F493926

General Info

Members Datasets Scaffolds Average Seq Length
1433 420 2866 182

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0139669|Ga0466964_0139669_312_974
Length 220
Sequence MPADGRSLRPCIALAECARIDERRPAGASKLATVALGDLWNRTLVYFGIAEEDDDWDDEDGYAAEESLEQTYRERPNVRRLTPRRRGHDYDDWTESESDAQTARAPAIRQARLRDARPQIEAVPGPSSVRVHLILPRSFNDAQQIADRFKSGMPVILNLQSADAELSKRLIDFTSGLTYALNGGMQRVADKVFLLTPRNVEVSAEQRAQLLERGGFFNQA

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
190 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
213 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
214 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
215 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
216 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
217 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
218 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
219 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
263 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
268 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
269 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
270 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
271 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
272 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
273 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
347 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
373 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
413 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
414 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
417 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
420 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 12.49
Rhizosphere 84.44
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0139669 3300044706 Bacteria 1112
2 JGI24744J21845_10000431 3300002077 Bacteria 7361
3 JGI24742J22300_10016012 3300002244 Bacteria 1263
4 Ga0070658_10011654 3300005327 Bacteria 7051
5 Ga0070658_10296871 3300005327 Bacteria 1377
6 Ga0070658_10409779 3300005327 Bacteria 1165
7 Ga0070683_100005463 3300005329 Bacteria 10618
8 Ga0070683_100014696 3300005329 Bacteria 6858
9 Ga0070683_100033750 3300005329 Bacteria 4668
10 Ga0070683_100046782 3300005329 Bacteria 3998
11 Ga0070683_100052937 3300005329 Bacteria 3761
12 Ga0070683_100057024 3300005329 Bacteria 3628
13 Ga0070683_100145725 3300005329 Bacteria 2243
14 Ga0070683_100260471 3300005329 Bacteria 1649
15 Ga0070683_101031923 3300005329 Bacteria 790
16 Ga0070683_101366492 3300005329 Bacteria 681
17 Ga0070690_100067093 3300005330 Bacteria 2324
18 Ga0068869_100920356 3300005334 Bacteria 758
19 Ga0070666_10045238 3300005335 Bacteria 2950
20 Ga0070680_100003716 3300005336 Bacteria 11400
21 Ga0070680_100008678 3300005336 Bacteria 7791
22 Ga0070680_100020219 3300005336 Bacteria 5282
23 Ga0070680_100054779 3300005336 Bacteria 3257
24 Ga0070680_100067838 3300005336 Bacteria 2927
25 Ga0070680_100269750 3300005336 Bacteria 1441
26 Ga0070682_100010000 3300005337 Bacteria 5373
27 Ga0070682_100041215 3300005337 Bacteria 2845
28 Ga0070682_100285584 3300005337 Unclassified 1205
29 Ga0070682_100461932 3300005337 Bacteria 975
30 Ga0068868_100022279 3300005338 Bacteria 4778
31 Ga0068868_100030281 3300005338 Bacteria 4150
32 Ga0068868_100069123 3300005338 Bacteria 2814
33 Ga0070660_100003611 3300005339 Bacteria 10692
34 Ga0070660_100003619 3300005339 Bacteria 10672
35 Ga0070660_100006608 3300005339 Bacteria 8047
36 Ga0070660_100051211 3300005339 Bacteria 3179
37 Ga0070660_100105017 3300005339 Bacteria 2241
38 Ga0070660_100124802 3300005339 Bacteria 2057
39 Ga0070660_100214122 3300005339 Bacteria 1564
40 Ga0070660_100309215 3300005339 Bacteria 1297
41 Ga0070689_100019349 3300005340 Bacteria 5034
42 Ga0070691_10010579 3300005341 Bacteria 4213
43 Ga0070691_10159814 3300005341 Bacteria 1161
44 Ga0070661_100020146 3300005344 Bacteria 4755
45 Ga0070661_100070569 3300005344 Bacteria 2569
46 Ga0070661_100194475 3300005344 Bacteria 1548
47 Ga0070661_100357842 3300005344 Bacteria 1146
48 Ga0070692_10171546 3300005345 Bacteria 1251
49 Ga0070669_100432472 3300005353 Bacteria 1082
50 Ga0070671_100016842 3300005355 Bacteria 5910
51 Ga0070671_100051304 3300005355 Bacteria 3431
52 Ga0070671_100153201 3300005355 Bacteria 1947
53 Ga0070671_100186333 3300005355 Bacteria 1758
54 Ga0070674_100001733 3300005356 Bacteria 11819
55 Ga0070674_100029669 3300005356 Bacteria 3607
56 Ga0070674_100118210 3300005356 Bacteria 1958
57 Ga0070674_100120644 3300005356 Bacteria 1940
58 Ga0070674_100413578 3300005356 Bacteria 1105
59 Ga0070688_100022203 3300005365 Bacteria 3714
60 Ga0070659_100006422 3300005366 Bacteria 8489
61 Ga0070659_100026883 3300005366 Bacteria 4429
62 Ga0070659_100068194 3300005366 Bacteria 2821
63 Ga0070659_101031944 3300005366 Bacteria 723
64 Ga0070667_100156947 3300005367 Unclassified 2002
65 Ga0070703_10058935 3300005406 Bacteria 1251
66 Ga0070709_10087479 3300005434 Bacteria 2047
67 Ga0070709_10105974 3300005434 Unclassified 1881
68 Ga0070709_10133658 3300005434 Bacteria 1696
69 Ga0070709_10307333 3300005434 Bacteria 1160
70 Ga0070709_10511240 3300005434 Bacteria 914
71 Ga0070714_100061015 3300005435 Bacteria 3237
72 Ga0070714_100068287 3300005435 Bacteria 3066
73 Ga0070714_100135410 3300005435 Unclassified 2205
74 Ga0070714_100158496 3300005435 Bacteria 2045
75 Ga0070714_100630577 3300005435 Bacteria 1031
76 Ga0070714_100753440 3300005435 Bacteria 941
77 Ga0070714_101385433 3300005435 Bacteria 687
78 Ga0070713_100016916 3300005436 Bacteria 5496
79 Ga0070713_100023552 3300005436 Bacteria 4780
80 Ga0070713_100051791 3300005436 Bacteria 3397
81 Ga0070713_100138374 3300005436 Bacteria 2154
82 Ga0070713_100163048 3300005436 Unclassified 1991
83 Ga0070713_100176256 3300005436 Bacteria 1919
84 Ga0070713_100184083 3300005436 Bacteria 1878
85 Ga0070713_100329669 3300005436 Bacteria 1412
86 Ga0070710_10007274 3300005437 Bacteria 5354
87 Ga0070710_10010539 3300005437 Bacteria 4543
88 Ga0070710_10060757 3300005437 Bacteria 2150
89 Ga0070701_10162227 3300005438 Bacteria 1295
90 Ga0070711_100003275 3300005439 Bacteria 9415
91 Ga0070711_100055389 3300005439 Bacteria 2739
92 Ga0070711_100059978 3300005439 Bacteria 2643
93 Ga0070711_100119762 3300005439 Bacteria 1945
94 Ga0070711_100212675 3300005439 Bacteria 1498
95 Ga0070705_100101127 3300005440 Bacteria 1820
96 Ga0070705_100531968 3300005440 Bacteria 898
97 Ga0070700_100002621 3300005441 Bacteria 9198
98 Ga0070700_100333315 3300005441 Bacteria 1119
99 Ga0070700_100448963 3300005441 Bacteria 981
100 Ga0070694_100568519 3300005444 Bacteria 910
101 Ga0070708_100013462 3300005445 Bacteria 6700
102 Ga0070708_100054645 3300005445 Bacteria 3548
103 Ga0070708_100175867 3300005445 Bacteria 2000
104 Ga0070708_100329009 3300005445 Bacteria 1440
105 Ga0070663_100366452 3300005455 Bacteria 1170
106 Ga0070663_100755587 3300005455 Unclassified 830
107 Ga0070678_100003222 3300005456 Bacteria 9060
108 Ga0070678_100015166 3300005456 Bacteria 4890
109 Ga0070678_100151821 3300005456 Bacteria 1867
110 Ga0070678_100420577 3300005456 Bacteria 1165
111 Ga0070678_100698144 3300005456 Unclassified 914
112 Ga0070681_10001213 3300005458 Bacteria 22417
113 Ga0070681_10003066 3300005458 Bacteria 15497
114 Ga0070681_10005979 3300005458 Bacteria 11789
115 Ga0070681_10099106 3300005458 Bacteria 2860
116 Ga0070681_10104999 3300005458 Bacteria 2767
117 Ga0070681_10381810 3300005458 Bacteria 1319
118 Ga0070681_10439244 3300005458 Bacteria 1217
119 Ga0068867_100040761 3300005459 Bacteria 3391
120 Ga0068867_100081693 3300005459 Bacteria 2437
121 Ga0068867_100109198 3300005459 Bacteria 2123
122 Ga0068867_100208271 3300005459 Bacteria 1569
123 Ga0070685_10001703 3300005466 Bacteria 11556
124 Ga0070706_100358021 3300005467 Bacteria 1360
125 Ga0070706_100736563 3300005467 Bacteria 913
126 Ga0070707_100005939 3300005468 Bacteria 11394
127 Ga0070707_100110992 3300005468 Unclassified 2659
128 Ga0070698_100028099 3300005471 Bacteria 5846
129 Ga0070698_100038691 3300005471 Bacteria 4914
130 Ga0070698_100053629 3300005471 Bacteria 4097
131 Ga0070698_100435010 3300005471 Bacteria 1247
132 Ga0070699_100061914 3300005518 Bacteria 3242
133 Ga0070699_100173579 3300005518 Bacteria 1911
134 Ga0070679_100004486 3300005530 Bacteria 12895
135 Ga0070679_100008211 3300005530 Bacteria 9814
136 Ga0070679_100019233 3300005530 Bacteria 6637
137 Ga0070679_100020574 3300005530 Bacteria 6435
138 Ga0070679_100058769 3300005530 Bacteria 3832
139 Ga0070679_100271748 3300005530 Bacteria 1649
140 Ga0070679_100302921 3300005530 Bacteria 1549
141 Ga0070679_100549503 3300005530 Unclassified 1099
142 Ga0070679_100780731 3300005530 Unclassified 898
143 Ga0070679_101071482 3300005530 Bacteria 750
144 Ga0070679_101520182 3300005530 Unclassified 616
145 Ga0070684_100007800 3300005535 Bacteria 8349
146 Ga0070684_100012798 3300005535 Bacteria 6738
147 Ga0070684_100013758 3300005535 Bacteria 6531
148 Ga0070684_100017138 3300005535 Bacteria 5937
149 Ga0070684_100044829 3300005535 Bacteria 3826
150 Ga0070684_100196926 3300005535 Bacteria 1835
151 Ga0070684_100318025 3300005535 Bacteria 1430
152 Ga0070684_100360746 3300005535 Bacteria 1337
153 Ga0070684_100558692 3300005535 Bacteria 1062
154 Ga0070684_100560603 3300005535 Bacteria 1060
155 Ga0070684_100654445 3300005535 Unclassified 978
156 Ga0070684_100799618 3300005535 Bacteria 881
157 Ga0070697_100196496 3300005536 Bacteria 1713
158 Ga0068853_100017800 3300005539 Bacteria 5867
159 Ga0068853_100092663 3300005539 Bacteria 2658
160 Ga0068853_100330881 3300005539 Bacteria 1413
161 Ga0070672_100022002 3300005543 Bacteria 4676
162 Ga0070672_100130107 3300005543 Bacteria 2068
163 Ga0070672_100623192 3300005543 Unclassified 941
164 Ga0070686_100002161 3300005544 Bacteria 10855
165 Ga0070686_100089922 3300005544 Bacteria 2052
166 Ga0070686_100102566 3300005544 Bacteria 1935
167 Ga0070695_100028871 3300005545 Bacteria 3444
168 Ga0070695_100310062 3300005545 Bacteria 1169
169 Ga0070696_100006574 3300005546 Bacteria 7761
170 Ga0070696_100022344 3300005546 Bacteria 4297
171 Ga0070696_100095507 3300005546 Bacteria 2123
172 Ga0070696_100128501 3300005546 Bacteria 1841
173 Ga0070693_100010437 3300005547 Bacteria 4654
174 Ga0070693_100025635 3300005547 Bacteria 3175
175 Ga0070693_100063632 3300005547 Bacteria 2151
176 Ga0070693_100240317 3300005547 Unclassified 1196
177 Ga0070693_100512464 3300005547 Bacteria 853
178 Ga0070665_100012505 3300005548 Bacteria 8552
179 Ga0070704_100017712 3300005549 Bacteria 4538
180 Ga0070704_100093177 3300005549 Bacteria 2250
181 Ga0070704_100137355 3300005549 Bacteria 1903
182 Ga0070704_100171840 3300005549 Bacteria 1725
183 Ga0070704_100503823 3300005549 Bacteria 1051
184 Ga0068855_100022769 3300005563 Bacteria 7508
185 Ga0068855_100063071 3300005563 Bacteria 4326
186 Ga0068855_100098614 3300005563 Bacteria 3366
187 Ga0068855_100116042 3300005563 Bacteria 3069
188 Ga0068855_100121526 3300005563 Bacteria 2989
189 Ga0068855_100163556 3300005563 Bacteria 2524
190 Ga0068855_100200959 3300005563 Bacteria 2243
191 Ga0068855_100556072 3300005563 Bacteria 1242
192 Ga0070664_100046670 3300005564 Bacteria 3659
193 Ga0070664_100050187 3300005564 Bacteria 3530
194 Ga0070664_100156584 3300005564 Bacteria 2013
195 Ga0070664_100373438 3300005564 Bacteria 1300
196 Ga0068857_100038252 3300005577 Bacteria 4249
197 Ga0068857_100066469 3300005577 Bacteria 3208
198 Ga0068857_100117615 3300005577 Bacteria 2392
199 Ga0068857_100287382 3300005577 Bacteria 1514
200 Ga0068857_100292510 3300005577 Bacteria 1500
201 Ga0068857_100620593 3300005577 Bacteria 1023
202 Ga0068854_100345818 3300005578 Bacteria 1216
203 Ga0068856_100006927 3300005614 Bacteria 11088
204 Ga0068856_100033618 3300005614 Bacteria 5022
205 Ga0068856_100035013 3300005614 Bacteria 4920
206 Ga0068856_100063290 3300005614 Bacteria 3655
207 Ga0068856_100081217 3300005614 Bacteria 3216
208 Ga0068856_100082703 3300005614 Bacteria 3187
209 Ga0068856_100139902 3300005614 Bacteria 2427
210 Ga0068856_100395413 3300005614 Bacteria 1402
211 Ga0070702_100007535 3300005615 Bacteria 5215
212 Ga0070702_100043548 3300005615 Bacteria 2530
213 Ga0070702_100231515 3300005615 Bacteria 1242
214 Ga0068852_100027110 3300005616 Bacteria 4665
215 Ga0068852_100092269 3300005616 Bacteria 2711
216 Ga0068859_100198475 3300005617 Bacteria 2091
217 Ga0068864_100205333 3300005618 Bacteria 1812
218 Ga0068864_100244089 3300005618 Bacteria 1665
219 Ga0068861_100292671 3300005719 Unclassified 1407
220 Ga0068861_100725990 3300005719 Bacteria 926
221 Ga0068851_10373505 3300005834 Bacteria 834
222 Ga0068870_10143152 3300005840 Bacteria 1401
223 Ga0068870_10294638 3300005840 Bacteria 1022
224 Ga0068860_100104907 3300005843 Bacteria 2699
225 Ga0068860_101434475 3300005843 Bacteria 712
226 Ga0081455_10021153 3300005937 Bacteria 6109
227 Ga0081455_10039632 3300005937 Bacteria 4161
228 Ga0081540_1014735 3300005983 Bacteria 4990
229 Ga0081539_10000041 3300005985 Bacteria 292660
230 Ga0081539_10003477 3300005985 Bacteria 19242
231 Ga0081539_10089492 3300005985 Bacteria 1594
232 Ga0070717_10013145 3300006028 Bacteria 6327
233 Ga0070717_10064666 3300006028 Bacteria 3039
