F493926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1433 | 420 | 2866 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300044706|Ga0466964_0139669|Ga0466964_0139669_312_974 |
| Length | 220 |
| Sequence | MPADGRSLRPCIALAECARIDERRPAGASKLATVALGDLWNRTLVYFGIAEEDDDWDDEDGYAAEESLEQTYRERPNVRRLTPRRRGHDYDDWTESESDAQTARAPAIRQARLRDARPQIEAVPGPSSVRVHLILPRSFNDAQQIADRFKSGMPVILNLQSADAELSKRLIDFTSGLTYALNGGMQRVADKVFLLTPRNVEVSAEQRAQLLERGGFFNQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 214 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 216 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 218 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 263 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 268 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 269 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 270 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 271 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 272 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 273 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 279 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 417 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 420 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.74 |
| Metatranscriptomes | 1.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 12.49 |
| Rhizosphere | 84.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466964_0139669 | 3300044706 | Bacteria | 1112 |
| 2 | JGI24744J21845_10000431 | 3300002077 | Bacteria | 7361 |
| 3 | JGI24742J22300_10016012 | 3300002244 | Bacteria | 1263 |
| 4 | Ga0070658_10011654 | 3300005327 | Bacteria | 7051 |
| 5 | Ga0070658_10296871 | 3300005327 | Bacteria | 1377 |
| 6 | Ga0070658_10409779 | 3300005327 | Bacteria | 1165 |
| 7 | Ga0070683_100005463 | 3300005329 | Bacteria | 10618 |
| 8 | Ga0070683_100014696 | 3300005329 | Bacteria | 6858 |
| 9 | Ga0070683_100033750 | 3300005329 | Bacteria | 4668 |
| 10 | Ga0070683_100046782 | 3300005329 | Bacteria | 3998 |
| 11 | Ga0070683_100052937 | 3300005329 | Bacteria | 3761 |
| 12 | Ga0070683_100057024 | 3300005329 | Bacteria | 3628 |
| 13 | Ga0070683_100145725 | 3300005329 | Bacteria | 2243 |
| 14 | Ga0070683_100260471 | 3300005329 | Bacteria | 1649 |
| 15 | Ga0070683_101031923 | 3300005329 | Bacteria | 790 |
| 16 | Ga0070683_101366492 | 3300005329 | Bacteria | 681 |
| 17 | Ga0070690_100067093 | 3300005330 | Bacteria | 2324 |
| 18 | Ga0068869_100920356 | 3300005334 | Bacteria | 758 |
| 19 | Ga0070666_10045238 | 3300005335 | Bacteria | 2950 |
| 20 | Ga0070680_100003716 | 3300005336 | Bacteria | 11400 |
| 21 | Ga0070680_100008678 | 3300005336 | Bacteria | 7791 |
| 22 | Ga0070680_100020219 | 3300005336 | Bacteria | 5282 |
| 23 | Ga0070680_100054779 | 3300005336 | Bacteria | 3257 |
| 24 | Ga0070680_100067838 | 3300005336 | Bacteria | 2927 |
| 25 | Ga0070680_100269750 | 3300005336 | Bacteria | 1441 |
| 26 | Ga0070682_100010000 | 3300005337 | Bacteria | 5373 |
| 27 | Ga0070682_100041215 | 3300005337 | Bacteria | 2845 |
| 28 | Ga0070682_100285584 | 3300005337 | Unclassified | 1205 |
| 29 | Ga0070682_100461932 | 3300005337 | Bacteria | 975 |
| 30 | Ga0068868_100022279 | 3300005338 | Bacteria | 4778 |
| 31 | Ga0068868_100030281 | 3300005338 | Bacteria | 4150 |
| 32 | Ga0068868_100069123 | 3300005338 | Bacteria | 2814 |
| 33 | Ga0070660_100003611 | 3300005339 | Bacteria | 10692 |
| 34 | Ga0070660_100003619 | 3300005339 | Bacteria | 10672 |
| 35 | Ga0070660_100006608 | 3300005339 | Bacteria | 8047 |
| 36 | Ga0070660_100051211 | 3300005339 | Bacteria | 3179 |
| 37 | Ga0070660_100105017 | 3300005339 | Bacteria | 2241 |
| 38 | Ga0070660_100124802 | 3300005339 | Bacteria | 2057 |
| 39 | Ga0070660_100214122 | 3300005339 | Bacteria | 1564 |
| 40 | Ga0070660_100309215 | 3300005339 | Bacteria | 1297 |
| 41 | Ga0070689_100019349 | 3300005340 | Bacteria | 5034 |
| 42 | Ga0070691_10010579 | 3300005341 | Bacteria | 4213 |
| 43 | Ga0070691_10159814 | 3300005341 | Bacteria | 1161 |
| 44 | Ga0070661_100020146 | 3300005344 | Bacteria | 4755 |
| 45 | Ga0070661_100070569 | 3300005344 | Bacteria | 2569 |
| 46 | Ga0070661_100194475 | 3300005344 | Bacteria | 1548 |
| 47 | Ga0070661_100357842 | 3300005344 | Bacteria | 1146 |
| 48 | Ga0070692_10171546 | 3300005345 | Bacteria | 1251 |
| 49 | Ga0070669_100432472 | 3300005353 | Bacteria | 1082 |
| 50 | Ga0070671_100016842 | 3300005355 | Bacteria | 5910 |
| 51 | Ga0070671_100051304 | 3300005355 | Bacteria | 3431 |
| 52 | Ga0070671_100153201 | 3300005355 | Bacteria | 1947 |
| 53 | Ga0070671_100186333 | 3300005355 | Bacteria | 1758 |
| 54 | Ga0070674_100001733 | 3300005356 | Bacteria | 11819 |
| 55 | Ga0070674_100029669 | 3300005356 | Bacteria | 3607 |
| 56 | Ga0070674_100118210 | 3300005356 | Bacteria | 1958 |
| 57 | Ga0070674_100120644 | 3300005356 | Bacteria | 1940 |
| 58 | Ga0070674_100413578 | 3300005356 | Bacteria | 1105 |
| 59 | Ga0070688_100022203 | 3300005365 | Bacteria | 3714 |
| 60 | Ga0070659_100006422 | 3300005366 | Bacteria | 8489 |
| 61 | Ga0070659_100026883 | 3300005366 | Bacteria | 4429 |
| 62 | Ga0070659_100068194 | 3300005366 | Bacteria | 2821 |
| 63 | Ga0070659_101031944 | 3300005366 | Bacteria | 723 |
| 64 | Ga0070667_100156947 | 3300005367 | Unclassified | 2002 |
| 65 | Ga0070703_10058935 | 3300005406 | Bacteria | 1251 |
| 66 | Ga0070709_10087479 | 3300005434 | Bacteria | 2047 |
| 67 | Ga0070709_10105974 | 3300005434 | Unclassified | 1881 |
| 68 | Ga0070709_10133658 | 3300005434 | Bacteria | 1696 |
| 69 | Ga0070709_10307333 | 3300005434 | Bacteria | 1160 |
| 70 | Ga0070709_10511240 | 3300005434 | Bacteria | 914 |
| 71 | Ga0070714_100061015 | 3300005435 | Bacteria | 3237 |
| 72 | Ga0070714_100068287 | 3300005435 | Bacteria | 3066 |
| 73 | Ga0070714_100135410 | 3300005435 | Unclassified | 2205 |
| 74 | Ga0070714_100158496 | 3300005435 | Bacteria | 2045 |
| 75 | Ga0070714_100630577 | 3300005435 | Bacteria | 1031 |
| 76 | Ga0070714_100753440 | 3300005435 | Bacteria | 941 |
| 77 | Ga0070714_101385433 | 3300005435 | Bacteria | 687 |
| 78 | Ga0070713_100016916 | 3300005436 | Bacteria | 5496 |
| 79 | Ga0070713_100023552 | 3300005436 | Bacteria | 4780 |
| 80 | Ga0070713_100051791 | 3300005436 | Bacteria | 3397 |
| 81 | Ga0070713_100138374 | 3300005436 | Bacteria | 2154 |
| 82 | Ga0070713_100163048 | 3300005436 | Unclassified | 1991 |
| 83 | Ga0070713_100176256 | 3300005436 | Bacteria | 1919 |
| 84 | Ga0070713_100184083 | 3300005436 | Bacteria | 1878 |
| 85 | Ga0070713_100329669 | 3300005436 | Bacteria | 1412 |
| 86 | Ga0070710_10007274 | 3300005437 | Bacteria | 5354 |
| 87 | Ga0070710_10010539 | 3300005437 | Bacteria | 4543 |
| 88 | Ga0070710_10060757 | 3300005437 | Bacteria | 2150 |
| 89 | Ga0070701_10162227 | 3300005438 | Bacteria | 1295 |
| 90 | Ga0070711_100003275 | 3300005439 | Bacteria | 9415 |
| 91 | Ga0070711_100055389 | 3300005439 | Bacteria | 2739 |
| 92 | Ga0070711_100059978 | 3300005439 | Bacteria | 2643 |
| 93 | Ga0070711_100119762 | 3300005439 | Bacteria | 1945 |
| 94 | Ga0070711_100212675 | 3300005439 | Bacteria | 1498 |
| 95 | Ga0070705_100101127 | 3300005440 | Bacteria | 1820 |
| 96 | Ga0070705_100531968 | 3300005440 | Bacteria | 898 |
| 97 | Ga0070700_100002621 | 3300005441 | Bacteria | 9198 |
| 98 | Ga0070700_100333315 | 3300005441 | Bacteria | 1119 |
| 99 | Ga0070700_100448963 | 3300005441 | Bacteria | 981 |
| 100 | Ga0070694_100568519 | 3300005444 | Bacteria | 910 |
| 101 | Ga0070708_100013462 | 3300005445 | Bacteria | 6700 |
| 102 | Ga0070708_100054645 | 3300005445 | Bacteria | 3548 |
| 103 | Ga0070708_100175867 | 3300005445 | Bacteria | 2000 |
| 104 | Ga0070708_100329009 | 3300005445 | Bacteria | 1440 |
| 105 | Ga0070663_100366452 | 3300005455 | Bacteria | 1170 |
| 106 | Ga0070663_100755587 | 3300005455 | Unclassified | 830 |
| 107 | Ga0070678_100003222 | 3300005456 | Bacteria | 9060 |
| 108 | Ga0070678_100015166 | 3300005456 | Bacteria | 4890 |
| 109 | Ga0070678_100151821 | 3300005456 | Bacteria | 1867 |
| 110 | Ga0070678_100420577 | 3300005456 | Bacteria | 1165 |
| 111 | Ga0070678_100698144 | 3300005456 | Unclassified | 914 |
| 112 | Ga0070681_10001213 | 3300005458 | Bacteria | 22417 |
| 113 | Ga0070681_10003066 | 3300005458 | Bacteria | 15497 |
| 114 | Ga0070681_10005979 | 3300005458 | Bacteria | 11789 |
| 115 | Ga0070681_10099106 | 3300005458 | Bacteria | 2860 |
| 116 | Ga0070681_10104999 | 3300005458 | Bacteria | 2767 |
| 117 | Ga0070681_10381810 | 3300005458 | Bacteria | 1319 |
| 118 | Ga0070681_10439244 | 3300005458 | Bacteria | 1217 |
| 119 | Ga0068867_100040761 | 3300005459 | Bacteria | 3391 |
| 120 | Ga0068867_100081693 | 3300005459 | Bacteria | 2437 |
| 121 | Ga0068867_100109198 | 3300005459 | Bacteria | 2123 |
| 122 | Ga0068867_100208271 | 3300005459 | Bacteria | 1569 |
| 123 | Ga0070685_10001703 | 3300005466 | Bacteria | 11556 |
| 124 | Ga0070706_100358021 | 3300005467 | Bacteria | 1360 |
| 125 | Ga0070706_100736563 | 3300005467 | Bacteria | 913 |
| 126 | Ga0070707_100005939 | 3300005468 | Bacteria | 11394 |
| 127 | Ga0070707_100110992 | 3300005468 | Unclassified | 2659 |
| 128 | Ga0070698_100028099 | 3300005471 | Bacteria | 5846 |
| 129 | Ga0070698_100038691 | 3300005471 | Bacteria | 4914 |
| 130 | Ga0070698_100053629 | 3300005471 | Bacteria | 4097 |
| 131 | Ga0070698_100435010 | 3300005471 | Bacteria | 1247 |
| 132 | Ga0070699_100061914 | 3300005518 | Bacteria | 3242 |
| 133 | Ga0070699_100173579 | 3300005518 | Bacteria | 1911 |
| 134 | Ga0070679_100004486 | 3300005530 | Bacteria | 12895 |
| 135 | Ga0070679_100008211 | 3300005530 | Bacteria | 9814 |
| 136 | Ga0070679_100019233 | 3300005530 | Bacteria | 6637 |
| 137 | Ga0070679_100020574 | 3300005530 | Bacteria | 6435 |
| 138 | Ga0070679_100058769 | 3300005530 | Bacteria | 3832 |
| 139 | Ga0070679_100271748 | 3300005530 | Bacteria | 1649 |
| 140 | Ga0070679_100302921 | 3300005530 | Bacteria | 1549 |
| 141 | Ga0070679_100549503 | 3300005530 | Unclassified | 1099 |
| 142 | Ga0070679_100780731 | 3300005530 | Unclassified | 898 |
| 143 | Ga0070679_101071482 | 3300005530 | Bacteria | 750 |
| 144 | Ga0070679_101520182 | 3300005530 | Unclassified | 616 |
| 145 | Ga0070684_100007800 | 3300005535 | Bacteria | 8349 |
| 146 | Ga0070684_100012798 | 3300005535 | Bacteria | 6738 |
| 147 | Ga0070684_100013758 | 3300005535 | Bacteria | 6531 |
| 148 | Ga0070684_100017138 | 3300005535 | Bacteria | 5937 |
| 149 | Ga0070684_100044829 | 3300005535 | Bacteria | 3826 |
| 150 | Ga0070684_100196926 | 3300005535 | Bacteria | 1835 |
| 151 | Ga0070684_100318025 | 3300005535 | Bacteria | 1430 |
| 152 | Ga0070684_100360746 | 3300005535 | Bacteria | 1337 |
| 153 | Ga0070684_100558692 | 3300005535 | Bacteria | 1062 |
| 154 | Ga0070684_100560603 | 3300005535 | Bacteria | 1060 |
| 155 | Ga0070684_100654445 | 3300005535 | Unclassified | 978 |
| 156 | Ga0070684_100799618 | 3300005535 | Bacteria | 881 |
| 157 | Ga0070697_100196496 | 3300005536 | Bacteria | 1713 |
| 158 | Ga0068853_100017800 | 3300005539 | Bacteria | 5867 |
| 159 | Ga0068853_100092663 | 3300005539 | Bacteria | 2658 |
| 160 | Ga0068853_100330881 | 3300005539 | Bacteria | 1413 |
| 161 | Ga0070672_100022002 | 3300005543 | Bacteria | 4676 |
| 162 | Ga0070672_100130107 | 3300005543 | Bacteria | 2068 |
| 163 | Ga0070672_100623192 | 3300005543 | Unclassified | 941 |
| 164 | Ga0070686_100002161 | 3300005544 | Bacteria | 10855 |
| 165 | Ga0070686_100089922 | 3300005544 | Bacteria | 2052 |
| 166 | Ga0070686_100102566 | 3300005544 | Bacteria | 1935 |
| 167 | Ga0070695_100028871 | 3300005545 | Bacteria | 3444 |
| 168 | Ga0070695_100310062 | 3300005545 | Bacteria | 1169 |
| 169 | Ga0070696_100006574 | 3300005546 | Bacteria | 7761 |
| 170 | Ga0070696_100022344 | 3300005546 | Bacteria | 4297 |
| 171 | Ga0070696_100095507 | 3300005546 | Bacteria | 2123 |
| 172 | Ga0070696_100128501 | 3300005546 | Bacteria | 1841 |
| 173 | Ga0070693_100010437 | 3300005547 | Bacteria | 4654 |
| 174 | Ga0070693_100025635 | 3300005547 | Bacteria | 3175 |
| 175 | Ga0070693_100063632 | 3300005547 | Bacteria | 2151 |
| 176 | Ga0070693_100240317 | 3300005547 | Unclassified | 1196 |
| 177 | Ga0070693_100512464 | 3300005547 | Bacteria | 853 |
| 178 | Ga0070665_100012505 | 3300005548 | Bacteria | 8552 |
| 179 | Ga0070704_100017712 | 3300005549 | Bacteria | 4538 |
| 180 | Ga0070704_100093177 | 3300005549 | Bacteria | 2250 |
| 181 | Ga0070704_100137355 | 3300005549 | Bacteria | 1903 |
| 182 | Ga0070704_100171840 | 3300005549 | Bacteria | 1725 |
| 183 | Ga0070704_100503823 | 3300005549 | Bacteria | 1051 |
| 184 | Ga0068855_100022769 | 3300005563 | Bacteria | 7508 |
| 185 | Ga0068855_100063071 | 3300005563 | Bacteria | 4326 |
| 186 | Ga0068855_100098614 | 3300005563 | Bacteria | 3366 |
| 187 | Ga0068855_100116042 | 3300005563 | Bacteria | 3069 |
| 188 | Ga0068855_100121526 | 3300005563 | Bacteria | 2989 |
| 189 | Ga0068855_100163556 | 3300005563 | Bacteria | 2524 |
| 190 | Ga0068855_100200959 | 3300005563 | Bacteria | 2243 |
| 191 | Ga0068855_100556072 | 3300005563 | Bacteria | 1242 |
| 192 | Ga0070664_100046670 | 3300005564 | Bacteria | 3659 |
| 193 | Ga0070664_100050187 | 3300005564 | Bacteria | 3530 |
| 194 | Ga0070664_100156584 | 3300005564 | Bacteria | 2013 |
| 195 | Ga0070664_100373438 | 3300005564 | Bacteria | 1300 |
| 196 | Ga0068857_100038252 | 3300005577 | Bacteria | 4249 |
| 197 | Ga0068857_100066469 | 3300005577 | Bacteria | 3208 |
| 198 | Ga0068857_100117615 | 3300005577 | Bacteria | 2392 |
| 199 | Ga0068857_100287382 | 3300005577 | Bacteria | 1514 |
| 200 | Ga0068857_100292510 | 3300005577 | Bacteria | 1500 |
| 201 | Ga0068857_100620593 | 3300005577 | Bacteria | 1023 |
| 202 | Ga0068854_100345818 | 3300005578 | Bacteria | 1216 |
| 203 | Ga0068856_100006927 | 3300005614 | Bacteria | 11088 |
| 204 | Ga0068856_100033618 | 3300005614 | Bacteria | 5022 |
| 205 | Ga0068856_100035013 | 3300005614 | Bacteria | 4920 |
| 206 | Ga0068856_100063290 | 3300005614 | Bacteria | 3655 |
| 207 | Ga0068856_100081217 | 3300005614 | Bacteria | 3216 |
| 208 | Ga0068856_100082703 | 3300005614 | Bacteria | 3187 |
| 209 | Ga0068856_100139902 | 3300005614 | Bacteria | 2427 |
| 210 | Ga0068856_100395413 | 3300005614 | Bacteria | 1402 |
| 211 | Ga0070702_100007535 | 3300005615 | Bacteria | 5215 |
| 212 | Ga0070702_100043548 | 3300005615 | Bacteria | 2530 |
| 213 | Ga0070702_100231515 | 3300005615 | Bacteria | 1242 |
| 214 | Ga0068852_100027110 | 3300005616 | Bacteria | 4665 |
| 215 | Ga0068852_100092269 | 3300005616 | Bacteria | 2711 |
| 216 | Ga0068859_100198475 | 3300005617 | Bacteria | 2091 |
| 217 | Ga0068864_100205333 | 3300005618 | Bacteria | 1812 |
| 218 | Ga0068864_100244089 | 3300005618 | Bacteria | 1665 |
| 219 | Ga0068861_100292671 | 3300005719 | Unclassified | 1407 |
| 220 | Ga0068861_100725990 | 3300005719 | Bacteria | 926 |
| 221 | Ga0068851_10373505 | 3300005834 | Bacteria | 834 |
| 222 | Ga0068870_10143152 | 3300005840 | Bacteria | 1401 |
| 223 | Ga0068870_10294638 | 3300005840 | Bacteria | 1022 |
| 224 | Ga0068860_100104907 | 3300005843 | Bacteria | 2699 |
| 225 | Ga0068860_101434475 | 3300005843 | Bacteria | 712 |
| 226 | Ga0081455_10021153 | 3300005937 | Bacteria | 6109 |
| 227 | Ga0081455_10039632 | 3300005937 | Bacteria | 4161 |
| 228 | Ga0081540_1014735 | 3300005983 | Bacteria | 4990 |
| 229 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 230 | Ga0081539_10003477 | 3300005985 | Bacteria | 19242 |
| 231 | Ga0081539_10089492 | 3300005985 | Bacteria | 1594 |
| 232 | Ga0070717_10013145 | 3300006028 | Bacteria | 6327 |
| 233 | Ga0070717_10064666 | 3300006028 | Bacteria | 3039 |
| 234 | Ga0070717_10466886 | 3300006028 | Bacteria | 1139 |
| 235 | Ga0075365_10439220 | 3300006038 | Bacteria | 921 |
| 236 | Ga0075364_10037251 | 3300006051 | Bacteria | 3148 |
| 237 | Ga0075432_10058954 | 3300006058 | Bacteria | 1364 |
| 238 | Ga0070715_10002468 | 3300006163 | Bacteria | 5682 |
| 239 | Ga0070715_10049790 | 3300006163 | Bacteria | 1796 |
| 240 | Ga0070715_10108688 | 3300006163 | Bacteria | 1305 |
| 241 | Ga0070716_100003252 | 3300006173 | Bacteria | 7632 |
| 242 | Ga0070716_100108668 | 3300006173 | Bacteria | 1714 |
| 243 | Ga0070716_100205301 | 3300006173 | Bacteria | 1313 |
| 244 | Ga0070712_100033376 | 3300006175 | Bacteria | 3482 |
| 245 | Ga0070712_100061780 | 3300006175 | Bacteria | 2647 |
| 246 | Ga0070712_100072155 | 3300006175 | Bacteria | 2472 |
| 247 | Ga0070712_100107293 | 3300006175 | Bacteria | 2077 |
| 248 | Ga0070712_100128214 | 3300006175 | Unclassified | 1919 |
| 249 | Ga0070712_100360892 | 3300006175 | Bacteria | 1191 |
| 250 | Ga0070712_100392261 | 3300006175 | Bacteria | 1145 |
| 251 | Ga0070712_100497154 | 3300006175 | Bacteria | 1022 |
| 252 | Ga0097621_100347645 | 3300006237 | Bacteria | 1318 |
| 253 | Ga0068871_100184090 | 3300006358 | Bacteria | 1796 |
| 254 | Ga0068871_100781676 | 3300006358 | Bacteria | 879 |
| 255 | Ga0075428_100853797 | 3300006844 | Bacteria | 966 |
| 256 | Ga0075428_101147736 | 3300006844 | Bacteria | 820 |
| 257 | Ga0075431_100499385 | 3300006847 | Bacteria | 1208 |
