmdc:mga08y16_111806_c1 | |||
| 2810 | nmdc:mga08y16_117153_c1 | |||
| 2811 | nmdc:mga08y16_156439_c1 | |||
| 2812 | nmdc:mga08y16_27126_c1 | |||
| 2813 | nmdc:mga08y16_50086_c1 | |||
| 2814 | nmdc:mga08y16_631467_c1 | |||
| 2815 | nmdc:mga08y16_80356_c1 | |||
| 2816 | nmdc:mga0n895_144540_c1 | |||
| 2817 | nmdc:mga0n895_147802_c1 | |||
| 2818 | nmdc:mga0n895_271932_c1 | |||
| 2819 | nmdc:mga0n895_300404_c1 | |||
| 2820 | nmdc:mga0n895_394614_c1 | |||
| 2821 | nmdc:mga0n895_639982_c1 | |||
| 2822 | nmdc:mga0n895_66856_c1 | |||
| 2823 | nmdc:mga0n895_70967_c1 | |||
| 2824 | nmdc:mga0n895_712362_c1 | |||
| 2825 | nmdc:mga0n895_871526_c1 | |||
| 2826 | nmdc:mga0rr50_21282_c1 | |||
| 2827 | nmdc:mga0rr50_247054_c1 | |||
| 2828 | nmdc:mga08x19_105160_c1 | |||
| 2829 | nmdc:mga08x19_22590_c1 | |||
| 2830 | nmdc:mga08x19_23001_c1 | |||
| 2831 | nmdc:mga08x19_26956_c1 | |||
| 2832 | nmdc:mga08x19_37657_c1 | |||
| 2833 | nmdc:mga08x19_4565_c1 | |||
| 2834 | nmdc:mga0a205_156520_c1 | |||
| 2835 | nmdc:mga0a205_172887_c1 | |||
| 2836 | nmdc:mga0a205_32521_c1 | |||
| 2837 | nmdc:mga0a205_352026_c1 | |||
| 2838 | nmdc:mga0a205_41155_c1 | |||
| 2839 | nmdc:mga0a205_441599_c1 | |||
| 2840 | nmdc:mga0a205_9333_c2 | |||
| 2841 | Ga0495601_0180556 | |||
| 2842 | Ga0495619_0071754 | |||
| 2843 | Ga0495619_0495695 | |||
| 2844 | Ga0501084_0007220 | |||
| 2845 | Ga0501084_0032455 | |||
| 2846 | Ga0501084_0060012 | |||
| 2847 | Ga0501084_0231548 | |||
| 2848 | Ga0501084_0265726 | |||
| 2849 | Ga0501084_0320345 | |||
| 2850 | Ga0501084_0458524 | |||
| 2851 | Ga0501084_0717732 | |||
| 2852 | Ga0587090_037235 | |||
| 2853 | Ga0501082_0001521 | |||
| 2854 | Ga0501082_0035827 | |||
| 2855 | Ga0501082_0060429 | |||
| 2856 | Ga0501082_0068456 | |||
| 2857 | Ga0501082_0071244 | |||
| 2858 | Ga0501082_0099068 | |||
| 2859 | Ga0501082_0420130 | |||
| 2860 | Ga0501082_0910596 | |||
| 2861 | Ga0530510_0075602 | |||
| 2862 | Ga0530510_0083097 | |||
| 2863 | Ga0530510_0174248 | |||
| 2864 | Ga0530510_0352520 | |||
| 2865 | Ga0530510_0407865 | |||
| 2866 | 2906802893 | |||
| 2867 | 2932430801 | |||
| 2868 | 2933419480 | |||
| 2869 | 2939650875 | |||
| 2870 | 2939675649 | |||
| 2871 | 2946060958 | |||
| 2872 | 8054108670 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qxx-assembly1.cif.gz_A | bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp | 0.9681 | 1 | 189 |
| 4a6a-assembly1.cif.gz_F | a115v variant of dctp deaminase-dutpase from mycobacterium tuberculosis in complex with dttp | 0.9649 | 1 | 189 |
| 2qxx-assembly1.cif.gz_A | bifunctional dctp deaminase: dutpase from mycobacterium tuberculosis in complex with dttp | 0.9631 | 1 | 189 |
| 2qlp-assembly2.cif.gz_E | bifunctional dctp deaminase:dutpase from mycobacterium tuberculosis, apo form | 0.962 | 1 | 159 |
| 4a6a-assembly1.cif.gz_F | a115v variant of dctp deaminase-dutpase from mycobacterium tuberculosis in complex with dttp | 0.9599 | 1 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a6aA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9633 | 1 | 189 | 2.70.40.10 |
| 2qlpA01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.96 | 1 | 154 | 2.70.40.10 |
| 4a6aA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9584 | 1 | 189 | 2.70.40.10 |
| 2qlpA01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.954 | 1 | 154 | 2.70.40.10 |
| 4xjcF00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9333 | 1 | 183 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0L9R1-F1-model_v4 | deleted | 0.9851 | 1 | 105 |
|
| AF-A0A2H1KJL0-F1-model_v4 | dCTP deaminase, dUMP-forming (EC 3.5.4.30) (Bifunctional dCTP deaminase:dUTPase) (DCD-DUT) | 0.9798 | 1 | 191 |
GO:0000166
GO:0006226 GO:0006229 GO:0008829 GO:0015949 GO:0033973 |
| AF-A0A5S4FKZ9-F1-model_v4 | dCTP deaminase, dUMP-forming (EC 3.5.4.30) (Bifunctional dCTP deaminase:dUTPase) (DCD-DUT) | 0.9794 | 1 | 191 |
GO:0000166
GO:0006226 GO:0006229 GO:0008829 GO:0015949 GO:0033973 |
| AF-A0A538FBU6-F1-model_v4 | dCTP deaminase (EC 3.5.4.13) | 0.9792 | 1 | 103 |
GO:0006229
GO:0008829 GO:0015949 |
| AF-A0A4Y3NNI2-F1-model_v4 | dCTP deaminase, dUMP-forming (EC 3.5.4.30) (Bifunctional dCTP deaminase:dUTPase) (DCD-DUT) | 0.9788 | 1 | 191 |
GO:0000166
GO:0006226 GO:0006229 GO:0008829 GO:0015949 GO:0033973 |