234 Ga0070717_10466886 3300006028 Bacteria 1139
235 Ga0075365_10439220 3300006038 Bacteria 921
236 Ga0075364_10037251 3300006051 Bacteria 3148
237 Ga0075432_10058954 3300006058 Bacteria 1364
238 Ga0070715_10002468 3300006163 Bacteria 5682
239 Ga0070715_10049790 3300006163 Bacteria 1796
240 Ga0070715_10108688 3300006163 Bacteria 1305
241 Ga0070716_100003252 3300006173 Bacteria 7632
242 Ga0070716_100108668 3300006173 Bacteria 1714
243 Ga0070716_100205301 3300006173 Bacteria 1313
244 Ga0070712_100033376 3300006175 Bacteria 3482
245 Ga0070712_100061780 3300006175 Bacteria 2647
246 Ga0070712_100072155 3300006175 Bacteria 2472
247 Ga0070712_100107293 3300006175 Bacteria 2077
248 Ga0070712_100128214 3300006175 Unclassified 1919
249 Ga0070712_100360892 3300006175 Bacteria 1191
250 Ga0070712_100392261 3300006175 Bacteria 1145
251 Ga0070712_100497154 3300006175 Bacteria 1022
252 Ga0097621_100347645 3300006237 Bacteria 1318
253 Ga0068871_100184090 3300006358 Bacteria 1796
254 Ga0068871_100781676 3300006358 Bacteria 879
255 Ga0075428_100853797 3300006844 Bacteria 966
256 Ga0075428_101147736 3300006844 Bacteria 820
257 Ga0075431_100499385 3300006847 Bacteria 1208
258 Ga0075433_10038807 3300006852 Bacteria 4115
259 Ga0075433_10045266 3300006852 Bacteria 3825
260 Ga0075433_10169677 3300006852 Bacteria 1942
261 Ga0075434_100102689 3300006871 Bacteria 2867
262 Ga0075429_100854548 3300006880 Bacteria 797
263 Ga0068865_100001919 3300006881 Bacteria 12226
264 Ga0068865_100827132 3300006881 Bacteria 801
265 Ga0097620_100198466 3300006931 Bacteria 2091
266 Ga0075435_100073109 3300007076 Bacteria 2802
267 Ga0075435_100197505 3300007076 Bacteria 1704
268 Ga0075435_100266028 3300007076 Bacteria 1462
269 Ga0075435_100397018 3300007076 Bacteria 1186
270 Ga0075435_100442324 3300007076 Bacteria 1121
271 Ga0105240_10016420 3300009093 Bacteria 10024
272 Ga0105240_10110931 3300009093 Bacteria 3319
273 Ga0105240_10238489 3300009093 Bacteria 2109
274 Ga0105240_10404541 3300009093 Bacteria 1537
275 Ga0105240_10660834 3300009093 Bacteria 1144
276 Ga0105240_11176282 3300009093 Unclassified 813
277 Ga0111539_10041829 3300009094 Bacteria 5507
278 Ga0111539_10181772 3300009094 Bacteria 2456
279 Ga0105245_10002363 3300009098 Bacteria 17055
280 Ga0105245_10006729 3300009098 Bacteria 10086
281 Ga0105245_10144642 3300009098 Bacteria 2242
282 Ga0105245_10197903 3300009098 Bacteria 1928
283 Ga0105245_10914655 3300009098 Bacteria 919
284 Ga0105245_10919533 3300009098 Bacteria 917
285 Ga0105245_10935122 3300009098 Bacteria 909
286 Ga0105247_10032115 3300009101 Bacteria 3189
287 Ga0114129_10007795 3300009147 Bacteria 15234
288 Ga0114129_10082552 3300009147 Bacteria 4465
289 Ga0114129_10265903 3300009147 Bacteria 2296
290 Ga0105243_10002852 3300009148 Bacteria 14323
291 Ga0105243_10060838 3300009148 Bacteria 3018
292 Ga0105243_10125864 3300009148 Bacteria 2168
293 Ga0105243_10466986 3300009148 Bacteria 1188
294 Ga0105243_10622453 3300009148 Bacteria 1042
295 Ga0105243_10904697 3300009148 Bacteria 878
296 Ga0105241_10026869 3300009174 Bacteria 4284
297 Ga0105241_10059659 3300009174 Bacteria 2934
298 Ga0105241_10077226 3300009174 Bacteria 2599
299 Ga0105241_10127395 3300009174 Bacteria 2057
300 Ga0105241_10360025 3300009174 Unclassified 1266
301 Ga0105241_11235571 3300009174 Bacteria 709
302 Ga0105242_10050202 3300009176 Bacteria 3396
303 Ga0105242_10093774 3300009176 Bacteria 2532
304 Ga0105242_10389248 3300009176 Bacteria 1298
305 Ga0105242_10511307 3300009176 Bacteria 1144
306 Ga0105248_10013646 3300009177 Bacteria 8943
307 Ga0105248_10605768 3300009177 Bacteria 1236
308 Ga0105237_10026541 3300009545 Bacteria 5920
309 Ga0105237_10039262 3300009545 Bacteria 4779
310 Ga0105238_10051504 3300009551 Bacteria 4141
311 Ga0105238_10062175 3300009551 Bacteria 3734
312 Ga0105238_10081650 3300009551 Bacteria 3222
313 Ga0105238_10275665 3300009551 Bacteria 1663
314 Ga0105238_11189360 3300009551 Bacteria 787
315 Ga0105238_11704791 3300009551 Bacteria 661
316 Ga0105249_10135352 3300009553 Bacteria 2357
317 Ga0105239_10010390 3300010375 Bacteria 10415
318 Ga0105239_10237715 3300010375 Bacteria 2045
319 Ga0105239_10335437 3300010375 Bacteria 1706
320 Ga0105239_11012051 3300010375 Unclassified 955
321 Ga0105239_11177649 3300010375 Bacteria 883
322 Ga0105239_11351469 3300010375 Bacteria 822
323 Ga0105246_10043731 3300011119 Bacteria 3040
324 Ga0105246_10140685 3300011119 Bacteria 1814
325 Ga0105246_10294852 3300011119 Bacteria 1306
326 Ga0157320_1006806 3300012481 Bacteria 802
327 Ga0157373_10125746 3300013100 Bacteria 1803
328 Ga0157373_10219521 3300013100 Bacteria 1341
329 Ga0157371_10210646 3300013102 Bacteria 1394
330 Ga0157371_10301643 3300013102 Bacteria 1160
331 Ga0157371_10378587 3300013102 Bacteria 1033
332 Ga0157370_10018569 3300013104 Bacteria 6990
333 Ga0157370_10021632 3300013104 Bacteria 6408
334 Ga0157370_10052189 3300013104 Bacteria 3904
335 Ga0157370_10060686 3300013104 Bacteria 3589
336 Ga0157370_10064360 3300013104 Bacteria 3472
337 Ga0157370_10070570 3300013104 Bacteria 3297
338 Ga0157370_10764622 3300013104 Unclassified 880
339 Ga0157369_10002394 3300013105 Bacteria 22528
340 Ga0157369_10003170 3300013105 Bacteria 19626
341 Ga0157369_10020044 3300013105 Bacteria 7480
342 Ga0157369_10056328 3300013105 Bacteria 4242
343 Ga0157369_10096757 3300013105 Bacteria 3149
344 Ga0157369_10155660 3300013105 Bacteria 2414
345 Ga0157369_10202624 3300013105 Bacteria 2082
346 Ga0157369_10229275 3300013105 Unclassified 1942
347 Ga0157369_11044160 3300013105 Bacteria 836
348 Ga0157374_10002922 3300013296 Bacteria 14319
349 Ga0157374_10084293 3300013296 Bacteria 3021
350 Ga0157374_10294943 3300013296 Bacteria 1603
351 Ga0157374_10549427 3300013296 Bacteria 1163
352 Ga0157374_10859644 3300013296 Bacteria 924
353 Ga0157374_11797968 3300013296 Unclassified 638
354 Ga0157378_10009605 3300013297 Bacteria 8423
355 Ga0157378_10324391 3300013297 Bacteria 1497
356 Ga0157378_10643372 3300013297 Bacteria 1075
357 Ga0157372_10044068 3300013307 Bacteria 4943
358 Ga0157372_10061739 3300013307 Bacteria 4197
359 Ga0157372_10081192 3300013307 Bacteria 3670
360 Ga0157372_10140995 3300013307 Bacteria 2777
361 Ga0157372_10142507 3300013307 Bacteria 2762
362 Ga0157372_10258868 3300013307 Bacteria 2020
363 Ga0157372_10548720 3300013307 Bacteria 1347
364 Ga0157372_10821351 3300013307 Bacteria 1080
365 Ga0157372_11803098 3300013307 Bacteria 704
366 Ga0157375_10096082 3300013308 Bacteria 3035
367 Ga0157375_10175581 3300013308 Bacteria 2291
368 Ga0157375_10872772 3300013308 Unclassified 1045
369 Ga0163163_10319175 3300014325 Bacteria 1607
370 Ga0163163_10543675 3300014325 Bacteria 1224
371 Ga0157380_10145813 3300014326 Bacteria 2040
372 Ga0182008_10152147 3300014497 Unclassified 1161
373 Ga0182008_10177432 3300014497 Bacteria 1077
374 Ga0182008_10190379 3300014497 Bacteria 1041
375 Ga0157377_10084611 3300014745 Bacteria 1861
376 Ga0157377_10230790 3300014745 Bacteria 1190
377 Ga0157376_10030959 3300014969 Bacteria 4279
378 Ga0157376_10038034 3300014969 Bacteria 3912
379 Ga0157376_10306219 3300014969 Bacteria 1506
380 Ga0197907_10597396 3300020069 Bacteria 1580
381 Ga0206356_11185392 3300020070 Bacteria 1102
382 Ga0206356_11685916 3300020070 Bacteria 3416
383 Ga0206352_10714872 3300020078 Unclassified 623
384 Ga0206350_11458775 3300020080 Bacteria 963
385 Ga0206354_10026723 3300020081 Bacteria 843
386 Ga0206354_10139567 3300020081 Bacteria 2247
387 Ga0206354_10363881 3300020081 Bacteria 1395
388 Ga0206354_10652406 3300020081 Bacteria 1380
389 Ga0206353_10123035 3300020082 Bacteria 3294
390 Ga0206353_10422209 3300020082 Bacteria 1466
391 Ga0206353_10506849 3300020082 Bacteria 8648
392 Ga0206353_10712429 3300020082 Bacteria 4178
393 Ga0206353_10722631 3300020082 Bacteria 1752
394 Ga0206353_11405661 3300020082 Bacteria 764
395 Ga0206353_11431565 3300020082 Bacteria 1058
396 Ga0206353_12056592 3300020082 Bacteria 5106
397 Ga0213873_10016713 3300021358 Bacteria 1663
398 Ga0213874_10003560 3300021377 Bacteria 3470
399 Ga0213874_10004492 3300021377 Bacteria 3191
400 Ga0213874_10017767 3300021377 Bacteria 1913
401 Ga0213876_10003400 3300021384 Bacteria 9108
402 Ga0213876_10075768 3300021384 Bacteria 1777
403 Ga0213875_10011474 3300021388 Bacteria 4406
404 Ga0213875_10038297 3300021388 Bacteria 2259
405 Ga0213875_10040337 3300021388 Bacteria 2198
406 Ga0213875_10106805 3300021388 Bacteria 1307
407 Ga0213875_10270277 3300021388 Bacteria 802
408 Ga0224712_10316573 3300022467 Bacteria 732
409 Ga0207656_10469819 3300025321 Bacteria 637
410 Ga0207653_10000589 3300025885 Bacteria 12860
411 Ga0207653_10079423 3300025885 Bacteria 1133
412 Ga0207653_10124111 3300025885 Bacteria 932
413 Ga0207692_10017312 3300025898 Bacteria 3212
414 Ga0207692_10023818 3300025898 Bacteria 2837
415 Ga0207692_10083041 3300025898 Bacteria 1718
416 Ga0207642_10075270 3300025899 Bacteria 1621
417 Ga0207642_10215293 3300025899 Bacteria 1070
418 Ga0207710_10046431 3300025900 Bacteria 1939
419 Ga0207688_10006630 3300025901 Bacteria 6297
420 Ga0207688_10075391 3300025901 Bacteria 1920
421 Ga0207688_10083508 3300025901 Bacteria 1827
422 Ga0207688_10166598 3300025901 Bacteria 1309
423 Ga0207647_10407852 3300025904 Bacteria 765
424 Ga0207685_10011327 3300025905 Bacteria 2677
425 Ga0207685_10035135 3300025905 Bacteria 1827
426 Ga0207699_10130163 3300025906 Bacteria 1640
427 Ga0207699_10147579 3300025906 Bacteria 1552
428 Ga0207699_10331384 3300025906 Bacteria 1070
429 Ga0207643_10027335 3300025908 Bacteria 3162
430 Ga0207643_10439671 3300025908 Bacteria 829
431 Ga0207705_10021888 3300025909 Bacteria 4561
432 Ga0207705_10132721 3300025909 Bacteria 1854
433 Ga0207705_10373114 3300025909 Bacteria 1101
434 Ga0207705_10461490 3300025909 Bacteria 985
435 Ga0207684_10057105 3300025910 Bacteria 3311
436 Ga0207684_10398368 3300025910 Bacteria 1183
437 Ga0207684_10463827 3300025910 Bacteria 1087
438 Ga0207684_10475285 3300025910 Bacteria 1072
439 Ga0207654_10016213 3300025911 Bacteria 3876
440 Ga0207654_10017166 3300025911 Bacteria 3781
441 Ga0207654_10152567 3300025911 Bacteria 1484
442 Ga0207654_10406874 3300025911 Unclassified 947
443 Ga0207707_10002380 3300025912 Bacteria 16951
444 Ga0207707_10018648 3300025912 Bacteria 6050
445 Ga0207707_10034890 3300025912 Bacteria 4400
446 Ga0207707_10053386 3300025912 Bacteria 3518
447 Ga0207707_10101056 3300025912 Bacteria 2520
448 Ga0207707_10185569 3300025912 Bacteria 1815
449 Ga0207707_10428964 3300025912 Bacteria 1133
450 Ga0207695_10430764 3300025913 Bacteria 1203
451 Ga0207671_10054864 3300025914 Bacteria 2952
452 Ga0207693_10001862 3300025915 Bacteria 18464
453 Ga0207693_10003040 3300025915 Bacteria 14500
454 Ga0207693_10003428 3300025915 Bacteria 13527
455 Ga0207693_10004843 3300025915 Bacteria 11329
456 Ga0207693_10005535 3300025915 Bacteria 10507
457 Ga0207693_10026100 3300025915 Bacteria 4626
458 Ga0207693_10107272 3300025915 Unclassified 2191
459 Ga0207693_10240065 3300025915 Bacteria 1422
460 Ga0207693_10388697 3300025915 Bacteria 1091
461 Ga0207693_10577094 3300025915 Bacteria 876
462 Ga0207663_10038877 3300025916 Bacteria 2880
463 Ga0207663_10041520 3300025916 Bacteria 2803
464 Ga0207663_10069621 3300025916 Bacteria 2264
465 Ga0207663_10080381 3300025916 Bacteria 2131
466 Ga0207663_10089591 3300025916 Bacteria 2037
467 Ga0207663_10131975 3300025916 Bacteria 1727
468 Ga0207663_10433068 3300025916 Bacteria 1011
469 Ga0207663_10535885 3300025916 Unclassified 913
470 Ga0207663_10689595 3300025916 Bacteria 808
471 Ga0207663_10940520 3300025916 Bacteria 692
472 Ga0207660_10012183 3300025917 Bacteria 5620
473 Ga0207660_10013519 3300025917 Bacteria 5350
474 Ga0207660_10093840 3300025917 Bacteria 2230
475 Ga0207660_10100290 3300025917 Bacteria 2162
476 Ga0207660_10136020 3300025917 Bacteria 1875
477 Ga0207657_10000054 3300025919 Bacteria 106767
478 Ga0207657_10001075 3300025919 Bacteria 28931
479 Ga0207657_10004160 3300025919 Bacteria 15336
480 Ga0207657_10006359 3300025919 Bacteria 12271
481 Ga0207657_10013020 3300025919 Bacteria 8173
482 Ga0207657_10020763 3300025919 Bacteria 6199
483 Ga0207657_10033290 3300025919 Bacteria 4647
484 Ga0207657_10141185 3300025919 Bacteria 1968
485 Ga0207657_10197179 3300025919 Bacteria 1622
486 Ga0207657_10291726 3300025919 Bacteria 1293
487 Ga0207657_10337525 3300025919 Bacteria 1190
488 Ga0207649_10020282 3300025920 Bacteria 3810
489 Ga0207649_10058016 3300025920 Bacteria 2423
490 Ga0207649_10327546 3300025920 Bacteria 1127
491 Ga0207649_10492429 3300025920 Bacteria 931
492 Ga0207649_10510563 3300025920 Bacteria 915
493 Ga0207652_10033577 3300025921 Bacteria 4321
494 Ga0207652_10087978 3300025921 Bacteria 2724
495 Ga0207652_10116070 3300025921 Bacteria 2378
496 Ga0207652_10147522 3300025921 Bacteria 2106
497 Ga0207652_10155906 3300025921 Bacteria 2046
498 Ga0207652_10201891 3300025921 Bacteria 1789
499 Ga0207652_10308520 3300025921 Archaea 1428
500 Ga0207652_10630200 3300025921 Bacteria 960
501 Ga0207646_10011714 3300025922 Bacteria 8478
502 Ga0207646_10323367 3300025922 Bacteria 1394
503 Ga0207646_10902080 3300025922 Bacteria 784
504 Ga0207681_10446106 3300025923 Bacteria 1052
505 Ga0207694_10026284 3300025924 Bacteria 4427