| 258 | Ga0075433_10038807 | 3300006852 | Bacteria | 4115 |
| 259 | Ga0075433_10045266 | 3300006852 | Bacteria | 3825 |
| 260 | Ga0075433_10169677 | 3300006852 | Bacteria | 1942 |
| 261 | Ga0075434_100102689 | 3300006871 | Bacteria | 2867 |
| 262 | Ga0075429_100854548 | 3300006880 | Bacteria | 797 |
| 263 | Ga0068865_100001919 | 3300006881 | Bacteria | 12226 |
| 264 | Ga0068865_100827132 | 3300006881 | Bacteria | 801 |
| 265 | Ga0097620_100198466 | 3300006931 | Bacteria | 2091 |
| 266 | Ga0075435_100073109 | 3300007076 | Bacteria | 2802 |
| 267 | Ga0075435_100197505 | 3300007076 | Bacteria | 1704 |
| 268 | Ga0075435_100266028 | 3300007076 | Bacteria | 1462 |
| 269 | Ga0075435_100397018 | 3300007076 | Bacteria | 1186 |
| 270 | Ga0075435_100442324 | 3300007076 | Bacteria | 1121 |
| 271 | Ga0105240_10016420 | 3300009093 | Bacteria | 10024 |
| 272 | Ga0105240_10110931 | 3300009093 | Bacteria | 3319 |
| 273 | Ga0105240_10238489 | 3300009093 | Bacteria | 2109 |
| 274 | Ga0105240_10404541 | 3300009093 | Bacteria | 1537 |
| 275 | Ga0105240_10660834 | 3300009093 | Bacteria | 1144 |
| 276 | Ga0105240_11176282 | 3300009093 | Unclassified | 813 |
| 277 | Ga0111539_10041829 | 3300009094 | Bacteria | 5507 |
| 278 | Ga0111539_10181772 | 3300009094 | Bacteria | 2456 |
| 279 | Ga0105245_10002363 | 3300009098 | Bacteria | 17055 |
| 280 | Ga0105245_10006729 | 3300009098 | Bacteria | 10086 |
| 281 | Ga0105245_10144642 | 3300009098 | Bacteria | 2242 |
| 282 | Ga0105245_10197903 | 3300009098 | Bacteria | 1928 |
| 283 | Ga0105245_10914655 | 3300009098 | Bacteria | 919 |
| 284 | Ga0105245_10919533 | 3300009098 | Bacteria | 917 |
| 285 | Ga0105245_10935122 | 3300009098 | Bacteria | 909 |
| 286 | Ga0105247_10032115 | 3300009101 | Bacteria | 3189 |
| 287 | Ga0114129_10007795 | 3300009147 | Bacteria | 15234 |
| 288 | Ga0114129_10082552 | 3300009147 | Bacteria | 4465 |
| 289 | Ga0114129_10265903 | 3300009147 | Bacteria | 2296 |
| 290 | Ga0105243_10002852 | 3300009148 | Bacteria | 14323 |
| 291 | Ga0105243_10060838 | 3300009148 | Bacteria | 3018 |
| 292 | Ga0105243_10125864 | 3300009148 | Bacteria | 2168 |
| 293 | Ga0105243_10466986 | 3300009148 | Bacteria | 1188 |
| 294 | Ga0105243_10622453 | 3300009148 | Bacteria | 1042 |
| 295 | Ga0105243_10904697 | 3300009148 | Bacteria | 878 |
| 296 | Ga0105241_10026869 | 3300009174 | Bacteria | 4284 |
| 297 | Ga0105241_10059659 | 3300009174 | Bacteria | 2934 |
| 298 | Ga0105241_10077226 | 3300009174 | Bacteria | 2599 |
| 299 | Ga0105241_10127395 | 3300009174 | Bacteria | 2057 |
| 300 | Ga0105241_10360025 | 3300009174 | Unclassified | 1266 |
| 301 | Ga0105241_11235571 | 3300009174 | Bacteria | 709 |
| 302 | Ga0105242_10050202 | 3300009176 | Bacteria | 3396 |
| 303 | Ga0105242_10093774 | 3300009176 | Bacteria | 2532 |
| 304 | Ga0105242_10389248 | 3300009176 | Bacteria | 1298 |
| 305 | Ga0105242_10511307 | 3300009176 | Bacteria | 1144 |
| 306 | Ga0105248_10013646 | 3300009177 | Bacteria | 8943 |
| 307 | Ga0105248_10605768 | 3300009177 | Bacteria | 1236 |
| 308 | Ga0105237_10026541 | 3300009545 | Bacteria | 5920 |
| 309 | Ga0105237_10039262 | 3300009545 | Bacteria | 4779 |
| 310 | Ga0105238_10051504 | 3300009551 | Bacteria | 4141 |
| 311 | Ga0105238_10062175 | 3300009551 | Bacteria | 3734 |
| 312 | Ga0105238_10081650 | 3300009551 | Bacteria | 3222 |
| 313 | Ga0105238_10275665 | 3300009551 | Bacteria | 1663 |
| 314 | Ga0105238_11189360 | 3300009551 | Bacteria | 787 |
| 315 | Ga0105238_11704791 | 3300009551 | Bacteria | 661 |
| 316 | Ga0105249_10135352 | 3300009553 | Bacteria | 2357 |
| 317 | Ga0105239_10010390 | 3300010375 | Bacteria | 10415 |
| 318 | Ga0105239_10237715 | 3300010375 | Bacteria | 2045 |
| 319 | Ga0105239_10335437 | 3300010375 | Bacteria | 1706 |
| 320 | Ga0105239_11012051 | 3300010375 | Unclassified | 955 |
| 321 | Ga0105239_11177649 | 3300010375 | Bacteria | 883 |
| 322 | Ga0105239_11351469 | 3300010375 | Bacteria | 822 |
| 323 | Ga0105246_10043731 | 3300011119 | Bacteria | 3040 |
| 324 | Ga0105246_10140685 | 3300011119 | Bacteria | 1814 |
| 325 | Ga0105246_10294852 | 3300011119 | Bacteria | 1306 |
| 326 | Ga0157320_1006806 | 3300012481 | Bacteria | 802 |
| 327 | Ga0157373_10125746 | 3300013100 | Bacteria | 1803 |
| 328 | Ga0157373_10219521 | 3300013100 | Bacteria | 1341 |
| 329 | Ga0157371_10210646 | 3300013102 | Bacteria | 1394 |
| 330 | Ga0157371_10301643 | 3300013102 | Bacteria | 1160 |
| 331 | Ga0157371_10378587 | 3300013102 | Bacteria | 1033 |
| 332 | Ga0157370_10018569 | 3300013104 | Bacteria | 6990 |
| 333 | Ga0157370_10021632 | 3300013104 | Bacteria | 6408 |
| 334 | Ga0157370_10052189 | 3300013104 | Bacteria | 3904 |
| 335 | Ga0157370_10060686 | 3300013104 | Bacteria | 3589 |
| 336 | Ga0157370_10064360 | 3300013104 | Bacteria | 3472 |
| 337 | Ga0157370_10070570 | 3300013104 | Bacteria | 3297 |
| 338 | Ga0157370_10764622 | 3300013104 | Unclassified | 880 |
| 339 | Ga0157369_10002394 | 3300013105 | Bacteria | 22528 |
| 340 | Ga0157369_10003170 | 3300013105 | Bacteria | 19626 |
| 341 | Ga0157369_10020044 | 3300013105 | Bacteria | 7480 |
| 342 | Ga0157369_10056328 | 3300013105 | Bacteria | 4242 |
| 343 | Ga0157369_10096757 | 3300013105 | Bacteria | 3149 |
| 344 | Ga0157369_10155660 | 3300013105 | Bacteria | 2414 |
| 345 | Ga0157369_10202624 | 3300013105 | Bacteria | 2082 |
| 346 | Ga0157369_10229275 | 3300013105 | Unclassified | 1942 |
| 347 | Ga0157369_11044160 | 3300013105 | Bacteria | 836 |
| 348 | Ga0157374_10002922 | 3300013296 | Bacteria | 14319 |
| 349 | Ga0157374_10084293 | 3300013296 | Bacteria | 3021 |
| 350 | Ga0157374_10294943 | 3300013296 | Bacteria | 1603 |
| 351 | Ga0157374_10549427 | 3300013296 | Bacteria | 1163 |
| 352 | Ga0157374_10859644 | 3300013296 | Bacteria | 924 |
| 353 | Ga0157374_11797968 | 3300013296 | Unclassified | 638 |
| 354 | Ga0157378_10009605 | 3300013297 | Bacteria | 8423 |
| 355 | Ga0157378_10324391 | 3300013297 | Bacteria | 1497 |
| 356 | Ga0157378_10643372 | 3300013297 | Bacteria | 1075 |
| 357 | Ga0157372_10044068 | 3300013307 | Bacteria | 4943 |
| 358 | Ga0157372_10061739 | 3300013307 | Bacteria | 4197 |
| 359 | Ga0157372_10081192 | 3300013307 | Bacteria | 3670 |
| 360 | Ga0157372_10140995 | 3300013307 | Bacteria | 2777 |
| 361 | Ga0157372_10142507 | 3300013307 | Bacteria | 2762 |
| 362 | Ga0157372_10258868 | 3300013307 | Bacteria | 2020 |
| 363 | Ga0157372_10548720 | 3300013307 | Bacteria | 1347 |
| 364 | Ga0157372_10821351 | 3300013307 | Bacteria | 1080 |
| 365 | Ga0157372_11803098 | 3300013307 | Bacteria | 704 |
| 366 | Ga0157375_10096082 | 3300013308 | Bacteria | 3035 |
| 367 | Ga0157375_10175581 | 3300013308 | Bacteria | 2291 |
| 368 | Ga0157375_10872772 | 3300013308 | Unclassified | 1045 |
| 369 | Ga0163163_10319175 | 3300014325 | Bacteria | 1607 |
| 370 | Ga0163163_10543675 | 3300014325 | Bacteria | 1224 |
| 371 | Ga0157380_10145813 | 3300014326 | Bacteria | 2040 |
| 372 | Ga0182008_10152147 | 3300014497 | Unclassified | 1161 |
| 373 | Ga0182008_10177432 | 3300014497 | Bacteria | 1077 |
| 374 | Ga0182008_10190379 | 3300014497 | Bacteria | 1041 |
| 375 | Ga0157377_10084611 | 3300014745 | Bacteria | 1861 |
| 376 | Ga0157377_10230790 | 3300014745 | Bacteria | 1190 |
| 377 | Ga0157376_10030959 | 3300014969 | Bacteria | 4279 |
| 378 | Ga0157376_10038034 | 3300014969 | Bacteria | 3912 |
| 379 | Ga0157376_10306219 | 3300014969 | Bacteria | 1506 |
| 380 | Ga0197907_10597396 | 3300020069 | Bacteria | 1580 |
| 381 | Ga0206356_11185392 | 3300020070 | Bacteria | 1102 |
| 382 | Ga0206356_11685916 | 3300020070 | Bacteria | 3416 |
| 383 | Ga0206352_10714872 | 3300020078 | Unclassified | 623 |
| 384 | Ga0206350_11458775 | 3300020080 | Bacteria | 963 |
| 385 | Ga0206354_10026723 | 3300020081 | Bacteria | 843 |
| 386 | Ga0206354_10139567 | 3300020081 | Bacteria | 2247 |
| 387 | Ga0206354_10363881 | 3300020081 | Bacteria | 1395 |
| 388 | Ga0206354_10652406 | 3300020081 | Bacteria | 1380 |
| 389 | Ga0206353_10123035 | 3300020082 | Bacteria | 3294 |
| 390 | Ga0206353_10422209 | 3300020082 | Bacteria | 1466 |
| 391 | Ga0206353_10506849 | 3300020082 | Bacteria | 8648 |
| 392 | Ga0206353_10712429 | 3300020082 | Bacteria | 4178 |
| 393 | Ga0206353_10722631 | 3300020082 | Bacteria | 1752 |
| 394 | Ga0206353_11405661 | 3300020082 | Bacteria | 764 |
| 395 | Ga0206353_11431565 | 3300020082 | Bacteria | 1058 |
| 396 | Ga0206353_12056592 | 3300020082 | Bacteria | 5106 |
| 397 | Ga0213873_10016713 | 3300021358 | Bacteria | 1663 |
| 398 | Ga0213874_10003560 | 3300021377 | Bacteria | 3470 |
| 399 | Ga0213874_10004492 | 3300021377 | Bacteria | 3191 |
| 400 | Ga0213874_10017767 | 3300021377 | Bacteria | 1913 |
| 401 | Ga0213876_10003400 | 3300021384 | Bacteria | 9108 |
| 402 | Ga0213876_10075768 | 3300021384 | Bacteria | 1777 |
| 403 | Ga0213875_10011474 | 3300021388 | Bacteria | 4406 |
| 404 | Ga0213875_10038297 | 3300021388 | Bacteria | 2259 |
| 405 | Ga0213875_10040337 | 3300021388 | Bacteria | 2198 |
| 406 | Ga0213875_10106805 | 3300021388 | Bacteria | 1307 |
| 407 | Ga0213875_10270277 | 3300021388 | Bacteria | 802 |
| 408 | Ga0224712_10316573 | 3300022467 | Bacteria | 732 |
| 409 | Ga0207656_10469819 | 3300025321 | Bacteria | 637 |
| 410 | Ga0207653_10000589 | 3300025885 | Bacteria | 12860 |
| 411 | Ga0207653_10079423 | 3300025885 | Bacteria | 1133 |
| 412 | Ga0207653_10124111 | 3300025885 | Bacteria | 932 |
| 413 | Ga0207692_10017312 | 3300025898 | Bacteria | 3212 |
| 414 | Ga0207692_10023818 | 3300025898 | Bacteria | 2837 |
| 415 | Ga0207692_10083041 | 3300025898 | Bacteria | 1718 |
| 416 | Ga0207642_10075270 | 3300025899 | Bacteria | 1621 |
| 417 | Ga0207642_10215293 | 3300025899 | Bacteria | 1070 |
| 418 | Ga0207710_10046431 | 3300025900 | Bacteria | 1939 |
| 419 | Ga0207688_10006630 | 3300025901 | Bacteria | 6297 |
| 420 | Ga0207688_10075391 | 3300025901 | Bacteria | 1920 |
| 421 | Ga0207688_10083508 | 3300025901 | Bacteria | 1827 |
| 422 | Ga0207688_10166598 | 3300025901 | Bacteria | 1309 |
| 423 | Ga0207647_10407852 | 3300025904 | Bacteria | 765 |
| 424 | Ga0207685_10011327 | 3300025905 | Bacteria | 2677 |
| 425 | Ga0207685_10035135 | 3300025905 | Bacteria | 1827 |
| 426 | Ga0207699_10130163 | 3300025906 | Bacteria | 1640 |
| 427 | Ga0207699_10147579 | 3300025906 | Bacteria | 1552 |
| 428 | Ga0207699_10331384 | 3300025906 | Bacteria | 1070 |
| 429 | Ga0207643_10027335 | 3300025908 | Bacteria | 3162 |
| 430 | Ga0207643_10439671 | 3300025908 | Bacteria | 829 |
| 431 | Ga0207705_10021888 | 3300025909 | Bacteria | 4561 |
| 432 | Ga0207705_10132721 | 3300025909 | Bacteria | 1854 |
| 433 | Ga0207705_10373114 | 3300025909 | Bacteria | 1101 |
| 434 | Ga0207705_10461490 | 3300025909 | Bacteria | 985 |
| 435 | Ga0207684_10057105 | 3300025910 | Bacteria | 3311 |
| 436 | Ga0207684_10398368 | 3300025910 | Bacteria | 1183 |
| 437 | Ga0207684_10463827 | 3300025910 | Bacteria | 1087 |
| 438 | Ga0207684_10475285 | 3300025910 | Bacteria | 1072 |
| 439 | Ga0207654_10016213 | 3300025911 | Bacteria | 3876 |
| 440 | Ga0207654_10017166 | 3300025911 | Bacteria | 3781 |
| 441 | Ga0207654_10152567 | 3300025911 | Bacteria | 1484 |
| 442 | Ga0207654_10406874 | 3300025911 | Unclassified | 947 |
| 443 | Ga0207707_10002380 | 3300025912 | Bacteria | 16951 |
| 444 | Ga0207707_10018648 | 3300025912 | Bacteria | 6050 |
| 445 | Ga0207707_10034890 | 3300025912 | Bacteria | 4400 |
| 446 | Ga0207707_10053386 | 3300025912 | Bacteria | 3518 |
| 447 | Ga0207707_10101056 | 3300025912 | Bacteria | 2520 |
| 448 | Ga0207707_10185569 | 3300025912 | Bacteria | 1815 |
| 449 | Ga0207707_10428964 | 3300025912 | Bacteria | 1133 |
| 450 | Ga0207695_10430764 | 3300025913 | Bacteria | 1203 |
| 451 | Ga0207671_10054864 | 3300025914 | Bacteria | 2952 |
| 452 | Ga0207693_10001862 | 3300025915 | Bacteria | 18464 |
| 453 | Ga0207693_10003040 | 3300025915 | Bacteria | 14500 |
| 454 | Ga0207693_10003428 | 3300025915 | Bacteria | 13527 |
| 455 | Ga0207693_10004843 | 3300025915 | Bacteria | 11329 |
| 456 | Ga0207693_10005535 | 3300025915 | Bacteria | 10507 |
| 457 | Ga0207693_10026100 | 3300025915 | Bacteria | 4626 |
| 458 | Ga0207693_10107272 | 3300025915 | Unclassified | 2191 |
| 459 | Ga0207693_10240065 | 3300025915 | Bacteria | 1422 |
| 460 | Ga0207693_10388697 | 3300025915 | Bacteria | 1091 |
| 461 | Ga0207693_10577094 | 3300025915 | Bacteria | 876 |
| 462 | Ga0207663_10038877 | 3300025916 | Bacteria | 2880 |
| 463 | Ga0207663_10041520 | 3300025916 | Bacteria | 2803 |
| 464 | Ga0207663_10069621 | 3300025916 | Bacteria | 2264 |
| 465 | Ga0207663_10080381 | 3300025916 | Bacteria | 2131 |
| 466 | Ga0207663_10089591 | 3300025916 | Bacteria | 2037 |
| 467 | Ga0207663_10131975 | 3300025916 | Bacteria | 1727 |
| 468 | Ga0207663_10433068 | 3300025916 | Bacteria | 1011 |
| 469 | Ga0207663_10535885 | 3300025916 | Unclassified | 913 |
| 470 | Ga0207663_10689595 | 3300025916 | Bacteria | 808 |
| 471 | Ga0207663_10940520 | 3300025916 | Bacteria | 692 |
| 472 | Ga0207660_10012183 | 3300025917 | Bacteria | 5620 |
| 473 | Ga0207660_10013519 | 3300025917 | Bacteria | 5350 |
| 474 | Ga0207660_10093840 | 3300025917 | Bacteria | 2230 |
| 475 | Ga0207660_10100290 | 3300025917 | Bacteria | 2162 |
| 476 | Ga0207660_10136020 | 3300025917 | Bacteria | 1875 |
| 477 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 478 | Ga0207657_10001075 | 3300025919 | Bacteria | 28931 |
| 479 | Ga0207657_10004160 | 3300025919 | Bacteria | 15336 |
| 480 | Ga0207657_10006359 | 3300025919 | Bacteria | 12271 |
| 481 | Ga0207657_10013020 | 3300025919 | Bacteria | 8173 |
| 482 | Ga0207657_10020763 | 3300025919 | Bacteria | 6199 |
| 483 | Ga0207657_10033290 | 3300025919 | Bacteria | 4647 |
| 484 | Ga0207657_10141185 | 3300025919 | Bacteria | 1968 |
| 485 | Ga0207657_10197179 | 3300025919 | Bacteria | 1622 |
| 486 | Ga0207657_10291726 | 3300025919 | Bacteria | 1293 |
| 487 | Ga0207657_10337525 | 3300025919 | Bacteria | 1190 |
| 488 | Ga0207649_10020282 | 3300025920 | Bacteria | 3810 |
| 489 | Ga0207649_10058016 | 3300025920 | Bacteria | 2423 |
| 490 | Ga0207649_10327546 | 3300025920 | Bacteria | 1127 |
| 491 | Ga0207649_10492429 | 3300025920 | Bacteria | 931 |
| 492 | Ga0207649_10510563 | 3300025920 | Bacteria | 915 |
| 493 | Ga0207652_10033577 | 3300025921 | Bacteria | 4321 |
| 494 | Ga0207652_10087978 | 3300025921 | Bacteria | 2724 |
| 495 | Ga0207652_10116070 | 3300025921 | Bacteria | 2378 |
| 496 | Ga0207652_10147522 | 3300025921 | Bacteria | 2106 |
| 497 | Ga0207652_10155906 | 3300025921 | Bacteria | 2046 |
| 498 | Ga0207652_10201891 | 3300025921 | Bacteria | 1789 |
| 499 | Ga0207652_10308520 | 3300025921 | Archaea | 1428 |
| 500 | Ga0207652_10630200 | 3300025921 | Bacteria | 960 |
| 501 | Ga0207646_10011714 | 3300025922 | Bacteria | 8478 |
| 502 | Ga0207646_10323367 | 3300025922 | Bacteria | 1394 |
| 503 | Ga0207646_10902080 | 3300025922 | Bacteria | 784 |
| 504 | Ga0207681_10446106 | 3300025923 | Bacteria | 1052 |
| 505 | Ga0207694_10026284 | 3300025924 | Bacteria | 4427 |
| 506 | Ga0207694_10528077 | 3300025924 | Bacteria | 989 |
| 507 | Ga0207694_10596398 | 3300025924 | Bacteria | 929 |
| 508 | Ga0207694_11186329 | 3300025924 | Bacteria | 646 |
| 509 | Ga0207687_10191162 | 3300025927 | Bacteria | 1593 |
| 510 | Ga0207687_10205832 | 3300025927 | Bacteria | 1541 |
| 511 | Ga0207687_10960363 | 3300025927 | Bacteria | 732 |
| 512 | Ga0207687_11053672 | 3300025927 | Unclassified | 698 |
| 513 | Ga0207700_10047053 | 3300025928 | Bacteria | 3195 |
| 514 | Ga0207700_10152535 | 3300025928 | Bacteria | 1911 |
| 515 | Ga0207700_10526897 | 3300025928 | Bacteria | 1047 |
| 516 | Ga0207664_10046016 | 3300025929 | Bacteria | 3424 |
| 517 | Ga0207664_10062402 | 3300025929 | Bacteria | 2976 |
| 518 | Ga0207664_10104816 | 3300025929 | Bacteria | 2342 |
| 519 | Ga0207664_10135528 | 3300025929 | Bacteria | 2077 |
| 520 | Ga0207664_10156674 | 3300025929 | Bacteria | 1939 |
| 521 | Ga0207664_10590707 | 3300025929 | Unclassified | 997 |
| 522 | Ga0207664_10787927 | 3300025929 | Bacteria | 855 |
| 523 | Ga0207664_11168003 | 3300025929 | Bacteria | 687 |
| 524 | Ga0207644_10224211 | 3300025931 | Bacteria | 1491 |
| 525 | Ga0207644_10812711 | 3300025931 | Bacteria | 782 |
| 526 | Ga0207690_10018587 | 3300025932 | Bacteria | 4264 |
| 527 | Ga0207690_10043519 | 3300025932 | Bacteria | 2955 |
| 528 | Ga0207690_10058287 | 3300025932 | Bacteria | 2612 |
| 529 | Ga0207690_10185208 | 3300025932 | Bacteria | 1570 |
| 530 | Ga0207690_10303620 | 3300025932 | Bacteria | 1250 |
| 531 | Ga0207690_10770455 | 3300025932 | Unclassified | 794 |
| 532 | Ga0207706_10829098 | 3300025933 | Bacteria | 784 |
| 533 | Ga0207686_10008636 | 3300025934 | Bacteria | 5502 |
| 534 | Ga0207709_10001437 | 3300025935 | Bacteria | 16621 |
| 535 | Ga0207709_10078685 | 3300025935 | Bacteria | 2117 |
| 536 | Ga0207709_10321493 | 3300025935 | Bacteria | 1158 |
| 537 | Ga0207670_10196744 | 3300025936 | Unclassified | 1529 |
| 538 | Ga0207669_10000947 | 3300025937 | Bacteria | 12291 |
| 539 | Ga0207669_10013492 | 3300025937 | Bacteria | 4059 |
| 540 | Ga0207704_10003034 | 3300025938 | Bacteria | 7583 |
| 541 | Ga0207704_10180822 | 3300025938 | Bacteria | 1524 |
| 542 | Ga0207665_10000344 | 3300025939 | Bacteria | 32292 |
| 543 | Ga0207665_10021600 | 3300025939 | Bacteria | 4234 |
| 544 | Ga0207665_10050876 | 3300025939 | Bacteria | 2787 |
| 545 | Ga0207665_10055879 | 3300025939 | Bacteria | 2664 |
| 546 | Ga0207665_10126478 | 3300025939 | Bacteria | 1810 |
| 547 | Ga0207691_10003841 | 3300025940 | Bacteria | 14577 |
| 548 | Ga0207691_10086709 | 3300025940 | Bacteria | 2809 |
| 549 | Ga0207711_10070075 | 3300025941 | Bacteria | 3040 |
| 550 | Ga0207689_10853498 | 3300025942 | Bacteria | 768 |
| 551 | Ga0207661_10000588 | 3300025944 | Bacteria | 23238 |
| 552 | Ga0207661_10002036 | 3300025944 | Bacteria | 13944 |
| 553 | Ga0207661_10011037 | 3300025944 | Bacteria | 6529 |
| 554 | Ga0207661_10020465 | 3300025944 | Bacteria | 4946 |
| 555 | Ga0207661_10026264 | 3300025944 | Bacteria | 4434 |
| 556 | Ga0207661_10074813 | 3300025944 | Bacteria | 2777 |
| 557 | Ga0207661_10077742 | 3300025944 | Bacteria | 2730 |
| 558 | Ga0207661_10218085 | 3300025944 | Bacteria | 1685 |
| 559 | Ga0207661_10239910 | 3300025944 | Bacteria | 1608 |
| 560 | Ga0207661_10328890 | 3300025944 | Bacteria | 1375 |
| 561 | Ga0207661_10527809 | 3300025944 | Unclassified | 1080 |
| 562 | Ga0207661_10704246 | 3300025944 | Bacteria | 929 |
| 563 | Ga0207679_10035462 | 3300025945 | Bacteria | 3529 |
| 564 | Ga0207679_10073477 | 3300025945 | Bacteria | 2587 |
| 565 | Ga0207679_10147944 | 3300025945 | Bacteria | 1908 |
| 566 | Ga0207667_10040671 | 3300025949 | Bacteria | 4950 |
| 567 | Ga0207667_10096249 | 3300025949 | Bacteria | 3055 |
| 568 | Ga0207667_10175124 | 3300025949 | Bacteria | 2204 |
| 569 | Ga0207667_10266827 | 3300025949 | Unclassified | 1750 |
| 570 | Ga0207667_10527742 | 3300025949 | Bacteria | 1195 |
| 571 | Ga0207667_11025384 | 3300025949 | Unclassified | 811 |
| 572 | Ga0207667_11320108 | 3300025949 | Unclassified | 697 |
| 573 | Ga0207712_10010849 | 3300025961 | Bacteria | 5797 |
| 574 | Ga0207712_10357383 | 3300025961 | Bacteria | 1216 |
| 575 | Ga0207712_10768104 | 3300025961 | Bacteria | 845 |
| 576 | Ga0207640_10498454 | 3300025981 | Bacteria | 1014 |
| 577 | Ga0207640_10522246 | 3300025981 | Bacteria | 993 |
| 578 | Ga0207640_11092456 | 3300025981 | Unclassified | 705 |
| 579 | Ga0207677_10019958 | 3300026023 | Bacteria | 4059 |
| 580 | Ga0207677_10057246 | 3300026023 | Bacteria | 2676 |
| 581 | Ga0207703_10841855 | 3300026035 | Bacteria | 877 |
| 582 | Ga0207639_10094904 | 3300026041 | Bacteria | 2396 |
| 583 | Ga0207639_10269163 | 3300026041 | Bacteria | 1494 |
| 584 | Ga0207639_10808038 | 3300026041 | Unclassified | 874 |
| 585 | Ga0207639_10967905 | 3300026041 | Bacteria | 797 |
| 586 | Ga0207678_10116707 | 3300026067 | Bacteria | 2277 |
| 587 | Ga0207678_10147567 | 3300026067 | Bacteria | 2007 |
| 588 | Ga0207678_10282327 | 3300026067 | Bacteria | 1425 |
| 589 | Ga0207678_10718115 | 3300026067 | Bacteria | 880 |
| 590 | Ga0207678_10767031 | 3300026067 | Unclassified | 851 |
| 591 | Ga0207708_10002124 | 3300026075 | Bacteria | 14612 |
| 592 | Ga0207708_10249283 | 3300026075 | Bacteria | 1430 |
| 593 | Ga0207708_10810477 | 3300026075 | Bacteria | 806 |
| 594 | Ga0207702_10012100 | 3300026078 | Bacteria | 7177 |
| 595 | Ga0207702_10024338 | 3300026078 | Bacteria | 5024 |
| 596 | Ga0207702_10032479 | 3300026078 | Unclassified | 4356 |
| 597 | Ga0207702_10090602 | 3300026078 | Bacteria | 2676 |
| 598 | Ga0207702_10102085 | 3300026078 | Bacteria | 2534 |
| 599 | Ga0207702_10143631 | 3300026078 | Bacteria | 2163 |
| 600 | Ga0207702_10163115 | 3300026078 | Bacteria | 2037 |
| 601 | Ga0207702_10296973 | 3300026078 | Bacteria | 1532 |
| 602 | Ga0207702_10334128 | 3300026078 | Bacteria | 1446 |
| 603 | Ga0207702_10566513 | 3300026078 | Bacteria | 1112 |
| 604 | Ga0207702_10802411 | 3300026078 | Unclassified | 930 |
| 605 | Ga0207702_10804748 | 3300026078 | Bacteria | 929 |
| 606 | Ga0207648_10003665 | 3300026089 | Bacteria | 16078 |
| 607 | Ga0207648_10514480 | 3300026089 | Bacteria | 1096 |
| 608 | Ga0207648_11192295 | 3300026089 | Bacteria | 715 |
| 609 | Ga0207676_10250220 | 3300026095 | Bacteria | 1595 |
| 610 | Ga0207676_10355645 | 3300026095 | Bacteria | 1356 |
| 611 | Ga0207674_10109936 | 3300026116 | Bacteria | 2732 |
| 612 | Ga0207674_10304063 | 3300026116 | Bacteria | 1544 |
| 613 | Ga0207674_10358692 | 3300026116 | Bacteria | 1409 |
| 614 | Ga0207674_10490563 | 3300026116 | Bacteria | 1187 |
| 615 | Ga0207675_100036335 | 3300026118 | Bacteria | 4596 |
| 616 | Ga0207675_100484288 | 3300026118 | Bacteria | 1230 |
| 617 | Ga0207675_100519942 | 3300026118 | Bacteria | 1186 |
| 618 | Ga0207683_10000549 | 3300026121 | Bacteria | 34716 |
| 619 | Ga0207683_10004028 | 3300026121 | Bacteria | 12708 |
| 620 | Ga0207683_10043295 | 3300026121 | Bacteria | 3934 |
| 621 | Ga0207683_10078094 | 3300026121 | Bacteria | 2933 |
| 622 | Ga0207683_10367239 | 3300026121 | Bacteria | 1322 |
| 623 | Ga0207683_10447707 | 3300026121 | Bacteria | 1190 |
| 624 | Ga0207683_10966109 | 3300026121 | Bacteria | 791 |
| 625 | Ga0207698_10087931 | 3300026142 | Bacteria | 2532 |
| 626 | Ga0207698_10095007 | 3300026142 | Bacteria | 2453 |
| 627 | Ga0207698_10168466 | 3300026142 | Bacteria | 1926 |
| 628 | Ga0207698_10476952 | 3300026142 | Bacteria | 1209 |
| 629 | Ga0207698_11593173 | 3300026142 | Bacteria | 668 |
| 630 | Ga0207428_10126040 | 3300027907 | Bacteria | 1961 |
| 631 | Ga0207428_10353969 | 3300027907 | Bacteria | 1080 |
| 632 | Ga0268266_10243689 | 3300028379 | Bacteria | 1660 |
| 633 | Ga0268266_10340379 | 3300028379 | Bacteria | 1408 |
| 634 | Ga0268264_10105830 | 3300028381 | Bacteria | 2454 |
| 635 | Ga0265319_1036087 | 3300028563 | Bacteria | 1693 |
| 636 | Ga0265334_10013764 | 3300028573 | Bacteria | 3382 |
| 637 | Ga0265318_10034636 | 3300028577 | Bacteria | 1945 |
| 638 | Ga0265318_10048967 | 3300028577 | Bacteria | 1591 |
| 639 | Ga0265318_10085300 | 3300028577 | Bacteria | 1164 |
| 640 | Ga0265318_10265370 | 3300028577 | Bacteria | 626 |
| 641 | Ga0265322_10006559 | 3300028654 | Bacteria | 3425 |
| 642 | Ga0265336_10043071 | 3300028666 | Bacteria | 1377 |
| 643 | Ga0265338_10003455 | 3300028800 | Bacteria | 22237 |
| 644 | Ga0265338_10021766 | 3300028800 | Bacteria | 6666 |
| 645 | Ga0265338_10097559 | 3300028800 | Bacteria | 2407 |
| 646 | Ga0265338_10170189 | 3300028800 | Bacteria | 1672 |
| 647 | Ga0265338_10235934 | 3300028800 | Bacteria | 1357 |
| 648 | Ga0265330_10064920 | 3300031235 | Bacteria | 1585 |
| 649 | Ga0265332_10169380 | 3300031238 | Bacteria | 912 |
| 650 | Ga0265320_10046447 | 3300031240 | Bacteria | 2128 |
| 651 | Ga0265320_10113644 | 3300031240 | Unclassified | 1239 |
| 652 | Ga0265325_10074032 | 3300031241 | Bacteria | 1704 |
| 653 | Ga0265340_10108901 | 3300031247 | Bacteria | 1282 |
| 654 | Ga0265327_10032727 | 3300031251 | Bacteria | 2907 |
| 655 | Ga0265327_10109439 | 3300031251 | Bacteria | 1322 |
| 656 | Ga0265327_10150643 | 3300031251 | Bacteria | 1080 |
| 657 | Ga0265327_10158380 | 3300031251 | Bacteria | 1048 |
| 658 | Ga0265327_10175442 | 3300031251 | Unclassified | 982 |
| 659 | Ga0265327_10322355 | 3300031251 | Bacteria | 678 |
| 660 | Ga0307408_100092328 | 3300031548 | Bacteria | 2288 |
| 661 | Ga0265313_10030460 | 3300031595 | Bacteria | 2778 |
| 662 | Ga0265313_10046383 | 3300031595 | Bacteria | 2110 |
| 663 | Ga0265314_10078607 | 3300031711 | Bacteria | 2183 |
| 664 | Ga0265342_10079201 | 3300031712 | Bacteria | 1900 |
| 665 | Ga0316578_10079921 | 3300031728 | Bacteria | 1945 |
| 666 | Ga0307405_10087131 | 3300031731 | Bacteria | 2057 |
| 667 | Ga0307413_10069267 | 3300031824 | Bacteria | 2213 |
| 668 | Ga0307406_10080729 | 3300031901 | Bacteria | 2160 |
| 669 | Ga0307412_10162980 | 3300031911 | Unclassified | 1659 |
| 670 | Ga0307412_10193765 | 3300031911 | Bacteria | 1538 |
| 671 | Ga0307409_100033256 | 3300031995 | Bacteria | 3750 |
| 672 | Ga0307409_101151351 | 3300031995 | Bacteria | 798 |
| 673 | Ga0307416_100051821 | 3300032002 | Bacteria | 3281 |
| 674 | Ga0307416_100755289 | 3300032002 | Unclassified | 1065 |
| 675 | Ga0307414_10069628 | 3300032004 | Bacteria | 2530 |
| 676 | Ga0307411_10012847 | 3300032005 | Bacteria | 4590 |
| 677 | Ga0307415_100067637 | 3300032126 | Bacteria | 2497 |
| 678 | Ga0307415_100146108 | 3300032126 | Bacteria | 1813 |
| 679 | Ga0373930_0005814 | 3300034816 | Bacteria | 2064 |
| 680 | Ga0373948_0104465 | 3300034817 | Bacteria | 670 |
| 681 | Ga0373950_0009604 | 3300034818 | Bacteria | 1549 |
| 682 | Ga0373950_0016249 | 3300034818 | Bacteria | 1271 |
| 683 | Ga0373958_0025873 | 3300034819 | Bacteria | 1120 |
| 684 | Ga0373958_0043959 | 3300034819 | Bacteria | 923 |
| 685 | Ga0373959_0002201 | 3300034820 | Bacteria | 3108 |
| 686 | Ga0373938_0023737 | 3300034957 | Bacteria | 1263 |
| 687 | Ga0373928_0028951 | 3300035084 | Bacteria | 1215 |
| 688 | Ga0373928_0058042 | 3300035084 | Bacteria | 930 |
| 689 | Ga0373929_0006551 | 3300035085 | Bacteria | 2106 |
| 690 | Ga0373929_0014842 | 3300035085 | Bacteria | 1509 |
| 691 | Ga0373940_0005134 | 3300035088 | Bacteria | 2820 |
| 692 | Ga0373944_0048535 | 3300035089 | Bacteria | 1332 |
| 693 | Ga0373949_0031119 | 3300035090 | Bacteria | 1271 |
| 694 | Ga0373951_0014437 | 3300035091 | Bacteria | 1776 |
| 695 | Ga0373952_0006790 | 3300035092 | Bacteria | 2128 |
| 696 | Ga0373932_0024602 | 3300035112 | Bacteria | 1622 |
| 697 | Ga0373936_0009649 | 3300035113 | Bacteria | 3638 |
| 698 | Ga0373936_0095529 | 3300035113 | Bacteria | 1250 |
| 699 | Ga0373939_0006438 | 3300035114 | Bacteria | 2829 |
| 700 | Ga0373941_0011013 | 3300035115 | Bacteria | 2327 |
| 701 | Ga0373945_0023282 | 3300035116 | Bacteria | 2139 |
| 702 | Ga0373945_0228957 | 3300035116 | Bacteria | 779 |
| 703 | Ga0373945_0233123 | 3300035116 | Bacteria | 773 |
| 704 | Ga0373954_0285449 | 3300035118 | Bacteria | 814 |
| 705 | Ga0373956_0087749 | 3300035119 | Bacteria | 1433 |
| 706 | Ga0373956_0172945 | 3300035119 | Bacteria | 1020 |
| 707 | Ga0373960_0016556 | 3300035121 | Bacteria | 1899 |
| 708 | Ga0373943_0000101 | 3300035170 | Bacteria | 31609 |
| 709 | Ga0373943_0001881 | 3300035170 | Bacteria | 9492 |
| 710 | Ga0373943_0021015 | 3300035170 | Bacteria | 3014 |
| 711 | Ga0373943_0210033 | 3300035170 | Bacteria | 1081 |
| 712 | Ga0373943_0498162 | 3300035170 | Bacteria | 712 |
| 713 | Ga0373946_0006107 | 3300035171 | Bacteria | 4362 |
| 714 | Ga0373946_0079806 | 3300035171 | Bacteria | 1430 |
| 715 | Ga0373955_0224788 | 3300035172 | Bacteria | 1122 |
| 716 | Ga0373942_0029525 | 3300035207 | Bacteria | 1439 |
| 717 | Ga0373962_0015150 | 3300035242 | Bacteria | 1973 |
| 718 | Ga0373962_0024930 | 3300035242 | Unclassified | 1603 |
| 719 | Ga0316574_0788391 | 3300035398 | Bacteria | 579 |
| 720 | Ga0373924_0019565 | 3300035410 | Bacteria | 2624 |
| 721 | Ga0373931_0002414 | 3300035691 | Bacteria | 8269 |
| 722 | Ga0373931_0013901 | 3300035691 | Bacteria | 3927 |
| 723 | Ga0373931_0201341 | 3300035691 | Bacteria | 1190 |
| 724 | Ga0373935_0026073 | 3300035692 | Bacteria | 3605 |
| 725 | Ga0373935_0043236 | 3300035692 | Bacteria | 2835 |
| 726 | Ga0373927_0093584 | 3300035695 | Bacteria | 1953 |
| 727 | Ga0373933_0074864 | 3300035724 | Bacteria | 2066 |
| 728 | Ga0373947_0004085 | 3300035725 | Bacteria | 8591 |
| 729 | Ga0373947_0005625 | 3300035725 | Bacteria | 7308 |
| 730 | Ga0373947_0039963 | 3300035725 | Bacteria | 2793 |
| 731 | Ga0373947_0278737 | 3300035725 | Bacteria | 1111 |
| 732 | Ga0373937_0157453 | 3300036401 | Bacteria | 2129 |
| 733 | Ga0373937_0234785 | 3300036401 | Bacteria | 1727 |
| 734 | Ga0373937_0471658 | 3300036401 | Bacteria | 1192 |
| 735 | Ga0373925_0001828 | 3300037068 | Bacteria | 17755 |
| 736 | Ga0373925_0898937 | 3300037068 | Bacteria | 730 |
| 737 | Ga0395899_0023795 | 3300037312 | Bacteria | 4635 |
| 738 | Ga0395899_0043135 | 3300037312 | Bacteria | 3365 |
| 739 | Ga0395899_0050366 | 3300037312 | Bacteria | 3092 |
| 740 | Ga0395899_0085357 | 3300037312 | Bacteria | 2293 |
| 741 | Ga0395899_0226357 | 3300037312 | Bacteria | 1293 |
| 742 | Ga0395899_0315209 | 3300037312 | Bacteria | 1055 |
| 743 | Ga0395900_0012528 | 3300037418 | Bacteria | 8676 |
| 744 | Ga0395900_0021884 | 3300037418 | Bacteria | 6537 |
| 745 | Ga0395900_0024974 | 3300037418 | Bacteria | 6115 |
| 746 | Ga0395900_0050336 | 3300037418 | Bacteria | 4291 |
| 747 | Ga0395900_0053846 | 3300037418 | Bacteria | 4142 |
| 748 | Ga0395900_0160153 | 3300037418 | Bacteria | 2296 |
| 749 | Ga0395900_0170449 | 3300037418 | Bacteria | 2216 |
| 750 | Ga0395900_0183364 | 3300037418 | Bacteria | 2126 |
| 751 | Ga0395900_0184041 | 3300037418 | Bacteria | 2121 |
| 752 | Ga0395900_0266290 | 3300037418 | Bacteria | 1710 |
| 753 | Ga0395900_0319459 | 3300037418 | Bacteria | 1533 |
| 754 | Ga0395900_0403876 | 3300037418 | Bacteria | 1330 |
| 755 | Ga0395900_0750026 | 3300037418 | Bacteria | 906 |
| 756 | Ga0395900_0905664 | 3300037418 | Bacteria | 805 |
| 757 | Ga0395898_0001509 | 3300037466 | Bacteria | 32076 |
| 758 | Ga0395898_0004411 | 3300037466 | Bacteria | 15397 |
| 759 | Ga0395898_0009218 | 3300037466 | Bacteria | 10382 |
| 760 | Ga0395898_0011522 | 3300037466 | Bacteria | 9182 |
| 761 | Ga0395898_0014811 | 3300037466 | Bacteria | 8004 |
| 762 | Ga0395898_0030302 | 3300037466 | Bacteria | 5415 |
| 763 | Ga0395898_0091755 | 3300037466 | Bacteria | 2922 |
| 764 | Ga0395898_0119799 | 3300037466 | Bacteria | 2521 |
| 765 | Ga0395898_0131716 | 3300037466 | Bacteria | 2395 |
| 766 | Ga0395898_0153557 | 3300037466 | Bacteria | 2203 |
| 767 | Ga0395898_0190719 | 3300037466 | Bacteria | 1958 |
| 768 | Ga0395898_0218659 | 3300037466 | Bacteria | 1817 |
| 769 | Ga0395898_0255362 | 3300037466 | Bacteria | 1672 |
| 770 | Ga0395898_0422585 | 3300037466 | Bacteria | 1270 |
| 771 | Ga0395898_0442076 | 3300037466 | Bacteria | 1239 |
| 772 | Ga0395898_0463501 | 3300037466 | Bacteria | 1206 |
| 773 | Ga0395898_0475823 | 3300037466 | Bacteria | 1188 |
| 774 | Ga0395898_0514709 | 3300037466 | Bacteria | 1138 |
| 775 | Ga0395898_1172664 | 3300037466 | Bacteria | 700 |
| 776 | Ga0395905_0013885 | 3300037471 | Bacteria | 7706 |
| 777 | Ga0395905_0023643 | 3300037471 | Bacteria | 5802 |
| 778 | Ga0395905_0024003 | 3300037471 | Bacteria | 5757 |
| 779 | Ga0395905_0045512 | 3300037471 | Bacteria | 4115 |
| 780 | Ga0395905_0077358 | 3300037471 | Bacteria | 3117 |
| 781 | Ga0395905_0100352 | 3300037471 | Bacteria | 2718 |
| 782 | Ga0395905_0265388 | 3300037471 | Bacteria | 1602 |
| 783 | Ga0395905_0579685 | 3300037471 | Bacteria | 1023 |
| 784 | Ga0395905_0805238 | 3300037471 | Bacteria | 842 |
| 785 | Ga0436364_0115954 | 3300037853 | Bacteria | 10221 |
| 786 | Ga0436364_0194867 | 3300037853 | Bacteria | 5731 |
| 787 | Ga0436364_0454997 | 3300037853 | Bacteria | 5450 |
| 788 | Ga0436364_0781557 | 3300037853 | Bacteria | 1000 |
| 789 | Ga0436364_0782464 | 3300037853 | Bacteria | 3021 |
| 790 | Ga0436364_0797529 | 3300037853 | Bacteria | 979 |
| 791 | Ga0436364_0808770 | 3300037853 | Bacteria | 893 |
| 792 | Ga0436364_1289981 | 3300037853 | Bacteria | 2561 |
| 793 | Ga0436364_1386615 | 3300037853 | Bacteria | 4646 |
| 794 | Ga0395901_0009334 | 3300038443 | Bacteria | 9945 |
| 795 | Ga0395901_0014373 | 3300038443 | Bacteria | 8058 |
| 796 | Ga0395901_0049218 | 3300038443 | Bacteria | 4379 |
| 797 | Ga0395901_0064947 | 3300038443 | Bacteria | 3799 |
| 798 | Ga0395901_0120252 | 3300038443 | Bacteria | 2760 |
| 799 | Ga0395901_0143089 | 3300038443 | Bacteria | 2514 |
| 800 | Ga0395901_0159762 | 3300038443 | Bacteria | 2367 |
| 801 | Ga0395901_0175737 | 3300038443 | Bacteria | 2246 |
| 802 | Ga0395901_0235390 | 3300038443 | Bacteria | 1911 |
| 803 | Ga0395901_0299523 | 3300038443 | Bacteria | 1667 |
| 804 | Ga0395901_0301484 | 3300038443 | Bacteria | 1661 |
| 805 | Ga0395901_0313827 | 3300038443 | Bacteria | 1623 |
| 806 | Ga0395901_0325207 | 3300038443 | Bacteria | 1590 |
| 807 | Ga0395901_0370419 | 3300038443 | Bacteria | 1475 |
| 808 | Ga0395901_0552976 | 3300038443 | Bacteria | 1166 |
| 809 | Ga0395901_0576038 | 3300038443 | Bacteria | 1138 |
| 810 | Ga0395901_1025653 | 3300038443 | Bacteria | 799 |
| 811 | Ga0436365_0134395 | 3300039437 | Bacteria | 1916 |
| 812 | Ga0436365_0215850 | 3300039437 | Bacteria | 7325 |
| 813 | Ga0436365_0383848 | 3300039437 | Bacteria | 4249 |
| 814 | Ga0436365_0704133 | 3300039437 | Bacteria | 7281 |
| 815 | Ga0436365_1199523 | 3300039437 | Bacteria | 3496 |
| 816 | Ga0436365_1294004 | 3300039437 | Bacteria | 824 |
| 817 | Ga0436365_1682359 | 3300039437 | Bacteria | 3175 |
| 818 | Ga0436363_0231463 | 3300039450 | Bacteria | 1180 |
| 819 | Ga0436363_0236348 | 3300039450 | Bacteria | 848 |
| 820 | Ga0436363_0256593 | 3300039450 | Bacteria | 8766 |
| 821 | Ga0436363_1280299 | 3300039450 | Bacteria | 1112 |
| 822 | Ga0436363_1329980 | 3300039450 | Bacteria | 827 |
| 823 | Ga0436363_1583354 | 3300039450 | Bacteria | 7401 |
| 824 | Ga0436362_1191867 | 3300039453 | Bacteria | 1448 |