506 Ga0207694_10528077 3300025924 Bacteria 989
507 Ga0207694_10596398 3300025924 Bacteria 929
508 Ga0207694_11186329 3300025924 Bacteria 646
509 Ga0207687_10191162 3300025927 Bacteria 1593
510 Ga0207687_10205832 3300025927 Bacteria 1541
511 Ga0207687_10960363 3300025927 Bacteria 732
512 Ga0207687_11053672 3300025927 Unclassified 698
513 Ga0207700_10047053 3300025928 Bacteria 3195
514 Ga0207700_10152535 3300025928 Bacteria 1911
515 Ga0207700_10526897 3300025928 Bacteria 1047
516 Ga0207664_10046016 3300025929 Bacteria 3424
517 Ga0207664_10062402 3300025929 Bacteria 2976
518 Ga0207664_10104816 3300025929 Bacteria 2342
519 Ga0207664_10135528 3300025929 Bacteria 2077
520 Ga0207664_10156674 3300025929 Bacteria 1939
521 Ga0207664_10590707 3300025929 Unclassified 997
522 Ga0207664_10787927 3300025929 Bacteria 855
523 Ga0207664_11168003 3300025929 Bacteria 687
524 Ga0207644_10224211 3300025931 Bacteria 1491
525 Ga0207644_10812711 3300025931 Bacteria 782
526 Ga0207690_10018587 3300025932 Bacteria 4264
527 Ga0207690_10043519 3300025932 Bacteria 2955
528 Ga0207690_10058287 3300025932 Bacteria 2612
529 Ga0207690_10185208 3300025932 Bacteria 1570
530 Ga0207690_10303620 3300025932 Bacteria 1250
531 Ga0207690_10770455 3300025932 Unclassified 794
532 Ga0207706_10829098 3300025933 Bacteria 784
533 Ga0207686_10008636 3300025934 Bacteria 5502
534 Ga0207709_10001437 3300025935 Bacteria 16621
535 Ga0207709_10078685 3300025935 Bacteria 2117
536 Ga0207709_10321493 3300025935 Bacteria 1158
537 Ga0207670_10196744 3300025936 Unclassified 1529
538 Ga0207669_10000947 3300025937 Bacteria 12291
539 Ga0207669_10013492 3300025937 Bacteria 4059
540 Ga0207704_10003034 3300025938 Bacteria 7583
541 Ga0207704_10180822 3300025938 Bacteria 1524
542 Ga0207665_10000344 3300025939 Bacteria 32292
543 Ga0207665_10021600 3300025939 Bacteria 4234
544 Ga0207665_10050876 3300025939 Bacteria 2787
545 Ga0207665_10055879 3300025939 Bacteria 2664
546 Ga0207665_10126478 3300025939 Bacteria 1810
547 Ga0207691_10003841 3300025940 Bacteria 14577
548 Ga0207691_10086709 3300025940 Bacteria 2809
549 Ga0207711_10070075 3300025941 Bacteria 3040
550 Ga0207689_10853498 3300025942 Bacteria 768
551 Ga0207661_10000588 3300025944 Bacteria 23238
552 Ga0207661_10002036 3300025944 Bacteria 13944
553 Ga0207661_10011037 3300025944 Bacteria 6529
554 Ga0207661_10020465 3300025944 Bacteria 4946
555 Ga0207661_10026264 3300025944 Bacteria 4434
556 Ga0207661_10074813 3300025944 Bacteria 2777
557 Ga0207661_10077742 3300025944 Bacteria 2730
558 Ga0207661_10218085 3300025944 Bacteria 1685
559 Ga0207661_10239910 3300025944 Bacteria 1608
560 Ga0207661_10328890 3300025944 Bacteria 1375
561 Ga0207661_10527809 3300025944 Unclassified 1080
562 Ga0207661_10704246 3300025944 Bacteria 929
563 Ga0207679_10035462 3300025945 Bacteria 3529
564 Ga0207679_10073477 3300025945 Bacteria 2587
565 Ga0207679_10147944 3300025945 Bacteria 1908
566 Ga0207667_10040671 3300025949 Bacteria 4950
567 Ga0207667_10096249 3300025949 Bacteria 3055
568 Ga0207667_10175124 3300025949 Bacteria 2204
569 Ga0207667_10266827 3300025949 Unclassified 1750
570 Ga0207667_10527742 3300025949 Bacteria 1195
571 Ga0207667_11025384 3300025949 Unclassified 811
572 Ga0207667_11320108 3300025949 Unclassified 697
573 Ga0207712_10010849 3300025961 Bacteria 5797
574 Ga0207712_10357383 3300025961 Bacteria 1216
575 Ga0207712_10768104 3300025961 Bacteria 845
576 Ga0207640_10498454 3300025981 Bacteria 1014
577 Ga0207640_10522246 3300025981 Bacteria 993
578 Ga0207640_11092456 3300025981 Unclassified 705
579 Ga0207677_10019958 3300026023 Bacteria 4059
580 Ga0207677_10057246 3300026023 Bacteria 2676
581 Ga0207703_10841855 3300026035 Bacteria 877
582 Ga0207639_10094904 3300026041 Bacteria 2396
583 Ga0207639_10269163 3300026041 Bacteria 1494
584 Ga0207639_10808038 3300026041 Unclassified 874
585 Ga0207639_10967905 3300026041 Bacteria 797
586 Ga0207678_10116707 3300026067 Bacteria 2277
587 Ga0207678_10147567 3300026067 Bacteria 2007
588 Ga0207678_10282327 3300026067 Bacteria 1425
589 Ga0207678_10718115 3300026067 Bacteria 880
590 Ga0207678_10767031 3300026067 Unclassified 851
591 Ga0207708_10002124 3300026075 Bacteria 14612
592 Ga0207708_10249283 3300026075 Bacteria 1430
593 Ga0207708_10810477 3300026075 Bacteria 806
594 Ga0207702_10012100 3300026078 Bacteria 7177
595 Ga0207702_10024338 3300026078 Bacteria 5024
596 Ga0207702_10032479 3300026078 Unclassified 4356
597 Ga0207702_10090602 3300026078 Bacteria 2676
598 Ga0207702_10102085 3300026078 Bacteria 2534
599 Ga0207702_10143631 3300026078 Bacteria 2163
600 Ga0207702_10163115 3300026078 Bacteria 2037
601 Ga0207702_10296973 3300026078 Bacteria 1532
602 Ga0207702_10334128 3300026078 Bacteria 1446
603 Ga0207702_10566513 3300026078 Bacteria 1112
604 Ga0207702_10802411 3300026078 Unclassified 930
605 Ga0207702_10804748 3300026078 Bacteria 929
606 Ga0207648_10003665 3300026089 Bacteria 16078
607 Ga0207648_10514480 3300026089 Bacteria 1096
608 Ga0207648_11192295 3300026089 Bacteria 715
609 Ga0207676_10250220 3300026095 Bacteria 1595
610 Ga0207676_10355645 3300026095 Bacteria 1356
611 Ga0207674_10109936 3300026116 Bacteria 2732
612 Ga0207674_10304063 3300026116 Bacteria 1544
613 Ga0207674_10358692 3300026116 Bacteria 1409
614 Ga0207674_10490563 3300026116 Bacteria 1187
615 Ga0207675_100036335 3300026118 Bacteria 4596
616 Ga0207675_100484288 3300026118 Bacteria 1230
617 Ga0207675_100519942 3300026118 Bacteria 1186
618 Ga0207683_10000549 3300026121 Bacteria 34716
619 Ga0207683_10004028 3300026121 Bacteria 12708
620 Ga0207683_10043295 3300026121 Bacteria 3934
621 Ga0207683_10078094 3300026121 Bacteria 2933
622 Ga0207683_10367239 3300026121 Bacteria 1322
623 Ga0207683_10447707 3300026121 Bacteria 1190
624 Ga0207683_10966109 3300026121 Bacteria 791
625 Ga0207698_10087931 3300026142 Bacteria 2532
626 Ga0207698_10095007 3300026142 Bacteria 2453
627 Ga0207698_10168466 3300026142 Bacteria 1926
628 Ga0207698_10476952 3300026142 Bacteria 1209
629 Ga0207698_11593173 3300026142 Bacteria 668
630 Ga0207428_10126040 3300027907 Bacteria 1961
631 Ga0207428_10353969 3300027907 Bacteria 1080
632 Ga0268266_10243689 3300028379 Bacteria 1660
633 Ga0268266_10340379 3300028379 Bacteria 1408
634 Ga0268264_10105830 3300028381 Bacteria 2454
635 Ga0265319_1036087 3300028563 Bacteria 1693
636 Ga0265334_10013764 3300028573 Bacteria 3382
637 Ga0265318_10034636 3300028577 Bacteria 1945
638 Ga0265318_10048967 3300028577 Bacteria 1591
639 Ga0265318_10085300 3300028577 Bacteria 1164
640 Ga0265318_10265370 3300028577 Bacteria 626
641 Ga0265322_10006559 3300028654 Bacteria 3425
642 Ga0265336_10043071 3300028666 Bacteria 1377
643 Ga0265338_10003455 3300028800 Bacteria 22237
644 Ga0265338_10021766 3300028800 Bacteria 6666
645 Ga0265338_10097559 3300028800 Bacteria 2407
646 Ga0265338_10170189 3300028800 Bacteria 1672
647 Ga0265338_10235934 3300028800 Bacteria 1357
648 Ga0265330_10064920 3300031235 Bacteria 1585
649 Ga0265332_10169380 3300031238 Bacteria 912
650 Ga0265320_10046447 3300031240 Bacteria 2128
651 Ga0265320_10113644 3300031240 Unclassified 1239
652 Ga0265325_10074032 3300031241 Bacteria 1704
653 Ga0265340_10108901 3300031247 Bacteria 1282
654 Ga0265327_10032727 3300031251 Bacteria 2907
655 Ga0265327_10109439 3300031251 Bacteria 1322
656 Ga0265327_10150643 3300031251 Bacteria 1080
657 Ga0265327_10158380 3300031251 Bacteria 1048
658 Ga0265327_10175442 3300031251 Unclassified 982
659 Ga0265327_10322355 3300031251 Bacteria 678
660 Ga0307408_100092328 3300031548 Bacteria 2288
661 Ga0265313_10030460 3300031595 Bacteria 2778
662 Ga0265313_10046383 3300031595 Bacteria 2110
663 Ga0265314_10078607 3300031711 Bacteria 2183
664 Ga0265342_10079201 3300031712 Bacteria 1900
665 Ga0316578_10079921 3300031728 Bacteria 1945
666 Ga0307405_10087131 3300031731 Bacteria 2057
667 Ga0307413_10069267 3300031824 Bacteria 2213
668 Ga0307406_10080729 3300031901 Bacteria 2160
669 Ga0307412_10162980 3300031911 Unclassified 1659
670 Ga0307412_10193765 3300031911 Bacteria 1538
671 Ga0307409_100033256 3300031995 Bacteria 3750
672 Ga0307409_101151351 3300031995 Bacteria 798
673 Ga0307416_100051821 3300032002 Bacteria 3281
674 Ga0307416_100755289 3300032002 Unclassified 1065
675 Ga0307414_10069628 3300032004 Bacteria 2530
676 Ga0307411_10012847 3300032005 Bacteria 4590
677 Ga0307415_100067637 3300032126 Bacteria 2497
678 Ga0307415_100146108 3300032126 Bacteria 1813
679 Ga0373930_0005814 3300034816 Bacteria 2064
680 Ga0373948_0104465 3300034817 Bacteria 670
681 Ga0373950_0009604 3300034818 Bacteria 1549
682 Ga0373950_0016249 3300034818 Bacteria 1271
683 Ga0373958_0025873 3300034819 Bacteria 1120
684 Ga0373958_0043959 3300034819 Bacteria 923
685 Ga0373959_0002201 3300034820 Bacteria 3108
686 Ga0373938_0023737 3300034957 Bacteria 1263
687 Ga0373928_0028951 3300035084 Bacteria 1215
688 Ga0373928_0058042 3300035084 Bacteria 930
689 Ga0373929_0006551 3300035085 Bacteria 2106
690 Ga0373929_0014842 3300035085 Bacteria 1509
691 Ga0373940_0005134 3300035088 Bacteria 2820
692 Ga0373944_0048535 3300035089 Bacteria 1332
693 Ga0373949_0031119 3300035090 Bacteria 1271
694 Ga0373951_0014437 3300035091 Bacteria 1776
695 Ga0373952_0006790 3300035092 Bacteria 2128
696 Ga0373932_0024602 3300035112 Bacteria 1622
697 Ga0373936_0009649 3300035113 Bacteria 3638
698 Ga0373936_0095529 3300035113 Bacteria 1250
699 Ga0373939_0006438 3300035114 Bacteria 2829
700 Ga0373941_0011013 3300035115 Bacteria 2327
701 Ga0373945_0023282 3300035116 Bacteria 2139
702 Ga0373945_0228957 3300035116 Bacteria 779
703 Ga0373945_0233123 3300035116 Bacteria 773
704 Ga0373954_0285449 3300035118 Bacteria 814
705 Ga0373956_0087749 3300035119 Bacteria 1433
706 Ga0373956_0172945 3300035119 Bacteria 1020
707 Ga0373960_0016556 3300035121 Bacteria 1899
708 Ga0373943_0000101 3300035170 Bacteria 31609
709 Ga0373943_0001881 3300035170 Bacteria 9492
710 Ga0373943_0021015 3300035170 Bacteria 3014
711 Ga0373943_0210033 3300035170 Bacteria 1081
712 Ga0373943_0498162 3300035170 Bacteria 712
713 Ga0373946_0006107 3300035171 Bacteria 4362
714 Ga0373946_0079806 3300035171 Bacteria 1430
715 Ga0373955_0224788 3300035172 Bacteria 1122
716 Ga0373942_0029525 3300035207 Bacteria 1439
717 Ga0373962_0015150 3300035242 Bacteria 1973
718 Ga0373962_0024930 3300035242 Unclassified 1603
719 Ga0316574_0788391 3300035398 Bacteria 579
720 Ga0373924_0019565 3300035410 Bacteria 2624
721 Ga0373931_0002414 3300035691 Bacteria 8269
722 Ga0373931_0013901 3300035691 Bacteria 3927
723 Ga0373931_0201341 3300035691 Bacteria 1190
724 Ga0373935_0026073 3300035692 Bacteria 3605
725 Ga0373935_0043236 3300035692 Bacteria 2835
726 Ga0373927_0093584 3300035695 Bacteria 1953
727 Ga0373933_0074864 3300035724 Bacteria 2066
728 Ga0373947_0004085 3300035725 Bacteria 8591
729 Ga0373947_0005625 3300035725 Bacteria 7308
730 Ga0373947_0039963 3300035725 Bacteria 2793
731 Ga0373947_0278737 3300035725 Bacteria 1111
732 Ga0373937_0157453 3300036401 Bacteria 2129
733 Ga0373937_0234785 3300036401 Bacteria 1727
734 Ga0373937_0471658 3300036401 Bacteria 1192
735 Ga0373925_0001828 3300037068 Bacteria 17755
736 Ga0373925_0898937 3300037068 Bacteria 730
737 Ga0395899_0023795 3300037312 Bacteria 4635
738 Ga0395899_0043135 3300037312 Bacteria 3365
739 Ga0395899_0050366 3300037312 Bacteria 3092
740 Ga0395899_0085357 3300037312 Bacteria 2293
741 Ga0395899_0226357 3300037312 Bacteria 1293
742 Ga0395899_0315209 3300037312 Bacteria 1055
743 Ga0395900_0012528 3300037418 Bacteria 8676
744 Ga0395900_0021884 3300037418 Bacteria 6537
745 Ga0395900_0024974 3300037418 Bacteria 6115
746 Ga0395900_0050336 3300037418 Bacteria 4291
747 Ga0395900_0053846 3300037418 Bacteria 4142
748 Ga0395900_0160153 3300037418 Bacteria 2296
749 Ga0395900_0170449 3300037418 Bacteria 2216
750 Ga0395900_0183364 3300037418 Bacteria 2126
751 Ga0395900_0184041 3300037418 Bacteria 2121
752 Ga0395900_0266290 3300037418 Bacteria 1710
753 Ga0395900_0319459 3300037418 Bacteria 1533
754 Ga0395900_0403876 3300037418 Bacteria 1330
755 Ga0395900_0750026 3300037418 Bacteria 906
756 Ga0395900_0905664 3300037418 Bacteria 805
757 Ga0395898_0001509 3300037466 Bacteria 32076
758 Ga0395898_0004411 3300037466 Bacteria 15397
759 Ga0395898_0009218 3300037466 Bacteria 10382
760 Ga0395898_0011522 3300037466 Bacteria 9182
761 Ga0395898_0014811 3300037466 Bacteria 8004
762 Ga0395898_0030302 3300037466 Bacteria 5415
763 Ga0395898_0091755 3300037466 Bacteria 2922
764 Ga0395898_0119799 3300037466 Bacteria 2521
765 Ga0395898_0131716 3300037466 Bacteria 2395
766 Ga0395898_0153557 3300037466 Bacteria 2203
767 Ga0395898_0190719 3300037466 Bacteria 1958
768 Ga0395898_0218659 3300037466 Bacteria 1817
769 Ga0395898_0255362 3300037466 Bacteria 1672
770 Ga0395898_0422585 3300037466 Bacteria 1270
771 Ga0395898_0442076 3300037466 Bacteria 1239
772 Ga0395898_0463501 3300037466 Bacteria 1206
773 Ga0395898_0475823 3300037466 Bacteria 1188
774 Ga0395898_0514709 3300037466 Bacteria 1138
775 Ga0395898_1172664 3300037466 Bacteria 700
776 Ga0395905_0013885 3300037471 Bacteria 7706
777 Ga0395905_0023643 3300037471 Bacteria 5802
778 Ga0395905_0024003 3300037471 Bacteria 5757
779 Ga0395905_0045512 3300037471 Bacteria 4115