| 825 | Ga0439466_0087321 | 3300041411 | Bacteria | 980 |
| 826 | Ga0451793_0532612 | 3300041452 | Unclassified | 1177 |
| 827 | Ga0451798_0213579 | 3300041458 | Bacteria | 933 |
| 828 | Ga0451802_1758706 | 3300041460 | Bacteria | 1091 |
| 829 | Ga0451853_2291318 | 3300041512 | Bacteria | 2788 |
| 830 | Ga0439431_0006790 | 3300041997 | Bacteria | 2540 |
| 831 | Ga0439442_001423 | 3300042002 | Bacteria | 4713 |
| 832 | Ga0439445_0023401 | 3300042004 | Bacteria | 1564 |
| 833 | Ga0439448_0034190 | 3300042005 | Bacteria | 1623 |
| 834 | Ga0439448_0119313 | 3300042005 | Unclassified | 905 |
| 835 | Ga0439432_172786 | 3300042006 | Bacteria | 630 |
| 836 | Ga0439449_0107835 | 3300042007 | Bacteria | 1031 |
| 837 | Ga0439451_005274 | 3300042009 | Bacteria | 2633 |
| 838 | Ga0439454_027757 | 3300042011 | Bacteria | 871 |
| 839 | Ga0439462_0012923 | 3300042015 | Bacteria | 2137 |
| 840 | Ga0450920_010083 | 3300042122 | Bacteria | 1748 |
| 841 | Ga0450923_007398 | 3300042125 | Bacteria | 1857 |
| 842 | Ga0450896_039167 | 3300042133 | Bacteria | 734 |
| 843 | Ga0450900_041346 | 3300042136 | Bacteria | 690 |
| 844 | Ga0439434_0059462 | 3300042435 | Bacteria | 1193 |
| 845 | Ga0450901_015700 | 3300042533 | Bacteria | 797 |
| 846 | Ga0451577_0250854 | 3300042876 | Bacteria | 1602 |
| 847 | Ga0466969_0021862 | 3300044656 | Bacteria | 3306 |
| 848 | Ga0466969_0304967 | 3300044656 | Unclassified | 721 |
| 849 | Ga0466965_0162990 | 3300044683 | Bacteria | 1170 |
| 850 | Ga0466966_0006668 | 3300044684 | Bacteria | 7645 |
| 851 | Ga0466966_0008410 | 3300044684 | Bacteria | 6827 |
| 852 | Ga0466966_0097901 | 3300044684 | Bacteria | 1816 |
| 853 | Ga0466966_0503824 | 3300044684 | Bacteria | 728 |
| 854 | Ga0466961_0002717 | 3300044693 | Bacteria | 11002 |
| 855 | Ga0466961_0012197 | 3300044693 | Bacteria | 5495 |
| 856 | Ga0466961_0019467 | 3300044693 | Bacteria | 4366 |
| 857 | Ga0466961_0026671 | 3300044693 | Bacteria | 3714 |
| 858 | Ga0466961_0080613 | 3300044693 | Bacteria | 2060 |
| 859 | Ga0466961_0083598 | 3300044693 | Bacteria | 2019 |
| 860 | Ga0466963_0000059 | 3300044694 | Bacteria | 37360 |
| 861 | Ga0466963_0003862 | 3300044694 | Bacteria | 8649 |
| 862 | Ga0466963_0004394 | 3300044694 | Bacteria | 8190 |
| 863 | Ga0466963_0011736 | 3300044694 | Bacteria | 5342 |
| 864 | Ga0466963_0019426 | 3300044694 | Bacteria | 4262 |
| 865 | Ga0466963_0019800 | 3300044694 | Bacteria | 4226 |
| 866 | Ga0466963_0022077 | 3300044694 | Bacteria | 4026 |
| 867 | Ga0466963_0028017 | 3300044694 | Bacteria | 3612 |
| 868 | Ga0466963_0030410 | 3300044694 | Bacteria | 3485 |
| 869 | Ga0466963_0036391 | 3300044694 | Bacteria | 3211 |
| 870 | Ga0466963_0045020 | 3300044694 | Bacteria | 2905 |
| 871 | Ga0466963_0108740 | 3300044694 | Bacteria | 1902 |
| 872 | Ga0466963_0153419 | 3300044694 | Bacteria | 1600 |
| 873 | Ga0466963_0289916 | 3300044694 | Bacteria | 1151 |
| 874 | Ga0466963_0308437 | 3300044694 | Bacteria | 1113 |
| 875 | Ga0466963_0326204 | 3300044694 | Bacteria | 1080 |
| 876 | Ga0466963_0667407 | 3300044694 | Bacteria | 734 |
| 877 | Ga0466964_0002916 | 3300044706 | Bacteria | 6178 |
| 878 | Ga0466964_0002988 | 3300044706 | Bacteria | 6122 |
| 879 | Ga0466964_0009352 | 3300044706 | Bacteria | 3689 |
| 880 | Ga0466964_0009904 | 3300044706 | Bacteria | 3592 |
| 881 | Ga0466964_0017077 | 3300044706 | Bacteria | 2776 |
| 882 | Ga0466964_0069891 | 3300044706 | Bacteria | 1482 |
| 883 | Ga0466964_0288620 | 3300044706 | Bacteria | 823 |
| 884 | Ga0453684_0927053 | 3300044712 | Bacteria | 931 |
| 885 | Ga0466971_0000282 | 3300044719 | Bacteria | 19481 |
| 886 | Ga0466971_0009074 | 3300044719 | Bacteria | 4346 |
| 887 | Ga0466971_0021690 | 3300044719 | Bacteria | 2859 |
| 888 | Ga0466971_0038542 | 3300044719 | Bacteria | 2144 |
| 889 | Ga0466971_0141192 | 3300044719 | Bacteria | 1121 |
| 890 | Ga0466968_0010810 | 3300044735 | Bacteria | 3547 |
| 891 | Ga0466968_0369995 | 3300044735 | Bacteria | 699 |
| 892 | Ga0466970_0350280 | 3300044765 | Bacteria | 838 |
| 893 | Ga0466970_0465361 | 3300044765 | Bacteria | 726 |
| 894 | Ga0466957_0002174 | 3300044842 | Bacteria | 10505 |
| 895 | Ga0466957_0004563 | 3300044842 | Bacteria | 7734 |
| 896 | Ga0466957_0034703 | 3300044842 | Bacteria | 3025 |
| 897 | Ga0466957_0046870 | 3300044842 | Bacteria | 2625 |
| 898 | Ga0466957_0047874 | 3300044842 | Bacteria | 2598 |
| 899 | Ga0466957_0119300 | 3300044842 | Bacteria | 1680 |
| 900 | Ga0466957_0129054 | 3300044842 | Bacteria | 1618 |
| 901 | Ga0466957_0291007 | 3300044842 | Bacteria | 1095 |
| 902 | Ga0466960_0015647 | 3300044901 | Bacteria | 3275 |
| 903 | Ga0466959_0007644 | 3300045049 | Bacteria | 7601 |
| 904 | Ga0466959_0034408 | 3300045049 | Bacteria | 3747 |
| 905 | Ga0466959_0046436 | 3300045049 | Bacteria | 3195 |
| 906 | Ga0466959_0083028 | 3300045049 | Bacteria | 2308 |
| 907 | Ga0466959_0091600 | 3300045049 | Bacteria | 2183 |
| 908 | Ga0466959_0097862 | 3300045049 | Bacteria | 2102 |
| 909 | Ga0466959_0113114 | 3300045049 | Bacteria | 1935 |
| 910 | Ga0466959_0252740 | 3300045049 | Bacteria | 1215 |
| 911 | Ga0451576_0242555 | 3300045051 | Bacteria | 1883 |
| 912 | Ga0466958_0004124 | 3300045836 | Bacteria | 7626 |
| 913 | Ga0466958_0010875 | 3300045836 | Bacteria | 5110 |
| 914 | Ga0466958_0011292 | 3300045836 | Bacteria | 5028 |
| 915 | Ga0466958_0012056 | 3300045836 | Bacteria | 4885 |
| 916 | Ga0466958_0016134 | 3300045836 | Bacteria | 4297 |
| 917 | Ga0466958_0019424 | 3300045836 | Bacteria | 3955 |
| 918 | Ga0466958_0038335 | 3300045836 | Bacteria | 2875 |
| 919 | Ga0466958_0052894 | 3300045836 | Bacteria | 2462 |
| 920 | Ga0466958_0122597 | 3300045836 | Bacteria | 1628 |
| 921 | Ga0466958_0167046 | 3300045836 | Bacteria | 1392 |
| 922 | Ga0466958_0223008 | 3300045836 | Bacteria | 1203 |
| 923 | Ga0466958_0288138 | 3300045836 | Bacteria | 1053 |
| 924 | Ga0466967_0000305 | 3300045976 | Bacteria | 22092 |
| 925 | Ga0466967_0010340 | 3300045976 | Bacteria | 6994 |
| 926 | Ga0466967_0015053 | 3300045976 | Bacteria | 6052 |
| 927 | Ga0466967_0022022 | 3300045976 | Bacteria | 5190 |
| 928 | Ga0466967_0026965 | 3300045976 | Bacteria | 4770 |
| 929 | Ga0466967_0036019 | 3300045976 | Bacteria | 4220 |
| 930 | Ga0466967_0047524 | 3300045976 | Bacteria | 3741 |
| 931 | Ga0466967_0051218 | 3300045976 | Bacteria | 3617 |
| 932 | Ga0466967_0064739 | 3300045976 | Bacteria | 3252 |
| 933 | Ga0466967_0077440 | 3300045976 | Bacteria | 2993 |
| 934 | Ga0466967_0100424 | 3300045976 | Bacteria | 2644 |
| 935 | Ga0466967_0109764 | 3300045976 | Bacteria | 2533 |
| 936 | Ga0466967_0114041 | 3300045976 | Bacteria | 2487 |
| 937 | Ga0466967_0125131 | 3300045976 | Bacteria | 2380 |
| 938 | Ga0466967_0169777 | 3300045976 | Bacteria | 2052 |
| 939 | Ga0466967_0201452 | 3300045976 | Bacteria | 1885 |
| 940 | Ga0466967_0275540 | 3300045976 | Bacteria | 1613 |
| 941 | Ga0466967_0334276 | 3300045976 | Bacteria | 1463 |
| 942 | Ga0466967_0338128 | 3300045976 | Bacteria | 1455 |
| 943 | Ga0466967_0374137 | 3300045976 | Bacteria | 1382 |
| 944 | Ga0466967_0437090 | 3300045976 | Bacteria | 1277 |
| 945 | Ga0466967_0446117 | 3300045976 | Bacteria | 1264 |
| 946 | Ga0466967_0449371 | 3300045976 | Unclassified | 1259 |
| 947 | Ga0466967_0473827 | 3300045976 | Bacteria | 1226 |
| 948 | Ga0466967_0580006 | 3300045976 | Bacteria | 1105 |
| 949 | Ga0466967_0751590 | 3300045976 | Bacteria | 967 |
| 950 | Ga0466967_1043283 | 3300045976 | Bacteria | 814 |
| 951 | Ga0466967_1046317 | 3300045976 | Bacteria | 813 |
| 952 | Ga0495592_0020890 | 3300046454 | Bacteria | 4981 |
| 953 | Ga0495592_0079525 | 3300046454 | Bacteria | 2373 |
| 954 | Ga0495592_0149894 | 3300046454 | Bacteria | 1614 |
| 955 | Ga0495603_0017131 | 3300046455 | Bacteria | 4386 |
| 956 | Ga0495603_0041553 | 3300046455 | Bacteria | 2749 |
| 957 | Ga0495629_0036163 | 3300046459 | Bacteria | 3487 |
| 958 | Ga0495629_0065495 | 3300046459 | Bacteria | 2536 |
| 959 | Ga0495641_0000374 | 3300046461 | Bacteria | 37120 |
| 960 | Ga0495641_0018087 | 3300046461 | Bacteria | 3648 |
| 961 | Ga0495641_0021229 | 3300046461 | Bacteria | 3271 |
| 962 | Ga0495641_0028226 | 3300046461 | Bacteria | 2718 |
| 963 | Ga0495641_0067876 | 3300046461 | Bacteria | 1603 |
| 964 | Ga0495641_0236973 | 3300046461 | Bacteria | 819 |
| 965 | Ga0495641_0313605 | 3300046461 | Bacteria | 707 |
| 966 | Ga0495651_0018440 | 3300046462 | Bacteria | 5405 |
| 967 | Ga0495651_0028003 | 3300046462 | Unclassified | 4392 |
| 968 | Ga0495651_0071904 | 3300046462 | Bacteria | 2629 |
| 969 | Ga0495651_0373706 | 3300046462 | Bacteria | 936 |
| 970 | Ga0495653_0015646 | 3300046463 | Bacteria | 6183 |
| 971 | Ga0495653_0115384 | 3300046463 | Bacteria | 1922 |
| 972 | Ga0495653_0202595 | 3300046463 | Bacteria | 1346 |
| 973 | Ga0495653_0213398 | 3300046463 | Bacteria | 1302 |
| 974 | Ga0495653_0459145 | 3300046463 | Bacteria | 800 |
| 975 | Ga0495580_0689370 | 3300046472 | Bacteria | 669 |
| 976 | Ga0495582_0000124 | 3300046473 | Bacteria | 41197 |
| 977 | Ga0495582_0057505 | 3300046473 | Bacteria | 2144 |
| 978 | Ga0495582_0058377 | 3300046473 | Bacteria | 2128 |
| 979 | Ga0495605_0054425 | 3300046474 | Bacteria | 1938 |
| 980 | Ga0495639_0000786 | 3300046475 | Bacteria | 14467 |
| 981 | Ga0495662_0000898 | 3300046476 | Bacteria | 14537 |
| 982 | Ga0495662_0449519 | 3300046476 | Bacteria | 632 |
| 983 | Ga0495664_0018607 | 3300046477 | Bacteria | 3984 |
| 984 | Ga0495664_0035313 | 3300046477 | Bacteria | 2943 |
| 985 | Ga0495664_0097484 | 3300046477 | Bacteria | 1770 |
| 986 | Ga0495584_0075372 | 3300046491 | Bacteria | 1696 |
| 987 | Ga0495584_0163708 | 3300046491 | Bacteria | 1131 |
| 988 | Ga0495584_0227236 | 3300046491 | Bacteria | 949 |
| 989 | Ga0495585_0139257 | 3300046492 | Bacteria | 1272 |
| 990 | Ga0495596_0086496 | 3300046500 | Bacteria | 1217 |
| 991 | Ga0495596_0160800 | 3300046500 | Unclassified | 873 |
| 992 | Ga0495596_0164174 | 3300046500 | Bacteria | 863 |
| 993 | Ga0495596_0267425 | 3300046500 | Bacteria | 664 |
| 994 | Ga0495608_0010122 | 3300046511 | Bacteria | 6580 |
| 995 | Ga0495608_0029476 | 3300046511 | Bacteria | 3721 |
| 996 | Ga0495608_0117276 | 3300046511 | Bacteria | 1708 |
| 997 | Ga0495608_0127601 | 3300046511 | Bacteria | 1629 |
| 998 | Ga0495608_0279134 | 3300046511 | Bacteria | 1037 |
| 999 | Ga0495628_0033834 | 3300046516 | Bacteria | 4116 |
| 1000 | Ga0495628_0105848 | 3300046516 | Bacteria | 2167 |
| 1001 | Ga0495628_0443940 | 3300046516 | Bacteria | 943 |
| 1002 | Ga0495630_0029084 | 3300046517 | Bacteria | 4107 |
| 1003 | Ga0495630_0056130 | 3300046517 | Bacteria | 2951 |
| 1004 | Ga0495630_0065190 | 3300046517 | Bacteria | 2737 |
| 1005 | Ga0495630_0110340 | 3300046517 | Bacteria | 2084 |
| 1006 | Ga0495630_0158586 | 3300046517 | Bacteria | 1722 |
| 1007 | Ga0495630_0699481 | 3300046517 | Bacteria | 775 |
| 1008 | Ga0495631_0030977 | 3300046518 | Unclassified | 2424 |
| 1009 | Ga0495666_0063979 | 3300046526 | Bacteria | 1756 |
| 1010 | Ga0495652_0095351 | 3300046529 | Bacteria | 2424 |
| 1011 | Ga0495652_0142057 | 3300046529 | Bacteria | 1887 |
| 1012 | Ga0495652_0183576 | 3300046529 | Bacteria | 1603 |
| 1013 | Ga0495652_0247313 | 3300046529 | Bacteria | 1323 |
| 1014 | Ga0495652_0461436 | 3300046529 | Bacteria | 887 |
| 1015 | Ga0495654_0233464 | 3300046530 | Bacteria | 773 |
| 1016 | Ga0495665_0086623 | 3300046531 | Bacteria | 1646 |
| 1017 | Ga0495665_0149299 | 3300046531 | Bacteria | 1220 |
| 1018 | Ga0495640_0019423 | 3300046533 | Bacteria | 5015 |
| 1019 | Ga0495640_0070726 | 3300046533 | Bacteria | 2343 |
| 1020 | Ga0495640_0090361 | 3300046533 | Bacteria | 2022 |
| 1021 | Ga0495640_0266169 | 3300046533 | Bacteria | 1070 |
| 1022 | Ga0495586_0011690 | 3300046535 | Bacteria | 4669 |
| 1023 | Ga0495586_0252818 | 3300046535 | Unclassified | 1006 |
| 1024 | Ga0495587_0082758 | 3300046536 | Bacteria | 1859 |
| 1025 | Ga0495587_0098432 | 3300046536 | Bacteria | 1686 |
| 1026 | Ga0495598_0075635 | 3300046537 | Bacteria | 1070 |
| 1027 | Ga0495598_0112075 | 3300046537 | Bacteria | 916 |
| 1028 | Ga0495609_0112922 | 3300046538 | Unclassified | 1172 |
| 1029 | Ga0495645_0102912 | 3300046543 | Bacteria | 2029 |
| 1030 | Ga0495645_0448240 | 3300046543 | Unclassified | 814 |
| 1031 | Ga0495645_0478659 | 3300046543 | Bacteria | 781 |
| 1032 | Ga0495667_0002397 | 3300046559 | Bacteria | 12532 |
| 1033 | Ga0495667_0020012 | 3300046559 | Bacteria | 4513 |
| 1034 | Ga0495667_0045214 | 3300046559 | Bacteria | 2916 |
| 1035 | Ga0495667_0054820 | 3300046559 | Bacteria | 2622 |
| 1036 | Ga0495667_0082516 | 3300046559 | Bacteria | 2088 |
| 1037 | Ga0495667_0085109 | 3300046559 | Bacteria | 2052 |
| 1038 | Ga0495667_0093105 | 3300046559 | Bacteria | 1951 |
| 1039 | Ga0495656_0034981 | 3300046615 | Unclassified | 2061 |
| 1040 | Ga0495656_0056688 | 3300046615 | Bacteria | 1694 |
| 1041 | Ga0495656_0460982 | 3300046615 | Bacteria | 670 |
| 1042 | Ga0495634_0008524 | 3300046642 | Bacteria | 7622 |
| 1043 | Ga0495634_0048048 | 3300046642 | Bacteria | 2874 |
| 1044 | Ga0495634_0075065 | 3300046642 | Bacteria | 2221 |
| 1045 | Ga0495634_0143878 | 3300046642 | Bacteria | 1512 |
| 1046 | Ga0495634_0179096 | 3300046642 | Bacteria | 1328 |
| 1047 | Ga0495634_0452405 | 3300046642 | Bacteria | 757 |
| 1048 | Ga0495611_0143235 | 3300046648 | Bacteria | 1116 |
| 1049 | Ga0495635_0020039 | 3300046663 | Bacteria | 4661 |
| 1050 | Ga0495635_0036436 | 3300046663 | Bacteria | 3410 |
| 1051 | Ga0495635_0088626 | 3300046663 | Bacteria | 2117 |
| 1052 | Ga0495635_0531300 | 3300046663 | Bacteria | 772 |
| 1053 | Ga0495659_0067275 | 3300046664 | Bacteria | 1336 |
| 1054 | Ga0495659_0246787 | 3300046664 | Unclassified | 743 |
| 1055 | Ga0495661_0205703 | 3300046665 | Bacteria | 1028 |
| 1056 | Ga0495657_0011624 | 3300046675 | Bacteria | 6574 |
| 1057 | Ga0495657_0019426 | 3300046675 | Bacteria | 4901 |
| 1058 | Ga0495657_0028795 | 3300046675 | Bacteria | 3902 |
| 1059 | Ga0495657_0199563 | 3300046675 | Bacteria | 1220 |
| 1060 | Ga0495599_0072964 | 3300046678 | Bacteria | 2142 |
| 1061 | Ga0495599_0092733 | 3300046678 | Unclassified | 1884 |
| 1062 | Ga0495623_0030274 | 3300046679 | Bacteria | 3482 |
| 1063 | Ga0495646_0035388 | 3300046680 | Bacteria | 3098 |
| 1064 | Ga0495647_0004080 | 3300046681 | Bacteria | 4720 |
| 1065 | Ga0495647_0036519 | 3300046681 | Unclassified | 1850 |
| 1066 | Ga0495647_0073793 | 3300046681 | Bacteria | 1371 |
| 1067 | Ga0495658_0000247 | 3300046683 | Bacteria | 30977 |
| 1068 | Ga0495658_0027012 | 3300046683 | Bacteria | 3084 |
| 1069 | Ga0495658_0032563 | 3300046683 | Bacteria | 2848 |
| 1070 | Ga0495658_0070745 | 3300046683 | Bacteria | 2025 |
| 1071 | Ga0495658_0582563 | 3300046683 | Bacteria | 717 |
| 1072 | Ga0495613_0013675 | 3300046689 | Bacteria | 6021 |
| 1073 | Ga0495613_0030117 | 3300046689 | Bacteria | 4032 |
| 1074 | Ga0495613_0032931 | 3300046689 | Bacteria | 3851 |
| 1075 | Ga0495613_0060816 | 3300046689 | Bacteria | 2766 |
| 1076 | Ga0495624_0010741 | 3300046690 | Bacteria | 6310 |
| 1077 | Ga0495624_0109848 | 3300046690 | Unclassified | 1696 |
| 1078 | Ga0495624_0183656 | 3300046690 | Bacteria | 1274 |
| 1079 | Ga0495670_0146774 | 3300046691 | Bacteria | 1236 |
| 1080 | Ga0495671_0448624 | 3300046692 | Bacteria | 617 |
| 1081 | Ga0495589_0013425 | 3300046794 | Bacteria | 4227 |
| 1082 | Ga0495589_0208818 | 3300046794 | Bacteria | 920 |
| 1083 | Ga0495600_0017559 | 3300046809 | Bacteria | 4553 |
| 1084 | Ga0495600_0059533 | 3300046809 | Bacteria | 2495 |
| 1085 | Ga0495600_0073141 | 3300046809 | Unclassified | 2238 |
| 1086 | Ga0495600_0088693 | 3300046809 | Bacteria | 2018 |
| 1087 | Ga0495581_0002147 | 3300047315 | Bacteria | 11128 |
| 1088 | Ga0495581_0003701 | 3300047315 | Bacteria | 8805 |
| 1089 | Ga0495581_0116740 | 3300047315 | Bacteria | 1552 |
| 1090 | Ga0495604_0016420 | 3300047317 | Bacteria | 5918 |
| 1091 | Ga0495604_0033832 | 3300047317 | Bacteria | 4045 |
| 1092 | Ga0495604_0259618 | 3300047317 | Bacteria | 1181 |
| 1093 | Ga0495604_0570929 | 3300047317 | Bacteria | 728 |
| 1094 | Ga0495636_0144749 | 3300047318 | Bacteria | 1063 |
| 1095 | Ga0495674_0003941 | 3300047319 | Bacteria | 14400 |
| 1096 | Ga0495674_0019510 | 3300047319 | Bacteria | 6289 |
| 1097 | Ga0495674_0045864 | 3300047319 | Bacteria | 3881 |
| 1098 | Ga0495674_0055315 | 3300047319 | Bacteria | 3481 |
| 1099 | Ga0495674_0129472 | 3300047319 | Bacteria | 2127 |
| 1100 | Ga0495674_0539616 | 3300047319 | Bacteria | 929 |
| 1101 | Ga0495676_0001077 | 3300047321 | Bacteria | 23118 |
| 1102 | Ga0495680_0003636 | 3300047322 | Bacteria | 15062 |
| 1103 | Ga0495680_0006023 | 3300047322 | Bacteria | 11341 |
| 1104 | Ga0495680_0011046 | 3300047322 | Bacteria | 8022 |
| 1105 | Ga0495680_0011579 | 3300047322 | Bacteria | 7797 |
| 1106 | Ga0495680_0024182 | 3300047322 | Bacteria | 5041 |
| 1107 | Ga0495680_0036742 | 3300047322 | Unclassified | 3929 |
| 1108 | Ga0495680_0043068 | 3300047322 | Bacteria | 3577 |
| 1109 | Ga0495680_0655613 | 3300047322 | Bacteria | 697 |
| 1110 | Ga0495675_0204003 | 3300047444 | Unclassified | 1202 |
| 1111 | Ga0495685_010607 | 3300047447 | Unclassified | 3094 |
| 1112 | Ga0495684_0001855 | 3300047471 | Bacteria | 16919 |
| 1113 | Ga0495684_0018726 | 3300047471 | Bacteria | 5333 |
| 1114 | Ga0495684_0083411 | 3300047471 | Bacteria | 2424 |
| 1115 | Ga0495684_0456493 | 3300047471 | Bacteria | 887 |
| 1116 | Ga0495593_0012759 | 3300047673 | Bacteria | 4798 |
| 1117 | Ga0495593_0129579 | 3300047673 | Bacteria | 1281 |
| 1118 | Ga0495593_0509422 | 3300047673 | Bacteria | 603 |
| 1119 | Ga0495602_0122289 | 3300048088 | Bacteria | 2092 |
| 1120 | Ga0495602_0141061 | 3300048088 | Bacteria | 1907 |
| 1121 | Ga0495602_0193124 | 3300048088 | Bacteria | 1559 |
| 1122 | Ga0495602_0351718 | 3300048088 | Bacteria | 1063 |
| 1123 | Ga0495614_0013434 | 3300048089 | Bacteria | 3592 |
| 1124 | Ga0495614_0074716 | 3300048089 | Unclassified | 1464 |
| 1125 | Ga0495626_0327940 | 3300048091 | Bacteria | 601 |
| 1126 | Ga0496100_0001575 | 3300048903 | Bacteria | 11237 |
| 1127 | Ga0496100_0004851 | 3300048903 | Bacteria | 7183 |
| 1128 | Ga0496100_0010229 | 3300048903 | Bacteria | 5306 |
| 1129 | Ga0496100_0031775 | 3300048903 | Bacteria | 3285 |
| 1130 | Ga0496100_0050817 | 3300048903 | Bacteria | 2688 |
| 1131 | Ga0496100_0063034 | 3300048903 | Unclassified | 2449 |
| 1132 | Ga0496100_0071371 | 3300048903 | Bacteria | 2318 |
| 1133 | Ga0496100_0298960 | 3300048903 | Bacteria | 1204 |
| 1134 | Ga0496101_0008696 | 3300048904 | Bacteria | 6640 |
| 1135 | Ga0496101_0008763 | 3300048904 | Bacteria | 6618 |
| 1136 | Ga0496101_0012134 | 3300048904 | Bacteria | 5743 |
| 1137 | Ga0496101_0012361 | 3300048904 | Bacteria | 5696 |
| 1138 | Ga0496101_0013813 | 3300048904 | Bacteria | 5420 |
| 1139 | Ga0496101_0019837 | 3300048904 | Bacteria | 4597 |
| 1140 | Ga0496101_0045876 | 3300048904 | Bacteria | 3132 |
| 1141 | Ga0496101_0047758 | 3300048904 | Bacteria | 3074 |
| 1142 | Ga0496101_0058115 | 3300048904 | Bacteria | 2799 |
| 1143 | Ga0496101_0163427 | 3300048904 | Unclassified | 1709 |
| 1144 | Ga0496101_0239783 | 3300048904 | Bacteria | 1411 |
| 1145 | Ga0496101_0330518 | 3300048904 | Bacteria | 1196 |
| 1146 | Ga0496102_0022630 | 3300048905 | Bacteria | 5569 |
| 1147 | Ga0496102_0025083 | 3300048905 | Bacteria | 5304 |
| 1148 | Ga0496102_0062684 | 3300048905 | Bacteria | 3405 |
| 1149 | Ga0496102_0078547 | 3300048905 | Bacteria | 3038 |
| 1150 | Ga0496102_0134649 | 3300048905 | Bacteria | 2315 |
| 1151 | Ga0496102_0340261 | 3300048905 | Bacteria | 1413 |
| 1152 | Ga0496102_0417329 | 3300048905 | Bacteria | 1260 |
| 1153 | Ga0496102_0433547 | 3300048905 | Bacteria | 1234 |
| 1154 | Ga0496102_0533133 | 3300048905 | Unclassified | 1097 |
| 1155 | Ga0496102_0859873 | 3300048905 | Bacteria | 829 |
| 1156 | Ga0496103_0001779 | 3300048906 | Bacteria | 14061 |
| 1157 | Ga0496103_0008609 | 3300048906 | Bacteria | 6059 |
| 1158 | Ga0496103_0031043 | 3300048906 | Bacteria | 3254 |
| 1159 | Ga0496103_0067695 | 3300048906 | Bacteria | 2230 |
| 1160 | Ga0496103_0071012 | 3300048906 | Bacteria | 2179 |
| 1161 | Ga0496103_0095128 | 3300048906 | Bacteria | 1882 |
| 1162 | Ga0496103_0309879 | 3300048906 | Bacteria | 1015 |
| 1163 | Ga0496104_0001048 | 3300048907 | Bacteria | 23633 |
| 1164 | Ga0496104_0007716 | 3300048907 | Bacteria | 9528 |
| 1165 | Ga0496104_0015097 | 3300048907 | Bacteria | 6990 |
| 1166 | Ga0496104_0033101 | 3300048907 | Bacteria | 4812 |
| 1167 | Ga0496104_0047160 | 3300048907 | Bacteria | 4060 |
| 1168 | Ga0496104_0066799 | 3300048907 | Bacteria | 3415 |
| 1169 | Ga0496104_0083771 | 3300048907 | Bacteria | 3041 |
| 1170 | Ga0496104_0089440 | 3300048907 | Bacteria | 2941 |
| 1171 | Ga0496104_0136449 | 3300048907 | Bacteria | 2357 |
| 1172 | Ga0496104_0223494 | 3300048907 | Bacteria | 1795 |
| 1173 | Ga0496104_0318189 | 3300048907 | Bacteria | 1469 |
| 1174 | Ga0496104_0485247 | 3300048907 | Bacteria | 1147 |
| 1175 | Ga0496104_0693881 | 3300048907 | Bacteria | 926 |
| 1176 | Ga0496105_0000594 | 3300048908 | Bacteria | 24087 |
| 1177 | Ga0496105_0008293 | 3300048908 | Bacteria | 8075 |
| 1178 | Ga0496105_0011620 | 3300048908 | Bacteria | 6965 |
| 1179 | Ga0496105_0028970 | 3300048908 | Bacteria | 4530 |
| 1180 | Ga0496105_0034310 | 3300048908 | Bacteria | 4172 |
| 1181 | Ga0496105_0196894 | 3300048908 | Bacteria | 1646 |
| 1182 | Ga0496105_0207161 | 3300048908 | Bacteria | 1599 |
| 1183 | Ga0496105_0221655 | 3300048908 | Bacteria | 1539 |
| 1184 | Ga0496105_0430638 | 3300048908 | Bacteria | 1043 |
| 1185 | Ga0496105_0534426 | 3300048908 | Bacteria | 917 |
| 1186 | Ga0496105_0748640 | 3300048908 | Unclassified | 746 |
| 1187 | Ga0496106_0005956 | 3300048909 | Bacteria | 9002 |
| 1188 | Ga0496106_0008187 | 3300048909 | Bacteria | 7725 |
| 1189 | Ga0496106_0017922 | 3300048909 | Bacteria | 5237 |
| 1190 | Ga0496106_0060221 | 3300048909 | Bacteria | 2877 |
| 1191 | Ga0496106_0116498 | 3300048909 | Bacteria | 2084 |
| 1192 | Ga0496106_0123807 | 3300048909 | Unclassified | 2023 |
| 1193 | Ga0496106_0176793 | 3300048909 | Bacteria | 1693 |
| 1194 | Ga0496106_0218441 | 3300048909 | Bacteria | 1520 |
| 1195 | Ga0496107_0008399 | 3300048910 | Bacteria | 7146 |
| 1196 | Ga0496107_0022298 | 3300048910 | Bacteria | 4476 |
| 1197 | Ga0496107_0045134 | 3300048910 | Bacteria | 3169 |
| 1198 | Ga0496107_0057051 | 3300048910 | Bacteria | 2822 |
| 1199 | Ga0496107_0063540 | 3300048910 | Bacteria | 2675 |
| 1200 | Ga0496107_0073243 | 3300048910 | Bacteria | 2491 |
| 1201 | Ga0496107_0092030 | 3300048910 | Bacteria | 2216 |
| 1202 | Ga0496107_0130800 | 3300048910 | Bacteria | 1853 |
| 1203 | Ga0496107_0132341 | 3300048910 | Bacteria | 1841 |
| 1204 | Ga0496107_0207827 | 3300048910 | Bacteria | 1455 |
| 1205 | Ga0496107_0215561 | 3300048910 | Bacteria | 1428 |
| 1206 | Ga0496107_0998163 | 3300048910 | Bacteria | 607 |
| 1207 | Ga0496108_0010409 | 3300048911 | Bacteria | 7553 |
| 1208 | Ga0496108_0028066 | 3300048911 | Bacteria | 4656 |
| 1209 | Ga0496108_0043824 | 3300048911 | Bacteria | 3737 |
| 1210 | Ga0496108_0054227 | 3300048911 | Bacteria | 3364 |
| 1211 | Ga0496108_0152331 | 3300048911 | Bacteria | 1995 |
| 1212 | Ga0496108_0166988 | 3300048911 | Bacteria | 1903 |
| 1213 | Ga0496108_0179769 | 3300048911 | Bacteria | 1832 |
| 1214 | Ga0496108_0195527 | 3300048911 | Bacteria | 1754 |
| 1215 | Ga0496108_0239354 | 3300048911 | Bacteria | 1579 |
| 1216 | Ga0496108_0268424 | 3300048911 | Bacteria | 1485 |
| 1217 | Ga0496108_0359734 | 3300048911 | Bacteria | 1270 |
| 1218 | Ga0496108_0503215 | 3300048911 | Unclassified | 1058 |
| 1219 | Ga0496109_0000463 | 3300048912 | Bacteria | 34599 |
| 1220 | Ga0496109_0000626 | 3300048912 | Bacteria | 29449 |
| 1221 | Ga0496109_0007742 | 3300048912 | Bacteria | 9095 |
| 1222 | Ga0496109_0014816 | 3300048912 | Bacteria | 6785 |
| 1223 | Ga0496109_0017699 | 3300048912 | Bacteria | 6251 |
| 1224 | Ga0496109_0019196 | 3300048912 | Bacteria | 6021 |
| 1225 | Ga0496109_0025337 | 3300048912 | Bacteria | 5284 |
| 1226 | Ga0496109_0030300 | 3300048912 | Bacteria | 4850 |
| 1227 | Ga0496109_0069220 | 3300048912 | Bacteria | 3236 |
| 1228 | Ga0496109_0090622 | 3300048912 | Bacteria | 2828 |
| 1229 | Ga0496109_0144527 | 3300048912 | Bacteria | 2225 |
| 1230 | Ga0496110_0000261 | 3300048913 | Bacteria | 34222 |
| 1231 | Ga0496110_0000563 | 3300048913 | Bacteria | 25359 |
| 1232 | Ga0496110_0007165 | 3300048913 | Bacteria | 8879 |
| 1233 | Ga0496110_0040043 | 3300048913 | Bacteria | 4083 |
| 1234 | Ga0496110_0043948 | 3300048913 | Bacteria | 3901 |
| 1235 | Ga0496110_0064621 | 3300048913 | Bacteria | 3234 |
| 1236 | Ga0496110_0085095 | 3300048913 | Bacteria | 2823 |
| 1237 | Ga0496110_0119476 | 3300048913 | Bacteria | 2374 |
| 1238 | Ga0496110_0143916 | 3300048913 | Unclassified | 2156 |
| 1239 | Ga0496110_0148286 | 3300048913 | Bacteria | 2123 |
| 1240 | Ga0496110_0333783 | 3300048913 | Bacteria | 1381 |
| 1241 | Ga0496111_0000086 | 3300048914 | Bacteria | 39141 |
| 1242 | Ga0496111_0007281 | 3300048914 | Bacteria | 7242 |
| 1243 | Ga0496111_0010323 | 3300048914 | Bacteria | 6261 |
| 1244 | Ga0496111_0010595 | 3300048914 | Bacteria | 6193 |
| 1245 | Ga0496111_0011426 | 3300048914 | Bacteria | 5979 |
| 1246 | Ga0496111_0019287 | 3300048914 | Bacteria | 4735 |
| 1247 | Ga0496111_0028408 | 3300048914 | Bacteria | 3964 |
| 1248 | Ga0496111_0186871 | 3300048914 | Bacteria | 1540 |
| 1249 | Ga0496111_0207041 | 3300048914 | Bacteria | 1458 |
| 1250 | Ga0496111_0224287 | 3300048914 | Bacteria | 1396 |
| 1251 | Ga0496111_0401437 | 3300048914 | Unclassified | 1013 |
| 1252 | Ga0496111_0404763 | 3300048914 | Bacteria | 1008 |
| 1253 | Ga0496111_0898674 | 3300048914 | Bacteria | 638 |
| 1254 | Ga0496112_0001342 | 3300048915 | Bacteria | 18712 |
| 1255 | Ga0496112_0016569 | 3300048915 | Bacteria | 6910 |
| 1256 | Ga0496112_0021620 | 3300048915 | Bacteria | 6119 |
| 1257 | Ga0496112_0026894 | 3300048915 | Bacteria | 5544 |
| 1258 | Ga0496112_0069713 | 3300048915 | Bacteria | 3473 |
| 1259 | Ga0496112_0093840 | 3300048915 | Bacteria | 2971 |
| 1260 | Ga0496112_0098797 | 3300048915 | Bacteria | 2888 |
| 1261 | Ga0496112_0101201 | 3300048915 | Bacteria | 2851 |
| 1262 | Ga0496112_0102144 | 3300048915 | Bacteria | 2837 |
| 1263 | Ga0496112_0163385 | 3300048915 | Bacteria | 2193 |
| 1264 | Ga0496112_0264712 | 3300048915 | Bacteria | 1668 |
| 1265 | Ga0496112_0269566 | 3300048915 | Bacteria | 1651 |
| 1266 | Ga0496112_0467710 | 3300048915 | Bacteria | 1198 |
| 1267 | Ga0496113_0031311 | 3300048916 | Bacteria | 3859 |
| 1268 | Ga0496113_0131667 | 3300048916 | Bacteria | 1963 |
| 1269 | Ga0496113_0174406 | 3300048916 | Bacteria | 1703 |
| 1270 | Ga0496113_0235834 | 3300048916 | Bacteria | 1459 |
| 1271 | Ga0496113_0417764 | 3300048916 | Bacteria | 1077 |
| 1272 | Ga0496113_0756536 | 3300048916 | Bacteria | 773 |
| 1273 | Ga0496114_0000690 | 3300048917 | Bacteria | 25130 |
| 1274 | Ga0496114_0001536 | 3300048917 | Bacteria | 17490 |
| 1275 | Ga0496114_0005912 | 3300048917 | Bacteria | 9616 |
| 1276 | Ga0496114_0012463 | 3300048917 | Bacteria | 6806 |
| 1277 | Ga0496114_0025920 | 3300048917 | Bacteria | 4796 |
| 1278 | Ga0496114_0082308 | 3300048917 | Bacteria | 2720 |
| 1279 | Ga0496114_0112077 | 3300048917 | Unclassified | 2338 |
| 1280 | Ga0496114_0120255 | 3300048917 | Bacteria | 2258 |
| 1281 | Ga0496114_0143607 | 3300048917 | Bacteria | 2068 |
| 1282 | Ga0496114_0171994 | 3300048917 | Bacteria | 1888 |
| 1283 | Ga0496114_0236509 | 3300048917 | Bacteria | 1605 |
| 1284 | Ga0496114_0243561 | 3300048917 | Bacteria | 1582 |
| 1285 | Ga0496114_0267917 | 3300048917 | Bacteria | 1505 |
| 1286 | Ga0496114_0280685 | 3300048917 | Bacteria | 1468 |
| 1287 | Ga0496114_0468153 | 3300048917 | Bacteria | 1115 |
| 1288 | Ga0496115_0006958 | 3300048918 | Bacteria | 8308 |
| 1289 | Ga0496115_0007667 | 3300048918 | Bacteria | 7953 |
| 1290 | Ga0496115_0016034 | 3300048918 | Bacteria | 5698 |
| 1291 | Ga0496115_0018068 | 3300048918 | Bacteria | 5404 |
| 1292 | Ga0496115_0027148 | 3300048918 | Bacteria | 4475 |
| 1293 | Ga0496115_0058268 | 3300048918 | Bacteria | 3108 |
| 1294 | Ga0496115_0082715 | 3300048918 | Bacteria | 2616 |
| 1295 | Ga0496115_0092031 | 3300048918 | Bacteria | 2479 |
| 1296 | Ga0496115_0100540 | 3300048918 | Bacteria | 2370 |
| 1297 | Ga0496115_0145234 | 3300048918 | Bacteria | 1958 |
| 1298 | Ga0496115_0247414 | 3300048918 | Bacteria | 1468 |
| 1299 | Ga0496115_0493115 | 3300048918 | Bacteria | 985 |
| 1300 | Ga0496115_0624375 | 3300048918 | Bacteria | 854 |
| 1301 | Ga0496115_1034297 | 3300048918 | Bacteria | 626 |
| 1302 | Ga0496117_0252066 | 3300048920 | Bacteria | 962 |
| 1303 | Ga0496121_0003393 | 3300048924 | Bacteria | 22796 |
| 1304 | Ga0496124_0505940 | 3300048927 | Bacteria | 809 |
| 1305 | Ga0501291_084244 | 3300049514 | Bacteria | 638 |
| 1306 | Ga0501031_0099378 | 3300049568 | Bacteria | 1899 |
| 1307 | Ga0501031_0166086 | 3300049568 | Bacteria | 1443 |
| 1308 | Ga0501034_0226976 | 3300049571 | Bacteria | 1818 |
| 1309 | Ga0501034_0338464 | 3300049571 | Bacteria | 1435 |
| 1310 | Ga0501036_0077748 | 3300049572 | Bacteria | 2808 |
| 1311 | Ga0501036_0160571 | 3300049572 | Bacteria | 1895 |
| 1312 | Ga0501037_0281347 | 3300049573 | Bacteria | 1159 |
| 1313 | Ga0501038_0295193 | 3300049574 | Bacteria | 1273 |
| 1314 | Ga0501039_0520329 | 3300049575 | Bacteria | 934 |
| 1315 | Ga0501040_0032001 | 3300049576 | Bacteria | 3558 |
| 1316 | Ga0501040_0048507 | 3300049576 | Bacteria | 2902 |
| 1317 | Ga0501040_0120582 | 3300049576 | Bacteria | 1840 |
| 1318 | Ga0501040_0390345 | 3300049576 | Bacteria | 999 |
| 1319 | Ga0501041_0039695 | 3300049577 | Bacteria | 2857 |
| 1320 | Ga0501042_0037687 | 3300049578 | Unclassified | 3432 |
| 1321 | Ga0501042_0074800 | 3300049578 | Bacteria | 2424 |
| 1322 | Ga0501042_0450307 | 3300049578 | Bacteria | 934 |
| 1323 | Ga0501042_0678103 | 3300049578 | Bacteria | 749 |
| 1324 | Ga0501046_0894120 | 3300049580 | Bacteria | 620 |
| 1325 | Ga0501047_0009800 | 3300049581 | Bacteria | 9053 |
| 1326 | Ga0501047_0036325 | 3300049581 | Bacteria | 4762 |
| 1327 | Ga0501047_0047876 | 3300049581 | Bacteria | 4130 |
| 1328 | Ga0501047_0191488 | 3300049581 | Bacteria | 1908 |
| 1329 | Ga0501047_0263116 | 3300049581 | Bacteria | 1572 |
| 1330 | Ga0501048_0390835 | 3300049582 | Bacteria | 994 |
| 1331 | Ga0501048_0425610 | 3300049582 | Bacteria | 950 |
| 1332 | Ga0501067_0000684 | 3300049583 | Bacteria | 18236 |
| 1333 | Ga0501067_0040552 | 3300049583 | Bacteria | 2585 |
| 1334 | Ga0501067_0317318 | 3300049583 | Bacteria | 868 |
| 1335 | Ga0501068_0150831 | 3300049584 | Bacteria | 1461 |
| 1336 | Ga0501068_0176248 | 3300049584 | Bacteria | 1351 |
| 1337 | Ga0501069_0085031 | 3300049585 | Bacteria | 1785 |
| 1338 | Ga0501069_0116351 | 3300049585 | Bacteria | 1525 |
| 1339 | Ga0501069_0278579 | 3300049585 | Bacteria | 978 |
| 1340 | Ga0501070_0000187 | 3300049586 | Bacteria | 58257 |
| 1341 | Ga0501070_0059846 | 3300049586 | Bacteria | 3157 |
| 1342 | Ga0501070_0535568 | 3300049586 | Bacteria | 938 |
| 1343 | Ga0501071_0010601 | 3300049587 | Bacteria | 6182 |
| 1344 | Ga0501072_0072510 | 3300049588 | Bacteria | 2722 |
| 1345 | Ga0501072_0114723 | 3300049588 | Bacteria | 2145 |
| 1346 | Ga0501072_0345995 | 3300049588 | Bacteria | 1180 |
| 1347 | Ga0501072_0594204 | 3300049588 | Bacteria | 873 |
| 1348 | Ga0501073_0127350 | 3300049589 | Bacteria | 1765 |
| 1349 | Ga0501073_0262784 | 3300049589 | Bacteria | 1191 |
| 1350 | Ga0501074_0039632 | 3300049590 | Bacteria | 3412 |
| 1351 | Ga0501074_0060768 | 3300049590 | Bacteria | 2722 |
| 1352 | Ga0501074_0331090 | 3300049590 | Bacteria | 1081 |
| 1353 | Ga0501075_0046587 | 3300049591 | Bacteria | 3257 |
| 1354 | Ga0501075_0080494 | 3300049591 | Bacteria | 2466 |
| 1355 | Ga0501075_0593028 | 3300049591 | Bacteria | 845 |
| 1356 | Ga0501076_0178512 | 3300049592 | Bacteria | 1731 |
| 1357 | Ga0501076_0397722 | 3300049592 | Bacteria | 1133 |
| 1358 | Ga0501077_0199407 | 3300049593 | Bacteria | 1271 |
| 1359 | Ga0501079_0304870 | 3300049741 | Unclassified | 1246 |
| 1360 | Ga0501080_0085748 | 3300049742 | Bacteria | 2926 |
| 1361 | Ga0501080_0233888 | 3300049742 | Bacteria | 1679 |
| 1362 | Ga0501080_0316842 | 3300049742 | Bacteria | 1413 |
| 1363 | Ga0501080_0331901 | 3300049742 | Bacteria | 1375 |
| 1364 | Ga0501080_0557909 | 3300049742 | Bacteria | 1020 |
| 1365 | Ga0501080_0581692 | 3300049742 | Bacteria | 995 |
| 1366 | Ga0501081_0098079 | 3300049743 | Bacteria | 2069 |
| 1367 | Ga0501081_0141135 | 3300049743 | Bacteria | 1727 |
| 1368 | Ga0501044_0263357 | 3300049823 | Bacteria | 1662 |
| 1369 | Ga0501045_0061091 | 3300049824 | Bacteria | 2764 |
| 1370 | Ga0501045_0090987 | 3300049824 | Bacteria | 2255 |
| 1371 | Ga0501045_0623533 | 3300049824 | Bacteria | 798 |
| 1372 | nmdc:mga03n38_16507_c1 | 3300050490 | Bacteria | 2872 |
| 1373 | nmdc:mga00v17_307286_c1 | 3300050491 | Bacteria | 1030 |
| 1374 | nmdc:mga00v17_40795_c1 | 3300050491 | Bacteria | 2786 |
| 1375 | nmdc:mga0yw44_273565_c1 | 3300050492 | Bacteria | 1128 |
| 1376 | nmdc:mga0yw44_35012_c1 | 3300050492 | Bacteria | 2947 |
| 1377 | nmdc:mga0yw44_359720_c1 | 3300050492 | Bacteria | 981 |
| 1378 | nmdc:mga05p37_104588_c1 | 3300050507 | Bacteria | 3483 |
| 1379 | nmdc:mga05p37_107043_c1 | 3300050507 | Bacteria | 3440 |
| 1380 | nmdc:mga05p37_175450_c1 | 3300050507 | Bacteria | 2611 |
| 1381 | nmdc:mga05p37_307137_c1 | 3300050507 | Bacteria | 1882 |
| 1382 | nmdc:mga08y16_204637_c1 | 3300050511 | Bacteria | 2045 |
| 1383 | nmdc:mga08y16_300374_c1 | 3300050511 | Bacteria | 1655 |
| 1384 | nmdc:mga08y16_44085_c1 | 3300050511 | Bacteria | 4673 |
| 1385 | nmdc:mga08y16_519535_c1 | 3300050511 | Bacteria | 1208 |
| 1386 | nmdc:mga0n895_106596_c1 | 3300050512 | Bacteria | 2815 |
| 1387 | nmdc:mga0n895_1335057_c1 | 3300050512 | Unclassified | 687 |
| 1388 | nmdc:mga0rr50_105370_c1 | 3300050513 | Bacteria | 2223 |
| 1389 | nmdc:mga0rr50_290349_c1 | 3300050513 | Bacteria | 1366 |
| 1390 | nmdc:mga0rr50_335112_c1 | 3300050513 | Bacteria | 1270 |
| 1391 | nmdc:mga0rr50_65197_c1 | 3300050513 | Bacteria | 2758 |