780 Ga0395905_0077358 3300037471 Bacteria 3117
781 Ga0395905_0100352 3300037471 Bacteria 2718
782 Ga0395905_0265388 3300037471 Bacteria 1602
783 Ga0395905_0579685 3300037471 Bacteria 1023
784 Ga0395905_0805238 3300037471 Bacteria 842
785 Ga0436364_0115954 3300037853 Bacteria 10221
786 Ga0436364_0194867 3300037853 Bacteria 5731
787 Ga0436364_0454997 3300037853 Bacteria 5450
788 Ga0436364_0781557 3300037853 Bacteria 1000
789 Ga0436364_0782464 3300037853 Bacteria 3021
790 Ga0436364_0797529 3300037853 Bacteria 979
791 Ga0436364_0808770 3300037853 Bacteria 893
792 Ga0436364_1289981 3300037853 Bacteria 2561
793 Ga0436364_1386615 3300037853 Bacteria 4646
794 Ga0395901_0009334 3300038443 Bacteria 9945
795 Ga0395901_0014373 3300038443 Bacteria 8058
796 Ga0395901_0049218 3300038443 Bacteria 4379
797 Ga0395901_0064947 3300038443 Bacteria 3799
798 Ga0395901_0120252 3300038443 Bacteria 2760
799 Ga0395901_0143089 3300038443 Bacteria 2514
800 Ga0395901_0159762 3300038443 Bacteria 2367
801 Ga0395901_0175737 3300038443 Bacteria 2246
802 Ga0395901_0235390 3300038443 Bacteria 1911
803 Ga0395901_0299523 3300038443 Bacteria 1667
804 Ga0395901_0301484 3300038443 Bacteria 1661
805 Ga0395901_0313827 3300038443 Bacteria 1623
806 Ga0395901_0325207 3300038443 Bacteria 1590
807 Ga0395901_0370419 3300038443 Bacteria 1475
808 Ga0395901_0552976 3300038443 Bacteria 1166
809 Ga0395901_0576038 3300038443 Bacteria 1138
810 Ga0395901_1025653 3300038443 Bacteria 799
811 Ga0436365_0134395 3300039437 Bacteria 1916
812 Ga0436365_0215850 3300039437 Bacteria 7325
813 Ga0436365_0383848 3300039437 Bacteria 4249
814 Ga0436365_0704133 3300039437 Bacteria 7281
815 Ga0436365_1199523 3300039437 Bacteria 3496
816 Ga0436365_1294004 3300039437 Bacteria 824
817 Ga0436365_1682359 3300039437 Bacteria 3175
818 Ga0436363_0231463 3300039450 Bacteria 1180
819 Ga0436363_0236348 3300039450 Bacteria 848
820 Ga0436363_0256593 3300039450 Bacteria 8766
821 Ga0436363_1280299 3300039450 Bacteria 1112
822 Ga0436363_1329980 3300039450 Bacteria 827
823 Ga0436363_1583354 3300039450 Bacteria 7401
824 Ga0436362_1191867 3300039453 Bacteria 1448
825 Ga0439466_0087321 3300041411 Bacteria 980
826 Ga0451793_0532612 3300041452 Unclassified 1177
827 Ga0451798_0213579 3300041458 Bacteria 933
828 Ga0451802_1758706 3300041460 Bacteria 1091
829 Ga0451853_2291318 3300041512 Bacteria 2788
830 Ga0439431_0006790 3300041997 Bacteria 2540
831 Ga0439442_001423 3300042002 Bacteria 4713
832 Ga0439445_0023401 3300042004 Bacteria 1564
833 Ga0439448_0034190 3300042005 Bacteria 1623
834 Ga0439448_0119313 3300042005 Unclassified 905
835 Ga0439432_172786 3300042006 Bacteria 630
836 Ga0439449_0107835 3300042007 Bacteria 1031
837 Ga0439451_005274 3300042009 Bacteria 2633
838 Ga0439454_027757 3300042011 Bacteria 871
839 Ga0439462_0012923 3300042015 Bacteria 2137
840 Ga0450920_010083 3300042122 Bacteria 1748
841 Ga0450923_007398 3300042125 Bacteria 1857
842 Ga0450896_039167 3300042133 Bacteria 734
843 Ga0450900_041346 3300042136 Bacteria 690
844 Ga0439434_0059462 3300042435 Bacteria 1193
845 Ga0450901_015700 3300042533 Bacteria 797
846 Ga0451577_0250854 3300042876 Bacteria 1602
847 Ga0466969_0021862 3300044656 Bacteria 3306
848 Ga0466969_0304967 3300044656 Unclassified 721
849 Ga0466965_0162990 3300044683 Bacteria 1170
850 Ga0466966_0006668 3300044684 Bacteria 7645
851 Ga0466966_0008410 3300044684 Bacteria 6827
852 Ga0466966_0097901 3300044684 Bacteria 1816
853 Ga0466966_0503824 3300044684 Bacteria 728
854 Ga0466961_0002717 3300044693 Bacteria 11002
855 Ga0466961_0012197 3300044693 Bacteria 5495
856 Ga0466961_0019467 3300044693 Bacteria 4366
857 Ga0466961_0026671 3300044693 Bacteria 3714
858 Ga0466961_0080613 3300044693 Bacteria 2060
859 Ga0466961_0083598 3300044693 Bacteria 2019
860 Ga0466963_0000059 3300044694 Bacteria 37360
861 Ga0466963_0003862 3300044694 Bacteria 8649
862 Ga0466963_0004394 3300044694 Bacteria 8190
863 Ga0466963_0011736 3300044694 Bacteria 5342
864 Ga0466963_0019426 3300044694 Bacteria 4262
865 Ga0466963_0019800 3300044694 Bacteria 4226
866 Ga0466963_0022077 3300044694 Bacteria 4026
867 Ga0466963_0028017 3300044694 Bacteria 3612
868 Ga0466963_0030410 3300044694 Bacteria 3485
869 Ga0466963_0036391 3300044694 Bacteria 3211
870 Ga0466963_0045020 3300044694 Bacteria 2905
871 Ga0466963_0108740 3300044694 Bacteria 1902
872 Ga0466963_0153419 3300044694 Bacteria 1600
873 Ga0466963_0289916 3300044694 Bacteria 1151
874 Ga0466963_0308437 3300044694 Bacteria 1113
875 Ga0466963_0326204 3300044694 Bacteria 1080
876 Ga0466963_0667407 3300044694 Bacteria 734
877 Ga0466964_0002916 3300044706 Bacteria 6178
878 Ga0466964_0002988 3300044706 Bacteria 6122
879 Ga0466964_0009352 3300044706 Bacteria 3689
880 Ga0466964_0009904 3300044706 Bacteria 3592
881 Ga0466964_0017077 3300044706 Bacteria 2776
882 Ga0466964_0069891 3300044706 Bacteria 1482
883 Ga0466964_0288620 3300044706 Bacteria 823
884 Ga0453684_0927053 3300044712 Bacteria 931
885 Ga0466971_0000282 3300044719 Bacteria 19481
886 Ga0466971_0009074 3300044719 Bacteria 4346
887 Ga0466971_0021690 3300044719 Bacteria 2859
888 Ga0466971_0038542 3300044719 Bacteria 2144
889 Ga0466971_0141192 3300044719 Bacteria 1121
890 Ga0466968_0010810 3300044735 Bacteria 3547
891 Ga0466968_0369995 3300044735 Bacteria 699
892 Ga0466970_0350280 3300044765 Bacteria 838
893 Ga0466970_0465361 3300044765 Bacteria 726
894 Ga0466957_0002174 3300044842 Bacteria 10505
895 Ga0466957_0004563 3300044842 Bacteria 7734
896 Ga0466957_0034703 3300044842 Bacteria 3025
897 Ga0466957_0046870 3300044842 Bacteria 2625
898 Ga0466957_0047874 3300044842 Bacteria 2598
899 Ga0466957_0119300 3300044842 Bacteria 1680
900 Ga0466957_0129054 3300044842 Bacteria 1618
901 Ga0466957_0291007 3300044842 Bacteria 1095
902 Ga0466960_0015647 3300044901 Bacteria 3275
903 Ga0466959_0007644 3300045049 Bacteria 7601
904 Ga0466959_0034408 3300045049 Bacteria 3747
905 Ga0466959_0046436 3300045049 Bacteria 3195
906 Ga0466959_0083028 3300045049 Bacteria 2308
907 Ga0466959_0091600 3300045049 Bacteria 2183
908 Ga0466959_0097862 3300045049 Bacteria 2102
909 Ga0466959_0113114 3300045049 Bacteria 1935
910 Ga0466959_0252740 3300045049 Bacteria 1215
911 Ga0451576_0242555 3300045051 Bacteria 1883
912 Ga0466958_0004124 3300045836 Bacteria 7626
913 Ga0466958_0010875 3300045836 Bacteria 5110
914 Ga0466958_0011292 3300045836 Bacteria 5028
915 Ga0466958_0012056 3300045836 Bacteria 4885
916 Ga0466958_0016134 3300045836 Bacteria 4297
917 Ga0466958_0019424 3300045836 Bacteria 3955
918 Ga0466958_0038335 3300045836 Bacteria 2875
919 Ga0466958_0052894 3300045836 Bacteria 2462
920 Ga0466958_0122597 3300045836 Bacteria 1628
921 Ga0466958_0167046 3300045836 Bacteria 1392
922 Ga0466958_0223008 3300045836 Bacteria 1203
923 Ga0466958_0288138 3300045836 Bacteria 1053
924 Ga0466967_0000305 3300045976 Bacteria 22092
925 Ga0466967_0010340 3300045976 Bacteria 6994
926 Ga0466967_0015053 3300045976 Bacteria 6052
927 Ga0466967_0022022 3300045976 Bacteria 5190
928 Ga0466967_0026965 3300045976 Bacteria 4770
929 Ga0466967_0036019 3300045976 Bacteria 4220
930 Ga0466967_0047524 3300045976 Bacteria 3741
931 Ga0466967_0051218 3300045976 Bacteria 3617
932 Ga0466967_0064739 3300045976 Bacteria 3252
933 Ga0466967_0077440 3300045976 Bacteria 2993
934 Ga0466967_0100424 3300045976 Bacteria 2644
935 Ga0466967_0109764 3300045976 Bacteria 2533
936 Ga0466967_0114041 3300045976 Bacteria 2487
937 Ga0466967_0125131 3300045976 Bacteria 2380
938 Ga0466967_0169777 3300045976 Bacteria 2052
939 Ga0466967_0201452 3300045976 Bacteria 1885
940 Ga0466967_0275540 3300045976 Bacteria 1613
941 Ga0466967_0334276 3300045976 Bacteria 1463
942 Ga0466967_0338128 3300045976 Bacteria 1455
943 Ga0466967_0374137 3300045976 Bacteria 1382
944 Ga0466967_0437090 3300045976 Bacteria 1277
945 Ga0466967_0446117 3300045976 Bacteria 1264
946 Ga0466967_0449371 3300045976 Unclassified 1259
947 Ga0466967_0473827 3300045976 Bacteria 1226
948 Ga0466967_0580006 3300045976 Bacteria 1105
949 Ga0466967_0751590 3300045976 Bacteria 967
950 Ga0466967_1043283 3300045976 Bacteria 814
951 Ga0466967_1046317 3300045976 Bacteria 813
952 Ga0495592_0020890 3300046454 Bacteria 4981
953 Ga0495592_0079525 3300046454 Bacteria 2373
954 Ga0495592_0149894 3300046454 Bacteria 1614
955 Ga0495603_0017131 3300046455 Bacteria 4386
956 Ga0495603_0041553 3300046455 Bacteria 2749
957 Ga0495629_0036163 3300046459 Bacteria 3487
958 Ga0495629_0065495 3300046459 Bacteria 2536
959 Ga0495641_0000374 3300046461 Bacteria 37120
960 Ga0495641_0018087 3300046461 Bacteria 3648
961 Ga0495641_0021229 3300046461 Bacteria 3271
962 Ga0495641_0028226 3300046461 Bacteria 2718
963 Ga0495641_0067876 3300046461 Bacteria 1603
964 Ga0495641_0236973 3300046461 Bacteria 819
965 Ga0495641_0313605 3300046461 Bacteria 707
966 Ga0495651_0018440 3300046462 Bacteria 5405
967 Ga0495651_0028003 3300046462 Unclassified 4392
968 Ga0495651_0071904 3300046462 Bacteria 2629
969 Ga0495651_0373706 3300046462 Bacteria 936
970 Ga0495653_0015646 3300046463 Bacteria 6183
971 Ga0495653_0115384 3300046463 Bacteria 1922
972 Ga0495653_0202595 3300046463 Bacteria 1346
973 Ga0495653_0213398 3300046463 Bacteria 1302
974 Ga0495653_0459145 3300046463 Bacteria 800
975 Ga0495580_0689370 3300046472 Bacteria 669
976 Ga0495582_0000124 3300046473 Bacteria 41197
977 Ga0495582_0057505 3300046473 Bacteria 2144
978 Ga0495582_0058377 3300046473 Bacteria 2128
979 Ga0495605_0054425 3300046474 Bacteria 1938
980 Ga0495639_0000786 3300046475 Bacteria 14467
981 Ga0495662_0000898 3300046476 Bacteria 14537
982 Ga0495662_0449519 3300046476 Bacteria 632
983 Ga0495664_0018607 3300046477 Bacteria 3984
984 Ga0495664_0035313 3300046477 Bacteria 2943
985 Ga0495664_0097484 3300046477 Bacteria 1770
986 Ga0495584_0075372 3300046491 Bacteria 1696
987 Ga0495584_0163708 3300046491 Bacteria 1131
988 Ga0495584_0227236 3300046491 Bacteria 949
989 Ga0495585_0139257 3300046492 Bacteria 1272
990 Ga0495596_0086496 3300046500 Bacteria 1217
991 Ga0495596_0160800 3300046500 Unclassified 873
992 Ga0495596_0164174 3300046500 Bacteria 863
993 Ga0495596_0267425 3300046500 Bacteria 664
994 Ga0495608_0010122 3300046511 Bacteria 6580
995 Ga0495608_0029476 3300046511 Bacteria 3721
996 Ga0495608_0117276 3300046511 Bacteria 1708
997 Ga0495608_0127601 3300046511 Bacteria 1629
998 Ga0495608_0279134 3300046511 Bacteria 1037
999 Ga0495628_0033834 3300046516 Bacteria 4116
1000 Ga0495628_0105848 3300046516 Bacteria 2167
1001 Ga0495628_0443940 3300046516 Bacteria 943
1002 Ga0495630_0029084 3300046517 Bacteria 4107
1003 Ga0495630_0056130 3300046517 Bacteria 2951
1004 Ga0495630_0065190 3300046517 Bacteria 2737
1005 Ga0495630_0110340 3300046517 Bacteria 2084
1006 Ga0495630_0158586 3300046517 Bacteria 1722
1007 Ga0495630_0699481 3300046517 Bacteria 775
1008 Ga0495631_0030977 3300046518 Unclassified 2424
1009 Ga0495666_0063979 3300046526 Bacteria 1756
1010 Ga0495652_0095351 3300046529 Bacteria 2424
1011 Ga0495652_0142057 3300046529 Bacteria 1887
1012 Ga0495652_0183576 3300046529 Bacteria 1603
1013 Ga0495652_0247313 3300046529 Bacteria 1323
1014 Ga0495652_0461436 3300046529 Bacteria 887
1015 Ga0495654_0233464 3300046530 Bacteria 773
1016 Ga0495665_0086623 3300046531 Bacteria 1646
1017 Ga0495665_0149299 3300046531 Bacteria 1220
1018 Ga0495640_0019423 3300046533 Bacteria 5015
1019 Ga0495640_0070726 3300046533 Bacteria 2343
1020 Ga0495640_0090361 3300046533 Bacteria 2022
1021 Ga0495640_0266169 3300046533 Bacteria 1070
1022 Ga0495586_0011690 3300046535 Bacteria 4669
1023 Ga0495586_0252818 3300046535 Unclassified 1006
1024 Ga0495587_0082758 3300046536 Bacteria 1859
1025 Ga0495587_0098432 3300046536 Bacteria 1686
1026 Ga0495598_0075635 3300046537 Bacteria 1070
1027 Ga0495598_0112075 3300046537 Bacteria 916
1028 Ga0495609_0112922 3300046538 Unclassified 1172
1029 Ga0495645_0102912 3300046543 Bacteria 2029
1030 Ga0495645_0448240 3300046543 Unclassified 814
1031 Ga0495645_0478659 3300046543 Bacteria 781
1032 Ga0495667_0002397 3300046559 Bacteria 12532
1033 Ga0495667_0020012 3300046559 Bacteria 4513
1034 Ga0495667_0045214 3300046559 Bacteria 2916
1035 Ga0495667_0054820 3300046559 Bacteria 2622
1036 Ga0495667_0082516 3300046559 Bacteria 2088
1037 Ga0495667_0085109 3300046559 Bacteria 2052
1038 Ga0495667_0093105 3300046559 Bacteria 1951
1039 Ga0495656_0034981 3300046615 Unclassified 2061
1040 Ga0495656_0056688 3300046615 Bacteria 1694
1041 Ga0495656_0460982 3300046615 Bacteria 670
1042 Ga0495634_0008524 3300046642 Bacteria 7622
1043 Ga0495634_0048048 3300046642 Bacteria 2874
1044 Ga0495634_0075065 3300046642 Bacteria 2221
1045 Ga0495634_0143878 3300046642 Bacteria 1512
1046 Ga0495634_0179096 3300046642 Bacteria 1328
1047 Ga0495634_0452405 3300046642 Bacteria 757
1048 Ga0495611_0143235 3300046648 Bacteria 1116
1049 Ga0495635_0020039 3300046663 Bacteria 4661
1050 Ga0495635_0036436 3300046663 Bacteria 3410
1051 Ga0495635_0088626 3300046663 Bacteria 2117
1052 Ga0495635_0531300 3300046663 Bacteria 772
1053 Ga0495659_0067275 3300046664 Bacteria 1336
1054 Ga0495659_0246787 3300046664 Unclassified 743
1055 Ga0495661_0205703 3300046665 Bacteria 1028
1056 Ga0495657_0011624 3300046675 Bacteria 6574