| 1392 | nmdc:mga0rr50_883578_c1 | 3300050513 | Bacteria | 762 |
| 1393 | nmdc:mga08x19_109851_c1 | 3300050514 | Unclassified | 1838 |
| 1394 | nmdc:mga08x19_603632_c1 | 3300050514 | Bacteria | 778 |
| 1395 | nmdc:mga0a205_13182_c2 | 3300050515 | Bacteria | 4726 |
| 1396 | nmdc:mga0a205_203734_c1 | 3300050515 | Bacteria | 1868 |
| 1397 | Ga0495601_0010980 | 3300053077 | Bacteria | 5408 |
| 1398 | Ga0495601_0075514 | 3300053077 | Bacteria | 2157 |
| 1399 | Ga0495601_0081126 | 3300053077 | Bacteria | 2082 |
| 1400 | Ga0495601_0084313 | 3300053077 | Bacteria | 2041 |
| 1401 | Ga0495601_0140522 | 3300053077 | Bacteria | 1575 |
| 1402 | Ga0495601_0611532 | 3300053077 | Bacteria | 699 |
| 1403 | Ga0495612_0059843 | 3300053078 | Bacteria | 1576 |
| 1404 | Ga0495612_0115817 | 3300053078 | Bacteria | 1150 |
| 1405 | Ga0495655_0012607 | 3300053083 | Bacteria | 1727 |
| 1406 | Ga0495595_0015142 | 3300053084 | Bacteria | 3286 |
| 1407 | Ga0495595_0018976 | 3300053084 | Unclassified | 2978 |
| 1408 | Ga0495595_0039102 | 3300053084 | Bacteria | 2164 |
| 1409 | Ga0495595_0095196 | 3300053084 | Bacteria | 1432 |
| 1410 | Ga0495619_0011353 | 3300053085 | Bacteria | 5609 |
| 1411 | Ga0495619_0032007 | 3300053085 | Bacteria | 3410 |
| 1412 | Ga0495619_0318691 | 3300053085 | Bacteria | 1076 |
| 1413 | Ga0495619_0395161 | 3300053085 | Bacteria | 955 |
| 1414 | Ga0495619_0775516 | 3300053085 | Bacteria | 649 |
| 1415 | Ga0501084_0059607 | 3300054114 | Bacteria | 3195 |
| 1416 | Ga0501084_0084775 | 3300054114 | Bacteria | 2660 |
| 1417 | Ga0501084_0173643 | 3300054114 | Bacteria | 1819 |
| 1418 | Ga0501084_0281472 | 3300054114 | Bacteria | 1404 |
| 1419 | Ga0590071_014593 | 3300059421 | Bacteria | 1843 |
| 1420 | Ga0590075_019535 | 3300059424 | Bacteria | 1682 |
| 1421 | Ga0501082_0017996 | 3300060353 | Bacteria | 6086 |
| 1422 | Ga0501082_0120023 | 3300060353 | Bacteria | 2279 |
| 1423 | Ga0466962_0006119 | 3300061719 | Bacteria | 5785 |
| 1424 | Ga0466962_0014815 | 3300061719 | Bacteria | 3756 |
| 1425 | Ga0466962_0017977 | 3300061719 | Bacteria | 3402 |
| 1426 | Ga0466962_0075002 | 3300061719 | Bacteria | 1616 |
| 1427 | Ga0466962_0120031 | 3300061719 | Bacteria | 1268 |
| 1428 | Ga0466962_0322235 | 3300061719 | Bacteria | 767 |
| 1429 | Ga0466962_0368673 | 3300061719 | Bacteria | 716 |
| 1430 | Ga0530510_0061846 | 3300061734 | Bacteria | 2711 |
| 1431 | Ga0530510_0185592 | 3300061734 | Bacteria | 1543 |
| 1432 | Ga0530510_0312156 | 3300061734 | Bacteria | 1178 |
| 1433 | Ga0530510_0477903 | 3300061734 | Bacteria | 944 |
| 1434 | Ga0466964_0139669 | |||
| 1435 | JGI24744J21845_10000431 | |||
| 1436 | JGI24742J22300_10016012 | |||
| 1437 | Ga0070658_10011654 | |||
| 1438 | Ga0070658_10296871 | |||
| 1439 | Ga0070658_10409779 | |||
| 1440 | Ga0070683_100005463 | |||
| 1441 | Ga0070683_100014696 | |||
| 1442 | Ga0070683_100033750 | |||
| 1443 | Ga0070683_100046782 | |||
| 1444 | Ga0070683_100052937 | |||
| 1445 | Ga0070683_100057024 | |||
| 1446 | Ga0070683_100145725 | |||
| 1447 | Ga0070683_100260471 | |||
| 1448 | Ga0070683_101031923 | |||
| 1449 | Ga0070683_101366492 | |||
| 1450 | Ga0070690_100067093 | |||
| 1451 | Ga0068869_100920356 | |||
| 1452 | Ga0070666_10045238 | |||
| 1453 | Ga0070680_100003716 | |||
| 1454 | Ga0070680_100008678 | |||
| 1455 | Ga0070680_100020219 | |||
| 1456 | Ga0070680_100054779 | |||
| 1457 | Ga0070680_100067838 | |||
| 1458 | Ga0070680_100269750 | |||
| 1459 | Ga0070682_100010000 | |||
| 1460 | Ga0070682_100041215 | |||
| 1461 | Ga0070682_100285584 | |||
| 1462 | Ga0070682_100461932 | |||
| 1463 | Ga0068868_100022279 | |||
| 1464 | Ga0068868_100030281 | |||
| 1465 | Ga0068868_100069123 | |||
| 1466 | Ga0070660_100003611 | |||
| 1467 | Ga0070660_100003619 | |||
| 1468 | Ga0070660_100006608 | |||
| 1469 | Ga0070660_100051211 | |||
| 1470 | Ga0070660_100105017 | |||
| 1471 | Ga0070660_100124802 | |||
| 1472 | Ga0070660_100214122 | |||
| 1473 | Ga0070660_100309215 | |||
| 1474 | Ga0070689_100019349 | |||
| 1475 | Ga0070691_10010579 | |||
| 1476 | Ga0070691_10159814 | |||
| 1477 | Ga0070661_100020146 | |||
| 1478 | Ga0070661_100070569 | |||
| 1479 | Ga0070661_100194475 | |||
| 1480 | Ga0070661_100357842 | |||
| 1481 | Ga0070692_10171546 | |||
| 1482 | Ga0070669_100432472 | |||
| 1483 | Ga0070671_100016842 | |||
| 1484 | Ga0070671_100051304 | |||
| 1485 | Ga0070671_100153201 | |||
| 1486 | Ga0070671_100186333 | |||
| 1487 | Ga0070674_100001733 | |||
| 1488 | Ga0070674_100029669 | |||
| 1489 | Ga0070674_100118210 | |||
| 1490 | Ga0070674_100120644 | |||
| 1491 | Ga0070674_100413578 | |||
| 1492 | Ga0070688_100022203 | |||
| 1493 | Ga0070659_100006422 | |||
| 1494 | Ga0070659_100026883 | |||
| 1495 | Ga0070659_100068194 | |||
| 1496 | Ga0070659_101031944 | |||
| 1497 | Ga0070667_100156947 | |||
| 1498 | Ga0070703_10058935 | |||
| 1499 | Ga0070709_10087479 | |||
| 1500 | Ga0070709_10105974 | |||
| 1501 | Ga0070709_10133658 | |||
| 1502 | Ga0070709_10307333 | |||
| 1503 | Ga0070709_10511240 | |||
| 1504 | Ga0070714_100061015 | |||
| 1505 | Ga0070714_100068287 | |||
| 1506 | Ga0070714_100135410 | |||
| 1507 | Ga0070714_100158496 | |||
| 1508 | Ga0070714_100630577 | |||
| 1509 | Ga0070714_100753440 | |||
| 1510 | Ga0070714_101385433 | |||
| 1511 | Ga0070713_100016916 | |||
| 1512 | Ga0070713_100023552 | |||
| 1513 | Ga0070713_100051791 | |||
| 1514 | Ga0070713_100138374 | |||
| 1515 | Ga0070713_100163048 | |||
| 1516 | Ga0070713_100176256 | |||
| 1517 | Ga0070713_100184083 | |||
| 1518 | Ga0070713_100329669 | |||
| 1519 | Ga0070710_10007274 | |||
| 1520 | Ga0070710_10010539 | |||
| 1521 | Ga0070710_10060757 | |||
| 1522 | Ga0070701_10162227 | |||
| 1523 | Ga0070711_100003275 | |||
| 1524 | Ga0070711_100055389 | |||
| 1525 | Ga0070711_100059978 | |||
| 1526 | Ga0070711_100119762 | |||
| 1527 | Ga0070711_100212675 | |||
| 1528 | Ga0070705_100101127 | |||
| 1529 | Ga0070705_100531968 | |||
| 1530 | Ga0070700_100002621 | |||
| 1531 | Ga0070700_100333315 | |||
| 1532 | Ga0070700_100448963 | |||
| 1533 | Ga0070694_100568519 | |||
| 1534 | Ga0070708_100013462 | |||
| 1535 | Ga0070708_100054645 | |||
| 1536 | Ga0070708_100175867 | |||
| 1537 | Ga0070708_100329009 | |||
| 1538 | Ga0070663_100366452 | |||
| 1539 | Ga0070663_100755587 | |||
| 1540 | Ga0070678_100003222 | |||
| 1541 | Ga0070678_100015166 | |||
| 1542 | Ga0070678_100151821 | |||
| 1543 | Ga0070678_100420577 | |||
| 1544 | Ga0070678_100698144 | |||
| 1545 | Ga0070681_10001213 | |||
| 1546 | Ga0070681_10003066 | |||
| 1547 | Ga0070681_10005979 | |||
| 1548 | Ga0070681_10099106 | |||
| 1549 | Ga0070681_10104999 | |||
| 1550 | Ga0070681_10381810 | |||
| 1551 | Ga0070681_10439244 | |||
| 1552 | Ga0068867_100040761 | |||
| 1553 | Ga0068867_100081693 | |||
| 1554 | Ga0068867_100109198 | |||
| 1555 | Ga0068867_100208271 | |||
| 1556 | Ga0070685_10001703 | |||
| 1557 | Ga0070706_100358021 | |||
| 1558 | Ga0070706_100736563 | |||
| 1559 | Ga0070707_100005939 | |||
| 1560 | Ga0070707_100110992 | |||
| 1561 | Ga0070698_100028099 | |||
| 1562 | Ga0070698_100038691 | |||
| 1563 | Ga0070698_100053629 | |||
| 1564 | Ga0070698_100435010 | |||
| 1565 | Ga0070699_100061914 | |||
| 1566 | Ga0070699_100173579 | |||
| 1567 | Ga0070679_100004486 | |||
| 1568 | Ga0070679_100008211 | |||
| 1569 | Ga0070679_100019233 | |||
| 1570 | Ga0070679_100020574 | |||
| 1571 | Ga0070679_100058769 | |||
| 1572 | Ga0070679_100271748 | |||
| 1573 | Ga0070679_100302921 | |||
| 1574 | Ga0070679_100549503 | |||
| 1575 | Ga0070679_100780731 | |||
| 1576 | Ga0070679_101071482 | |||
| 1577 | Ga0070679_101520182 | |||
| 1578 | Ga0070684_100007800 | |||
| 1579 | Ga0070684_100012798 | |||
| 1580 | Ga0070684_100013758 | |||
| 1581 | Ga0070684_100017138 | |||
| 1582 | Ga0070684_100044829 | |||
| 1583 | Ga0070684_100196926 | |||
| 1584 | Ga0070684_100318025 | |||
| 1585 | Ga0070684_100360746 | |||
| 1586 | Ga0070684_100558692 | |||
| 1587 | Ga0070684_100560603 | |||
| 1588 | Ga0070684_100654445 | |||
| 1589 | Ga0070684_100799618 | |||
| 1590 | Ga0070697_100196496 | |||
| 1591 | Ga0068853_100017800 | |||
| 1592 | Ga0068853_100092663 | |||
| 1593 | Ga0068853_100330881 | |||
| 1594 | Ga0070672_100022002 | |||
| 1595 | Ga0070672_100130107 | |||
| 1596 | Ga0070672_100623192 | |||
| 1597 | Ga0070686_100002161 | |||
| 1598 | Ga0070686_100089922 | |||
| 1599 | Ga0070686_100102566 | |||
| 1600 | Ga0070695_100028871 | |||
| 1601 | Ga0070695_100310062 | |||
| 1602 | Ga0070696_100006574 | |||
| 1603 | Ga0070696_100022344 | |||
| 1604 | Ga0070696_100095507 | |||
| 1605 | Ga0070696_100128501 | |||
| 1606 | Ga0070693_100010437 | |||
| 1607 | Ga0070693_100025635 | |||
| 1608 | Ga0070693_100063632 | |||
| 1609 | Ga0070693_100240317 | |||
| 1610 | Ga0070693_100512464 | |||
| 1611 | Ga0070665_100012505 | |||
| 1612 | Ga0070704_100017712 | |||
| 1613 | Ga0070704_100093177 | |||
| 1614 | Ga0070704_100137355 | |||
| 1615 | Ga0070704_100171840 | |||
| 1616 | Ga0070704_100503823 | |||
| 1617 | Ga0068855_100022769 | |||
| 1618 | Ga0068855_100063071 | |||
| 1619 | Ga0068855_100098614 | |||
| 1620 | Ga0068855_100116042 | |||
| 1621 | Ga0068855_100121526 | |||
| 1622 | Ga0068855_100163556 | |||
| 1623 | Ga0068855_100200959 | |||
| 1624 | Ga0068855_100556072 | |||
| 1625 | Ga0070664_100046670 | |||
| 1626 | Ga0070664_100050187 | |||
| 1627 | Ga0070664_100156584 | |||
| 1628 | Ga0070664_100373438 | |||
| 1629 | Ga0068857_100038252 | |||
| 1630 | Ga0068857_100066469 | |||
| 1631 | Ga0068857_100117615 | |||
| 1632 | Ga0068857_100287382 | |||
| 1633 | Ga0068857_100292510 | |||
| 1634 | Ga0068857_100620593 | |||
| 1635 | Ga0068854_100345818 | |||
| 1636 | Ga0068856_100006927 | |||
| 1637 | Ga0068856_100033618 | |||
| 1638 | Ga0068856_100035013 | |||
| 1639 | Ga0068856_100063290 | |||
| 1640 | Ga0068856_100081217 | |||
| 1641 | Ga0068856_100082703 | |||
| 1642 | Ga0068856_100139902 | |||
| 1643 | Ga0068856_100395413 | |||
| 1644 | Ga0070702_100007535 | |||
| 1645 | Ga0070702_100043548 | |||
| 1646 | Ga0070702_100231515 | |||
| 1647 | Ga0068852_100027110 | |||
| 1648 | Ga0068852_100092269 | |||
| 1649 | Ga0068859_100198475 | |||
| 1650 | Ga0068864_100205333 | |||
| 1651 | Ga0068864_100244089 | |||
| 1652 | Ga0068861_100292671 | |||
| 1653 | Ga0068861_100725990 | |||
| 1654 | Ga0068851_10373505 | |||
| 1655 | Ga0068870_10143152 | |||
| 1656 | Ga0068870_10294638 | |||
| 1657 | Ga0068860_100104907 | |||
| 1658 | Ga0068860_101434475 | |||
| 1659 | Ga0081455_10021153 | |||
| 1660 | Ga0081455_10039632 | |||
| 1661 | Ga0081540_1014735 | |||
| 1662 | Ga0081539_10000041 | |||
| 1663 | Ga0081539_10003477 | |||
| 1664 | Ga0081539_10089492 | |||
| 1665 | Ga0070717_10013145 | |||
| 1666 | Ga0070717_10064666 | |||
| 1667 | Ga0070717_10466886 | |||
| 1668 | Ga0075365_10439220 | |||
| 1669 | Ga0075364_10037251 | |||
| 1670 | Ga0075432_10058954 | |||
| 1671 | Ga0070715_10002468 | |||
| 1672 | Ga0070715_10049790 | |||
| 1673 | Ga0070715_10108688 | |||
| 1674 | Ga0070716_100003252 | |||
| 1675 | Ga0070716_100108668 | |||
| 1676 | Ga0070716_100205301 | |||
| 1677 | Ga0070712_100033376 | |||
| 1678 | Ga0070712_100061780 | |||
| 1679 | Ga0070712_100072155 | |||
| 1680 | Ga0070712_100107293 | |||
| 1681 | Ga0070712_100128214 | |||
| 1682 | Ga0070712_100360892 | |||
| 1683 | Ga0070712_100392261 | |||
| 1684 | Ga0070712_100497154 | |||
| 1685 | Ga0097621_100347645 | |||
| 1686 | Ga0068871_100184090 | |||
| 1687 | Ga0068871_100781676 | |||
| 1688 | Ga0075428_100853797 | |||
| 1689 | Ga0075428_101147736 | |||
| 1690 | Ga0075431_100499385 | |||
| 1691 | Ga0075433_10038807 | |||
| 1692 | Ga0075433_10045266 | |||
| 1693 | Ga0075433_10169677 | |||
| 1694 | Ga0075434_100102689 | |||
| 1695 | Ga0075429_100854548 | |||
| 1696 | Ga0068865_100001919 | |||
| 1697 | Ga0068865_100827132 | |||
| 1698 | Ga0097620_100198466 | |||
| 1699 | Ga0075435_100073109 | |||
| 1700 | Ga0075435_100197505 | |||
| 1701 | Ga0075435_100266028 | |||
| 1702 | Ga0075435_100397018 | |||
| 1703 | Ga0075435_100442324 | |||
| 1704 | Ga0105240_10016420 | |||
| 1705 | Ga0105240_10110931 | |||
| 1706 | Ga0105240_10238489 | |||
| 1707 | Ga0105240_10404541 | |||
| 1708 | Ga0105240_10660834 | |||
| 1709 | Ga0105240_11176282 | |||
| 1710 | Ga0111539_10041829 | |||
| 1711 | Ga0111539_10181772 | |||
| 1712 | Ga0105245_10002363 | |||
| 1713 | Ga0105245_10006729 | |||
| 1714 | Ga0105245_10144642 | |||
| 1715 | Ga0105245_10197903 | |||
| 1716 | Ga0105245_10914655 | |||
| 1717 | Ga0105245_10919533 | |||
| 1718 | Ga0105245_10935122 | |||
| 1719 | Ga0105247_10032115 | |||
| 1720 | Ga0114129_10007795 | |||
| 1721 | Ga0114129_10082552 | |||
| 1722 | Ga0114129_10265903 | |||
| 1723 | Ga0105243_10002852 | |||
| 1724 | Ga0105243_10060838 | |||
| 1725 | Ga0105243_10125864 | |||
| 1726 | Ga0105243_10466986 | |||
| 1727 | Ga0105243_10622453 | |||
| 1728 | Ga0105243_10904697 | |||
| 1729 | Ga0105241_10026869 | |||
| 1730 | Ga0105241_10059659 | |||
| 1731 | Ga0105241_10077226 | |||
| 1732 | Ga0105241_10127395 | |||
| 1733 | Ga0105241_10360025 | |||
| 1734 | Ga0105241_11235571 | |||
| 1735 | Ga0105242_10050202 | |||
| 1736 | Ga0105242_10093774 | |||
| 1737 | Ga0105242_10389248 | |||
| 1738 | Ga0105242_10511307 | |||
| 1739 | Ga0105248_10013646 | |||
| 1740 | Ga0105248_10605768 | |||
| 1741 | Ga0105237_10026541 | |||
| 1742 | Ga0105237_10039262 | |||
| 1743 | Ga0105238_10051504 | |||
| 1744 | Ga0105238_10062175 | |||
| 1745 | Ga0105238_10081650 | |||
| 1746 | Ga0105238_10275665 | |||
| 1747 | Ga0105238_11189360 | |||
| 1748 | Ga0105238_11704791 | |||
| 1749 | Ga0105249_10135352 | |||
| 1750 | Ga0105239_10010390 | |||
| 1751 | Ga0105239_10237715 | |||
| 1752 | Ga0105239_10335437 | |||
| 1753 | Ga0105239_11012051 | |||
| 1754 | Ga0105239_11177649 | |||
| 1755 | Ga0105239_11351469 | |||
| 1756 | Ga0105246_10043731 | |||
| 1757 | Ga0105246_10140685 | |||
| 1758 | Ga0105246_10294852 | |||
| 1759 | Ga0157320_1006806 | |||
| 1760 | Ga0157373_10125746 | |||
| 1761 | Ga0157373_10219521 | |||
| 1762 | Ga0157371_10210646 | |||
| 1763 | Ga0157371_10301643 | |||
| 1764 | Ga0157371_10378587 | |||
| 1765 | Ga0157370_10018569 | |||
| 1766 | Ga0157370_10021632 | |||
| 1767 | Ga0157370_10052189 | |||
| 1768 | Ga0157370_10060686 | |||
| 1769 | Ga0157370_10064360 | |||
| 1770 | Ga0157370_10070570 | |||
| 1771 | Ga0157370_10764622 | |||
| 1772 | Ga0157369_10002394 | |||
| 1773 | Ga0157369_10003170 | |||
| 1774 | Ga0157369_10020044 | |||
| 1775 | Ga0157369_10056328 | |||
| 1776 | Ga0157369_10096757 | |||
| 1777 | Ga0157369_10155660 | |||
| 1778 | Ga0157369_10202624 | |||
| 1779 | Ga0157369_10229275 | |||
| 1780 | Ga0157369_11044160 | |||
| 1781 | Ga0157374_10002922 | |||
| 1782 | Ga0157374_10084293 | |||
| 1783 | Ga0157374_10294943 | |||
| 1784 | Ga0157374_10549427 | |||
| 1785 | Ga0157374_10859644 | |||
| 1786 | Ga0157374_11797968 | |||
| 1787 | Ga0157378_10009605 | |||
| 1788 | Ga0157378_10324391 | |||
| 1789 | Ga0157378_10643372 | |||
| 1790 | Ga0157372_10044068 | |||
| 1791 | Ga0157372_10061739 | |||
| 1792 | Ga0157372_10081192 | |||
| 1793 | Ga0157372_10140995 | |||
| 1794 | Ga0157372_10142507 | |||
| 1795 | Ga0157372_10258868 | |||
| 1796 | Ga0157372_10548720 | |||
| 1797 | Ga0157372_10821351 | |||
| 1798 | Ga0157372_11803098 | |||
| 1799 | Ga0157375_10096082 | |||
| 1800 | Ga0157375_10175581 | |||
| 1801 | Ga0157375_10872772 | |||
| 1802 | Ga0163163_10319175 | |||
| 1803 | Ga0163163_10543675 | |||
| 1804 | Ga0157380_10145813 | |||
| 1805 | Ga0182008_10152147 | |||
| 1806 | Ga0182008_10177432 | |||
| 1807 | Ga0182008_10190379 | |||
| 1808 | Ga0157377_10084611 | |||
| 1809 | Ga0157377_10230790 | |||
| 1810 | Ga0157376_10030959 | |||
| 1811 | Ga0157376_10038034 | |||
| 1812 | Ga0157376_10306219 | |||
| 1813 | Ga0197907_10597396 | |||
| 1814 | Ga0206356_11185392 | |||
| 1815 | Ga0206356_11685916 | |||
| 1816 | Ga0206352_10714872 | |||
| 1817 | Ga0206350_11458775 | |||
| 1818 | Ga0206354_10026723 | |||
| 1819 | Ga0206354_10139567 | |||
| 1820 | Ga0206354_10363881 | |||
| 1821 | Ga0206354_10652406 | |||
| 1822 | Ga0206353_10123035 | |||
| 1823 | Ga0206353_10422209 | |||
| 1824 | Ga0206353_10506849 | |||
| 1825 | Ga0206353_10712429 | |||
| 1826 | Ga0206353_10722631 | |||
| 1827 | Ga0206353_11405661 | |||
| 1828 | Ga0206353_11431565 | |||
| 1829 | Ga0206353_12056592 | |||
| 1830 | Ga0213873_10016713 | |||
| 1831 | Ga0213874_10003560 | |||
| 1832 | Ga0213874_10004492 | |||
| 1833 | Ga0213874_10017767 | |||
| 1834 | Ga0213876_10003400 | |||
| 1835 | Ga0213876_10075768 | |||
| 1836 | Ga0213875_10011474 | |||
| 1837 | Ga0213875_10038297 | |||
| 1838 | Ga0213875_10040337 | |||
| 1839 | Ga0213875_10106805 | |||
| 1840 | Ga0213875_10270277 | |||
| 1841 | Ga0224712_10316573 | |||
| 1842 | Ga0207656_10469819 | |||
| 1843 | Ga0207653_10000589 | |||
| 1844 | Ga0207653_10079423 | |||
| 1845 | Ga0207653_10124111 | |||
| 1846 | Ga0207692_10017312 | |||
| 1847 | Ga0207692_10023818 | |||
| 1848 | Ga0207692_10083041 | |||
| 1849 | Ga0207642_10075270 | |||
| 1850 | Ga0207642_10215293 | |||