1057 Ga0495657_0019426 3300046675 Bacteria 4901
1058 Ga0495657_0028795 3300046675 Bacteria 3902
1059 Ga0495657_0199563 3300046675 Bacteria 1220
1060 Ga0495599_0072964 3300046678 Bacteria 2142
1061 Ga0495599_0092733 3300046678 Unclassified 1884
1062 Ga0495623_0030274 3300046679 Bacteria 3482
1063 Ga0495646_0035388 3300046680 Bacteria 3098
1064 Ga0495647_0004080 3300046681 Bacteria 4720
1065 Ga0495647_0036519 3300046681 Unclassified 1850
1066 Ga0495647_0073793 3300046681 Bacteria 1371
1067 Ga0495658_0000247 3300046683 Bacteria 30977
1068 Ga0495658_0027012 3300046683 Bacteria 3084
1069 Ga0495658_0032563 3300046683 Bacteria 2848
1070 Ga0495658_0070745 3300046683 Bacteria 2025
1071 Ga0495658_0582563 3300046683 Bacteria 717
1072 Ga0495613_0013675 3300046689 Bacteria 6021
1073 Ga0495613_0030117 3300046689 Bacteria 4032
1074 Ga0495613_0032931 3300046689 Bacteria 3851
1075 Ga0495613_0060816 3300046689 Bacteria 2766
1076 Ga0495624_0010741 3300046690 Bacteria 6310
1077 Ga0495624_0109848 3300046690 Unclassified 1696
1078 Ga0495624_0183656 3300046690 Bacteria 1274
1079 Ga0495670_0146774 3300046691 Bacteria 1236
1080 Ga0495671_0448624 3300046692 Bacteria 617
1081 Ga0495589_0013425 3300046794 Bacteria 4227
1082 Ga0495589_0208818 3300046794 Bacteria 920
1083 Ga0495600_0017559 3300046809 Bacteria 4553
1084 Ga0495600_0059533 3300046809 Bacteria 2495
1085 Ga0495600_0073141 3300046809 Unclassified 2238
1086 Ga0495600_0088693 3300046809 Bacteria 2018
1087 Ga0495581_0002147 3300047315 Bacteria 11128
1088 Ga0495581_0003701 3300047315 Bacteria 8805
1089 Ga0495581_0116740 3300047315 Bacteria 1552
1090 Ga0495604_0016420 3300047317 Bacteria 5918
1091 Ga0495604_0033832 3300047317 Bacteria 4045
1092 Ga0495604_0259618 3300047317 Bacteria 1181
1093 Ga0495604_0570929 3300047317 Bacteria 728
1094 Ga0495636_0144749 3300047318 Bacteria 1063
1095 Ga0495674_0003941 3300047319 Bacteria 14400
1096 Ga0495674_0019510 3300047319 Bacteria 6289
1097 Ga0495674_0045864 3300047319 Bacteria 3881
1098 Ga0495674_0055315 3300047319 Bacteria 3481
1099 Ga0495674_0129472 3300047319 Bacteria 2127
1100 Ga0495674_0539616 3300047319 Bacteria 929
1101 Ga0495676_0001077 3300047321 Bacteria 23118
1102 Ga0495680_0003636 3300047322 Bacteria 15062
1103 Ga0495680_0006023 3300047322 Bacteria 11341
1104 Ga0495680_0011046 3300047322 Bacteria 8022
1105 Ga0495680_0011579 3300047322 Bacteria 7797
1106 Ga0495680_0024182 3300047322 Bacteria 5041
1107 Ga0495680_0036742 3300047322 Unclassified 3929
1108 Ga0495680_0043068 3300047322 Bacteria 3577
1109 Ga0495680_0655613 3300047322 Bacteria 697
1110 Ga0495675_0204003 3300047444 Unclassified 1202
1111 Ga0495685_010607 3300047447 Unclassified 3094
1112 Ga0495684_0001855 3300047471 Bacteria 16919
1113 Ga0495684_0018726 3300047471 Bacteria 5333
1114 Ga0495684_0083411 3300047471 Bacteria 2424
1115 Ga0495684_0456493 3300047471 Bacteria 887
1116 Ga0495593_0012759 3300047673 Bacteria 4798
1117 Ga0495593_0129579 3300047673 Bacteria 1281
1118 Ga0495593_0509422 3300047673 Bacteria 603
1119 Ga0495602_0122289 3300048088 Bacteria 2092
1120 Ga0495602_0141061 3300048088 Bacteria 1907
1121 Ga0495602_0193124 3300048088 Bacteria 1559
1122 Ga0495602_0351718 3300048088 Bacteria 1063
1123 Ga0495614_0013434 3300048089 Bacteria 3592
1124 Ga0495614_0074716 3300048089 Unclassified 1464
1125 Ga0495626_0327940 3300048091 Bacteria 601
1126 Ga0496100_0001575 3300048903 Bacteria 11237
1127 Ga0496100_0004851 3300048903 Bacteria 7183
1128 Ga0496100_0010229 3300048903 Bacteria 5306
1129 Ga0496100_0031775 3300048903 Bacteria 3285
1130 Ga0496100_0050817 3300048903 Bacteria 2688
1131 Ga0496100_0063034 3300048903 Unclassified 2449
1132 Ga0496100_0071371 3300048903 Bacteria 2318
1133 Ga0496100_0298960 3300048903 Bacteria 1204
1134 Ga0496101_0008696 3300048904 Bacteria 6640
1135 Ga0496101_0008763 3300048904 Bacteria 6618
1136 Ga0496101_0012134 3300048904 Bacteria 5743
1137 Ga0496101_0012361 3300048904 Bacteria 5696
1138 Ga0496101_0013813 3300048904 Bacteria 5420
1139 Ga0496101_0019837 3300048904 Bacteria 4597
1140 Ga0496101_0045876 3300048904 Bacteria 3132
1141 Ga0496101_0047758 3300048904 Bacteria 3074
1142 Ga0496101_0058115 3300048904 Bacteria 2799
1143 Ga0496101_0163427 3300048904 Unclassified 1709
1144 Ga0496101_0239783 3300048904 Bacteria 1411
1145 Ga0496101_0330518 3300048904 Bacteria 1196
1146 Ga0496102_0022630 3300048905 Bacteria 5569
1147 Ga0496102_0025083 3300048905 Bacteria 5304
1148 Ga0496102_0062684 3300048905 Bacteria 3405
1149 Ga0496102_0078547 3300048905 Bacteria 3038
1150 Ga0496102_0134649 3300048905 Bacteria 2315
1151 Ga0496102_0340261 3300048905 Bacteria 1413
1152 Ga0496102_0417329 3300048905 Bacteria 1260
1153 Ga0496102_0433547 3300048905 Bacteria 1234
1154 Ga0496102_0533133 3300048905 Unclassified 1097
1155 Ga0496102_0859873 3300048905 Bacteria 829
1156 Ga0496103_0001779 3300048906 Bacteria 14061
1157 Ga0496103_0008609 3300048906 Bacteria 6059
1158 Ga0496103_0031043 3300048906 Bacteria 3254
1159 Ga0496103_0067695 3300048906 Bacteria 2230
1160 Ga0496103_0071012 3300048906 Bacteria 2179
1161 Ga0496103_0095128 3300048906 Bacteria 1882
1162 Ga0496103_0309879 3300048906 Bacteria 1015
1163 Ga0496104_0001048 3300048907 Bacteria 23633
1164 Ga0496104_0007716 3300048907 Bacteria 9528
1165 Ga0496104_0015097 3300048907 Bacteria 6990
1166 Ga0496104_0033101 3300048907 Bacteria 4812
1167 Ga0496104_0047160 3300048907 Bacteria 4060
1168 Ga0496104_0066799 3300048907 Bacteria 3415
1169 Ga0496104_0083771 3300048907 Bacteria 3041
1170 Ga0496104_0089440 3300048907 Bacteria 2941
1171 Ga0496104_0136449 3300048907 Bacteria 2357
1172 Ga0496104_0223494 3300048907 Bacteria 1795
1173 Ga0496104_0318189 3300048907 Bacteria 1469
1174 Ga0496104_0485247 3300048907 Bacteria 1147
1175 Ga0496104_0693881 3300048907 Bacteria 926
1176 Ga0496105_0000594 3300048908 Bacteria 24087
1177 Ga0496105_0008293 3300048908 Bacteria 8075
1178 Ga0496105_0011620 3300048908 Bacteria 6965
1179 Ga0496105_0028970 3300048908 Bacteria 4530
1180 Ga0496105_0034310 3300048908 Bacteria 4172
1181 Ga0496105_0196894 3300048908 Bacteria 1646
1182 Ga0496105_0207161 3300048908 Bacteria 1599
1183 Ga0496105_0221655 3300048908 Bacteria 1539
1184 Ga0496105_0430638 3300048908 Bacteria 1043
1185 Ga0496105_0534426 3300048908 Bacteria 917
1186 Ga0496105_0748640 3300048908 Unclassified 746
1187 Ga0496106_0005956 3300048909 Bacteria 9002
1188 Ga0496106_0008187 3300048909 Bacteria 7725
1189 Ga0496106_0017922 3300048909 Bacteria 5237
1190 Ga0496106_0060221 3300048909 Bacteria 2877
1191 Ga0496106_0116498 3300048909 Bacteria 2084
1192 Ga0496106_0123807 3300048909 Unclassified 2023
1193 Ga0496106_0176793 3300048909 Bacteria 1693
1194 Ga0496106_0218441 3300048909 Bacteria 1520
1195 Ga0496107_0008399 3300048910 Bacteria 7146
1196 Ga0496107_0022298 3300048910 Bacteria 4476
1197 Ga0496107_0045134 3300048910 Bacteria 3169
1198 Ga0496107_0057051 3300048910 Bacteria 2822
1199 Ga0496107_0063540 3300048910 Bacteria 2675
1200 Ga0496107_0073243 3300048910 Bacteria 2491
1201 Ga0496107_0092030 3300048910 Bacteria 2216
1202 Ga0496107_0130800 3300048910 Bacteria 1853
1203 Ga0496107_0132341 3300048910 Bacteria 1841
1204 Ga0496107_0207827 3300048910 Bacteria 1455
1205 Ga0496107_0215561 3300048910 Bacteria 1428
1206 Ga0496107_0998163 3300048910 Bacteria 607
1207 Ga0496108_0010409 3300048911 Bacteria 7553
1208 Ga0496108_0028066 3300048911 Bacteria 4656
1209 Ga0496108_0043824 3300048911 Bacteria 3737
1210 Ga0496108_0054227 3300048911 Bacteria 3364
1211 Ga0496108_0152331 3300048911 Bacteria 1995
1212 Ga0496108_0166988 3300048911 Bacteria 1903
1213 Ga0496108_0179769 3300048911 Bacteria 1832
1214 Ga0496108_0195527 3300048911 Bacteria 1754
1215 Ga0496108_0239354 3300048911 Bacteria 1579
1216 Ga0496108_0268424 3300048911 Bacteria 1485
1217 Ga0496108_0359734 3300048911 Bacteria 1270
1218 Ga0496108_0503215 3300048911 Unclassified 1058
1219 Ga0496109_0000463 3300048912 Bacteria 34599
1220 Ga0496109_0000626 3300048912 Bacteria 29449
1221 Ga0496109_0007742 3300048912 Bacteria 9095
1222 Ga0496109_0014816 3300048912 Bacteria 6785
1223 Ga0496109_0017699 3300048912 Bacteria 6251
1224 Ga0496109_0019196 3300048912 Bacteria 6021
1225 Ga0496109_0025337 3300048912 Bacteria 5284
1226 Ga0496109_0030300 3300048912 Bacteria 4850
1227 Ga0496109_0069220 3300048912 Bacteria 3236
1228 Ga0496109_0090622 3300048912 Bacteria 2828
1229 Ga0496109_0144527 3300048912 Bacteria 2225
1230 Ga0496110_0000261 3300048913 Bacteria 34222
1231 Ga0496110_0000563 3300048913 Bacteria 25359
1232 Ga0496110_0007165 3300048913 Bacteria 8879
1233 Ga0496110_0040043 3300048913 Bacteria 4083
1234 Ga0496110_0043948 3300048913 Bacteria 3901
1235 Ga0496110_0064621 3300048913 Bacteria 3234
1236 Ga0496110_0085095 3300048913 Bacteria 2823
1237 Ga0496110_0119476 3300048913 Bacteria 2374
1238 Ga0496110_0143916 3300048913 Unclassified 2156
1239 Ga0496110_0148286 3300048913 Bacteria 2123
1240 Ga0496110_0333783 3300048913 Bacteria 1381
1241 Ga0496111_0000086 3300048914 Bacteria 39141
1242 Ga0496111_0007281 3300048914 Bacteria 7242
1243 Ga0496111_0010323 3300048914 Bacteria 6261
1244 Ga0496111_0010595 3300048914 Bacteria 6193
1245 Ga0496111_0011426 3300048914 Bacteria 5979
1246 Ga0496111_0019287 3300048914 Bacteria 4735
1247 Ga0496111_0028408 3300048914 Bacteria 3964
1248 Ga0496111_0186871 3300048914 Bacteria 1540
1249 Ga0496111_0207041 3300048914 Bacteria 1458
1250 Ga0496111_0224287 3300048914 Bacteria 1396
1251 Ga0496111_0401437 3300048914 Unclassified 1013
1252 Ga0496111_0404763 3300048914 Bacteria 1008
1253 Ga0496111_0898674 3300048914 Bacteria 638
1254 Ga0496112_0001342 3300048915 Bacteria 18712
1255 Ga0496112_0016569 3300048915 Bacteria 6910
1256 Ga0496112_0021620 3300048915 Bacteria 6119
1257 Ga0496112_0026894 3300048915 Bacteria 5544
1258 Ga0496112_0069713 3300048915 Bacteria 3473
1259 Ga0496112_0093840 3300048915 Bacteria 2971
1260 Ga0496112_0098797 3300048915 Bacteria 2888
1261 Ga0496112_0101201 3300048915 Bacteria 2851
1262 Ga0496112_0102144 3300048915 Bacteria 2837
1263 Ga0496112_0163385 3300048915 Bacteria 2193
1264 Ga0496112_0264712 3300048915 Bacteria 1668
1265 Ga0496112_0269566 3300048915 Bacteria 1651
1266 Ga0496112_0467710 3300048915 Bacteria 1198
1267 Ga0496113_0031311 3300048916 Bacteria 3859
1268 Ga0496113_0131667 3300048916 Bacteria 1963
1269 Ga0496113_0174406 3300048916 Bacteria 1703
1270 Ga0496113_0235834 3300048916 Bacteria 1459
1271 Ga0496113_0417764 3300048916 Bacteria 1077
1272 Ga0496113_0756536 3300048916 Bacteria 773
1273 Ga0496114_0000690 3300048917 Bacteria 25130
1274 Ga0496114_0001536 3300048917 Bacteria 17490
1275 Ga0496114_0005912 3300048917 Bacteria 9616
1276 Ga0496114_0012463 3300048917 Bacteria 6806
1277 Ga0496114_0025920 3300048917 Bacteria 4796
1278 Ga0496114_0082308 3300048917 Bacteria 2720
1279 Ga0496114_0112077 3300048917 Unclassified 2338
1280 Ga0496114_0120255 3300048917 Bacteria 2258
1281 Ga0496114_0143607 3300048917 Bacteria 2068
1282 Ga0496114_0171994 3300048917 Bacteria 1888
1283 Ga0496114_0236509 3300048917 Bacteria 1605
1284 Ga0496114_0243561 3300048917 Bacteria 1582
1285 Ga0496114_0267917 3300048917 Bacteria 1505
1286 Ga0496114_0280685 3300048917 Bacteria 1468
1287 Ga0496114_0468153 3300048917 Bacteria 1115
1288 Ga0496115_0006958 3300048918 Bacteria 8308
1289 Ga0496115_0007667 3300048918 Bacteria 7953
1290 Ga0496115_0016034 3300048918 Bacteria 5698
1291 Ga0496115_0018068 3300048918 Bacteria 5404
1292 Ga0496115_0027148 3300048918 Bacteria 4475
1293 Ga0496115_0058268 3300048918 Bacteria 3108
1294 Ga0496115_0082715 3300048918 Bacteria 2616
1295 Ga0496115_0092031 3300048918 Bacteria 2479
1296 Ga0496115_0100540 3300048918 Bacteria 2370
1297 Ga0496115_0145234 3300048918 Bacteria 1958
1298 Ga0496115_0247414 3300048918 Bacteria 1468
1299 Ga0496115_0493115 3300048918 Bacteria 985
1300 Ga0496115_0624375 3300048918 Bacteria 854
1301 Ga0496115_1034297 3300048918 Bacteria 626
1302 Ga0496117_0252066 3300048920 Bacteria 962
1303 Ga0496121_0003393 3300048924 Bacteria 22796
1304 Ga0496124_0505940 3300048927 Bacteria 809
1305 Ga0501291_084244 3300049514 Bacteria 638
1306 Ga0501031_0099378 3300049568 Bacteria 1899
1307 Ga0501031_0166086 3300049568 Bacteria 1443
1308 Ga0501034_0226976 3300049571 Bacteria 1818
1309 Ga0501034_0338464 3300049571 Bacteria 1435
1310 Ga0501036_0077748 3300049572 Bacteria 2808
1311 Ga0501036_0160571 3300049572 Bacteria 1895
1312 Ga0501037_0281347 3300049573 Bacteria 1159
1313 Ga0501038_0295193 3300049574 Bacteria 1273
1314 Ga0501039_0520329 3300049575 Bacteria 934
1315 Ga0501040_0032001 3300049576 Bacteria 3558
1316 Ga0501040_0048507 3300049576 Bacteria 2902
1317 Ga0501040_0120582 3300049576 Bacteria 1840
1318 Ga0501040_0390345 3300049576 Bacteria 999
1319 Ga0501041_0039695 3300049577 Bacteria 2857
1320 Ga0501042_0037687 3300049578 Unclassified 3432
1321 Ga0501042_0074800 3300049578 Bacteria 2424
1322 Ga0501042_0450307 3300049578 Bacteria 934
1323 Ga0501042_0678103 3300049578 Bacteria 749
1324 Ga0501046_0894120 3300049580 Bacteria 620
1325 Ga0501047_0009800 3300049581 Bacteria 9053
1326 Ga0501047_0036325 3300049581 Bacteria 4762
1327 Ga0501047_0047876 3300049581 Bacteria 4130
1328 Ga0501047_0191488 3300049581 Bacteria 1908
1329 Ga0501047_0263116 3300049581 Bacteria 1572
1330 Ga0501048_0390835 3300049582 Bacteria 994
1331 Ga0501048_0425610 3300049582 Bacteria 950
1332 Ga0501067_0000684 3300049583 Bacteria 18236
1333 Ga0501067_0040552 3300049583 Bacteria 2585
1334 Ga0501067_0317318 3300049583 Bacteria 868
1335 Ga0501068_0150831 3300049584 Bacteria 1461
1336 Ga0501068_0176248 3300049584 Bacteria 1351
1337 Ga0501069_0085031 3300049585 Bacteria 1785
1338 Ga0501069_0116351 3300049585 Bacteria 1525
1339 Ga0501069_0278579 3300049585 Bacteria 978
1340 Ga0501070_0000187 3300049586 Bacteria 58257
1341 Ga0501070_0059846 3300049586 Bacteria 3157
1342 Ga0501070_0535568 3300049586 Bacteria 938
1343 Ga0501071_0010601 3300049587 Bacteria 6182
1344 Ga0501072_0072510 3300049588 Bacteria 2722
1345 Ga0501072_0114723 3300049588 Bacteria 2145
1346 Ga0501072_0345995 3300049588 Bacteria 1180
1347 Ga0501072_0594204 3300049588 Bacteria 873
1348 Ga0501073_0127350 3300049589 Bacteria 1765
1349 Ga0501073_0262784 3300049589 Bacteria 1191
1350 Ga0501074_0039632 3300049590 Bacteria 3412
1351 Ga0501074_0060768 3300049590 Bacteria 2722
1352 Ga0501074_0331090 3300049590 Bacteria 1081
1353 Ga0501075_0046587 3300049591 Bacteria 3257
1354 Ga0501075_0080494 3300049591 Bacteria 2466
1355 Ga0501075_0593028 3300049591 Bacteria 845
1356 Ga0501076_0178512 3300049592 Bacteria 1731
1357 Ga0501076_0397722 3300049592 Bacteria 1133
1358 Ga0501077_0199407 3300049593 Bacteria 1271
1359 Ga0501079_0304870 3300049741 Unclassified 1246
1360 Ga0501080_0085748 3300049742 Bacteria 2926
1361 Ga0501080_0233888 3300049742 Bacteria 1679
1362 Ga0501080_0316842 3300049742 Bacteria 1413
1363 Ga0501080_0331901 3300049742 Bacteria 1375
1364 Ga0501080_0557909 3300049742 Bacteria 1020
1365 Ga0501080_0581692 3300049742 Bacteria 995
1366 Ga0501081_0098079 3300049743 Bacteria 2069
1367 Ga0501081_0141135 3300049743 Bacteria 1727
1368 Ga0501044_0263357 3300049823 Bacteria 1662
1369 Ga0501045_0061091 3300049824 Bacteria 2764
1370 Ga0501045_0090987 3300049824 Bacteria 2255
1371 Ga0501045_0623533 3300049824 Bacteria 798
1372 nmdc:mga03n38_16507_c1 3300050490 Bacteria 2872
1373 nmdc:mga00v17_307286_c1 3300050491 Bacteria 1030
1374 nmdc:mga00v17_40795_c1 3300050491 Bacteria 2786
1375 nmdc:mga0yw44_273565_c1 3300050492 Bacteria 1128
1376 nmdc:mga0yw44_35012_c1 3300050492 Bacteria 2947
1377 nmdc:mga0yw44_359720_c1 3300050492 Bacteria 981
1378 nmdc:mga05p37_104588_c1 3300050507 Bacteria 3483
1379 nmdc:mga05p37_107043_c1 3300050507 Bacteria 3440
1380 nmdc:mga05p37_175450_c1 3300050507 Bacteria 2611
1381 nmdc:mga05p37_307137_c1 3300050507 Bacteria 1882
1382 nmdc:mga08y16_204637_c1 3300050511 Bacteria 2045
1383 nmdc:mga08y16_300374_c1 3300050511 Bacteria 1655
1384 nmdc:mga08y16_44085_c1 3300050511 Bacteria 4673
1385 nmdc:mga08y16_519535_c1 3300050511 Bacteria 1208
1386 nmdc:mga0n895_106596_c1 3300050512 Bacteria 2815
1387 nmdc:mga0n895_1335057_c1 3300050512 Unclassified 687
1388 nmdc:mga0rr50_105370_c1 3300050513 Bacteria 2223
1389 nmdc:mga0rr50_290349_c1 3300050513 Bacteria 1366
1390 nmdc:mga0rr50_335112_c1 3300050513 Bacteria 1270
1391 nmdc:mga0rr50_65197_c1 3300050513 Bacteria 2758
1392 nmdc:mga0rr50_883578_c1 3300050513 Bacteria 762
1393 nmdc:mga08x19_109851_c1 3300050514 Unclassified 1838
1394 nmdc:mga08x19_603632_c1 3300050514 Bacteria 778
1395 nmdc:mga0a205_13182_c2 3300050515 Bacteria 4726
1396 nmdc:mga0a205_203734_c1 3300050515 Bacteria 1868
1397 Ga0495601_0010980 3300053077 Bacteria 5408
1398 Ga0495601_0075514 3300053077 Bacteria 2157
1399 Ga0495601_0081126 3300053077 Bacteria 2082
1400 Ga0495601_0084313 3300053077 Bacteria 2041
1401 Ga0495601_0140522 3300053077 Bacteria 1575
1402 Ga0495601_0611532 3300053077 Bacteria 699
1403 Ga0495612_0059843 3300053078 Bacteria 1576
1404 Ga0495612_0115817 3300053078 Bacteria 1150
1405 Ga0495655_0012607 3300053083 Bacteria 1727
1406 Ga0495595_0015142 3300053084 Bacteria 3286
1407 Ga0495595_0018976 3300053084 Unclassified 2978
1408 Ga0495595_0039102 3300053084 Bacteria 2164
1409 Ga0495595_0095196 3300053084 Bacteria 1432
1410 Ga0495619_0011353 3300053085 Bacteria 5609
1411 Ga0495619_0032007 3300053085 Bacteria 3410
1412 Ga0495619_0318691 3300053085 Bacteria 1076
1413 Ga0495619_0395161 3300053085 Bacteria 955
1414 Ga0495619_0775516 3300053085 Bacteria 649
1415 Ga0501084_0059607 3300054114 Bacteria 3195
1416 Ga0501084_0084775 3300054114 Bacteria 2660
1417 Ga0501084_0173643 3300054114 Bacteria 1819
1418 Ga0501084_0281472 3300054114 Bacteria 1404
1419 Ga0590071_014593 3300059421 Bacteria 1843
1420 Ga0590075_019535 3300059424 Bacteria 1682
1421 Ga0501082_0017996 3300060353 Bacteria 6086
1422 Ga0501082_0120023 3300060353 Bacteria 2279
1423 Ga0466962_0006119 3300061719 Bacteria 5785
1424 Ga0466962_0014815 3300061719 Bacteria 3756
1425 Ga0466962_0017977 3300061719 Bacteria 3402
1426 Ga0466962_0075002 3300061719 Bacteria 1616
1427 Ga0466962_0120031 3300061719 Bacteria 1268
1428 Ga0466962_0322235 3300061719 Bacteria 767
1429 Ga0466962_0368673 3300061719 Bacteria 716
1430 Ga0530510_0061846 3300061734 Bacteria 2711
1431 Ga0530510_0185592 3300061734 Bacteria 1543
1432 Ga0530510_0312156 3300061734 Bacteria 1178
1433 Ga0530510_0477903 3300061734 Bacteria 944
1434 Ga0466964_0139669
1435 JGI24744J21845_10000431
1436 JGI24742J22300_10016012
1437 Ga0070658_10011654
1438 Ga0070658_10296871
1439 Ga0070658_10409779
1440 Ga0070683_100005463
1441 Ga0070683_100014696
1442 Ga0070683_100033750
1443 Ga0070683_100046782
1444 Ga0070683_100052937
1445 Ga0070683_100057024
1446 Ga0070683_100145725
1447 Ga0070683_100260471
1448 Ga0070683_101031923
1449 Ga0070683_101366492
1450 Ga0070690_100067093
1451 Ga0068869_100920356
1452 Ga0070666_10045238
1453 Ga0070680_100003716
1454 Ga0070680_100008678
1455 Ga0070680_100020219
1456 Ga0070680_100054779
1457 Ga0070680_100067838
1458 Ga0070680_100269750
1459 Ga0070682_100010000
1460 Ga0070682_100041215
1461 Ga0070682_100285584
1462 Ga0070682_100461932
1463 Ga0068868_100022279
1464 Ga0068868_100030281
1465 Ga0068868_100069123
1466 Ga0070660_100003611
1467 Ga0070660_100003619
1468 Ga0070660_100006608
1469 Ga0070660_100051211
1470 Ga0070660_100105017
1471 Ga0070660_100124802
1472 Ga0070660_100214122
1473 Ga0070660_100309215
1474 Ga0070689_100019349
1475 Ga0070691_10010579
1476 Ga0070691_10159814
1477 Ga0070661_100020146
1478 Ga0070661_100070569
1479 Ga0070661_100194475
1480 Ga0070661_100357842
1481 Ga0070692_10171546
1482 Ga0070669_100432472
1483 Ga0070671_100016842
1484 Ga0070671_100051304
1485 Ga0070671_100153201
1486 Ga0070671_100186333
1487 Ga0070674_100001733
1488 Ga0070674_100029669
1489 Ga0070674_100118210
1490 Ga0070674_100120644
1491 Ga0070674_100413578
1492 Ga0070688_100022203
1493 Ga0070659_100006422
1494 Ga0070659_100026883
1495 Ga0070659_100068194
1496 Ga0070659_101031944
1497 Ga0070667_100156947
1498 Ga0070703_10058935
1499 Ga0070709_10087479
1500 Ga0070709_10105974
1501 Ga0070709_10133658
1502 Ga0070709_10307333
1503 Ga0070709_10511240
1504 Ga0070714_100061015
1505 Ga0070714_100068287
1506 Ga0070714_100135410
1507 Ga0070714_100158496
1508 Ga0070714_100630577
1509 Ga0070714_100753440
1510 Ga0070714_101385433
1511 Ga0070713_100016916
1512 Ga0070713_100023552
1513 Ga0070713_100051791
1514 Ga0070713_100138374
1515 Ga0070713_100163048
1516 Ga0070713_100176256
1517 Ga0070713_100184083
1518 Ga0070713_100329669
1519 Ga0070710_10007274
1520 Ga0070710_10010539
1521 Ga0070710_10060757
1522 Ga0070701_10162227
1523 Ga0070711_100003275
1524 Ga0070711_100055389
1525 Ga0070711_100059978
1526 Ga0070711_100119762
1527 Ga0070711_100212675
1528 Ga0070705_100101127
1529 Ga0070705_100531968
1530 Ga0070700_100002621
1531 Ga0070700_100333315
1532 Ga0070700_100448963
1533 Ga0070694_100568519
1534 Ga0070708_100013462
1535 Ga0070708_100054645
1536 Ga0070708_100175867
1537 Ga0070708_100329009
1538 Ga0070663_100366452
1539 Ga0070663_100755587
1540 Ga0070678_100003222
1541 Ga0070678_100015166
1542 Ga0070678_100151821
1543 Ga0070678_100420577
1544 Ga0070678_100698144
1545 Ga0070681_10001213
1546 Ga0070681_10003066
1547 Ga0070681_10005979
1548 Ga0070681_10099106
1549 Ga0070681_10104999
1550 Ga0070681_10381810
1551 Ga0070681_10439244
1552 Ga0068867_100040761
1553 Ga0068867_100081693
1554 Ga0068867_100109198
1555 Ga0068867_100208271
1556 Ga0070685_10001703
1557 Ga0070706_100358021
1558 Ga0070706_100736563
1559 Ga0070707_100005939
1560 Ga0070707_100110992
1561 Ga0070698_100028099
1562 Ga0070698_100038691
1563 Ga0070698_100053629
1564 Ga0070698_100435010
1565 Ga0070699_100061914
1566 Ga0070699_100173579
1567 Ga0070679_100004486
1568 Ga0070679_100008211
1569 Ga0070679_100019233
1570 Ga0070679_100020574
1571 Ga0070679_100058769
1572 Ga0070679_100271748
1573 Ga0070679_100302921
1574 Ga0070679_100549503
1575 Ga0070679_100780731
1576 Ga0070679_101071482
1577 Ga0070679_101520182
1578 Ga0070684_100007800
1579 Ga0070684_100012798
1580 Ga0070684_100013758
1581 Ga0070684_100017138
1582 Ga0070684_100044829
1583 Ga0070684_100196926
1584 Ga0070684_100318025
1585 Ga0070684_100360746
1586 Ga0070684_100558692
1587 Ga0070684_100560603
1588 Ga0070684_100654445
1589 Ga0070684_100799618
1590 Ga0070697_100196496
1591 Ga0068853_100017800
1592 Ga0068853_100092663
1593 Ga0068853_100330881
1594 Ga0070672_100022002
1595 Ga0070672_100130107
1596 Ga0070672_100623192
1597 Ga0070686_100002161
1598 Ga0070686_100089922
1599 Ga0070686_100102566
1600 Ga0070695_100028871
1601 Ga0070695_100310062
1602 Ga0070696_100006574
1603 Ga0070696_100022344
1604 Ga0070696_100095507
1605 Ga0070696_100128501
1606 Ga0070693_100010437
1607 Ga0070693_100025635
1608 Ga0070693_100063632
1609 Ga0070693_100240317
1610 Ga0070693_100512464
1611 Ga0070665_100012505
1612 Ga0070704_100017712
1613 Ga0070704_100093177
1614 Ga0070704_100137355
1615 Ga0070704_100171840
1616 Ga0070704_100503823
1617 Ga0068855_100022769
1618 Ga0068855_100063071
1619 Ga0068855_100098614
1620 Ga0068855_100116042
1621 Ga0068855_100121526
1622 Ga0068855_100163556
1623 Ga0068855_100200959
1624 Ga0068855_100556072
1625 Ga0070664_100046670
1626 Ga0070664_100050187
1627 Ga0070664_100156584
1628 Ga0070664_100373438
1629 Ga0068857_100038252
1630 Ga0068857_100066469
1631 Ga0068857_100117615
1632 Ga0068857_100287382
1633 Ga0068857_100292510
1634 Ga0068857_100620593
1635 Ga0068854_100345818
1636 Ga0068856_100006927
1637 Ga0068856_100033618
1638 Ga0068856_100035013
1639 Ga0068856_100063290
1640 Ga0068856_100081217
1641 Ga0068856_100082703
1642 Ga0068856_100139902
1643 Ga0068856_100395413
1644 Ga0070702_100007535
1645 Ga0070702_100043548
1646 Ga0070702_100231515
1647 Ga0068852_100027110
1648 Ga0068852_100092269
1649 Ga0068859_100198475
1650 Ga0068864_100205333
1651 Ga0068864_100244089
1652 Ga0068861_100292671
1653 Ga0068861_100725990
1654 Ga0068851_10373505
1655 Ga0068870_10143152
1656 Ga0068870_10294638
1657 Ga0068860_100104907
1658 Ga0068860_101434475
1659 Ga0081455_10021153
1660 Ga0081455_10039632
1661 Ga0081540_1014735
1662 Ga0081539_10000041
1663 Ga0081539_10003477
1664 Ga0081539_10089492
1665 Ga0070717_10013145
1666 Ga0070717_10064666
1667 Ga0070717_10466886
1668 Ga0075365_10439220
1669 Ga0075364_10037251
1670 Ga0075432_10058954
1671 Ga0070715_10002468
1672 Ga0070715_10049790
1673 Ga0070715_10108688
1674 Ga0070716_100003252
1675 Ga0070716_100108668
1676 Ga0070716_100205301
1677 Ga0070712_100033376
1678 Ga0070712_100061780
1679 Ga0070712_100072155
1680 Ga0070712_100107293
1681 Ga0070712_100128214
1682 Ga0070712_100360892
1683 Ga0070712_100392261
1684 Ga0070712_100497154
1685 Ga0097621_100347645
1686 Ga0068871_100184090
1687 Ga0068871_100781676
1688 Ga0075428_100853797
1689 Ga0075428_101147736
1690 Ga0075431_100499385
1691 Ga0075433_10038807
1692 Ga0075433_10045266
1693 Ga0075433_10169677
1694 Ga0075434_100102689
1695 Ga0075429_100854548
1696 Ga0068865_100001919
1697 Ga0068865_100827132
1698 Ga0097620_100198466
1699 Ga0075435_100073109
1700 Ga0075435_100197505
1701 Ga0075435_100266028
1702 Ga0075435_100397018
1703 Ga0075435_100442324
1704 Ga0105240_10016420
1705 Ga0105240_10110931
1706 Ga0105240_10238489
1707 Ga0105240_10404541
1708 Ga0105240_10660834
1709 Ga0105240_11176282
1710 Ga0111539_10041829
1711 Ga0111539_10181772
1712 Ga0105245_10002363
1713 Ga0105245_10006729
1714 Ga0105245_10144642
1715 Ga0105245_10197903
1716 Ga0105245_10914655
1717 Ga0105245_10919533
1718 Ga0105245_10935122
1719 Ga0105247_10032115
1720 Ga0114129_10007795
1721 Ga0114129_10082552
1722 Ga0114129_10265903
1723 Ga0105243_10002852
1724 Ga0105243_10060838
1725 Ga0105243_10125864
1726 Ga0105243_10466986
1727 Ga0105243_10622453
1728 Ga0105243_10904697
1729 Ga0105241_10026869
1730 Ga0105241_10059659
1731 Ga0105241_10077226
1732 Ga0105241_10127395
1733 Ga0105241_10360025
1734 Ga0105241_11235571
1735 Ga0105242_10050202
1736 Ga0105242_10093774
1737 Ga0105242_10389248
1738 Ga0105242_10511307
1739 Ga0105248_10013646
1740 Ga0105248_10605768
1741 Ga0105237_10026541
1742 Ga0105237_10039262
1743 Ga0105238_10051504
1744 Ga0105238_10062175
1745 Ga0105238_10081650
1746 Ga0105238_10275665
1747 Ga0105238_11189360
1748 Ga0105238_11704791
1749 Ga0105249_10135352
1750 Ga0105239_10010390
1751 Ga0105239_10237715
1752 Ga0105239_10335437
1753 Ga0105239_11012051