| 1851 | Ga0207710_10046431 | |||
| 1852 | Ga0207688_10006630 | |||
| 1853 | Ga0207688_10075391 | |||
| 1854 | Ga0207688_10083508 | |||
| 1855 | Ga0207688_10166598 | |||
| 1856 | Ga0207647_10407852 | |||
| 1857 | Ga0207685_10011327 | |||
| 1858 | Ga0207685_10035135 | |||
| 1859 | Ga0207699_10130163 | |||
| 1860 | Ga0207699_10147579 | |||
| 1861 | Ga0207699_10331384 | |||
| 1862 | Ga0207643_10027335 | |||
| 1863 | Ga0207643_10439671 | |||
| 1864 | Ga0207705_10021888 | |||
| 1865 | Ga0207705_10132721 | |||
| 1866 | Ga0207705_10373114 | |||
| 1867 | Ga0207705_10461490 | |||
| 1868 | Ga0207684_10057105 | |||
| 1869 | Ga0207684_10398368 | |||
| 1870 | Ga0207684_10463827 | |||
| 1871 | Ga0207684_10475285 | |||
| 1872 | Ga0207654_10016213 | |||
| 1873 | Ga0207654_10017166 | |||
| 1874 | Ga0207654_10152567 | |||
| 1875 | Ga0207654_10406874 | |||
| 1876 | Ga0207707_10002380 | |||
| 1877 | Ga0207707_10018648 | |||
| 1878 | Ga0207707_10034890 | |||
| 1879 | Ga0207707_10053386 | |||
| 1880 | Ga0207707_10101056 | |||
| 1881 | Ga0207707_10185569 | |||
| 1882 | Ga0207707_10428964 | |||
| 1883 | Ga0207695_10430764 | |||
| 1884 | Ga0207671_10054864 | |||
| 1885 | Ga0207693_10001862 | |||
| 1886 | Ga0207693_10003040 | |||
| 1887 | Ga0207693_10003428 | |||
| 1888 | Ga0207693_10004843 | |||
| 1889 | Ga0207693_10005535 | |||
| 1890 | Ga0207693_10026100 | |||
| 1891 | Ga0207693_10107272 | |||
| 1892 | Ga0207693_10240065 | |||
| 1893 | Ga0207693_10388697 | |||
| 1894 | Ga0207693_10577094 | |||
| 1895 | Ga0207663_10038877 | |||
| 1896 | Ga0207663_10041520 | |||
| 1897 | Ga0207663_10069621 | |||
| 1898 | Ga0207663_10080381 | |||
| 1899 | Ga0207663_10089591 | |||
| 1900 | Ga0207663_10131975 | |||
| 1901 | Ga0207663_10433068 | |||
| 1902 | Ga0207663_10535885 | |||
| 1903 | Ga0207663_10689595 | |||
| 1904 | Ga0207663_10940520 | |||
| 1905 | Ga0207660_10012183 | |||
| 1906 | Ga0207660_10013519 | |||
| 1907 | Ga0207660_10093840 | |||
| 1908 | Ga0207660_10100290 | |||
| 1909 | Ga0207660_10136020 | |||
| 1910 | Ga0207657_10000054 | |||
| 1911 | Ga0207657_10001075 | |||
| 1912 | Ga0207657_10004160 | |||
| 1913 | Ga0207657_10006359 | |||
| 1914 | Ga0207657_10013020 | |||
| 1915 | Ga0207657_10020763 | |||
| 1916 | Ga0207657_10033290 | |||
| 1917 | Ga0207657_10141185 | |||
| 1918 | Ga0207657_10197179 | |||
| 1919 | Ga0207657_10291726 | |||
| 1920 | Ga0207657_10337525 | |||
| 1921 | Ga0207649_10020282 | |||
| 1922 | Ga0207649_10058016 | |||
| 1923 | Ga0207649_10327546 | |||
| 1924 | Ga0207649_10492429 | |||
| 1925 | Ga0207649_10510563 | |||
| 1926 | Ga0207652_10033577 | |||
| 1927 | Ga0207652_10087978 | |||
| 1928 | Ga0207652_10116070 | |||
| 1929 | Ga0207652_10147522 | |||
| 1930 | Ga0207652_10155906 | |||
| 1931 | Ga0207652_10201891 | |||
| 1932 | Ga0207652_10308520 | |||
| 1933 | Ga0207652_10630200 | |||
| 1934 | Ga0207646_10011714 | |||
| 1935 | Ga0207646_10323367 | |||
| 1936 | Ga0207646_10902080 | |||
| 1937 | Ga0207681_10446106 | |||
| 1938 | Ga0207694_10026284 | |||
| 1939 | Ga0207694_10528077 | |||
| 1940 | Ga0207694_10596398 | |||
| 1941 | Ga0207694_11186329 | |||
| 1942 | Ga0207687_10191162 | |||
| 1943 | Ga0207687_10205832 | |||
| 1944 | Ga0207687_10960363 | |||
| 1945 | Ga0207687_11053672 | |||
| 1946 | Ga0207700_10047053 | |||
| 1947 | Ga0207700_10152535 | |||
| 1948 | Ga0207700_10526897 | |||
| 1949 | Ga0207664_10046016 | |||
| 1950 | Ga0207664_10062402 | |||
| 1951 | Ga0207664_10104816 | |||
| 1952 | Ga0207664_10135528 | |||
| 1953 | Ga0207664_10156674 | |||
| 1954 | Ga0207664_10590707 | |||
| 1955 | Ga0207664_10787927 | |||
| 1956 | Ga0207664_11168003 | |||
| 1957 | Ga0207644_10224211 | |||
| 1958 | Ga0207644_10812711 | |||
| 1959 | Ga0207690_10018587 | |||
| 1960 | Ga0207690_10043519 | |||
| 1961 | Ga0207690_10058287 | |||
| 1962 | Ga0207690_10185208 | |||
| 1963 | Ga0207690_10303620 | |||
| 1964 | Ga0207690_10770455 | |||
| 1965 | Ga0207706_10829098 | |||
| 1966 | Ga0207686_10008636 | |||
| 1967 | Ga0207709_10001437 | |||
| 1968 | Ga0207709_10078685 | |||
| 1969 | Ga0207709_10321493 | |||
| 1970 | Ga0207670_10196744 | |||
| 1971 | Ga0207669_10000947 | |||
| 1972 | Ga0207669_10013492 | |||
| 1973 | Ga0207704_10003034 | |||
| 1974 | Ga0207704_10180822 | |||
| 1975 | Ga0207665_10000344 | |||
| 1976 | Ga0207665_10021600 | |||
| 1977 | Ga0207665_10050876 | |||
| 1978 | Ga0207665_10055879 | |||
| 1979 | Ga0207665_10126478 | |||
| 1980 | Ga0207691_10003841 | |||
| 1981 | Ga0207691_10086709 | |||
| 1982 | Ga0207711_10070075 | |||
| 1983 | Ga0207689_10853498 | |||
| 1984 | Ga0207661_10000588 | |||
| 1985 | Ga0207661_10002036 | |||
| 1986 | Ga0207661_10011037 | |||
| 1987 | Ga0207661_10020465 | |||
| 1988 | Ga0207661_10026264 | |||
| 1989 | Ga0207661_10074813 | |||
| 1990 | Ga0207661_10077742 | |||
| 1991 | Ga0207661_10218085 | |||
| 1992 | Ga0207661_10239910 | |||
| 1993 | Ga0207661_10328890 | |||
| 1994 | Ga0207661_10527809 | |||
| 1995 | Ga0207661_10704246 | |||
| 1996 | Ga0207679_10035462 | |||
| 1997 | Ga0207679_10073477 | |||
| 1998 | Ga0207679_10147944 | |||
| 1999 | Ga0207667_10040671 | |||
| 2000 | Ga0207667_10096249 | |||
| 2001 | Ga0207667_10175124 | |||
| 2002 | Ga0207667_10266827 | |||
| 2003 | Ga0207667_10527742 | |||
| 2004 | Ga0207667_11025384 | |||
| 2005 | Ga0207667_11320108 | |||
| 2006 | Ga0207712_10010849 | |||
| 2007 | Ga0207712_10357383 | |||
| 2008 | Ga0207712_10768104 | |||
| 2009 | Ga0207640_10498454 | |||
| 2010 | Ga0207640_10522246 | |||
| 2011 | Ga0207640_11092456 | |||
| 2012 | Ga0207677_10019958 | |||
| 2013 | Ga0207677_10057246 | |||
| 2014 | Ga0207703_10841855 | |||
| 2015 | Ga0207639_10094904 | |||
| 2016 | Ga0207639_10269163 | |||
| 2017 | Ga0207639_10808038 | |||
| 2018 | Ga0207639_10967905 | |||
| 2019 | Ga0207678_10116707 | |||
| 2020 | Ga0207678_10147567 | |||
| 2021 | Ga0207678_10282327 | |||
| 2022 | Ga0207678_10718115 | |||
| 2023 | Ga0207678_10767031 | |||
| 2024 | Ga0207708_10002124 | |||
| 2025 | Ga0207708_10249283 | |||
| 2026 | Ga0207708_10810477 | |||
| 2027 | Ga0207702_10012100 | |||
| 2028 | Ga0207702_10024338 | |||
| 2029 | Ga0207702_10032479 | |||
| 2030 | Ga0207702_10090602 | |||
| 2031 | Ga0207702_10102085 | |||
| 2032 | Ga0207702_10143631 | |||
| 2033 | Ga0207702_10163115 | |||
| 2034 | Ga0207702_10296973 | |||
| 2035 | Ga0207702_10334128 | |||
| 2036 | Ga0207702_10566513 | |||
| 2037 | Ga0207702_10802411 | |||
| 2038 | Ga0207702_10804748 | |||
| 2039 | Ga0207648_10003665 | |||
| 2040 | Ga0207648_10514480 | |||
| 2041 | Ga0207648_11192295 | |||
| 2042 | Ga0207676_10250220 | |||
| 2043 | Ga0207676_10355645 | |||
| 2044 | Ga0207674_10109936 | |||
| 2045 | Ga0207674_10304063 | |||
| 2046 | Ga0207674_10358692 | |||
| 2047 | Ga0207674_10490563 | |||
| 2048 | Ga0207675_100036335 | |||
| 2049 | Ga0207675_100484288 | |||
| 2050 | Ga0207675_100519942 | |||
| 2051 | Ga0207683_10000549 | |||
| 2052 | Ga0207683_10004028 | |||
| 2053 | Ga0207683_10043295 | |||
| 2054 | Ga0207683_10078094 | |||
| 2055 | Ga0207683_10367239 | |||
| 2056 | Ga0207683_10447707 | |||
| 2057 | Ga0207683_10966109 | |||
| 2058 | Ga0207698_10087931 | |||
| 2059 | Ga0207698_10095007 | |||
| 2060 | Ga0207698_10168466 | |||
| 2061 | Ga0207698_10476952 | |||
| 2062 | Ga0207698_11593173 | |||
| 2063 | Ga0207428_10126040 | |||
| 2064 | Ga0207428_10353969 | |||
| 2065 | Ga0268266_10243689 | |||
| 2066 | Ga0268266_10340379 | |||
| 2067 | Ga0268264_10105830 | |||
| 2068 | Ga0265319_1036087 | |||
| 2069 | Ga0265334_10013764 | |||
| 2070 | Ga0265318_10034636 | |||
| 2071 | Ga0265318_10048967 | |||
| 2072 | Ga0265318_10085300 | |||
| 2073 | Ga0265318_10265370 | |||
| 2074 | Ga0265322_10006559 | |||
| 2075 | Ga0265336_10043071 | |||
| 2076 | Ga0265338_10003455 | |||
| 2077 | Ga0265338_10021766 | |||
| 2078 | Ga0265338_10097559 | |||
| 2079 | Ga0265338_10170189 | |||
| 2080 | Ga0265338_10235934 | |||
| 2081 | Ga0265330_10064920 | |||
| 2082 | Ga0265332_10169380 | |||
| 2083 | Ga0265320_10046447 | |||
| 2084 | Ga0265320_10113644 | |||
| 2085 | Ga0265325_10074032 | |||
| 2086 | Ga0265340_10108901 | |||
| 2087 | Ga0265327_10032727 | |||
| 2088 | Ga0265327_10109439 | |||
| 2089 | Ga0265327_10150643 | |||
| 2090 | Ga0265327_10158380 | |||
| 2091 | Ga0265327_10175442 | |||
| 2092 | Ga0265327_10322355 | |||
| 2093 | Ga0307408_100092328 | |||
| 2094 | Ga0265313_10030460 | |||
| 2095 | Ga0265313_10046383 | |||
| 2096 | Ga0265314_10078607 | |||
| 2097 | Ga0265342_10079201 | |||
| 2098 | Ga0316578_10079921 | |||
| 2099 | Ga0307405_10087131 | |||
| 2100 | Ga0307413_10069267 | |||
| 2101 | Ga0307406_10080729 | |||
| 2102 | Ga0307412_10162980 | |||
| 2103 | Ga0307412_10193765 | |||
| 2104 | Ga0307409_100033256 | |||
| 2105 | Ga0307409_101151351 | |||
| 2106 | Ga0307416_100051821 | |||
| 2107 | Ga0307416_100755289 | |||
| 2108 | Ga0307414_10069628 | |||
| 2109 | Ga0307411_10012847 | |||
| 2110 | Ga0307415_100067637 | |||
| 2111 | Ga0307415_100146108 | |||
| 2112 | Ga0373930_0005814 | |||
| 2113 | Ga0373948_0104465 | |||
| 2114 | Ga0373950_0009604 | |||
| 2115 | Ga0373950_0016249 | |||
| 2116 | Ga0373958_0025873 | |||
| 2117 | Ga0373958_0043959 | |||
| 2118 | Ga0373959_0002201 | |||
| 2119 | Ga0373938_0023737 | |||
| 2120 | Ga0373928_0028951 | |||
| 2121 | Ga0373928_0058042 | |||
| 2122 | Ga0373929_0006551 | |||
| 2123 | Ga0373929_0014842 | |||
| 2124 | Ga0373940_0005134 | |||
| 2125 | Ga0373944_0048535 | |||
| 2126 | Ga0373949_0031119 | |||
| 2127 | Ga0373951_0014437 | |||
| 2128 | Ga0373952_0006790 | |||
| 2129 | Ga0373932_0024602 | |||
| 2130 | Ga0373936_0009649 | |||
| 2131 | Ga0373936_0095529 | |||
| 2132 | Ga0373939_0006438 | |||
| 2133 | Ga0373941_0011013 | |||
| 2134 | Ga0373945_0023282 | |||
| 2135 | Ga0373945_0228957 | |||
| 2136 | Ga0373945_0233123 | |||
| 2137 | Ga0373954_0285449 | |||
| 2138 | Ga0373956_0087749 | |||
| 2139 | Ga0373956_0172945 | |||
| 2140 | Ga0373960_0016556 | |||
| 2141 | Ga0373943_0000101 | |||
| 2142 | Ga0373943_0001881 | |||
| 2143 | Ga0373943_0021015 | |||
| 2144 | Ga0373943_0210033 | |||
| 2145 | Ga0373943_0498162 | |||
| 2146 | Ga0373946_0006107 | |||
| 2147 | Ga0373946_0079806 | |||
| 2148 | Ga0373955_0224788 | |||
| 2149 | Ga0373942_0029525 | |||
| 2150 | Ga0373962_0015150 | |||
| 2151 | Ga0373962_0024930 | |||
| 2152 | Ga0316574_0788391 | |||
| 2153 | Ga0373924_0019565 | |||
| 2154 | Ga0373931_0002414 | |||
| 2155 | Ga0373931_0013901 | |||
| 2156 | Ga0373931_0201341 | |||
| 2157 | Ga0373935_0026073 | |||
| 2158 | Ga0373935_0043236 | |||
| 2159 | Ga0373927_0093584 | |||
| 2160 | Ga0373933_0074864 | |||
| 2161 | Ga0373947_0004085 | |||
| 2162 | Ga0373947_0005625 | |||
| 2163 | Ga0373947_0039963 | |||
| 2164 | Ga0373947_0278737 | |||
| 2165 | Ga0373937_0157453 | |||
| 2166 | Ga0373937_0234785 | |||
| 2167 | Ga0373937_0471658 | |||
| 2168 | Ga0373925_0001828 | |||
| 2169 | Ga0373925_0898937 | |||
| 2170 | Ga0395899_0023795 | |||
| 2171 | Ga0395899_0043135 | |||
| 2172 | Ga0395899_0050366 | |||
| 2173 | Ga0395899_0085357 | |||
| 2174 | Ga0395899_0226357 | |||
| 2175 | Ga0395899_0315209 | |||
| 2176 | Ga0395900_0012528 | |||
| 2177 | Ga0395900_0021884 | |||
| 2178 | Ga0395900_0024974 | |||
| 2179 | Ga0395900_0050336 | |||
| 2180 | Ga0395900_0053846 | |||
| 2181 | Ga0395900_0160153 | |||
| 2182 | Ga0395900_0170449 | |||
| 2183 | Ga0395900_0183364 | |||
| 2184 | Ga0395900_0184041 | |||
| 2185 | Ga0395900_0266290 | |||
| 2186 | Ga0395900_0319459 | |||
| 2187 | Ga0395900_0403876 | |||
| 2188 | Ga0395900_0750026 | |||
| 2189 | Ga0395900_0905664 | |||
| 2190 | Ga0395898_0001509 | |||
| 2191 | Ga0395898_0004411 | |||
| 2192 | Ga0395898_0009218 | |||
| 2193 | Ga0395898_0011522 | |||
| 2194 | Ga0395898_0014811 | |||
| 2195 | Ga0395898_0030302 | |||
| 2196 | Ga0395898_0091755 | |||
| 2197 | Ga0395898_0119799 | |||
| 2198 | Ga0395898_0131716 | |||
| 2199 | Ga0395898_0153557 | |||
| 2200 | Ga0395898_0190719 | |||
| 2201 | Ga0395898_0218659 | |||
| 2202 | Ga0395898_0255362 | |||
| 2203 | Ga0395898_0422585 | |||
| 2204 | Ga0395898_0442076 | |||
| 2205 | Ga0395898_0463501 | |||
| 2206 | Ga0395898_0475823 | |||
| 2207 | Ga0395898_0514709 | |||
| 2208 | Ga0395898_1172664 | |||
| 2209 | Ga0395905_0013885 | |||
| 2210 | Ga0395905_0023643 | |||
| 2211 | Ga0395905_0024003 | |||
| 2212 | Ga0395905_0045512 | |||
| 2213 | Ga0395905_0077358 | |||
| 2214 | Ga0395905_0100352 | |||
| 2215 | Ga0395905_0265388 | |||
| 2216 | Ga0395905_0579685 | |||
| 2217 | Ga0395905_0805238 | |||
| 2218 | Ga0436364_0115954 | |||
| 2219 | Ga0436364_0194867 | |||
| 2220 | Ga0436364_0454997 | |||
| 2221 | Ga0436364_0781557 | |||
| 2222 | Ga0436364_0782464 | |||
| 2223 | Ga0436364_0797529 | |||
| 2224 | Ga0436364_0808770 | |||
| 2225 | Ga0436364_1289981 | |||
| 2226 | Ga0436364_1386615 | |||
| 2227 | Ga0395901_0009334 | |||
| 2228 | Ga0395901_0014373 | |||
| 2229 | Ga0395901_0049218 | |||
| 2230 | Ga0395901_0064947 | |||
| 2231 | Ga0395901_0120252 | |||
| 2232 | Ga0395901_0143089 | |||
| 2233 | Ga0395901_0159762 | |||
| 2234 | Ga0395901_0175737 | |||
| 2235 | Ga0395901_0235390 | |||
| 2236 | Ga0395901_0299523 | |||
| 2237 | Ga0395901_0301484 | |||
| 2238 | Ga0395901_0313827 | |||
| 2239 | Ga0395901_0325207 | |||
| 2240 | Ga0395901_0370419 | |||
| 2241 | Ga0395901_0552976 | |||
| 2242 | Ga0395901_0576038 | |||
| 2243 | Ga0395901_1025653 | |||
| 2244 | Ga0436365_0134395 | |||
| 2245 | Ga0436365_0215850 | |||
| 2246 | Ga0436365_0383848 | |||
| 2247 | Ga0436365_0704133 | |||
| 2248 | Ga0436365_1199523 | |||
| 2249 | Ga0436365_1294004 | |||
| 2250 | Ga0436365_1682359 | |||
| 2251 | Ga0436363_0231463 | |||
| 2252 | Ga0436363_0236348 | |||
| 2253 | Ga0436363_0256593 | |||
| 2254 | Ga0436363_1280299 | |||
| 2255 | Ga0436363_1329980 | |||
| 2256 | Ga0436363_1583354 | |||
| 2257 | Ga0436362_1191867 | |||
| 2258 | Ga0439466_0087321 | |||
| 2259 | Ga0451793_0532612 | |||
| 2260 | Ga0451798_0213579 | |||
| 2261 | Ga0451802_1758706 | |||
| 2262 | Ga0451853_2291318 | |||
| 2263 | Ga0439431_0006790 | |||
| 2264 | Ga0439442_001423 | |||
| 2265 | Ga0439445_0023401 | |||
| 2266 | Ga0439448_0034190 | |||
| 2267 | Ga0439448_0119313 | |||
| 2268 | Ga0439432_172786 | |||
| 2269 | Ga0439449_0107835 | |||
| 2270 | Ga0439451_005274 | |||
| 2271 | Ga0439454_027757 | |||
| 2272 | Ga0439462_0012923 | |||
| 2273 | Ga0450920_010083 | |||
| 2274 | Ga0450923_007398 | |||
| 2275 | Ga0450896_039167 | |||
| 2276 | Ga0450900_041346 | |||
| 2277 | Ga0439434_0059462 | |||
| 2278 | Ga0450901_015700 | |||
| 2279 | Ga0451577_0250854 | |||
| 2280 | Ga0466969_0021862 | |||
| 2281 | Ga0466969_0304967 | |||
| 2282 | Ga0466965_0162990 | |||
| 2283 | Ga0466966_0006668 | |||
| 2284 | Ga0466966_0008410 | |||
| 2285 | Ga0466966_0097901 | |||
| 2286 | Ga0466966_0503824 | |||
| 2287 | Ga0466961_0002717 | |||
| 2288 | Ga0466961_0012197 | |||
| 2289 | Ga0466961_0019467 | |||
| 2290 | Ga0466961_0026671 | |||
| 2291 | Ga0466961_0080613 | |||
| 2292 | Ga0466961_0083598 | |||
| 2293 | Ga0466963_0000059 | |||
| 2294 | Ga0466963_0003862 | |||
| 2295 | Ga0466963_0004394 | |||
| 2296 | Ga0466963_0011736 | |||
| 2297 | Ga0466963_0019426 | |||
| 2298 | Ga0466963_0019800 | |||
| 2299 | Ga0466963_0022077 | |||
| 2300 | Ga0466963_0028017 | |||
| 2301 | Ga0466963_0030410 | |||
| 2302 | Ga0466963_0036391 | |||
| 2303 | Ga0466963_0045020 | |||
| 2304 | Ga0466963_0108740 | |||
| 2305 | Ga0466963_0153419 | |||
| 2306 | Ga0466963_0289916 | |||
| 2307 | Ga0466963_0308437 | |||
| 2308 | Ga0466963_0326204 | |||
| 2309 | Ga0466963_0667407 | |||
| 2310 | Ga0466964_0002916 | |||
| 2311 | Ga0466964_0002988 | |||
| 2312 | Ga0466964_0009352 | |||
| 2313 | Ga0466964_0009904 | |||
| 2314 | Ga0466964_0017077 | |||
| 2315 | Ga0466964_0069891 | |||
| 2316 | Ga0466964_0288620 | |||
| 2317 | Ga0453684_0927053 | |||
| 2318 | Ga0466971_0000282 | |||
| 2319 | Ga0466971_0009074 | |||
| 2320 | Ga0466971_0021690 | |||
| 2321 | Ga0466971_0038542 | |||
| 2322 | Ga0466971_0141192 | |||
| 2323 | Ga0466968_0010810 | |||
| 2324 | Ga0466968_0369995 | |||
| 2325 | Ga0466970_0350280 | |||
| 2326 | Ga0466970_0465361 | |||
| 2327 | Ga0466957_0002174 | |||
| 2328 | Ga0466957_0004563 | |||
| 2329 | Ga0466957_0034703 | |||
| 2330 | Ga0466957_0046870 | |||
| 2331 | Ga0466957_0047874 | |||
| 2332 | Ga0466957_0119300 | |||
| 2333 | Ga0466957_0129054 | |||
| 2334 | Ga0466957_0291007 | |||
| 2335 | Ga0466960_0015647 | |||
| 2336 | Ga0466959_0007644 | |||
| 2337 | Ga0466959_0034408 | |||
| 2338 | Ga0466959_0046436 | |||
| 2339 | Ga0466959_0083028 | |||
| 2340 | Ga0466959_0091600 | |||
| 2341 | Ga0466959_0097862 | |||
| 2342 | Ga0466959_0113114 | |||
| 2343 | Ga0466959_0252740 | |||
| 2344 | Ga0451576_0242555 | |||
| 2345 | Ga0466958_0004124 | |||
| 2346 | Ga0466958_0010875 | |||
| 2347 | Ga0466958_0011292 | |||
| 2348 | Ga0466958_0012056 | |||
| 2349 | Ga0466958_0016134 | |||
| 2350 | Ga0466958_0019424 | |||
| 2351 | Ga0466958_0038335 | |||
| 2352 | Ga0466958_0052894 | |||
| 2353 | Ga0466958_0122597 | |||
| 2354 | Ga0466958_0167046 | |||
| 2355 | Ga0466958_0223008 | |||
| 2356 | Ga0466958_0288138 | |||
| 2357 | Ga0466967_0000305 | |||