1754 Ga0105239_11177649
1755 Ga0105239_11351469
1756 Ga0105246_10043731
1757 Ga0105246_10140685
1758 Ga0105246_10294852
1759 Ga0157320_1006806
1760 Ga0157373_10125746
1761 Ga0157373_10219521
1762 Ga0157371_10210646
1763 Ga0157371_10301643
1764 Ga0157371_10378587
1765 Ga0157370_10018569
1766 Ga0157370_10021632
1767 Ga0157370_10052189
1768 Ga0157370_10060686
1769 Ga0157370_10064360
1770 Ga0157370_10070570
1771 Ga0157370_10764622
1772 Ga0157369_10002394
1773 Ga0157369_10003170
1774 Ga0157369_10020044
1775 Ga0157369_10056328
1776 Ga0157369_10096757
1777 Ga0157369_10155660
1778 Ga0157369_10202624
1779 Ga0157369_10229275
1780 Ga0157369_11044160
1781 Ga0157374_10002922
1782 Ga0157374_10084293
1783 Ga0157374_10294943
1784 Ga0157374_10549427
1785 Ga0157374_10859644
1786 Ga0157374_11797968
1787 Ga0157378_10009605
1788 Ga0157378_10324391
1789 Ga0157378_10643372
1790 Ga0157372_10044068
1791 Ga0157372_10061739
1792 Ga0157372_10081192
1793 Ga0157372_10140995
1794 Ga0157372_10142507
1795 Ga0157372_10258868
1796 Ga0157372_10548720
1797 Ga0157372_10821351
1798 Ga0157372_11803098
1799 Ga0157375_10096082
1800 Ga0157375_10175581
1801 Ga0157375_10872772
1802 Ga0163163_10319175
1803 Ga0163163_10543675
1804 Ga0157380_10145813
1805 Ga0182008_10152147
1806 Ga0182008_10177432
1807 Ga0182008_10190379
1808 Ga0157377_10084611
1809 Ga0157377_10230790
1810 Ga0157376_10030959
1811 Ga0157376_10038034
1812 Ga0157376_10306219
1813 Ga0197907_10597396
1814 Ga0206356_11185392
1815 Ga0206356_11685916
1816 Ga0206352_10714872
1817 Ga0206350_11458775
1818 Ga0206354_10026723
1819 Ga0206354_10139567
1820 Ga0206354_10363881
1821 Ga0206354_10652406
1822 Ga0206353_10123035
1823 Ga0206353_10422209
1824 Ga0206353_10506849
1825 Ga0206353_10712429
1826 Ga0206353_10722631
1827 Ga0206353_11405661
1828 Ga0206353_11431565
1829 Ga0206353_12056592
1830 Ga0213873_10016713
1831 Ga0213874_10003560
1832 Ga0213874_10004492
1833 Ga0213874_10017767
1834 Ga0213876_10003400
1835 Ga0213876_10075768
1836 Ga0213875_10011474
1837 Ga0213875_10038297
1838 Ga0213875_10040337
1839 Ga0213875_10106805
1840 Ga0213875_10270277
1841 Ga0224712_10316573
1842 Ga0207656_10469819
1843 Ga0207653_10000589
1844 Ga0207653_10079423
1845 Ga0207653_10124111
1846 Ga0207692_10017312
1847 Ga0207692_10023818
1848 Ga0207692_10083041
1849 Ga0207642_10075270
1850 Ga0207642_10215293
1851 Ga0207710_10046431
1852 Ga0207688_10006630
1853 Ga0207688_10075391
1854 Ga0207688_10083508
1855 Ga0207688_10166598
1856 Ga0207647_10407852
1857 Ga0207685_10011327
1858 Ga0207685_10035135
1859 Ga0207699_10130163
1860 Ga0207699_10147579
1861 Ga0207699_10331384
1862 Ga0207643_10027335
1863 Ga0207643_10439671
1864 Ga0207705_10021888
1865 Ga0207705_10132721
1866 Ga0207705_10373114
1867 Ga0207705_10461490
1868 Ga0207684_10057105
1869 Ga0207684_10398368
1870 Ga0207684_10463827
1871 Ga0207684_10475285
1872 Ga0207654_10016213
1873 Ga0207654_10017166
1874 Ga0207654_10152567
1875 Ga0207654_10406874
1876 Ga0207707_10002380
1877 Ga0207707_10018648
1878 Ga0207707_10034890
1879 Ga0207707_10053386
1880 Ga0207707_10101056
1881 Ga0207707_10185569
1882 Ga0207707_10428964
1883 Ga0207695_10430764
1884 Ga0207671_10054864
1885 Ga0207693_10001862
1886 Ga0207693_10003040
1887 Ga0207693_10003428
1888 Ga0207693_10004843
1889 Ga0207693_10005535
1890 Ga0207693_10026100
1891 Ga0207693_10107272
1892 Ga0207693_10240065
1893 Ga0207693_10388697
1894 Ga0207693_10577094
1895 Ga0207663_10038877
1896 Ga0207663_10041520
1897 Ga0207663_10069621
1898 Ga0207663_10080381
1899 Ga0207663_10089591
1900 Ga0207663_10131975
1901 Ga0207663_10433068
1902 Ga0207663_10535885
1903 Ga0207663_10689595
1904 Ga0207663_10940520
1905 Ga0207660_10012183
1906 Ga0207660_10013519
1907 Ga0207660_10093840
1908 Ga0207660_10100290
1909 Ga0207660_10136020
1910 Ga0207657_10000054
1911 Ga0207657_10001075
1912 Ga0207657_10004160
1913 Ga0207657_10006359
1914 Ga0207657_10013020
1915 Ga0207657_10020763
1916 Ga0207657_10033290
1917 Ga0207657_10141185
1918 Ga0207657_10197179
1919 Ga0207657_10291726
1920 Ga0207657_10337525
1921 Ga0207649_10020282
1922 Ga0207649_10058016
1923 Ga0207649_10327546
1924 Ga0207649_10492429
1925 Ga0207649_10510563
1926 Ga0207652_10033577
1927 Ga0207652_10087978
1928 Ga0207652_10116070
1929 Ga0207652_10147522
1930 Ga0207652_10155906
1931 Ga0207652_10201891
1932 Ga0207652_10308520
1933 Ga0207652_10630200
1934 Ga0207646_10011714
1935 Ga0207646_10323367
1936 Ga0207646_10902080
1937 Ga0207681_10446106
1938 Ga0207694_10026284
1939 Ga0207694_10528077
1940 Ga0207694_10596398
1941 Ga0207694_11186329
1942 Ga0207687_10191162
1943 Ga0207687_10205832
1944 Ga0207687_10960363
1945 Ga0207687_11053672
1946 Ga0207700_10047053
1947 Ga0207700_10152535
1948 Ga0207700_10526897
1949 Ga0207664_10046016
1950 Ga0207664_10062402
1951 Ga0207664_10104816
1952 Ga0207664_10135528
1953 Ga0207664_10156674
1954 Ga0207664_10590707
1955 Ga0207664_10787927
1956 Ga0207664_11168003
1957 Ga0207644_10224211
1958 Ga0207644_10812711
1959 Ga0207690_10018587
1960 Ga0207690_10043519
1961 Ga0207690_10058287
1962 Ga0207690_10185208
1963 Ga0207690_10303620
1964 Ga0207690_10770455
1965 Ga0207706_10829098
1966 Ga0207686_10008636
1967 Ga0207709_10001437
1968 Ga0207709_10078685
1969 Ga0207709_10321493
1970 Ga0207670_10196744
1971 Ga0207669_10000947
1972 Ga0207669_10013492
1973 Ga0207704_10003034
1974 Ga0207704_10180822
1975 Ga0207665_10000344
1976 Ga0207665_10021600
1977 Ga0207665_10050876
1978 Ga0207665_10055879
1979 Ga0207665_10126478
1980 Ga0207691_10003841
1981 Ga0207691_10086709
1982 Ga0207711_10070075
1983 Ga0207689_10853498
1984 Ga0207661_10000588
1985 Ga0207661_10002036
1986 Ga0207661_10011037
1987 Ga0207661_10020465
1988 Ga0207661_10026264
1989 Ga0207661_10074813
1990 Ga0207661_10077742
1991 Ga0207661_10218085
1992 Ga0207661_10239910
1993 Ga0207661_10328890
1994 Ga0207661_10527809
1995 Ga0207661_10704246
1996 Ga0207679_10035462
1997 Ga0207679_10073477
1998 Ga0207679_10147944
1999 Ga0207667_10040671
2000 Ga0207667_10096249
2001 Ga0207667_10175124
2002 Ga0207667_10266827
2003 Ga0207667_10527742
2004 Ga0207667_11025384
2005 Ga0207667_11320108
2006 Ga0207712_10010849
2007 Ga0207712_10357383
2008 Ga0207712_10768104
2009 Ga0207640_10498454
2010 Ga0207640_10522246
2011 Ga0207640_11092456
2012 Ga0207677_10019958
2013 Ga0207677_10057246
2014 Ga0207703_10841855
2015 Ga0207639_10094904
2016 Ga0207639_10269163
2017 Ga0207639_10808038
2018 Ga0207639_10967905
2019 Ga0207678_10116707
2020 Ga0207678_10147567
2021 Ga0207678_10282327
2022 Ga0207678_10718115
2023 Ga0207678_10767031
2024 Ga0207708_10002124
2025 Ga0207708_10249283
2026 Ga0207708_10810477
2027 Ga0207702_10012100
2028 Ga0207702_10024338
2029 Ga0207702_10032479
2030 Ga0207702_10090602
2031 Ga0207702_10102085
2032 Ga0207702_10143631
2033 Ga0207702_10163115
2034 Ga0207702_10296973
2035 Ga0207702_10334128
2036 Ga0207702_10566513
2037 Ga0207702_10802411
2038 Ga0207702_10804748
2039 Ga0207648_10003665
2040 Ga0207648_10514480
2041 Ga0207648_11192295
2042 Ga0207676_10250220
2043 Ga0207676_10355645
2044 Ga0207674_10109936
2045 Ga0207674_10304063
2046 Ga0207674_10358692
2047 Ga0207674_10490563
2048 Ga0207675_100036335
2049 Ga0207675_100484288
2050 Ga0207675_100519942
2051 Ga0207683_10000549
2052 Ga0207683_10004028
2053 Ga0207683_10043295
2054 Ga0207683_10078094
2055 Ga0207683_10367239
2056 Ga0207683_10447707
2057 Ga0207683_10966109
2058 Ga0207698_10087931
2059 Ga0207698_10095007
2060 Ga0207698_10168466
2061 Ga0207698_10476952
2062 Ga0207698_11593173
2063 Ga0207428_10126040
2064 Ga0207428_10353969
2065 Ga0268266_10243689
2066 Ga0268266_10340379
2067 Ga0268264_10105830
2068 Ga0265319_1036087
2069 Ga0265334_10013764
2070 Ga0265318_10034636
2071 Ga0265318_10048967
2072 Ga0265318_10085300
2073 Ga0265318_10265370
2074 Ga0265322_10006559
2075 Ga0265336_10043071
2076 Ga0265338_10003455
2077 Ga0265338_10021766
2078 Ga0265338_10097559
2079 Ga0265338_10170189
2080 Ga0265338_10235934
2081 Ga0265330_10064920
2082 Ga0265332_10169380
2083 Ga0265320_10046447
2084 Ga0265320_10113644
2085 Ga0265325_10074032
2086 Ga0265340_10108901
2087 Ga0265327_10032727
2088 Ga0265327_10109439
2089 Ga0265327_10150643
2090 Ga0265327_10158380
2091 Ga0265327_10175442
2092 Ga0265327_10322355
2093 Ga0307408_100092328
2094 Ga0265313_10030460
2095 Ga0265313_10046383
2096 Ga0265314_10078607
2097 Ga0265342_10079201
2098 Ga0316578_10079921
2099 Ga0307405_10087131
2100 Ga0307413_10069267
2101 Ga0307406_10080729
2102 Ga0307412_10162980
2103 Ga0307412_10193765
2104 Ga0307409_100033256
2105 Ga0307409_101151351
2106 Ga0307416_100051821
2107 Ga0307416_100755289
2108 Ga0307414_10069628
2109 Ga0307411_10012847
2110 Ga0307415_100067637
2111 Ga0307415_100146108
2112 Ga0373930_0005814
2113 Ga0373948_0104465
2114 Ga0373950_0009604
2115 Ga0373950_0016249
2116 Ga0373958_0025873
2117 Ga0373958_0043959
2118 Ga0373959_0002201
2119 Ga0373938_0023737
2120 Ga0373928_0028951
2121 Ga0373928_0058042
2122 Ga0373929_0006551
2123 Ga0373929_0014842
2124 Ga0373940_0005134
2125 Ga0373944_0048535
2126 Ga0373949_0031119
2127 Ga0373951_0014437
2128 Ga0373952_0006790
2129 Ga0373932_0024602
2130 Ga0373936_0009649
2131 Ga0373936_0095529
2132 Ga0373939_0006438
2133 Ga0373941_0011013
2134 Ga0373945_0023282
2135 Ga0373945_0228957
2136 Ga0373945_0233123
2137 Ga0373954_0285449
2138 Ga0373956_0087749
2139 Ga0373956_0172945
2140 Ga0373960_0016556
2141 Ga0373943_0000101
2142 Ga0373943_0001881
2143 Ga0373943_0021015
2144 Ga0373943_0210033
2145 Ga0373943_0498162
2146 Ga0373946_0006107
2147 Ga0373946_0079806
2148 Ga0373955_0224788
2149 Ga0373942_0029525
2150 Ga0373962_0015150
2151 Ga0373962_0024930
2152 Ga0316574_0788391
2153 Ga0373924_0019565
2154 Ga0373931_0002414
2155 Ga0373931_0013901
2156 Ga0373931_0201341
2157 Ga0373935_0026073
2158 Ga0373935_0043236
2159 Ga0373927_0093584
2160 Ga0373933_0074864
2161 Ga0373947_0004085
2162 Ga0373947_0005625
2163 Ga0373947_0039963
2164 Ga0373947_0278737
2165 Ga0373937_0157453
2166 Ga0373937_0234785
2167 Ga0373937_0471658
2168 Ga0373925_0001828
2169 Ga0373925_0898937
2170 Ga0395899_0023795
2171 Ga0395899_0043135
2172 Ga0395899_0050366
2173 Ga0395899_0085357
2174 Ga0395899_0226357
2175 Ga0395899_0315209
2176 Ga0395900_0012528
2177 Ga0395900_0021884
2178 Ga0395900_0024974
2179 Ga0395900_0050336
2180 Ga0395900_0053846
2181 Ga0395900_0160153
2182 Ga0395900_0170449
2183 Ga0395900_0183364
2184 Ga0395900_0184041
2185 Ga0395900_0266290
2186 Ga0395900_0319459
2187 Ga0395900_0403876
2188 Ga0395900_0750026
2189 Ga0395900_0905664
2190 Ga0395898_0001509
2191 Ga0395898_0004411
2192 Ga0395898_0009218
2193 Ga0395898_0011522
2194 Ga0395898_0014811
2195 Ga0395898_0030302
2196 Ga0395898_0091755
2197 Ga0395898_0119799
2198 Ga0395898_0131716
2199 Ga0395898_0153557
2200 Ga0395898_0190719
2201 Ga0395898_0218659
2202 Ga0395898_0255362
2203 Ga0395898_0422585
2204 Ga0395898_0442076
2205 Ga0395898_0463501
2206 Ga0395898_0475823
2207 Ga0395898_0514709
2208 Ga0395898_1172664
2209 Ga0395905_0013885
2210 Ga0395905_0023643
2211 Ga0395905_0024003
2212 Ga0395905_0045512
2213 Ga0395905_0077358
2214 Ga0395905_0100352
2215 Ga0395905_0265388
2216 Ga0395905_0579685
2217 Ga0395905_0805238
2218 Ga0436364_0115954
2219 Ga0436364_0194867
2220 Ga0436364_0454997
2221 Ga0436364_0781557
2222 Ga0436364_0782464
2223 Ga0436364_0797529
2224 Ga0436364_0808770
2225 Ga0436364_1289981
2226 Ga0436364_1386615
2227 Ga0395901_0009334
2228 Ga0395901_0014373
2229 Ga0395901_0049218
2230 Ga0395901_0064947
2231 Ga0395901_0120252
2232 Ga0395901_0143089
2233 Ga0395901_0159762
2234 Ga0395901_0175737
2235 Ga0395901_0235390
2236 Ga0395901_0299523
2237 Ga0395901_0301484
2238 Ga0395901_0313827
2239 Ga0395901_0325207
2240 Ga0395901_0370419
2241 Ga0395901_0552976
2242 Ga0395901_0576038
2243 Ga0395901_1025653
2244 Ga0436365_0134395
2245 Ga0436365_0215850
2246 Ga0436365_0383848
2247 Ga0436365_0704133
2248 Ga0436365_1199523
2249 Ga0436365_1294004
2250 Ga0436365_1682359
2251 Ga0436363_0231463
2252 Ga0436363_0236348
2253 Ga0436363_0256593
2254 Ga0436363_1280299
2255 Ga0436363_1329980
2256 Ga0436363_1583354
2257 Ga0436362_1191867
2258 Ga0439466_0087321
2259 Ga0451793_0532612
2260 Ga0451798_0213579
2261 Ga0451802_1758706
2262 Ga0451853_2291318
2263 Ga0439431_0006790
2264 Ga0439442_001423
2265 Ga0439445_0023401
2266 Ga0439448_0034190
2267 Ga0439448_0119313
2268 Ga0439432_172786
2269 Ga0439449_0107835
2270 Ga0439451_005274
2271 Ga0439454_027757
2272 Ga0439462_0012923
2273 Ga0450920_010083
2274 Ga0450923_007398
2275 Ga0450896_039167
2276 Ga0450900_041346
2277 Ga0439434_0059462
2278 Ga0450901_015700
2279 Ga0451577_0250854
2280 Ga0466969_0021862
2281 Ga0466969_0304967
2282 Ga0466965_0162990
2283 Ga0466966_0006668
2284 Ga0466966_0008410
2285 Ga0466966_0097901
2286 Ga0466966_0503824
2287 Ga0466961_0002717
2288 Ga0466961_0012197
2289 Ga0466961_0019467
2290 Ga0466961_0026671
2291 Ga0466961_0080613
2292 Ga0466961_0083598
2293 Ga0466963_0000059
2294 Ga0466963_0003862
2295 Ga0466963_0004394
2296 Ga0466963_0011736
2297 Ga0466963_0019426
2298 Ga0466963_0019800
2299 Ga0466963_0022077
2300 Ga0466963_0028017
2301 Ga0466963_0030410
2302 Ga0466963_0036391
2303 Ga0466963_0045020
2304 Ga0466963_0108740
2305 Ga0466963_0153419
2306 Ga0466963_0289916
2307 Ga0466963_0308437
2308 Ga0466963_0326204
2309 Ga0466963_0667407
2310 Ga0466964_0002916
2311 Ga0466964_0002988
2312 Ga0466964_0009352
2313 Ga0466964_0009904
2314 Ga0466964_0017077
2315 Ga0466964_0069891
2316 Ga0466964_0288620
2317 Ga0453684_0927053
2318 Ga0466971_0000282
2319 Ga0466971_0009074
2320 Ga0466971_0021690
2321 Ga0466971_0038542
2322 Ga0466971_0141192
2323 Ga0466968_0010810
2324 Ga0466968_0369995
2325 Ga0466970_0350280
2326 Ga0466970_0465361
2327 Ga0466957_0002174
2328 Ga0466957_0004563
2329 Ga0466957_0034703
2330 Ga0466957_0046870
2331 Ga0466957_0047874
2332 Ga0466957_0119300
2333 Ga0466957_0129054
2334 Ga0466957_0291007
2335 Ga0466960_0015647
2336 Ga0466959_0007644
2337 Ga0466959_0034408
2338 Ga0466959_0046436
2339 Ga0466959_0083028
2340 Ga0466959_0091600
2341 Ga0466959_0097862
2342 Ga0466959_0113114
2343 Ga0466959_0252740
2344 Ga0451576_0242555
2345 Ga0466958_0004124
2346 Ga0466958_0010875
2347 Ga0466958_0011292
2348 Ga0466958_0012056
2349 Ga0466958_0016134
2350 Ga0466958_0019424
2351 Ga0466958_0038335
2352 Ga0466958_0052894
2353 Ga0466958_0122597
2354 Ga0466958_0167046
2355 Ga0466958_0223008
2356 Ga0466958_0288138
2357 Ga0466967_0000305
2358 Ga0466967_0010340
2359 Ga0466967_0015053
2360 Ga0466967_0022022
2361 Ga0466967_0026965
2362 Ga0466967_0036019
2363 Ga0466967_0047524
2364 Ga0466967_0051218
2365 Ga0466967_0064739
2366 Ga0466967_0077440
2367 Ga0466967_0100424
2368 Ga0466967_0109764
2369 Ga0466967_0114041
2370 Ga0466967_0125131
2371 Ga0466967_0169777
2372 Ga0466967_0201452
2373 Ga0466967_0275540
2374 Ga0466967_0334276
2375 Ga0466967_0338128
2376 Ga0466967_0374137
2377 Ga0466967_0437090
2378 Ga0466967_0446117
2379 Ga0466967_0449371
2380 Ga0466967_0473827
2381 Ga0466967_0580006
2382 Ga0466967_0751590
2383 Ga0466967_1043283
2384 Ga0466967_1046317
2385 Ga0495592_0020890
2386 Ga0495592_0079525
2387 Ga0495592_0149894
2388 Ga0495603_0017131
2389 Ga0495603_0041553
2390 Ga0495629_0036163
2391 Ga0495629_0065495
2392 Ga0495641_0000374
2393 Ga0495641_0018087
2394 Ga0495641_0021229
2395 Ga0495641_0028226
2396 Ga0495641_0067876
2397 Ga0495641_0236973
2398 Ga0495641_0313605
2399 Ga0495651_0018440
2400 Ga0495651_0028003
2401 Ga0495651_0071904
2402 Ga0495651_0373706
2403 Ga0495653_0015646
2404 Ga0495653_0115384
2405 Ga0495653_0202595
2406 Ga0495653_0213398
2407 Ga0495653_0459145
2408 Ga0495580_0689370
2409 Ga0495582_0000124
2410 Ga0495582_0057505
2411 Ga0495582_0058377
2412 Ga0495605_0054425
2413 Ga0495639_0000786
2414 Ga0495662_0000898
2415 Ga0495662_0449519
2416 Ga0495664_0018607
2417 Ga0495664_0035313
2418 Ga0495664_0097484
2419 Ga0495584_0075372
2420 Ga0495584_0163708
2421 Ga0495584_0227236
2422 Ga0495585_0139257
2423 Ga0495596_0086496
2424 Ga0495596_0160800
2425 Ga0495596_0164174
2426 Ga0495596_0267425
2427 Ga0495608_0010122
2428 Ga0495608_0029476
2429 Ga0495608_0117276
2430 Ga0495608_0127601
2431 Ga0495608_0279134
2432 Ga0495628_0033834
2433 Ga0495628_0105848
2434 Ga0495628_0443940
2435 Ga0495630_0029084
2436 Ga0495630_0056130
2437 Ga0495630_0065190
2438 Ga0495630_0110340
2439 Ga0495630_0158586
2440 Ga0495630_0699481
2441 Ga0495631_0030977
2442 Ga0495666_0063979
2443 Ga0495652_0095351
2444 Ga0495652_0142057
2445 Ga0495652_0183576
2446 Ga0495652_0247313
2447 Ga0495652_0461436
2448 Ga0495654_0233464
2449 Ga0495665_0086623
2450 Ga0495665_0149299
2451 Ga0495640_0019423
2452 Ga0495640_0070726
2453 Ga0495640_0090361
2454 Ga0495640_0266169
2455 Ga0495586_0011690
2456 Ga0495586_0252818
2457 Ga0495587_0082758
2458 Ga0495587_0098432
2459 Ga0495598_0075635
2460 Ga0495598_0112075
2461 Ga0495609_0112922
2462 Ga0495645_0102912
2463 Ga0495645_0448240
2464 Ga0495645_0478659
2465 Ga0495667_0002397
2466 Ga0495667_0020012
2467 Ga0495667_0045214
2468 Ga0495667_0054820
2469 Ga0495667_0082516
2470 Ga0495667_0085109
2471 Ga0495667_0093105
2472 Ga0495656_0034981
2473 Ga0495656_0056688
2474 Ga0495656_0460982
2475 Ga0495634_0008524
2476 Ga0495634_0048048
2477 Ga0495634_0075065
2478 Ga0495634_0143878
2479 Ga0495634_0179096
2480 Ga0495634_0452405
2481 Ga0495611_0143235
2482 Ga0495635_0020039
2483 Ga0495635_0036436
2484 Ga0495635_0088626
2485 Ga0495635_0531300
2486 Ga0495659_0067275
2487 Ga0495659_0246787
2488 Ga0495661_0205703
2489 Ga0495657_0011624
2490 Ga0495657_0019426
2491 Ga0495657_0028795
2492 Ga0495657_0199563
2493 Ga0495599_0072964
2494 Ga0495599_0092733
2495 Ga0495623_0030274
2496 Ga0495646_0035388
2497 Ga0495647_0004080
2498 Ga0495647_0036519
2499 Ga0495647_0073793
2500 Ga0495658_0000247
2501 Ga0495658_0027012
2502 Ga0495658_0032563
2503 Ga0495658_0070745
2504 Ga0495658_0582563
2505 Ga0495613_0013675
2506 Ga0495613_0030117
2507 Ga0495613_0032931
2508 Ga0495613_0060816
2509 Ga0495624_0010741
2510 Ga0495624_0109848
2511 Ga0495624_0183656
2512 Ga0495670_0146774
2513 Ga0495671_0448624
2514 Ga0495589_0013425
2515 Ga0495589_0208818
2516 Ga0495600_0017559
2517 Ga0495600_0059533
2518 Ga0495600_0073141
2519 Ga0495600_0088693
2520 Ga0495581_0002147
2521 Ga0495581_0003701
2522 Ga0495581_0116740
2523 Ga0495604_0016420
2524 Ga0495604_0033832
2525 Ga0495604_0259618
2526 Ga0495604_0570929
2527 Ga0495636_0144749
2528 Ga0495674_0003941
2529 Ga0495674_0019510
2530 Ga0495674_0045864
2531 Ga0495674_0055315
2532 Ga0495674_0129472
2533 Ga0495674_0539616
2534 Ga0495676_0001077
2535 Ga0495680_0003636
2536 Ga0495680_0006023
2537 Ga0495680_0011046
2538 Ga0495680_0011579
2539 Ga0495680_0024182
2540 Ga0495680_0036742
2541 Ga0495680_0043068
2542 Ga0495680_0655613
2543 Ga0495675_0204003
2544 Ga0495685_010607
2545 Ga0495684_0001855
2546 Ga0495684_0018726
2547 Ga0495684_0083411
2548 Ga0495684_0456493
2549 Ga0495593_0012759
2550 Ga0495593_0129579
2551 Ga0495593_0509422
2552 Ga0495602_0122289
2553 Ga0495602_0141061
2554 Ga0495602_0193124
2555 Ga0495602_0351718
2556 Ga0495614_0013434
2557 Ga0495614_0074716
2558 Ga0495626_0327940
2559 Ga0496100_0001575
2560 Ga0496100_0004851
2561 Ga0496100_0010229
2562 Ga0496100_0031775
2563 Ga0496100_0050817
2564 Ga0496100_0063034
2565 Ga0496100_0071371
2566 Ga0496100_0298960
2567 Ga0496101_0008696
2568 Ga0496101_0008763
2569 Ga0496101_0012134
2570 Ga0496101_0012361
2571 Ga0496101_0013813
2572 Ga0496101_0019837
2573 Ga0496101_0045876
2574 Ga0496101_0047758
2575 Ga0496101_0058115
2576 Ga0496101_0163427
2577 Ga0496101_0239783
2578 Ga0496101_0330518
2579 Ga0496102_0022630
2580 Ga0496102_0025083
2581 Ga0496102_0062684
2582 Ga0496102_0078547
2583 Ga0496102_0134649
2584 Ga0496102_0340261
2585 Ga0496102_0417329
2586 Ga0496102_0433547
2587 Ga0496102_0533133
2588 Ga0496102_0859873
2589 Ga0496103_0001779
2590 Ga0496103_0008609
2591 Ga0496103_0031043
2592 Ga0496103_0067695
2593 Ga0496103_0071012
2594 Ga0496103_0095128
2595 Ga0496103_0309879
2596 Ga0496104_0001048
2597 Ga0496104_0007716
2598 Ga0496104_0015097
2599 Ga0496104_0033101
2600 Ga0496104_0047160
2601 Ga0496104_0066799
2602 Ga0496104_0083771
2603 Ga0496104_0089440
2604 Ga0496104_0136449
2605 Ga0496104_0223494
2606 Ga0496104_0318189
2607 Ga0496104_0485247
2608 Ga0496104_0693881
2609 Ga0496105_0000594
2610 Ga0496105_0008293
2611 Ga0496105_0011620
2612 Ga0496105_0028970
2613 Ga0496105_0034310
2614 Ga0496105_0196894
2615 Ga0496105_0207161
2616 Ga0496105_0221655
2617 Ga0496105_0430638
2618 Ga0496105_0534426
2619 Ga0496105_0748640
2620 Ga0496106_0005956
2621 Ga0496106_0008187
2622 Ga0496106_0017922
2623 Ga0496106_0060221
2624 Ga0496106_0116498
2625 Ga0496106_0123807
2626 Ga0496106_0176793
2627 Ga0496106_0218441
2628 Ga0496107_0008399
2629 Ga0496107_0022298
2630 Ga0496107_0045134
2631 Ga0496107_0057051
2632 Ga0496107_0063540
2633 Ga0496107_0073243
2634 Ga0496107_0092030
2635 Ga0496107_0130800
2636 Ga0496107_0132341
2637 Ga0496107_0207827
2638 Ga0496107_0215561
2639 Ga0496107_0998163
2640 Ga0496108_0010409
2641 Ga0496108_0028066
2642 Ga0496108_0043824
2643 Ga0496108_0054227
2644 Ga0496108_0152331
2645 Ga0496108_0166988
2646 Ga0496108_0179769
2647 Ga0496108_0195527
2648 Ga0496108_0239354
2649 Ga0496108_0268424
2650 Ga0496108_0359734
2651 Ga0496108_0503215
2652 Ga0496109_0000463
2653 Ga0496109_0000626
2654 Ga0496109_0007742
2655 Ga0496109_0014816
2656 Ga0496109_0017699
2657 Ga0496109_0019196
2658 Ga0496109_0025337
2659 Ga0496109_0030300
2660 Ga0496109_0069220
2661 Ga0496109_0090622
2662 Ga0496109_0144527
2663 Ga0496110_0000261
2664 Ga0496110_0000563
2665 Ga0496110_0007165
2666 Ga0496110_0040043
2667 Ga0496110_0043948
2668 Ga0496110_0064621
2669 Ga0496110_0085095
2670 Ga0496110_0119476
2671 Ga0496110_0143916
2672 Ga0496110_0148286
2673 Ga0496110_0333783
2674 Ga0496111_0000086
2675 Ga0496111_0007281
2676 Ga0496111_0010323
2677 Ga0496111_0010595
2678 Ga0496111_0011426
2679 Ga0496111_0019287
2680 Ga0496111_0028408
2681 Ga0496111_0186871
2682 Ga0496111_0207041
2683 Ga0496111_0224287
2684 Ga0496111_0401437
2685 Ga0496111_0404763
2686 Ga0496111_0898674
2687 Ga0496112_0001342
2688 Ga0496112_0016569
2689 Ga0496112_0021620
2690 Ga0496112_0026894
2691 Ga0496112_0069713
2692 Ga0496112_0093840
2693 Ga0496112_0098797
2694 Ga0496112_0101201
2695 Ga0496112_0102144
2696 Ga0496112_0163385
2697 Ga0496112_0264712
2698 Ga0496112_0269566
2699 Ga0496112_0467710
2700 Ga0496113_0031311
2701 Ga0496113_0131667
2702 Ga0496113_0174406
2703 Ga0496113_0235834
2704 Ga0496113_0417764
2705 Ga0496113_0756536
2706 Ga0496114_0000690
2707 Ga0496114_0001536
2708 Ga0496114_0005912
2709 Ga0496114_0012463
2710 Ga0496114_0025920
2711 Ga0496114_0082308
2712 Ga0496114_0112077
2713 Ga0496114_0120255
2714 Ga0496114_0143607
2715 Ga0496114_0171994
2716 Ga0496114_0236509
2717 Ga0496114_0243561
2718 Ga0496114_0267917
2719 Ga0496114_0280685
2720 Ga0496114_0468153
2721 Ga0496115_0006958
2722 Ga0496115_0007667
2723 Ga0496115_0016034
2724 Ga0496115_0018068
2725 Ga0496115_0027148
2726 Ga0496115_0058268
2727 Ga0496115_0082715
2728 Ga0496115_0092031
2729 Ga0496115_0100540
2730 Ga0496115_0145234
2731 Ga0496115_0247414
2732 Ga0496115_0493115
2733 Ga0496115_0624375
2734 Ga0496115_1034297
2735 Ga0496117_0252066
2736 Ga0496121_0003393
2737 Ga0496124_0505940
2738 Ga0501291_084244
2739 Ga0501031_0099378
2740 Ga0501031_0166086
2741 Ga0501034_0226976
2742 Ga0501034_0338464
2743 Ga0501036_0077748
2744 Ga0501036_0160571
2745 Ga0501037_0281347
2746 Ga0501038_0295193
2747 Ga0501039_0520329
2748 Ga0501040_0032001
2749 Ga0501040_0048507
2750 Ga0501040_0120582
2751 Ga0501040_0390345
2752 Ga0501041_0039695
2753 Ga0501042_0037687
2754 Ga0501042_0074800
2755 Ga0501042_0450307
2756 Ga0501042_0678103
2757 Ga0501046_0894120
2758 Ga0501047_0009800
2759 Ga0501047_0036325
2760 Ga0501047_0047876
2761 Ga0501047_0191488
2762 Ga0501047_0263116
2763 Ga0501048_0390835
2764 Ga0501048_0425610
2765 Ga0501067_0000684
2766 Ga0501067_0040552
2767 Ga0501067_0317318
2768 Ga0501068_0150831
2769 Ga0501068_0176248
2770 Ga0501069_0085031
2771 Ga0501069_0116351
2772 Ga0501069_0278579
2773 Ga0501070_0000187
2774 Ga0501070_0059846
2775 Ga0501070_0535568
2776 Ga0501071_0010601
2777 Ga0501072_0072510
2778 Ga0501072_0114723
2779 Ga0501072_0345995
2780 Ga0501072_0594204
2781 Ga0501073_0127350
2782 Ga0501073_0262784
2783 Ga0501074_0039632
2784 Ga0501074_0060768
2785 Ga0501074_0331090
2786 Ga0501075_0046587
2787 Ga0501075_0080494
2788 Ga0501075_0593028
2789 Ga0501076_0178512
2790 Ga0501076_0397722
2791 Ga0501077_0199407
2792 Ga0501079_0304870
2793 Ga0501080_0085748
2794 Ga0501080_0233888
2795 Ga0501080_0316842
2796 Ga0501080_0331901
2797 Ga0501080_0557909
2798 Ga0501080_0581692
2799 Ga0501081_0098079
2800 Ga0501081_0141135
2801 Ga0501044_0263357
2802 Ga0501045_0061091
2803 Ga0501045_0090987
2804 Ga0501045_0623533
2805 nmdc:mga03n38_16507_c1
2806 nmdc:mga00v17_307286_c1
2807 nmdc:mga00v17_40795_c1
2808 nmdc:mga0yw44_273565_c1
2809 nmdc:mga0yw44_35012_c1
2810 nmdc:mga0yw44_359720_c1
2811 nmdc:mga05p37_104588_c1
2812 nmdc:mga05p37_107043_c1
2813 nmdc:mga05p37_175450_c1
2814 nmdc:mga05p37_307137_c1
2815 nmdc:mga08y16_204637_c1
2816 nmdc:mga08y16_300374_c1
2817 nmdc:mga08y16_44085_c1
2818 nmdc:mga08y16_519535_c1
2819 nmdc:mga0n895_106596_c1
2820 nmdc:mga0n895_1335057_c1
2821 nmdc:mga0rr50_105370_c1
2822 nmdc:mga0rr50_290349_c1
2823 nmdc:mga0rr50_335112_c1
2824 nmdc:mga0rr50_65197_c1
2825 nmdc:mga0rr50_883578_c1
2826 nmdc:mga08x19_109851_c1
2827 nmdc:mga08x19_603632_c1
2828 nmdc:mga0a205_13182_c2
2829 nmdc:mga0a205_203734_c1
2830 Ga0495601_0010980
2831 Ga0495601_0075514
2832 Ga0495601_0081126
2833 Ga0495601_0084313
2834 Ga0495601_0140522
2835 Ga0495601_0611532
2836 Ga0495612_0059843
2837 Ga0495612_0115817
2838 Ga0495655_0012607
2839 Ga0495595_0015142
2840 Ga0495595_0018976
2841 Ga0495595_0039102
2842 Ga0495595_0095196
2843 Ga0495619_0011353
2844 Ga0495619_0032007
2845 Ga0495619_0318691
2846 Ga0495619_0395161
2847 Ga0495619_0775516
2848 Ga0501084_0059607
2849 Ga0501084_0084775
2850 Ga0501084_0173643
2851 Ga0501084_0281472
2852 Ga0590071_014593
2853 Ga0590075_019535
2854 Ga0501082_0017996
2855 Ga0501082_0120023
2856 Ga0466962_0006119
2857 Ga0466962_0014815
2858 Ga0466962_0017977
2859 Ga0466962_0075002
2860 Ga0466962_0120031
2861 Ga0466962_0322235
2862 Ga0466962_0368673
2863 Ga0530510_0061846
2864 Ga0530510_0185592
2865 Ga0530510_0312156
2866 Ga0530510_0477903

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04472

SepF

Cell division protein SepF

131

202

0.97

Map