| 2358 | Ga0466967_0010340 | |||
| 2359 | Ga0466967_0015053 | |||
| 2360 | Ga0466967_0022022 | |||
| 2361 | Ga0466967_0026965 | |||
| 2362 | Ga0466967_0036019 | |||
| 2363 | Ga0466967_0047524 | |||
| 2364 | Ga0466967_0051218 | |||
| 2365 | Ga0466967_0064739 | |||
| 2366 | Ga0466967_0077440 | |||
| 2367 | Ga0466967_0100424 | |||
| 2368 | Ga0466967_0109764 | |||
| 2369 | Ga0466967_0114041 | |||
| 2370 | Ga0466967_0125131 | |||
| 2371 | Ga0466967_0169777 | |||
| 2372 | Ga0466967_0201452 | |||
| 2373 | Ga0466967_0275540 | |||
| 2374 | Ga0466967_0334276 | |||
| 2375 | Ga0466967_0338128 | |||
| 2376 | Ga0466967_0374137 | |||
| 2377 | Ga0466967_0437090 | |||
| 2378 | Ga0466967_0446117 | |||
| 2379 | Ga0466967_0449371 | |||
| 2380 | Ga0466967_0473827 | |||
| 2381 | Ga0466967_0580006 | |||
| 2382 | Ga0466967_0751590 | |||
| 2383 | Ga0466967_1043283 | |||
| 2384 | Ga0466967_1046317 | |||
| 2385 | Ga0495592_0020890 | |||
| 2386 | Ga0495592_0079525 | |||
| 2387 | Ga0495592_0149894 | |||
| 2388 | Ga0495603_0017131 | |||
| 2389 | Ga0495603_0041553 | |||
| 2390 | Ga0495629_0036163 | |||
| 2391 | Ga0495629_0065495 | |||
| 2392 | Ga0495641_0000374 | |||
| 2393 | Ga0495641_0018087 | |||
| 2394 | Ga0495641_0021229 | |||
| 2395 | Ga0495641_0028226 | |||
| 2396 | Ga0495641_0067876 | |||
| 2397 | Ga0495641_0236973 | |||
| 2398 | Ga0495641_0313605 | |||
| 2399 | Ga0495651_0018440 | |||
| 2400 | Ga0495651_0028003 | |||
| 2401 | Ga0495651_0071904 | |||
| 2402 | Ga0495651_0373706 | |||
| 2403 | Ga0495653_0015646 | |||
| 2404 | Ga0495653_0115384 | |||
| 2405 | Ga0495653_0202595 | |||
| 2406 | Ga0495653_0213398 | |||
| 2407 | Ga0495653_0459145 | |||
| 2408 | Ga0495580_0689370 | |||
| 2409 | Ga0495582_0000124 | |||
| 2410 | Ga0495582_0057505 | |||
| 2411 | Ga0495582_0058377 | |||
| 2412 | Ga0495605_0054425 | |||
| 2413 | Ga0495639_0000786 | |||
| 2414 | Ga0495662_0000898 | |||
| 2415 | Ga0495662_0449519 | |||
| 2416 | Ga0495664_0018607 | |||
| 2417 | Ga0495664_0035313 | |||
| 2418 | Ga0495664_0097484 | |||
| 2419 | Ga0495584_0075372 | |||
| 2420 | Ga0495584_0163708 | |||
| 2421 | Ga0495584_0227236 | |||
| 2422 | Ga0495585_0139257 | |||
| 2423 | Ga0495596_0086496 | |||
| 2424 | Ga0495596_0160800 | |||
| 2425 | Ga0495596_0164174 | |||
| 2426 | Ga0495596_0267425 | |||
| 2427 | Ga0495608_0010122 | |||
| 2428 | Ga0495608_0029476 | |||
| 2429 | Ga0495608_0117276 | |||
| 2430 | Ga0495608_0127601 | |||
| 2431 | Ga0495608_0279134 | |||
| 2432 | Ga0495628_0033834 | |||
| 2433 | Ga0495628_0105848 | |||
| 2434 | Ga0495628_0443940 | |||
| 2435 | Ga0495630_0029084 | |||
| 2436 | Ga0495630_0056130 | |||
| 2437 | Ga0495630_0065190 | |||
| 2438 | Ga0495630_0110340 | |||
| 2439 | Ga0495630_0158586 | |||
| 2440 | Ga0495630_0699481 | |||
| 2441 | Ga0495631_0030977 | |||
| 2442 | Ga0495666_0063979 | |||
| 2443 | Ga0495652_0095351 | |||
| 2444 | Ga0495652_0142057 | |||
| 2445 | Ga0495652_0183576 | |||
| 2446 | Ga0495652_0247313 | |||
| 2447 | Ga0495652_0461436 | |||
| 2448 | Ga0495654_0233464 | |||
| 2449 | Ga0495665_0086623 | |||
| 2450 | Ga0495665_0149299 | |||
| 2451 | Ga0495640_0019423 | |||
| 2452 | Ga0495640_0070726 | |||
| 2453 | Ga0495640_0090361 | |||
| 2454 | Ga0495640_0266169 | |||
| 2455 | Ga0495586_0011690 | |||
| 2456 | Ga0495586_0252818 | |||
| 2457 | Ga0495587_0082758 | |||
| 2458 | Ga0495587_0098432 | |||
| 2459 | Ga0495598_0075635 | |||
| 2460 | Ga0495598_0112075 | |||
| 2461 | Ga0495609_0112922 | |||
| 2462 | Ga0495645_0102912 | |||
| 2463 | Ga0495645_0448240 | |||
| 2464 | Ga0495645_0478659 | |||
| 2465 | Ga0495667_0002397 | |||
| 2466 | Ga0495667_0020012 | |||
| 2467 | Ga0495667_0045214 | |||
| 2468 | Ga0495667_0054820 | |||
| 2469 | Ga0495667_0082516 | |||
| 2470 | Ga0495667_0085109 | |||
| 2471 | Ga0495667_0093105 | |||
| 2472 | Ga0495656_0034981 | |||
| 2473 | Ga0495656_0056688 | |||
| 2474 | Ga0495656_0460982 | |||
| 2475 | Ga0495634_0008524 | |||
| 2476 | Ga0495634_0048048 | |||
| 2477 | Ga0495634_0075065 | |||
| 2478 | Ga0495634_0143878 | |||
| 2479 | Ga0495634_0179096 | |||
| 2480 | Ga0495634_0452405 | |||
| 2481 | Ga0495611_0143235 | |||
| 2482 | Ga0495635_0020039 | |||
| 2483 | Ga0495635_0036436 | |||
| 2484 | Ga0495635_0088626 | |||
| 2485 | Ga0495635_0531300 | |||
| 2486 | Ga0495659_0067275 | |||
| 2487 | Ga0495659_0246787 | |||
| 2488 | Ga0495661_0205703 | |||
| 2489 | Ga0495657_0011624 | |||
| 2490 | Ga0495657_0019426 | |||
| 2491 | Ga0495657_0028795 | |||
| 2492 | Ga0495657_0199563 | |||
| 2493 | Ga0495599_0072964 | |||
| 2494 | Ga0495599_0092733 | |||
| 2495 | Ga0495623_0030274 | |||
| 2496 | Ga0495646_0035388 | |||
| 2497 | Ga0495647_0004080 | |||
| 2498 | Ga0495647_0036519 | |||
| 2499 | Ga0495647_0073793 | |||
| 2500 | Ga0495658_0000247 | |||
| 2501 | Ga0495658_0027012 | |||
| 2502 | Ga0495658_0032563 | |||
| 2503 | Ga0495658_0070745 | |||
| 2504 | Ga0495658_0582563 | |||
| 2505 | Ga0495613_0013675 | |||
| 2506 | Ga0495613_0030117 | |||
| 2507 | Ga0495613_0032931 | |||
| 2508 | Ga0495613_0060816 | |||
| 2509 | Ga0495624_0010741 | |||
| 2510 | Ga0495624_0109848 | |||
| 2511 | Ga0495624_0183656 | |||
| 2512 | Ga0495670_0146774 | |||
| 2513 | Ga0495671_0448624 | |||
| 2514 | Ga0495589_0013425 | |||
| 2515 | Ga0495589_0208818 | |||
| 2516 | Ga0495600_0017559 | |||
| 2517 | Ga0495600_0059533 | |||
| 2518 | Ga0495600_0073141 | |||
| 2519 | Ga0495600_0088693 | |||
| 2520 | Ga0495581_0002147 | |||
| 2521 | Ga0495581_0003701 | |||
| 2522 | Ga0495581_0116740 | |||
| 2523 | Ga0495604_0016420 | |||
| 2524 | Ga0495604_0033832 | |||
| 2525 | Ga0495604_0259618 | |||
| 2526 | Ga0495604_0570929 | |||
| 2527 | Ga0495636_0144749 | |||
| 2528 | Ga0495674_0003941 | |||
| 2529 | Ga0495674_0019510 | |||
| 2530 | Ga0495674_0045864 | |||
| 2531 | Ga0495674_0055315 | |||
| 2532 | Ga0495674_0129472 | |||
| 2533 | Ga0495674_0539616 | |||
| 2534 | Ga0495676_0001077 | |||
| 2535 | Ga0495680_0003636 | |||
| 2536 | Ga0495680_0006023 | |||
| 2537 | Ga0495680_0011046 | |||
| 2538 | Ga0495680_0011579 | |||
| 2539 | Ga0495680_0024182 | |||
| 2540 | Ga0495680_0036742 | |||
| 2541 | Ga0495680_0043068 | |||
| 2542 | Ga0495680_0655613 | |||
| 2543 | Ga0495675_0204003 | |||
| 2544 | Ga0495685_010607 | |||
| 2545 | Ga0495684_0001855 | |||
| 2546 | Ga0495684_0018726 | |||
| 2547 | Ga0495684_0083411 | |||
| 2548 | Ga0495684_0456493 | |||
| 2549 | Ga0495593_0012759 | |||
| 2550 | Ga0495593_0129579 | |||
| 2551 | Ga0495593_0509422 | |||
| 2552 | Ga0495602_0122289 | |||
| 2553 | Ga0495602_0141061 | |||
| 2554 | Ga0495602_0193124 | |||
| 2555 | Ga0495602_0351718 | |||
| 2556 | Ga0495614_0013434 | |||
| 2557 | Ga0495614_0074716 | |||
| 2558 | Ga0495626_0327940 | |||
| 2559 | Ga0496100_0001575 | |||
| 2560 | Ga0496100_0004851 | |||
| 2561 | Ga0496100_0010229 | |||
| 2562 | Ga0496100_0031775 | |||
| 2563 | Ga0496100_0050817 | |||
| 2564 | Ga0496100_0063034 | |||
| 2565 | Ga0496100_0071371 | |||
| 2566 | Ga0496100_0298960 | |||
| 2567 | Ga0496101_0008696 | |||
| 2568 | Ga0496101_0008763 | |||
| 2569 | Ga0496101_0012134 | |||
| 2570 | Ga0496101_0012361 | |||
| 2571 | Ga0496101_0013813 | |||
| 2572 | Ga0496101_0019837 | |||
| 2573 | Ga0496101_0045876 | |||
| 2574 | Ga0496101_0047758 | |||
| 2575 | Ga0496101_0058115 | |||
| 2576 | Ga0496101_0163427 | |||
| 2577 | Ga0496101_0239783 | |||
| 2578 | Ga0496101_0330518 | |||
| 2579 | Ga0496102_0022630 | |||
| 2580 | Ga0496102_0025083 | |||
| 2581 | Ga0496102_0062684 | |||
| 2582 | Ga0496102_0078547 | |||
| 2583 | Ga0496102_0134649 | |||
| 2584 | Ga0496102_0340261 | |||
| 2585 | Ga0496102_0417329 | |||
| 2586 | Ga0496102_0433547 | |||
| 2587 | Ga0496102_0533133 | |||
| 2588 | Ga0496102_0859873 | |||
| 2589 | Ga0496103_0001779 | |||
| 2590 | Ga0496103_0008609 | |||
| 2591 | Ga0496103_0031043 | |||
| 2592 | Ga0496103_0067695 | |||
| 2593 | Ga0496103_0071012 | |||
| 2594 | Ga0496103_0095128 | |||
| 2595 | Ga0496103_0309879 | |||
| 2596 | Ga0496104_0001048 | |||
| 2597 | Ga0496104_0007716 | |||
| 2598 | Ga0496104_0015097 | |||
| 2599 | Ga0496104_0033101 | |||
| 2600 | Ga0496104_0047160 | |||
| 2601 | Ga0496104_0066799 | |||
| 2602 | Ga0496104_0083771 | |||
| 2603 | Ga0496104_0089440 | |||
| 2604 | Ga0496104_0136449 | |||
| 2605 | Ga0496104_0223494 | |||
| 2606 | Ga0496104_0318189 | |||
| 2607 | Ga0496104_0485247 | |||
| 2608 | Ga0496104_0693881 | |||
| 2609 | Ga0496105_0000594 | |||
| 2610 | Ga0496105_0008293 | |||
| 2611 | Ga0496105_0011620 | |||
| 2612 | Ga0496105_0028970 | |||
| 2613 | Ga0496105_0034310 | |||
| 2614 | Ga0496105_0196894 | |||
| 2615 | Ga0496105_0207161 | |||
| 2616 | Ga0496105_0221655 | |||
| 2617 | Ga0496105_0430638 | |||
| 2618 | Ga0496105_0534426 | |||
| 2619 | Ga0496105_0748640 | |||
| 2620 | Ga0496106_0005956 | |||
| 2621 | Ga0496106_0008187 | |||
| 2622 | Ga0496106_0017922 | |||
| 2623 | Ga0496106_0060221 | |||
| 2624 | Ga0496106_0116498 | |||
| 2625 | Ga0496106_0123807 | |||
| 2626 | Ga0496106_0176793 | |||
| 2627 | Ga0496106_0218441 | |||
| 2628 | Ga0496107_0008399 | |||
| 2629 | Ga0496107_0022298 | |||
| 2630 | Ga0496107_0045134 | |||
| 2631 | Ga0496107_0057051 | |||
| 2632 | Ga0496107_0063540 | |||
| 2633 | Ga0496107_0073243 | |||
| 2634 | Ga0496107_0092030 | |||
| 2635 | Ga0496107_0130800 | |||
| 2636 | Ga0496107_0132341 | |||
| 2637 | Ga0496107_0207827 | |||
| 2638 | Ga0496107_0215561 | |||
| 2639 | Ga0496107_0998163 | |||
| 2640 | Ga0496108_0010409 | |||
| 2641 | Ga0496108_0028066 | |||
| 2642 | Ga0496108_0043824 | |||
| 2643 | Ga0496108_0054227 | |||
| 2644 | Ga0496108_0152331 | |||
| 2645 | Ga0496108_0166988 | |||
| 2646 | Ga0496108_0179769 | |||
| 2647 | Ga0496108_0195527 | |||
| 2648 | Ga0496108_0239354 | |||
| 2649 | Ga0496108_0268424 | |||
| 2650 | Ga0496108_0359734 | |||
| 2651 | Ga0496108_0503215 | |||
| 2652 | Ga0496109_0000463 | |||
| 2653 | Ga0496109_0000626 | |||
| 2654 | Ga0496109_0007742 | |||
| 2655 | Ga0496109_0014816 | |||
| 2656 | Ga0496109_0017699 | |||
| 2657 | Ga0496109_0019196 | |||
| 2658 | Ga0496109_0025337 | |||
| 2659 | Ga0496109_0030300 | |||
| 2660 | Ga0496109_0069220 | |||
| 2661 | Ga0496109_0090622 | |||
| 2662 | Ga0496109_0144527 | |||
| 2663 | Ga0496110_0000261 | |||
| 2664 | Ga0496110_0000563 | |||
| 2665 | Ga0496110_0007165 | |||
| 2666 | Ga0496110_0040043 | |||
| 2667 | Ga0496110_0043948 | |||
| 2668 | Ga0496110_0064621 | |||
| 2669 | Ga0496110_0085095 | |||
| 2670 | Ga0496110_0119476 | |||
| 2671 | Ga0496110_0143916 | |||
| 2672 | Ga0496110_0148286 | |||
| 2673 | Ga0496110_0333783 | |||
| 2674 | Ga0496111_0000086 | |||
| 2675 | Ga0496111_0007281 | |||
| 2676 | Ga0496111_0010323 | |||
| 2677 | Ga0496111_0010595 | |||
| 2678 | Ga0496111_0011426 | |||
| 2679 | Ga0496111_0019287 | |||
| 2680 | Ga0496111_0028408 | |||
| 2681 | Ga0496111_0186871 | |||
| 2682 | Ga0496111_0207041 | |||
| 2683 | Ga0496111_0224287 | |||
| 2684 | Ga0496111_0401437 | |||
| 2685 | Ga0496111_0404763 | |||
| 2686 | Ga0496111_0898674 | |||
| 2687 | Ga0496112_0001342 | |||
| 2688 | Ga0496112_0016569 | |||
| 2689 | Ga0496112_0021620 | |||
| 2690 | Ga0496112_0026894 | |||
| 2691 | Ga0496112_0069713 | |||
| 2692 | Ga0496112_0093840 | |||
| 2693 | Ga0496112_0098797 | |||
| 2694 | Ga0496112_0101201 | |||
| 2695 | Ga0496112_0102144 | |||
| 2696 | Ga0496112_0163385 | |||
| 2697 | Ga0496112_0264712 | |||
| 2698 | Ga0496112_0269566 | |||
| 2699 | Ga0496112_0467710 | |||
| 2700 | Ga0496113_0031311 | |||
| 2701 | Ga0496113_0131667 | |||
| 2702 | Ga0496113_0174406 | |||
| 2703 | Ga0496113_0235834 | |||
| 2704 | Ga0496113_0417764 | |||
| 2705 | Ga0496113_0756536 | |||
| 2706 | Ga0496114_0000690 | |||
| 2707 | Ga0496114_0001536 | |||
| 2708 | Ga0496114_0005912 | |||
| 2709 | Ga0496114_0012463 | |||
| 2710 | Ga0496114_0025920 | |||
| 2711 | Ga0496114_0082308 | |||
| 2712 | Ga0496114_0112077 | |||
| 2713 | Ga0496114_0120255 | |||
| 2714 | Ga0496114_0143607 | |||
| 2715 | Ga0496114_0171994 | |||
| 2716 | Ga0496114_0236509 | |||
| 2717 | Ga0496114_0243561 | |||
| 2718 | Ga0496114_0267917 | |||
| 2719 | Ga0496114_0280685 | |||
| 2720 | Ga0496114_0468153 | |||
| 2721 | Ga0496115_0006958 | |||
| 2722 | Ga0496115_0007667 | |||
| 2723 | Ga0496115_0016034 | |||
| 2724 | Ga0496115_0018068 | |||
| 2725 | Ga0496115_0027148 | |||
| 2726 | Ga0496115_0058268 | |||
| 2727 | Ga0496115_0082715 | |||
| 2728 | Ga0496115_0092031 | |||
| 2729 | Ga0496115_0100540 | |||
| 2730 | Ga0496115_0145234 | |||
| 2731 | Ga0496115_0247414 | |||
| 2732 | Ga0496115_0493115 | |||
| 2733 | Ga0496115_0624375 | |||
| 2734 | Ga0496115_1034297 | |||
| 2735 | Ga0496117_0252066 | |||
| 2736 | Ga0496121_0003393 | |||
| 2737 | Ga0496124_0505940 | |||
| 2738 | Ga0501291_084244 | |||
| 2739 | Ga0501031_0099378 | |||
| 2740 | Ga0501031_0166086 | |||
| 2741 | Ga0501034_0226976 | |||
| 2742 | Ga0501034_0338464 | |||
| 2743 | Ga0501036_0077748 | |||
| 2744 | Ga0501036_0160571 | |||
| 2745 | Ga0501037_0281347 | |||
| 2746 | Ga0501038_0295193 | |||
| 2747 | Ga0501039_0520329 | |||
| 2748 | Ga0501040_0032001 | |||
| 2749 | Ga0501040_0048507 | |||
| 2750 | Ga0501040_0120582 | |||
| 2751 | Ga0501040_0390345 | |||
| 2752 | Ga0501041_0039695 | |||
| 2753 | Ga0501042_0037687 | |||
| 2754 | Ga0501042_0074800 | |||
| 2755 | Ga0501042_0450307 | |||
| 2756 | Ga0501042_0678103 | |||
| 2757 | Ga0501046_0894120 | |||
| 2758 | Ga0501047_0009800 | |||
| 2759 | Ga0501047_0036325 | |||
| 2760 | Ga0501047_0047876 | |||
| 2761 | Ga0501047_0191488 | |||
| 2762 | Ga0501047_0263116 | |||
| 2763 | Ga0501048_0390835 | |||
| 2764 | Ga0501048_0425610 | |||
| 2765 | Ga0501067_0000684 | |||
| 2766 | Ga0501067_0040552 | |||
| 2767 | Ga0501067_0317318 | |||
| 2768 | Ga0501068_0150831 | |||
| 2769 | Ga0501068_0176248 | |||
| 2770 | Ga0501069_0085031 | |||
| 2771 | Ga0501069_0116351 | |||
| 2772 | Ga0501069_0278579 | |||
| 2773 | Ga0501070_0000187 | |||
| 2774 | Ga0501070_0059846 | |||
| 2775 | Ga0501070_0535568 | |||
| 2776 | Ga0501071_0010601 | |||
| 2777 | Ga0501072_0072510 | |||
| 2778 | Ga0501072_0114723 | |||
| 2779 | Ga0501072_0345995 | |||
| 2780 | Ga0501072_0594204 | |||
| 2781 | Ga0501073_0127350 | |||
| 2782 | Ga0501073_0262784 | |||
| 2783 | Ga0501074_0039632 | |||
| 2784 | Ga0501074_0060768 | |||
| 2785 | Ga0501074_0331090 | |||
| 2786 | Ga0501075_0046587 | |||
| 2787 | Ga0501075_0080494 | |||
| 2788 | Ga0501075_0593028 | |||
| 2789 | Ga0501076_0178512 | |||
| 2790 | Ga0501076_0397722 | |||
| 2791 | Ga0501077_0199407 | |||
| 2792 | Ga0501079_0304870 | |||
| 2793 | Ga0501080_0085748 | |||
| 2794 | Ga0501080_0233888 | |||
| 2795 | Ga0501080_0316842 | |||
| 2796 | Ga0501080_0331901 | |||
| 2797 | Ga0501080_0557909 | |||
| 2798 | Ga0501080_0581692 | |||
| 2799 | Ga0501081_0098079 | |||
| 2800 | Ga0501081_0141135 | |||
| 2801 | Ga0501044_0263357 | |||
| 2802 | Ga0501045_0061091 | |||
| 2803 | Ga0501045_0090987 | |||
| 2804 | Ga0501045_0623533 | |||
| 2805 | nmdc:mga03n38_16507_c1 | |||
| 2806 | nmdc:mga00v17_307286_c1 | |||
| 2807 | nmdc:mga00v17_40795_c1 | |||
| 2808 | nmdc:mga0yw44_273565_c1 | |||
| 2809 | nmdc:mga0yw44_35012_c1 | |||
| 2810 | nmdc:mga0yw44_359720_c1 | |||
| 2811 | nmdc:mga05p37_104588_c1 | |||
| 2812 | nmdc:mga05p37_107043_c1 | |||
| 2813 | nmdc:mga05p37_175450_c1 | |||
| 2814 | nmdc:mga05p37_307137_c1 | |||
| 2815 | nmdc:mga08y16_204637_c1 | |||
| 2816 | nmdc:mga08y16_300374_c1 | |||
| 2817 | nmdc:mga08y16_44085_c1 | |||
| 2818 | nmdc:mga08y16_519535_c1 | |||
| 2819 | nmdc:mga0n895_106596_c1 | |||
| 2820 | nmdc:mga0n895_1335057_c1 | |||
| 2821 | nmdc:mga0rr50_105370_c1 | |||
| 2822 | nmdc:mga0rr50_290349_c1 | |||
| 2823 | nmdc:mga0rr50_335112_c1 | |||
| 2824 | nmdc:mga0rr50_65197_c1 | |||
| 2825 | nmdc:mga0rr50_883578_c1 | |||
| 2826 | nmdc:mga08x19_109851_c1 | |||
| 2827 | nmdc:mga08x19_603632_c1 | |||
| 2828 | nmdc:mga0a205_13182_c2 | |||
| 2829 | nmdc:mga0a205_203734_c1 | |||
| 2830 | Ga0495601_0010980 | |||
| 2831 | Ga0495601_0075514 | |||
| 2832 | Ga0495601_0081126 | |||
| 2833 | Ga0495601_0084313 | |||
| 2834 | Ga0495601_0140522 | |||
| 2835 | Ga0495601_0611532 | |||
| 2836 | Ga0495612_0059843 | |||
| 2837 | Ga0495612_0115817 | |||
| 2838 | Ga0495655_0012607 | |||
| 2839 | Ga0495595_0015142 | |||
| 2840 | Ga0495595_0018976 | |||
| 2841 | Ga0495595_0039102 | |||
| 2842 | Ga0495595_0095196 | |||
| 2843 | Ga0495619_0011353 | |||
| 2844 | Ga0495619_0032007 | |||
| 2845 | Ga0495619_0318691 | |||
| 2846 | Ga0495619_0395161 | |||
| 2847 | Ga0495619_0775516 | |||
| 2848 | Ga0501084_0059607 | |||
| 2849 | Ga0501084_0084775 | |||
| 2850 | Ga0501084_0173643 | |||
| 2851 | Ga0501084_0281472 | |||
| 2852 | Ga0590071_014593 | |||
| 2853 | Ga0590075_019535 | |||
| 2854 | Ga0501082_0017996 | |||
| 2855 | Ga0501082_0120023 | |||
| 2856 | Ga0466962_0006119 | |||
| 2857 | Ga0466962_0014815 | |||
| 2858 | Ga0466962_0017977 | |||
| 2859 | Ga0466962_0075002 | |||
| 2860 | Ga0466962_0120031 | |||
| 2861 | Ga0466962_0322235 | |||
| 2862 | Ga0466962_0368673 | |||
| 2863 | Ga0530510_0061846 | |||
| 2864 | Ga0530510_0185592 | |||
| 2865 | Ga0530510_0312156 | |||
| 2866 | Ga0530510_0477903 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy