F493910
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1431 | 405 | 2862 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0085278|Ga0395899_0085278_1083_1634 |
| Length | 183 |
| Sequence | LVRIATIRARDGAFGAAFFRKKGCTHVKEVILTPEGYEKLKQEIEALSTTKRREVAERIRVAREFGDIAENAEYDDAKNEQMLLEHRIATLEERLRDARVISKKDIAXXVVSVGSKVKLRDVAAKETIEYHIVGSAEANPAENKLSNESPVGKAIIGHKKGETVEVTAPRGTLKFKIVEIKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 122 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 123 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 124 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 261 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 265 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 266 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 267 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 268 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 269 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 270 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 271 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 272 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 344 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 345 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 357 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 10.06 |
| Rhizosphere | 89.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0085278 | 3300037312 | Bacteria | 2295 |
| 2 | ARCol0yngRDRAFT_1007316 | 3300000652 | Bacteria | 794 |
| 3 | JGI24743J22301_10098292 | 3300001991 | Bacteria | 629 |
| 4 | JGI24738J21930_10024965 | 3300002075 | Bacteria | 1229 |
| 5 | JGI24738J21930_10029631 | 3300002075 | Bacteria | 1118 |
| 6 | JGI24744J21845_10068284 | 3300002077 | Bacteria | 649 |
| 7 | JGI24033J26618_1016728 | 3300002155 | Bacteria | 913 |
| 8 | JGI24742J22300_10020413 | 3300002244 | Bacteria | 1128 |
| 9 | JGI25406J46586_10005431 | 3300003203 | Bacteria | 5911 |
| 10 | JGI25406J46586_10047029 | 3300003203 | Bacteria | 1473 |
| 11 | JGI25407J50210_10047439 | 3300003373 | Bacteria | 1092 |
| 12 | JGI25407J50210_10146433 | 3300003373 | Bacteria | 581 |
| 13 | JGI25404J52841_10067083 | 3300003659 | Bacteria | 750 |
| 14 | JGI25404J52841_10120774 | 3300003659 | Bacteria | 552 |
| 15 | JGI25405J52794_10086632 | 3300003911 | Bacteria | 692 |
| 16 | Ga0070658_10012764 | 3300005327 | Bacteria | 6741 |
| 17 | Ga0070676_10102490 | 3300005328 | Bacteria | 1770 |
| 18 | Ga0070683_100036803 | 3300005329 | Bacteria | 4479 |
| 19 | Ga0070683_100056810 | 3300005329 | Bacteria | 3634 |
| 20 | Ga0070683_100158156 | 3300005329 | Bacteria | 2149 |
| 21 | Ga0070683_100718757 | 3300005329 | Bacteria | 957 |
| 22 | Ga0070683_100943778 | 3300005329 | Bacteria | 828 |
| 23 | Ga0070690_100086107 | 3300005330 | Bacteria | 2062 |
| 24 | Ga0070690_100118177 | 3300005330 | Bacteria | 1777 |
| 25 | Ga0070690_100165901 | 3300005330 | Bacteria | 1517 |
| 26 | Ga0070690_100356842 | 3300005330 | Bacteria | 1063 |
| 27 | Ga0070690_100392097 | 3300005330 | Bacteria | 1018 |
| 28 | Ga0070690_100574117 | 3300005330 | Bacteria | 853 |
| 29 | Ga0070670_100003102 | 3300005331 | Bacteria | 13754 |
| 30 | Ga0070670_100011984 | 3300005331 | Bacteria | 7416 |
| 31 | Ga0070670_100234593 | 3300005331 | Bacteria | 1597 |
| 32 | Ga0070670_100246306 | 3300005331 | Bacteria | 1556 |
| 33 | Ga0070670_100344675 | 3300005331 | Bacteria | 1308 |
| 34 | Ga0068869_100017707 | 3300005334 | Bacteria | 4837 |
| 35 | Ga0068869_100028022 | 3300005334 | Bacteria | 3931 |
| 36 | Ga0068869_100134212 | 3300005334 | Bacteria | 1905 |
| 37 | Ga0068869_100271562 | 3300005334 | Bacteria | 1361 |
| 38 | Ga0068869_100363982 | 3300005334 | Bacteria | 1182 |
| 39 | Ga0068869_100506279 | 3300005334 | Bacteria | 1009 |
| 40 | Ga0070680_100129890 | 3300005336 | Bacteria | 2107 |
| 41 | Ga0070680_100330571 | 3300005336 | Bacteria | 1294 |
| 42 | Ga0070680_100686812 | 3300005336 | Bacteria | 881 |
| 43 | Ga0070682_100067021 | 3300005337 | Bacteria | 2285 |
| 44 | Ga0070682_100130242 | 3300005337 | Bacteria | 1702 |
| 45 | Ga0070682_100199405 | 3300005337 | Bacteria | 1411 |
| 46 | Ga0070682_100316326 | 3300005337 | Bacteria | 1151 |
| 47 | Ga0070682_100901477 | 3300005337 | Bacteria | 727 |
| 48 | Ga0068868_100033190 | 3300005338 | Bacteria | 3977 |
| 49 | Ga0068868_100036439 | 3300005338 | Bacteria | 3807 |
| 50 | Ga0068868_100063177 | 3300005338 | Bacteria | 2937 |
| 51 | Ga0068868_100088014 | 3300005338 | Bacteria | 2499 |
| 52 | Ga0068868_100105931 | 3300005338 | Bacteria | 2280 |
| 53 | Ga0068868_100343013 | 3300005338 | Bacteria | 1278 |
| 54 | Ga0068868_100487510 | 3300005338 | Bacteria | 1078 |
| 55 | Ga0070660_100003416 | 3300005339 | Bacteria | 10923 |
| 56 | Ga0070660_100053871 | 3300005339 | Bacteria | 3104 |
| 57 | Ga0070660_100094885 | 3300005339 | Bacteria | 2357 |
| 58 | Ga0070660_100098570 | 3300005339 | Bacteria | 2313 |
| 59 | Ga0070660_100129993 | 3300005339 | Bacteria | 2014 |
| 60 | Ga0070660_100520196 | 3300005339 | Bacteria | 991 |
| 61 | Ga0070689_100034826 | 3300005340 | Bacteria | 3843 |
| 62 | Ga0070689_100037809 | 3300005340 | Bacteria | 3691 |
| 63 | Ga0070689_100194058 | 3300005340 | Bacteria | 1654 |
| 64 | Ga0070691_10012486 | 3300005341 | Bacteria | 3890 |
| 65 | Ga0070691_10024351 | 3300005341 | Bacteria | 2813 |
| 66 | Ga0070691_10055090 | 3300005341 | Bacteria | 1904 |
| 67 | Ga0070691_10122294 | 3300005341 | Bacteria | 1312 |
| 68 | Ga0070691_10315208 | 3300005341 | Bacteria | 859 |
| 69 | Ga0070687_100022454 | 3300005343 | Bacteria | 2984 |
| 70 | Ga0070687_100099590 | 3300005343 | Bacteria | 1625 |
| 71 | Ga0070661_100165963 | 3300005344 | Bacteria | 1675 |
| 72 | Ga0070661_100477099 | 3300005344 | Bacteria | 995 |
| 73 | Ga0070692_10105630 | 3300005345 | Bacteria | 1550 |
| 74 | Ga0070692_10143032 | 3300005345 | Bacteria | 1355 |
| 75 | Ga0070692_10819898 | 3300005345 | Bacteria | 637 |
| 76 | Ga0070668_100008802 | 3300005347 | Bacteria | 7497 |
| 77 | Ga0070668_100023901 | 3300005347 | Bacteria | 4627 |
| 78 | Ga0070668_100035179 | 3300005347 | Bacteria | 3819 |
| 79 | Ga0070668_100117304 | 3300005347 | Bacteria | 2124 |
| 80 | Ga0070668_100184561 | 3300005347 | Bacteria | 1706 |
| 81 | Ga0070668_100202611 | 3300005347 | Bacteria | 1629 |
| 82 | Ga0070668_100721134 | 3300005347 | Bacteria | 881 |
| 83 | Ga0070669_100069603 | 3300005353 | Bacteria | 2599 |
| 84 | Ga0070669_100102629 | 3300005353 | Bacteria | 2160 |
| 85 | Ga0070669_100585378 | 3300005353 | Bacteria | 933 |
| 86 | Ga0070669_100831493 | 3300005353 | Bacteria | 786 |
| 87 | Ga0070675_100127955 | 3300005354 | Bacteria | 2162 |
| 88 | Ga0070675_100150137 | 3300005354 | Bacteria | 1997 |
| 89 | Ga0070675_100195178 | 3300005354 | Bacteria | 1756 |
| 90 | Ga0070675_100812188 | 3300005354 | Bacteria | 855 |
| 91 | Ga0070675_101031618 | 3300005354 | Bacteria | 755 |
| 92 | Ga0070675_101154434 | 3300005354 | Bacteria | 713 |
| 93 | Ga0070671_100192052 | 3300005355 | Bacteria | 1731 |
| 94 | Ga0070671_100771837 | 3300005355 | Bacteria | 836 |
| 95 | Ga0070674_100002837 | 3300005356 | Bacteria | 9578 |
| 96 | Ga0070674_100003211 | 3300005356 | Bacteria | 9123 |
| 97 | Ga0070674_100005150 | 3300005356 | Bacteria | 7517 |
| 98 | Ga0070674_100110555 | 3300005356 | Bacteria | 2017 |
| 99 | Ga0070674_100116976 | 3300005356 | Bacteria | 1968 |
| 100 | Ga0070674_100155832 | 3300005356 | Bacteria | 1728 |
| 101 | Ga0070674_100367284 | 3300005356 | Bacteria | 1167 |
| 102 | Ga0070674_100432981 | 3300005356 | Bacteria | 1082 |
| 103 | Ga0070674_100593451 | 3300005356 | Bacteria | 935 |
| 104 | Ga0070673_100034265 | 3300005364 | Bacteria | 3840 |
| 105 | Ga0070673_100089041 | 3300005364 | Bacteria | 2519 |
| 106 | Ga0070673_100162218 | 3300005364 | Bacteria | 1902 |
| 107 | Ga0070673_101577948 | 3300005364 | Bacteria | 620 |
| 108 | Ga0070688_100010486 | 3300005365 | Bacteria | 5111 |
| 109 | Ga0070688_100014377 | 3300005365 | Bacteria | 4483 |
| 110 | Ga0070688_100247587 | 3300005365 | Bacteria | 1268 |
| 111 | Ga0070688_100254095 | 3300005365 | Bacteria | 1253 |
| 112 | Ga0070659_100007542 | 3300005366 | Bacteria | 7906 |
| 113 | Ga0070659_100056310 | 3300005366 | Bacteria | 3100 |
| 114 | Ga0070659_100061971 | 3300005366 | Bacteria | 2956 |
| 115 | Ga0070659_100101800 | 3300005366 | Bacteria | 2312 |
| 116 | Ga0070659_100175769 | 3300005366 | Bacteria | 1756 |
| 117 | Ga0070659_100283000 | 3300005366 | Bacteria | 1380 |
| 118 | Ga0070659_100686041 | 3300005366 | Bacteria | 885 |
| 119 | Ga0070667_100089326 | 3300005367 | Bacteria | 2647 |
| 120 | Ga0070667_101287804 | 3300005367 | Bacteria | 685 |
| 121 | Ga0070703_10016533 | 3300005406 | Bacteria | 2118 |
| 122 | Ga0070703_10123241 | 3300005406 | Bacteria | 943 |
| 123 | Ga0070709_10036442 | 3300005434 | Bacteria | 2996 |
| 124 | Ga0070709_10131341 | 3300005434 | Bacteria | 1710 |
| 125 | Ga0070709_10171446 | 3300005434 | Bacteria | 1516 |
| 126 | Ga0070714_100015567 | 3300005435 | Bacteria | 6119 |
| 127 | Ga0070714_100151320 | 3300005435 | Bacteria | 2091 |
| 128 | Ga0070714_101242849 | 3300005435 | Bacteria | 727 |
| 129 | Ga0070714_101889261 | 3300005435 | Bacteria | 583 |
| 130 | Ga0070713_100300116 | 3300005436 | Bacteria | 1478 |
| 131 | Ga0070710_10031988 | 3300005437 | Bacteria | 2846 |
| 132 | Ga0070710_10036978 | 3300005437 | Bacteria | 2672 |
| 133 | Ga0070710_10344604 | 3300005437 | Bacteria | 985 |
| 134 | Ga0070701_10061643 | 3300005438 | Bacteria | 1978 |
| 135 | Ga0070701_10125770 | 3300005438 | Bacteria | 1451 |
| 136 | Ga0070701_10141065 | 3300005438 | Bacteria | 1378 |
| 137 | Ga0070701_10467089 | 3300005438 | Bacteria | 813 |
| 138 | Ga0070701_10542483 | 3300005438 | Bacteria | 762 |
| 139 | Ga0070711_100020712 | 3300005439 | Bacteria | 4242 |
| 140 | Ga0070711_100115395 | 3300005439 | Bacteria | 1977 |
| 141 | Ga0070711_100271269 | 3300005439 | Bacteria | 1339 |
| 142 | Ga0070711_100294442 | 3300005439 | Bacteria | 1288 |
| 143 | Ga0070711_100385808 | 3300005439 | Bacteria | 1134 |
| 144 | Ga0070711_100599230 | 3300005439 | Bacteria | 919 |
| 145 | Ga0070705_100194153 | 3300005440 | Bacteria | 1386 |
| 146 | Ga0070705_100245355 | 3300005440 | Bacteria | 1254 |
| 147 | Ga0070705_100354537 | 3300005440 | Bacteria | 1071 |
| 148 | Ga0070705_100673169 | 3300005440 | Bacteria | 809 |
| 149 | Ga0070700_100064871 | 3300005441 | Bacteria | 2313 |
| 150 | Ga0070700_100068709 | 3300005441 | Bacteria | 2254 |
| 151 | Ga0070700_100123331 | 3300005441 | Bacteria | 1739 |
| 152 | Ga0070700_100158226 | 3300005441 | Bacteria | 1557 |
| 153 | Ga0070700_100193839 | 3300005441 | Bacteria | 1423 |
| 154 | Ga0070700_100352402 | 3300005441 | Bacteria | 1092 |
| 155 | Ga0070694_100016424 | 3300005444 | Bacteria | 4659 |
| 156 | Ga0070694_100067018 | 3300005444 | Bacteria | 2463 |
| 157 | Ga0070694_100144645 | 3300005444 | Bacteria | 1730 |
| 158 | Ga0070694_100427448 | 3300005444 | Bacteria | 1042 |
| 159 | Ga0070694_100993179 | 3300005444 | Bacteria | 696 |
| 160 | Ga0070708_100045730 | 3300005445 | Bacteria | 3858 |
| 161 | Ga0070708_100150463 | 3300005445 | Bacteria | 2164 |
| 162 | Ga0070708_100169739 | 3300005445 | Bacteria | 2036 |
| 163 | Ga0070708_100272667 | 3300005445 | Bacteria | 1591 |
| 164 | Ga0070708_100380477 | 3300005445 | Bacteria | 1331 |
| 165 | Ga0070708_100902686 | 3300005445 | Unclassified | 829 |
| 166 | Ga0070663_100161390 | 3300005455 | Bacteria | 1725 |
| 167 | Ga0070663_100253808 | 3300005455 | Bacteria | 1393 |
| 168 | Ga0070663_100275742 | 3300005455 | Bacteria | 1338 |
| 169 | Ga0070663_100407605 | 3300005455 | Bacteria | 1112 |
| 170 | Ga0070678_100046653 | 3300005456 | Bacteria | 3109 |
| 171 | Ga0070678_100195056 | 3300005456 | Bacteria | 1667 |
| 172 | Ga0070678_100258067 | 3300005456 | Bacteria | 1464 |
| 173 | Ga0070678_100277580 | 3300005456 | Bacteria | 1416 |
| 174 | Ga0070678_100283066 | 3300005456 | Bacteria | 1403 |
| 175 | Ga0070678_100800478 | 3300005456 | Bacteria | 856 |
| 176 | Ga0070678_101365946 | 3300005456 | Bacteria | 661 |
| 177 | Ga0070662_100020948 | 3300005457 | Bacteria | 4459 |
| 178 | Ga0070662_100024496 | 3300005457 | Bacteria | 4158 |
| 179 | Ga0070662_100081598 | 3300005457 | Bacteria | 2410 |
| 180 | Ga0070662_100107635 | 3300005457 | Bacteria | 2119 |
| 181 | Ga0070662_100321113 | 3300005457 | Bacteria | 1262 |
| 182 | Ga0070662_100401268 | 3300005457 | Bacteria | 1132 |
| 183 | Ga0070662_100434494 | 3300005457 | Bacteria | 1088 |
| 184 | Ga0070681_10078887 | 3300005458 | Bacteria | 3249 |
| 185 | Ga0070681_10084272 | 3300005458 | Bacteria | 3131 |
| 186 | Ga0068867_100043441 | 3300005459 | Bacteria | 3290 |
| 187 | Ga0068867_100053243 | 3300005459 | Bacteria | 2989 |
| 188 | Ga0068867_100088986 | 3300005459 | Bacteria | 2341 |
| 189 | Ga0068867_100095339 | 3300005459 | Bacteria | 2264 |
| 190 | Ga0068867_100216070 | 3300005459 | Bacteria | 1542 |
| 191 | Ga0068867_100279417 | 3300005459 | Bacteria | 1369 |
| 192 | Ga0068867_100280288 | 3300005459 | Bacteria | 1367 |
| 193 | Ga0068867_100292442 | 3300005459 | Bacteria | 1340 |
| 194 | Ga0068867_101345094 | 3300005459 | Bacteria | 661 |
| 195 | Ga0070685_10004294 | 3300005466 | Bacteria | 7194 |
| 196 | Ga0070685_10445953 | 3300005466 | Bacteria | 906 |
| 197 | Ga0070685_10905208 | 3300005466 | Bacteria | 657 |
| 198 | Ga0070706_100052019 | 3300005467 | Bacteria | 3781 |
| 199 | Ga0070706_100053033 | 3300005467 | Bacteria | 3742 |
| 200 | Ga0070706_100093204 | 3300005467 | Bacteria | 2794 |
| 201 | Ga0070706_100183580 | 3300005467 | Bacteria | 1954 |
| 202 | Ga0070706_100219495 | 3300005467 | Bacteria | 1775 |
| 203 | Ga0070706_100429968 | 3300005467 | Bacteria | 1229 |
| 204 | Ga0070707_100251581 | 3300005468 | Unclassified | 1720 |
| 205 | Ga0070707_100432889 | 3300005468 | Unclassified | 1276 |
| 206 | Ga0070707_100612050 | 3300005468 | Bacteria | 1052 |
| 207 | Ga0070698_100005110 | 3300005471 | Bacteria | 14361 |
| 208 | Ga0070698_100037645 | 3300005471 | Bacteria | 4987 |
| 209 | Ga0070699_100017154 | 3300005518 | Bacteria | 6218 |
| 210 | Ga0070699_100270836 | 3300005518 | Bacteria | 1520 |
| 211 | Ga0070699_100624051 | 3300005518 | Bacteria | 983 |
| 212 | Ga0070699_100792020 | 3300005518 | Bacteria | 867 |
| 213 | Ga0070679_100047580 | 3300005530 | Bacteria | 4274 |
| 214 | Ga0070679_100064914 | 3300005530 | Bacteria | 3639 |
| 215 | Ga0070679_100111231 | 3300005530 | Bacteria | 2725 |
| 216 | Ga0070679_100209256 | 3300005530 | Bacteria | 1915 |
| 217 | Ga0070679_100370220 | 3300005530 | Bacteria | 1380 |
| 218 | Ga0070679_100474268 | 3300005530 | Bacteria | 1196 |
| 219 | Ga0070684_100004647 | 3300005535 | Bacteria | 10478 |
| 220 | Ga0070684_100007114 | 3300005535 | Bacteria | 8695 |
| 221 | Ga0070684_100012867 | 3300005535 | Bacteria | 6724 |
| 222 | Ga0070684_100066667 | 3300005535 | Bacteria | 3160 |
| 223 | Ga0070684_100099760 | 3300005535 | Bacteria | 2592 |
| 224 | Ga0070684_100103888 | 3300005535 | Bacteria | 2542 |
| 225 | Ga0070684_100270832 | 3300005535 | Bacteria | 1554 |
| 226 | Ga0070684_100494889 | 3300005535 | Bacteria | 1132 |
| 227 | Ga0070684_101082921 | 3300005535 | Bacteria | 753 |
| 228 | Ga0070697_100298371 | 3300005536 | Bacteria | 1385 |
| 229 | Ga0068853_100043518 | 3300005539 | Bacteria | 3842 |
| 230 | Ga0068853_100212305 | 3300005539 | Bacteria | 1764 |
| 231 | Ga0068853_100272235 | 3300005539 | Bacteria | 1560 |
| 232 | Ga0068853_100769707 | 3300005539 | Bacteria | 921 |
| 233 | Ga0070672_100019095 | 3300005543 | Bacteria | 4968 |
| 234 | Ga0070672_100027996 | 3300005543 | Bacteria | 4210 |
| 235 | Ga0070672_100090346 | 3300005543 | Bacteria | 2470 |
| 236 | Ga0070686_100004853 | 3300005544 | Bacteria | 7426 |
| 237 | Ga0070686_100093224 | 3300005544 | Bacteria | 2019 |
| 238 | Ga0070686_100110133 | 3300005544 | Bacteria | 1875 |
| 239 | Ga0070686_100230439 | 3300005544 | Bacteria | 1343 |
| 240 | Ga0070695_100075746 | 3300005545 | Bacteria | 2215 |
| 241 | Ga0070695_100127817 | 3300005545 | Bacteria | 1748 |
| 242 | Ga0070695_100172059 | 3300005545 | Bacteria | 1528 |
| 243 | Ga0070695_100252325 | 3300005545 | Bacteria | 1285 |
| 244 | Ga0070695_100414782 | 3300005545 | Unclassified | 1024 |
| 245 | Ga0070695_100805979 | 3300005545 | Bacteria | 753 |
| 246 | Ga0070696_100013955 | 3300005546 | Bacteria | 5394 |
| 247 | Ga0070696_100098608 | 3300005546 | Bacteria | 2090 |
| 248 | Ga0070696_100153009 | 3300005546 | Bacteria | 1695 |
| 249 | Ga0070696_100165622 | 3300005546 | Bacteria | 1631 |
| 250 | Ga0070696_100174379 | 3300005546 | Bacteria | 1592 |
| 251 | Ga0070696_100234555 | 3300005546 | Bacteria | 1381 |
| 252 | Ga0070696_100442914 | 3300005546 | Bacteria | 1024 |
| 253 | Ga0070696_100640207 | 3300005546 | Bacteria | 861 |
| 254 | Ga0070696_100727869 | 3300005546 | Bacteria | 811 |
| 255 | Ga0070693_100043202 | 3300005547 | Bacteria | 2544 |
| 256 | Ga0070693_100126027 | 3300005547 | Bacteria | 1594 |
| 257 | Ga0070693_100227862 | 3300005547 | Bacteria | 1224 |
| 258 | Ga0070693_100309411 | 3300005547 | Bacteria | 1068 |
| 259 | Ga0070665_100056627 | 3300005548 | Bacteria | 3930 |
| 260 | Ga0070665_100061371 | 3300005548 | Bacteria | 3768 |
| 261 | Ga0070665_100220542 | 3300005548 | Bacteria | 1897 |
| 262 | Ga0070665_100511080 | 3300005548 | Bacteria | 1213 |
| 263 | Ga0070704_100060975 | 3300005549 | Bacteria | 2697 |
| 264 | Ga0070704_100152483 | 3300005549 | Bacteria | 1818 |
| 265 | Ga0070704_100414945 | 3300005549 | Bacteria | 1152 |
| 266 | Ga0070704_100425608 | 3300005549 | Bacteria | 1138 |
| 267 | Ga0070704_100596115 | 3300005549 | Bacteria | 971 |
| 268 | Ga0068855_100016339 | 3300005563 | Bacteria | 8924 |
| 269 | Ga0068855_100168972 | 3300005563 | Bacteria | 2477 |
| 270 | Ga0068855_100428040 | 3300005563 | Bacteria | 1447 |
| 271 | Ga0068855_100438692 | 3300005563 | Bacteria | 1426 |
| 272 | Ga0068855_100542470 | 3300005563 | Bacteria | 1260 |
| 273 | Ga0068855_101271924 | 3300005563 | Bacteria | 762 |
| 274 | Ga0070664_100100266 | 3300005564 | Bacteria | 2517 |
| 275 | Ga0070664_100142062 | 3300005564 | Bacteria | 2114 |
| 276 | Ga0070664_100405063 | 3300005564 | Bacteria | 1248 |
| 277 | Ga0070664_100407658 | 3300005564 | Bacteria | 1244 |
| 278 | Ga0068857_100004037 | 3300005577 | Bacteria | 12356 |
| 279 | Ga0068857_100011522 | 3300005577 | Bacteria | 7692 |
| 280 | Ga0068857_100020799 | 3300005577 | Bacteria | 5773 |
| 281 | Ga0068857_100292126 | 3300005577 | Bacteria | 1501 |
| 282 | Ga0068854_100123951 | 3300005578 | Bacteria | 1965 |
| 283 | Ga0068854_100179809 | 3300005578 | Bacteria | 1652 |
| 284 | Ga0068854_100247219 | 3300005578 | Bacteria | 1423 |
| 285 | Ga0068854_100726325 | 3300005578 | Unclassified | 859 |
| 286 | Ga0068856_100060848 | 3300005614 | Bacteria | 3730 |
| 287 | Ga0068856_100097795 | 3300005614 | Bacteria | 2925 |
| 288 | Ga0068856_100573304 | 3300005614 | Bacteria | 1150 |
| 289 | Ga0068856_100638362 | 3300005614 | Bacteria | 1085 |
| 290 | Ga0070702_100040905 | 3300005615 | Bacteria | 2596 |
| 291 | Ga0070702_100046445 | 3300005615 | Bacteria | 2461 |
| 292 | Ga0070702_100170928 | 3300005615 | Bacteria | 1414 |
| 293 | Ga0070702_100824379 | 3300005615 | Bacteria | 720 |
| 294 | Ga0068852_100087395 | 3300005616 | Bacteria | 2781 |
| 295 | Ga0068852_100235426 | 3300005616 | Bacteria | 1747 |
| 296 | Ga0068852_100410728 | 3300005616 | Bacteria | 1333 |
| 297 | Ga0068852_100575381 | 3300005616 | Bacteria | 1129 |
| 298 | Ga0068852_100865782 | 3300005616 | Bacteria | 920 |
| 299 | Ga0068852_100873080 | 3300005616 | Bacteria | 916 |
| 300 | Ga0068859_100202672 | 3300005617 | Bacteria | 2069 |
| 301 | Ga0068859_100359435 | 3300005617 | Bacteria | 1551 |
| 302 | Ga0068859_100400274 | 3300005617 | Bacteria | 1469 |
| 303 | Ga0068859_100721639 | 3300005617 | Bacteria | 1087 |
| 304 | Ga0068864_100053215 | 3300005618 | Bacteria | 3492 |
| 305 | Ga0068864_100253783 | 3300005618 | Bacteria | 1634 |
| 306 | Ga0068864_100665662 | 3300005618 | Bacteria | 1015 |
| 307 | Ga0068866_10059006 | 3300005718 | Bacteria | 1983 |
| 308 | Ga0068866_10146938 | 3300005718 | Unclassified | 1361 |
| 309 | Ga0068866_10275803 | 3300005718 | Bacteria | 1040 |
| 310 | Ga0068866_10352421 | 3300005718 | Bacteria | 936 |
| 311 | Ga0068866_10543224 | 3300005718 | Bacteria | 776 |
| 312 | Ga0068861_100000599 | 3300005719 | Bacteria | 21360 |
| 313 | Ga0068861_100046527 | 3300005719 | Bacteria | 3271 |
| 314 | Ga0068861_100048989 | 3300005719 | Bacteria | 3197 |
| 315 | Ga0068861_100069266 | 3300005719 | Bacteria | 2729 |
| 316 | Ga0068861_100113228 | 3300005719 | Bacteria | 2176 |
| 317 | Ga0068861_100900817 | 3300005719 | Bacteria | 838 |
| 318 | Ga0068870_10066313 | 3300005840 | Bacteria | 1955 |
| 319 | Ga0068870_10119604 | 3300005840 | Bacteria | 1515 |
| 320 | Ga0068870_10127191 | 3300005840 | Unclassified | 1475 |
| 321 | Ga0068870_10149567 | 3300005840 | Bacteria | 1374 |
| 322 | Ga0068863_100118758 | 3300005841 | Bacteria | 2521 |
| 323 | Ga0068863_100175600 | 3300005841 | Bacteria | 2056 |
| 324 | Ga0068863_101106831 | 3300005841 | Bacteria | 797 |
| 325 | Ga0068858_100082667 | 3300005842 | Bacteria | 2986 |
| 326 | Ga0068858_100591675 | 3300005842 | Bacteria | 1076 |
| 327 | Ga0068858_100909185 | 3300005842 | Bacteria | 861 |
| 328 | Ga0068860_100135445 | 3300005843 | Bacteria | 2365 |
| 329 | Ga0068860_100321916 | 3300005843 | Bacteria | 1518 |
| 330 | Ga0068860_100336356 | 3300005843 | Bacteria | 1484 |
| 331 | Ga0068862_100034106 | 3300005844 | Bacteria | 4305 |
| 332 | Ga0068862_100108242 | 3300005844 | Bacteria | 2437 |
| 333 | Ga0081455_10037793 | 3300005937 | Bacteria | 4281 |
| 334 | Ga0081455_10046700 | 3300005937 | Bacteria | 3755 |
| 335 | Ga0081538_10002668 | 3300005981 | Bacteria | 17209 |
| 336 | Ga0081538_10030418 | 3300005981 | Bacteria | 3666 |
| 337 | Ga0081538_10065202 | 3300005981 | Bacteria | 2053 |
| 338 | Ga0081538_10097573 | 3300005981 | Bacteria | 1493 |
| 339 | Ga0081540_1000590 | 3300005983 | Bacteria | 34934 |
| 340 | Ga0081540_1001254 | 3300005983 | Bacteria | 22178 |
| 341 | Ga0081539_10000703 | 3300005985 | Bacteria | 67184 |
| 342 | Ga0081539_10081023 | 3300005985 | Bacteria | 1706 |
| 343 | Ga0081539_10171682 | 3300005985 | Bacteria | 1025 |
| 344 | Ga0070717_10091885 | 3300006028 | Bacteria | 2563 |
| 345 | Ga0070717_10117219 | 3300006028 | Bacteria | 2277 |
| 346 | Ga0070717_10770850 | 3300006028 | Bacteria | 874 |
| 347 | Ga0075364_10512529 | 3300006051 | Bacteria | 820 |
| 348 | Ga0075432_10000155 | 3300006058 | Bacteria | 16542 |
| 349 | Ga0070715_10010700 | 3300006163 | Bacteria | 3277 |
| 350 | Ga0070715_10012518 | 3300006163 | Bacteria | 3091 |
| 351 | Ga0070715_10012523 | 3300006163 | Bacteria | 3090 |
| 352 | Ga0070716_100021841 | 3300006173 | Bacteria | 3375 |
| 353 | Ga0070716_100085983 | 3300006173 | Bacteria | 1890 |
| 354 | Ga0070716_100134939 | 3300006173 | Unclassified | 1566 |
| 355 | Ga0070712_100011954 | 3300006175 | Bacteria | 5517 |
| 356 | Ga0070712_100018248 | 3300006175 | Bacteria | 4553 |
| 357 | Ga0070712_100033365 | 3300006175 | Bacteria | 3483 |
| 358 | Ga0070712_100037758 | 3300006175 | Bacteria | 3295 |
| 359 | Ga0070712_100199842 | 3300006175 | Bacteria | 1569 |
| 360 | Ga0070712_100234317 | 3300006175 | Unclassified | 1459 |
| 361 | Ga0070712_100316078 | 3300006175 | Bacteria | 1269 |
| 362 | Ga0070712_100548503 | 3300006175 | Bacteria | 974 |
| 363 | Ga0075366_10412377 | 3300006195 | Bacteria | 832 |
| 364 | Ga0097621_100074602 | 3300006237 | Bacteria | 2810 |
| 365 | Ga0097621_100614578 | 3300006237 | Bacteria | 994 |
| 366 | Ga0068871_100152298 | 3300006358 | Bacteria | 1973 |
| 367 | Ga0068871_100234253 | 3300006358 | Bacteria | 1594 |
| 368 | Ga0068871_100335837 | 3300006358 | Bacteria | 1333 |
| 369 | Ga0068871_100606677 | 3300006358 | Bacteria | 996 |
| 370 | Ga0075428_100073425 | 3300006844 | Bacteria | 3736 |
| 371 | Ga0075428_100365622 | 3300006844 | Bacteria | 1547 |
| 372 | Ga0075428_100554153 | 3300006844 | Bacteria | 1229 |
| 373 | Ga0075431_100153427 | 3300006847 | Bacteria | 2371 |
| 374 | Ga0075431_100188109 | 3300006847 | Bacteria | 2116 |
| 375 | Ga0075431_101092075 | 3300006847 | Bacteria | 763 |
| 376 | Ga0075433_10024795 | 3300006852 | Bacteria | 5066 |
| 377 | Ga0075433_10196771 | 3300006852 | Bacteria | 1793 |
| 378 | Ga0075433_10226438 | 3300006852 | Bacteria | 1661 |
| 379 | Ga0075433_10231012 | 3300006852 | Bacteria | 1643 |
| 380 | Ga0075433_10258125 | 3300006852 | Bacteria | 1545 |
| 381 | Ga0075433_10293584 | 3300006852 | Bacteria | 1439 |
| 382 | Ga0075433_10501386 | 3300006852 | Bacteria | 1068 |
| 383 | Ga0075434_100015405 | 3300006871 | Bacteria | 7329 |
| 384 | Ga0075434_100023080 | 3300006871 | Bacteria | 6057 |
| 385 | Ga0075434_100053669 | 3300006871 | Bacteria | 4004 |
| 386 | Ga0075434_100215977 | 3300006871 | Bacteria | 1938 |
| 387 | Ga0075434_100405360 | 3300006871 | Bacteria | 1384 |
| 388 | Ga0075434_100672199 | 3300006871 | Bacteria | 1053 |
| 389 | Ga0075429_100231728 | 3300006880 | Bacteria | 1618 |
| 390 | Ga0075429_100541247 | 3300006880 | Bacteria | 1020 |
| 391 | Ga0075429_100665094 | 3300006880 | Unclassified | 912 |
| 392 | Ga0068865_100048111 | 3300006881 | Bacteria | 2934 |
| 393 | Ga0068865_100061984 | 3300006881 | Bacteria | 2624 |
| 394 | Ga0068865_100079460 | 3300006881 | Bacteria | 2349 |
| 395 | Ga0068865_100099768 | 3300006881 | Bacteria | 2123 |
| 396 | Ga0068865_100169145 | 3300006881 | Bacteria | 1674 |
| 397 | Ga0068865_100417997 | 3300006881 | Bacteria | 1102 |
| 398 | Ga0068865_100450857 | 3300006881 | Bacteria | 1064 |
| 399 | Ga0068865_100628141 | 3300006881 | Bacteria | 911 |
| 400 | Ga0068865_101043265 | 3300006881 | Bacteria | 718 |
| 401 | Ga0075436_100012943 | 3300006914 | Bacteria | 5719 |
| 402 | Ga0075436_100020689 | 3300006914 | Bacteria | 4515 |
| 403 | Ga0075436_100062021 | 3300006914 | Bacteria | 2584 |
| 404 | Ga0075436_100299784 | 3300006914 | Bacteria | 1152 |
| 405 | Ga0075436_100488538 | 3300006914 | Bacteria | 900 |
| 406 | Ga0075436_100635917 | 3300006914 | Unclassified | 788 |
| 407 | Ga0097620_100202699 | 3300006931 | Bacteria | 2069 |
| 408 | Ga0097620_100359476 | 3300006931 | Bacteria | 1551 |
| 409 | Ga0097620_100400273 | 3300006931 | Bacteria | 1469 |
| 410 | Ga0097620_100721662 | 3300006931 | Bacteria | 1087 |
| 411 | Ga0075435_100006892 | 3300007076 | Bacteria | 8061 |
| 412 | Ga0075435_100016752 | 3300007076 | Bacteria | 5529 |
| 413 | Ga0075435_100021969 | 3300007076 | Bacteria | 4917 |
| 414 | Ga0075435_100024707 | 3300007076 | Bacteria | 4667 |
| 415 | Ga0075435_100225537 | 3300007076 | Bacteria | 1591 |
| 416 | Ga0105244_10079253 | 3300009036 | Unclassified | 1628 |
| 417 | Ga0105240_10769711 | 3300009093 | Bacteria | 1045 |
| 418 | Ga0105240_10796596 | 3300009093 | Bacteria | 1024 |
| 419 | Ga0105240_12033788 | 3300009093 | Bacteria | 597 |
| 420 | Ga0111539_10050201 | 3300009094 | Bacteria | 4970 |
| 421 | Ga0111539_10060535 | 3300009094 | Bacteria | 4487 |
| 422 | Ga0111539_10064029 | 3300009094 | Bacteria | 4351 |
| 423 | Ga0111539_10213992 | 3300009094 | Unclassified | 2245 |
| 424 | Ga0111539_10436134 | 3300009094 | Bacteria | 1525 |
| 425 | Ga0111539_10441308 | 3300009094 | Unclassified | 1515 |
| 426 | Ga0111539_11462295 | 3300009094 | Bacteria | 793 |
| 427 | Ga0105245_10029388 | 3300009098 | Bacteria | 4855 |
| 428 | Ga0105245_10039116 | 3300009098 | Bacteria | 4221 |
| 429 | Ga0105245_10052784 | 3300009098 | Bacteria | 3647 |
| 430 | Ga0105245_10101084 | 3300009098 | Bacteria | 2668 |
| 431 | Ga0105245_10110975 | 3300009098 | Bacteria | 2550 |
| 432 | Ga0105245_10116618 | 3300009098 | Bacteria | 2490 |
| 433 | Ga0105245_10143381 | 3300009098 | Bacteria | 2252 |
| 434 | Ga0105245_10198946 | 3300009098 | Bacteria | 1923 |
| 435 | Ga0105245_10205561 | 3300009098 | Bacteria | 1893 |
| 436 | Ga0105245_10276106 | 3300009098 | Bacteria | 1641 |
| 437 | Ga0105245_10414029 | 3300009098 | Bacteria | 1349 |
| 438 | Ga0105245_10462975 | 3300009098 | Bacteria | 1278 |
| 439 | Ga0105245_11182692 | 3300009098 | Bacteria | 812 |
| 440 | Ga0105247_10009470 | 3300009101 | Bacteria | 5910 |
| 441 | Ga0105247_10773498 | 3300009101 | Bacteria | 730 |
| 442 | Ga0114129_10021521 | 3300009147 | Bacteria | 9154 |
| 443 | Ga0114129_10041728 | 3300009147 | Bacteria | 6462 |
| 444 | Ga0114129_10198491 | 3300009147 | Bacteria | 2719 |
| 445 | Ga0114129_10584178 | 3300009147 | Bacteria | 1449 |
| 446 | Ga0114129_10773584 | 3300009147 | Bacteria | 1227 |
| 447 | Ga0114129_12431135 | 3300009147 | Bacteria | 627 |
| 448 | Ga0105243_10006578 | 3300009148 | Bacteria | 8980 |
| 449 | Ga0105243_10011319 | 3300009148 | Bacteria | 6750 |
| 450 | Ga0105243_10057101 | 3300009148 | Bacteria | 3107 |
| 451 | Ga0105243_10063674 | 3300009148 | Bacteria | 2955 |
| 452 | Ga0105243_10134597 | 3300009148 | Bacteria | 2101 |
| 453 | Ga0105243_10140568 | 3300009148 | Bacteria | 2059 |
| 454 | Ga0105243_10197702 | 3300009148 | Bacteria | 1761 |
| 455 | Ga0105243_10241525 | 3300009148 | Bacteria | 1608 |
| 456 | Ga0105243_10367601 | 3300009148 | Bacteria | 1326 |
| 457 | Ga0105243_11115109 | 3300009148 | Bacteria | 798 |
| 458 | Ga0105241_10055814 | 3300009174 | Bacteria | 3026 |
| 459 | Ga0105241_10093317 | 3300009174 | Bacteria | 2378 |
| 460 | Ga0105241_10271712 | 3300009174 | Bacteria | 1444 |
| 461 | Ga0105242_10016338 | 3300009176 | Bacteria | 5772 |
| 462 | Ga0105242_10030820 | 3300009176 | Bacteria | 4284 |
| 463 | Ga0105242_10032691 | 3300009176 | Bacteria | 4161 |
| 464 | Ga0105242_10052227 | 3300009176 | Bacteria | 3335 |
| 465 | Ga0105242_10076487 | 3300009176 | Bacteria | 2790 |
| 466 | Ga0105242_10077096 | 3300009176 | Bacteria | 2780 |
| 467 | Ga0105242_10096406 | 3300009176 | Bacteria | 2499 |
| 468 | Ga0105242_10096880 | 3300009176 | Bacteria | 2493 |
| 469 | Ga0105242_10759820 | 3300009176 | Bacteria | 955 |
| 470 | Ga0105242_10967007 | 3300009176 | Bacteria | 857 |
| 471 | Ga0105248_10050144 | 3300009177 | Bacteria | 4681 |
| 472 | Ga0105248_10467919 | 3300009177 | Bacteria | 1421 |
| 473 | Ga0105248_10535495 | 3300009177 | Bacteria | 1321 |
| 474 | Ga0105248_10590999 | 3300009177 | Bacteria | 1253 |
| 475 | Ga0105237_10015040 | 3300009545 | Bacteria | 8064 |
| 476 | Ga0105237_10048627 | 3300009545 | Bacteria | 4263 |
| 477 | Ga0105237_10495547 | 3300009545 | Bacteria | 1228 |
| 478 | Ga0105238_10029146 | 3300009551 | Bacteria | 5624 |
| 479 | Ga0105238_10496657 | 3300009551 | Bacteria | 1220 |
| 480 | Ga0105238_10966484 | 3300009551 | Unclassified | 872 |
| 481 | Ga0105249_10021215 | 3300009553 | Bacteria | 5815 |
| 482 | Ga0105249_10086108 | 3300009553 | Bacteria | 2930 |
| 483 | Ga0105249_10163393 | 3300009553 | Bacteria | 2154 |
| 484 | Ga0105249_10228366 | 3300009553 | Bacteria | 1835 |
| 485 | Ga0105249_10248920 | 3300009553 | Bacteria | 1761 |
| 486 | Ga0105249_10368490 | 3300009553 | Bacteria | 1459 |
| 487 | Ga0105249_10378417 | 3300009553 | Bacteria | 1441 |
| 488 | Ga0105249_10688780 | 3300009553 | Bacteria | 1081 |
| 489 | Ga0105249_11336260 | 3300009553 | Bacteria | 788 |
| 490 | Ga0105239_10070973 | 3300010375 | Bacteria | 3826 |
| 491 | Ga0105239_10099109 | 3300010375 | Bacteria | 3221 |
| 492 | Ga0105239_10126075 | 3300010375 | Bacteria | 2845 |
| 493 | Ga0105239_10138061 | 3300010375 | Bacteria | 2715 |
| 494 | Ga0105239_10830870 | 3300010375 | Bacteria | 1059 |
| 495 | Ga0105239_12679287 | 3300010375 | Unclassified | 582 |
| 496 | Ga0105246_10006452 | 3300011119 | Bacteria | 7166 |
| 497 | Ga0105246_10016365 | 3300011119 | Bacteria | 4696 |
| 498 | Ga0105246_10062964 | 3300011119 | Bacteria | 2586 |
| 499 | Ga0105246_10109949 | 3300011119 | Bacteria | 2023 |
| 500 | Ga0105246_10204879 | 3300011119 | Bacteria | 1536 |
| 501 | Ga0105246_10307743 | 3300011119 | Bacteria | 1282 |
| 502 | Ga0157343_1032006 | 3300012488 | Bacteria | 534 |
| 503 | Ga0157345_1007395 | 3300012498 | Bacteria | 895 |
| 504 | Ga0157347_1003770 | 3300012502 | Bacteria | 1378 |
| 505 | Ga0157316_1002248 | 3300012510 | Bacteria | 1296 |
| 506 | Ga0157371_10120348 | 3300013102 | Bacteria | 1866 |
| 507 | Ga0157371_10256471 | 3300013102 | Bacteria | 1260 |
| 508 | Ga0157371_10478408 | 3300013102 | Bacteria | 918 |
| 509 | Ga0157370_10312908 | 3300013104 | Bacteria | 1449 |
| 510 | Ga0157369_10320317 | 3300013105 | Bacteria | 1612 |
| 511 | Ga0157369_10509513 | 3300013105 | Bacteria | 1245 |
| 512 | Ga0157374_10011101 | 3300013296 | Bacteria | 7785 |
| 513 | Ga0157378_10099887 | 3300013297 | Bacteria | 2648 |
| 514 | Ga0157378_10141795 | 3300013297 | Bacteria | 2232 |
| 515 | Ga0157378_10474183 | 3300013297 | Bacteria | 1246 |
| 516 | Ga0163162_10036711 | 3300013306 | Bacteria | 4886 |
| 517 | Ga0163162_10128466 | 3300013306 | Bacteria | 2642 |
| 518 | Ga0163162_10192049 | 3300013306 | Bacteria | 2170 |
| 519 | Ga0163162_10258117 | 3300013306 | Bacteria | 1874 |
| 520 | Ga0163162_10271857 | 3300013306 | Bacteria | 1826 |
| 521 | Ga0163162_10278962 | 3300013306 | Bacteria | 1803 |
| 522 | Ga0163162_10279332 | 3300013306 | Unclassified | 1802 |
| 523 | Ga0163162_10497608 | 3300013306 | Bacteria | 1349 |
| 524 | Ga0157372_10067977 | 3300013307 | Bacteria | 4006 |
| 525 | Ga0157372_10093044 | 3300013307 | Bacteria | 3430 |
| 526 | Ga0157372_10246342 | 3300013307 | Bacteria | 2074 |
| 527 | Ga0157372_10834300 | 3300013307 | Bacteria | 1070 |
| 528 | Ga0157375_10195347 | 3300013308 | Bacteria | 2178 |
| 529 | Ga0157375_10922586 | 3300013308 | Bacteria | 1016 |
| 530 | Ga0163163_10015084 | 3300014325 | Bacteria | 7130 |
| 531 | Ga0163163_10375679 | 3300014325 | Bacteria | 1479 |
| 532 | Ga0163163_10882333 | 3300014325 | Bacteria | 958 |
| 533 | Ga0157380_10017463 | 3300014326 | Bacteria | 5310 |
| 534 | Ga0157380_10097198 | 3300014326 | Bacteria | 2443 |
| 535 | Ga0157380_10446768 | 3300014326 | Bacteria | 1240 |
| 536 | Ga0157380_10670005 | 3300014326 | Bacteria | 1038 |
| 537 | Ga0157380_10875598 | 3300014326 | Bacteria | 922 |
| 538 | Ga0157380_10948203 | 3300014326 | Bacteria | 890 |
| 539 | Ga0182008_10054314 | 3300014497 | Bacteria | 1982 |
| 540 | Ga0157377_10003069 | 3300014745 | Bacteria | 7493 |
| 541 | Ga0157377_10021451 | 3300014745 | Bacteria | 3398 |
| 542 | Ga0157377_10058025 | 3300014745 | Bacteria | 2203 |
| 543 | Ga0157377_10072645 | 3300014745 | Bacteria | 1992 |
| 544 | Ga0157377_10246932 | 3300014745 | Bacteria | 1155 |
| 545 | Ga0157377_10672762 | 3300014745 | Bacteria | 748 |
| 546 | Ga0157379_10080456 | 3300014968 | Bacteria | 2918 |
| 547 | Ga0157379_10184896 | 3300014968 | Bacteria | 1883 |
| 548 | Ga0157379_10352025 | 3300014968 | Bacteria | 1348 |
| 549 | Ga0157376_10013044 | 3300014969 | Bacteria | 6191 |
| 550 | Ga0157376_10109741 | 3300014969 | Bacteria | 2426 |
| 551 | Ga0157376_10119793 | 3300014969 | Bacteria | 2331 |
| 552 | Ga0157376_10206466 | 3300014969 | Bacteria | 1811 |
| 553 | Ga0157376_10353997 | 3300014969 | Bacteria | 1406 |
| 554 | Ga0157376_11030461 | 3300014969 | Bacteria | 846 |
| 555 | Ga0163161_10250273 | 3300017792 | Bacteria | 1381 |
| 556 | Ga0163161_10534486 | 3300017792 | Bacteria | 959 |
| 557 | Ga0163161_10588271 | 3300017792 | Bacteria | 916 |
| 558 | Ga0197907_10034126 | 3300020069 | Bacteria | 663 |
| 559 | Ga0206356_10954049 | 3300020070 | Bacteria | 979 |
| 560 | Ga0206351_10526121 | 3300020077 | Bacteria | 1014 |
| 561 | Ga0154015_1595217 | 3300020610 | Bacteria | 927 |
| 562 | Ga0207653_10107940 | 3300025885 | Bacteria | 991 |
| 563 | Ga0207682_10088969 | 3300025893 | Bacteria | 1336 |
| 564 | Ga0207692_10028356 | 3300025898 | Bacteria | 2647 |
| 565 | Ga0207692_10127545 | 3300025898 | Bacteria | 1433 |
| 566 | Ga0207692_10154858 | 3300025898 | Bacteria | 1316 |
| 567 | Ga0207642_10064556 | 3300025899 | Bacteria | 1717 |
| 568 | Ga0207642_10078813 | 3300025899 | Bacteria | 1593 |
| 569 | Ga0207642_10114574 | 3300025899 | Bacteria | 1379 |
| 570 | Ga0207642_10166824 | 3300025899 | Bacteria | 1187 |
| 571 | Ga0207642_10182252 | 3300025899 | Unclassified | 1145 |
| 572 | Ga0207710_10044000 | 3300025900 | Bacteria | 1988 |
| 573 | Ga0207688_10010947 | 3300025901 | Bacteria | 4935 |
| 574 | Ga0207688_10023379 | 3300025901 | Bacteria | 3384 |
| 575 | Ga0207688_10060800 | 3300025901 | Bacteria | 2129 |
| 576 | Ga0207688_10129549 | 3300025901 | Bacteria | 1478 |
| 577 | Ga0207688_10140522 | 3300025901 | Unclassified | 1421 |
| 578 | Ga0207688_10320817 | 3300025901 | Bacteria | 950 |
| 579 | Ga0207647_10228702 | 3300025904 | Bacteria | 1070 |
| 580 | Ga0207647_10384018 | 3300025904 | Unclassified | 793 |
| 581 | Ga0207647_10592550 | 3300025904 | Bacteria | 612 |
| 582 | Ga0207685_10019344 | 3300025905 | Bacteria | 2243 |
| 583 | Ga0207685_10023237 | 3300025905 | Bacteria | 2108 |
| 584 | Ga0207685_10037253 | 3300025905 | Bacteria | 1789 |
| 585 | Ga0207699_10054307 | 3300025906 | Bacteria | 2379 |
| 586 | Ga0207699_10134884 | 3300025906 | Bacteria | 1615 |
| 587 | Ga0207699_10279802 | 3300025906 | Bacteria | 1159 |
| 588 | Ga0207699_10324534 | 3300025906 | Bacteria | 1081 |
| 589 | Ga0207645_10109233 | 3300025907 | Bacteria | 1789 |
| 590 | Ga0207645_10568272 | 3300025907 | Bacteria | 769 |
| 591 | Ga0207643_10002816 | 3300025908 | Bacteria | 9385 |
| 592 | Ga0207643_10025874 | 3300025908 | Bacteria | 3246 |
| 593 | Ga0207643_10040727 | 3300025908 | Bacteria | 2616 |
| 594 | Ga0207643_10062187 | 3300025908 | Bacteria | 2133 |
| 595 | Ga0207643_10117875 | 3300025908 | Bacteria | 1570 |
| 596 | Ga0207643_10239322 | 3300025908 | Bacteria | 1115 |
| 597 | Ga0207643_10268049 | 3300025908 | Bacteria | 1056 |
| 598 | Ga0207643_10315182 | 3300025908 | Bacteria | 976 |
| 599 | Ga0207684_10064241 | 3300025910 | Bacteria | 3116 |
| 600 | Ga0207684_10220098 | 3300025910 | Unclassified | 1638 |
| 601 | Ga0207684_10240866 | 3300025910 | Bacteria | 1560 |
| 602 | Ga0207684_10510184 | 3300025910 | Unclassified | 1030 |
| 603 | Ga0207654_10096981 | 3300025911 | Bacteria | 1809 |
| 604 | Ga0207654_10240261 | 3300025911 | Bacteria | 1210 |
| 605 | Ga0207707_10133645 | 3300025912 | Bacteria | 2170 |
| 606 | Ga0207693_10002498 | 3300025915 | Bacteria | 16007 |
| 607 | Ga0207693_10018661 | 3300025915 | Bacteria | 5521 |
| 608 | Ga0207693_10036223 | 3300025915 | Bacteria | 3889 |
| 609 | Ga0207693_10050225 | 3300025915 | Bacteria | 3275 |
| 610 | Ga0207693_10127663 | 3300025915 | Bacteria | 1999 |
| 611 | Ga0207693_10259736 | 3300025915 | Bacteria | 1362 |
| 612 | Ga0207693_10311402 | 3300025915 | Bacteria | 1233 |
| 613 | Ga0207693_10823905 | 3300025915 | Bacteria | 715 |
| 614 | Ga0207663_10016048 | 3300025916 | Bacteria | 4145 |
| 615 | Ga0207663_10076207 | 3300025916 | Bacteria | 2178 |
| 616 | Ga0207663_10113988 | 3300025916 | Bacteria | 1839 |
| 617 | Ga0207663_10162570 | 3300025916 | Bacteria | 1578 |
| 618 | Ga0207663_10177147 | 3300025916 | Bacteria | 1519 |
| 619 | Ga0207663_10269088 | 3300025916 | Bacteria | 1261 |
| 620 | Ga0207663_10436539 | 3300025916 | Bacteria | 1008 |
| 621 | Ga0207660_10654854 | 3300025917 | Bacteria | 856 |
| 622 | Ga0207660_11499648 | 3300025917 | Bacteria | 545 |
| 623 | Ga0207662_10126476 | 3300025918 | Bacteria | 1608 |
| 624 | Ga0207662_10141647 | 3300025918 | Bacteria | 1523 |
| 625 | Ga0207657_10009576 | 3300025919 | Bacteria | 9725 |
| 626 | Ga0207657_10160038 | 3300025919 | Bacteria | 1829 |
| 627 | Ga0207657_10269221 | 3300025919 | Bacteria | 1354 |
| 628 | Ga0207649_10021599 | 3300025920 | Bacteria | 3708 |
| 629 | Ga0207649_10619038 | 3300025920 | Bacteria | 834 |
| 630 | Ga0207652_10061423 | 3300025921 | Bacteria | 3244 |
| 631 | Ga0207646_10019475 | 3300025922 | Bacteria | 6306 |
| 632 | Ga0207646_10126372 | 3300025922 | Bacteria | 2299 |
| 633 | Ga0207646_10370200 | 3300025922 | Unclassified | 1294 |
| 634 | Ga0207681_10243080 | 3300025923 | Bacteria | 1402 |
| 635 | Ga0207681_10270249 | 3300025923 | Bacteria | 1334 |
| 636 | Ga0207681_10391355 | 3300025923 | Bacteria | 1121 |
| 637 | Ga0207694_10327561 | 3300025924 | Bacteria | 1265 |
| 638 | Ga0207650_10020925 | 3300025925 | Bacteria | 4621 |
| 639 | Ga0207659_10029480 | 3300025926 | Bacteria | 3741 |
| 640 | Ga0207659_10180965 | 3300025926 | Bacteria | 1670 |
| 641 | Ga0207659_10595631 | 3300025926 | Bacteria | 942 |
| 642 | Ga0207687_10004254 | 3300025927 | Bacteria | 9575 |
| 643 | Ga0207687_10012189 | 3300025927 | Bacteria | 5623 |
| 644 | Ga0207687_10015050 | 3300025927 | Bacteria | 5067 |
| 645 | Ga0207687_10114580 | 3300025927 | Bacteria | 2007 |
| 646 | Ga0207687_10208548 | 3300025927 | Bacteria | 1532 |
| 647 | Ga0207687_10219686 | 3300025927 | Bacteria | 1495 |
| 648 | Ga0207687_10223261 | 3300025927 | Bacteria | 1485 |
| 649 | Ga0207687_10224560 | 3300025927 | Bacteria | 1481 |
| 650 | Ga0207687_10463861 | 3300025927 | Bacteria | 1052 |
| 651 | Ga0207687_11060481 | 3300025927 | Bacteria | 696 |
| 652 | Ga0207687_11222077 | 3300025927 | Unclassified | 646 |
| 653 | Ga0207700_10166176 | 3300025928 | Bacteria | 1836 |
| 654 | Ga0207700_10167076 | 3300025928 | Bacteria | 1832 |
| 655 | Ga0207700_10410889 | 3300025928 | Bacteria | 1187 |
| 656 | Ga0207700_10458413 | 3300025928 | Bacteria | 1124 |
| 657 | Ga0207700_10802040 | 3300025928 | Bacteria | 842 |
| 658 | Ga0207664_10021336 | 3300025929 | Bacteria | 4813 |
| 659 | Ga0207664_10029771 | 3300025929 | Bacteria | 4162 |
| 660 | Ga0207664_10186199 | 3300025929 | Bacteria | 1785 |
| 661 | Ga0207664_10246137 | 3300025929 | Bacteria | 1558 |
| 662 | Ga0207664_10272445 | 3300025929 | Bacteria | 1483 |
| 663 | Ga0207664_10524645 | 3300025929 | Bacteria | 1061 |
| 664 | Ga0207644_10020746 | 3300025931 | Bacteria | 4470 |
| 665 | Ga0207690_10050965 | 3300025932 | Bacteria | 2766 |
| 666 | Ga0207690_10059272 | 3300025932 | Bacteria | 2593 |
| 667 | Ga0207690_10103432 | 3300025932 | Bacteria | 2038 |
| 668 | Ga0207690_10133479 | 3300025932 | Bacteria | 1820 |
| 669 | Ga0207690_10282275 | 3300025932 | Bacteria | 1293 |
| 670 | Ga0207690_10376894 | 3300025932 | Bacteria | 1127 |
| 671 | Ga0207690_11147224 | 3300025932 | Bacteria | 648 |
| 672 | Ga0207706_10014996 | 3300025933 | Bacteria | 7016 |
| 673 | Ga0207706_10017665 | 3300025933 | Bacteria | 6427 |
| 674 | Ga0207706_10034581 | 3300025933 | Bacteria | 4495 |
| 675 | Ga0207706_10201463 | 3300025933 | Bacteria | 1746 |
| 676 | Ga0207706_10320465 | 3300025933 | Bacteria | 1349 |
| 677 | Ga0207686_10047744 | 3300025934 | Bacteria | 2649 |
| 678 | Ga0207686_10179831 | 3300025934 | Bacteria | 1499 |
| 679 | Ga0207686_10248019 | 3300025934 | Bacteria | 1299 |
| 680 | Ga0207686_10403144 | 3300025934 | Bacteria | 1042 |
| 681 | Ga0207686_10496213 | 3300025934 | Bacteria | 946 |
| 682 | Ga0207686_10641430 | 3300025934 | Bacteria | 839 |
| 683 | Ga0207709_10007458 | 3300025935 | Bacteria | 6090 |
| 684 | Ga0207709_10028024 | 3300025935 | Bacteria | 3253 |
| 685 | Ga0207709_10049157 | 3300025935 | Bacteria | 2573 |
| 686 | Ga0207709_10059205 | 3300025935 | Bacteria | 2384 |
| 687 | Ga0207709_10063968 | 3300025935 | Bacteria | 2308 |
| 688 | Ga0207709_10073340 | 3300025935 | Bacteria | 2181 |
| 689 | Ga0207709_10229928 | 3300025935 | Bacteria | 1343 |
| 690 | Ga0207709_10781300 | 3300025935 | Bacteria | 770 |
| 691 | Ga0207670_10670937 | 3300025936 | Bacteria | 856 |
| 692 | Ga0207669_10017533 | 3300025937 | Bacteria | 3676 |
| 693 | Ga0207669_10042619 | 3300025937 | Bacteria | 2651 |
| 694 | Ga0207669_10051244 | 3300025937 | Bacteria | 2472 |
| 695 | Ga0207669_10121335 | 3300025937 | Bacteria | 1775 |
| 696 | Ga0207669_10139874 | 3300025937 | Bacteria | 1678 |
| 697 | Ga0207669_10287953 | 3300025937 | Bacteria | 1242 |
| 698 | Ga0207669_11071641 | 3300025937 | Bacteria | 679 |
| 699 | Ga0207704_10101644 | 3300025938 | Bacteria | 1918 |
| 700 | Ga0207704_10161627 | 3300025938 | Bacteria | 1594 |
| 701 | Ga0207704_10317308 | 3300025938 | Bacteria | 1201 |
| 702 | Ga0207704_10341616 | 3300025938 | Bacteria | 1162 |
| 703 | Ga0207704_10461063 | 3300025938 | Bacteria | 1016 |
| 704 | Ga0207704_10557025 | 3300025938 | Bacteria | 932 |
| 705 | Ga0207665_10008549 | 3300025939 | Bacteria | 6738 |
| 706 | Ga0207665_10020234 | 3300025939 | Bacteria | 4372 |
| 707 | Ga0207665_10108498 | 3300025939 | Bacteria | 1947 |
| 708 | Ga0207665_10159043 | 3300025939 | Bacteria | 1624 |
| 709 | Ga0207665_10225971 | 3300025939 | Bacteria | 1374 |
| 710 | Ga0207665_10274467 | 3300025939 | Bacteria | 1253 |
| 711 | Ga0207691_10015901 | 3300025940 | Bacteria | 7148 |
| 712 | Ga0207691_10019041 | 3300025940 | Bacteria | 6501 |
| 713 | Ga0207691_10031849 | 3300025940 | Bacteria | 4921 |
| 714 | Ga0207691_10058080 | 3300025940 | Bacteria | 3519 |
| 715 | Ga0207691_10540158 | 3300025940 | Bacteria | 989 |
| 716 | Ga0207711_10116605 | 3300025941 | Bacteria | 2381 |
| 717 | Ga0207711_10138117 | 3300025941 | Bacteria | 2191 |
| 718 | Ga0207711_10162507 | 3300025941 | Bacteria | 2023 |
| 719 | Ga0207711_10230166 | 3300025941 | Bacteria | 1697 |
| 720 | Ga0207689_10022143 | 3300025942 | Bacteria | 5344 |
| 721 | Ga0207689_10250401 | 3300025942 | Bacteria | 1465 |
| 722 | Ga0207689_10515065 | 3300025942 | Unclassified | 1003 |
| 723 | Ga0207661_10106385 | 3300025944 | Bacteria | 2365 |
| 724 | Ga0207661_10139290 | 3300025944 | Bacteria | 2086 |
| 725 | Ga0207661_10698480 | 3300025944 | Bacteria | 933 |
| 726 | Ga0207661_10793094 | 3300025944 | Bacteria | 872 |
| 727 | Ga0207679_10030086 | 3300025945 | Bacteria | 3788 |
| 728 | Ga0207679_10156956 | 3300025945 | Bacteria | 1859 |
| 729 | Ga0207679_10190185 | 3300025945 | Bacteria | 1706 |
| 730 | Ga0207679_11037327 | 3300025945 | Bacteria | 752 |
| 731 | Ga0207667_10028849 | 3300025949 | Bacteria | 6025 |
| 732 | Ga0207667_10307206 | 3300025949 | Bacteria | 1620 |
| 733 | Ga0207667_10318041 | 3300025949 | Bacteria | 1590 |
| 734 | Ga0207667_10403240 | 3300025949 | Bacteria | 1392 |
| 735 | Ga0207667_10422283 | 3300025949 | Bacteria | 1357 |
| 736 | Ga0207667_10518044 | 3300025949 | Bacteria | 1208 |
| 737 | Ga0207651_10025016 | 3300025960 | Bacteria | 3704 |
| 738 | Ga0207651_10049676 | 3300025960 | Bacteria | 2843 |
| 739 | Ga0207712_10051337 | 3300025961 | Bacteria | 2884 |
| 740 | Ga0207712_10130904 | 3300025961 | Bacteria | 1912 |
| 741 | Ga0207712_10131142 | 3300025961 | Bacteria | 1910 |
| 742 | Ga0207712_10231211 | 3300025961 | Bacteria | 1484 |
| 743 | Ga0207668_10060117 | 3300025972 | Bacteria | 2666 |
| 744 | Ga0207668_10096545 | 3300025972 | Bacteria | 2185 |
| 745 | Ga0207668_10143518 | 3300025972 | Bacteria | 1839 |
| 746 | Ga0207668_10639183 | 3300025972 | Bacteria | 930 |
| 747 | Ga0207668_10698980 | 3300025972 | Bacteria | 891 |
| 748 | Ga0207640_10033675 | 3300025981 | Bacteria | 3190 |
| 749 | Ga0207640_10124284 | 3300025981 | Bacteria | 1855 |
| 750 | Ga0207640_10278763 | 3300025981 | Bacteria | 1312 |
| 751 | Ga0207640_10322705 | 3300025981 | Bacteria | 1230 |
| 752 | Ga0207640_10395194 | 3300025981 | Bacteria | 1124 |
| 753 | Ga0207640_10493448 | 3300025981 | Bacteria | 1018 |
| 754 | Ga0207677_10040146 | 3300026023 | Bacteria | 3083 |
| 755 | Ga0207677_10047667 | 3300026023 | Bacteria | 2879 |
| 756 | Ga0207677_10114534 | 3300026023 | Bacteria | 2015 |
| 757 | Ga0207677_10195662 | 3300026023 | Bacteria | 1603 |
| 758 | Ga0207677_10238564 | 3300026023 | Bacteria | 1469 |
| 759 | Ga0207677_10571198 | 3300026023 | Bacteria | 988 |
| 760 | Ga0207677_10659398 | 3300026023 | Bacteria | 924 |
| 761 | Ga0207703_10073429 | 3300026035 | Bacteria | 2830 |
| 762 | Ga0207703_10294061 | 3300026035 | Bacteria | 1479 |
| 763 | Ga0207703_10294695 | 3300026035 | Bacteria | 1477 |
| 764 | Ga0207703_10448044 | 3300026035 | Bacteria | 1205 |
| 765 | Ga0207703_10618749 | 3300026035 | Bacteria | 1025 |
| 766 | Ga0207639_10006229 | 3300026041 | Bacteria | 8104 |
| 767 | Ga0207639_10048829 | 3300026041 | Bacteria | 3205 |
| 768 | Ga0207639_10522109 | 3300026041 | Unclassified | 1087 |
| 769 | Ga0207639_10722774 | 3300026041 | Bacteria | 925 |
| 770 | Ga0207639_11209501 | 3300026041 | Bacteria | 709 |
| 771 | Ga0207678_10057996 | 3300026067 | Bacteria | 3332 |
| 772 | Ga0207678_10132769 | 3300026067 | Bacteria | 2124 |
| 773 | Ga0207678_10376675 | 3300026067 | Bacteria | 1227 |
| 774 | Ga0207678_10400255 | 3300026067 | Bacteria | 1189 |
| 775 | Ga0207678_10651380 | 3300026067 | Bacteria | 925 |
| 776 | Ga0207708_10002498 | 3300026075 | Bacteria | 13532 |
| 777 | Ga0207708_10002644 | 3300026075 | Bacteria | 13175 |
| 778 | Ga0207708_10010840 | 3300026075 | Bacteria | 6780 |
| 779 | Ga0207708_10034049 | 3300026075 | Bacteria | 3874 |
| 780 | Ga0207708_10051722 | 3300026075 | Bacteria | 3128 |
| 781 | Ga0207708_10099011 | 3300026075 | Bacteria | 2254 |
| 782 | Ga0207708_10196499 | 3300026075 | Bacteria | 1608 |
| 783 | Ga0207708_10212032 | 3300026075 | Bacteria | 1549 |
| 784 | Ga0207708_10841265 | 3300026075 | Bacteria | 792 |
| 785 | Ga0207702_10005791 | 3300026078 | Bacteria | 10749 |
| 786 | Ga0207702_10031806 | 3300026078 | Bacteria | 4400 |
| 787 | Ga0207702_10186855 | 3300026078 | Bacteria | 1912 |
| 788 | Ga0207641_10117643 | 3300026088 | Bacteria | 2367 |
| 789 | Ga0207641_10215924 | 3300026088 | Bacteria | 1776 |
| 790 | Ga0207641_10870587 | 3300026088 | Bacteria | 894 |
| 791 | Ga0207648_10025309 | 3300026089 | Bacteria | 5289 |
| 792 | Ga0207648_10036493 | 3300026089 | Bacteria | 4330 |
| 793 | Ga0207648_10039704 | 3300026089 | Bacteria | 4138 |
| 794 | Ga0207648_10067743 | 3300026089 | Bacteria | 3111 |
| 795 | Ga0207648_10080618 | 3300026089 | Bacteria | 2839 |
| 796 | Ga0207648_10081260 | 3300026089 | Bacteria | 2827 |
| 797 | Ga0207648_10110686 | 3300026089 | Bacteria | 2411 |
| 798 | Ga0207648_10205823 | 3300026089 | Bacteria | 1746 |
| 799 | Ga0207648_10324647 | 3300026089 | Bacteria | 1384 |
| 800 | Ga0207648_10825367 | 3300026089 | Bacteria | 864 |
| 801 | Ga0207676_10088485 | 3300026095 | Bacteria | 2535 |
| 802 | Ga0207676_10199770 | 3300026095 | Bacteria | 1766 |
| 803 | Ga0207676_10261170 | 3300026095 | Bacteria | 1564 |
| 804 | Ga0207674_10009027 | 3300026116 | Bacteria | 11453 |
| 805 | Ga0207674_10010087 | 3300026116 | Bacteria | 10741 |
| 806 | Ga0207674_10016296 | 3300026116 | Bacteria | 8140 |
| 807 | Ga0207675_100000456 | 3300026118 | Bacteria | 39658 |
| 808 | Ga0207675_100018997 | 3300026118 | Bacteria | 6416 |
| 809 | Ga0207675_100073717 | 3300026118 | Bacteria | 3194 |
| 810 | Ga0207675_100089183 | 3300026118 | Bacteria | 2897 |
| 811 | Ga0207675_100121938 | 3300026118 | Bacteria | 2467 |
| 812 | Ga0207675_100123267 | 3300026118 | Bacteria | 2454 |
| 813 | Ga0207675_100171554 | 3300026118 | Bacteria | 2074 |
| 814 | Ga0207675_100175737 | 3300026118 | Bacteria | 2049 |
| 815 | Ga0207675_100287596 | 3300026118 | Bacteria | 1598 |
| 816 | Ga0207675_100636719 | 3300026118 | Bacteria | 1072 |
| 817 | Ga0207683_10040192 | 3300026121 | Bacteria | 4080 |
| 818 | Ga0207683_10063509 | 3300026121 | Bacteria | 3253 |
| 819 | Ga0207683_10131380 | 3300026121 | Bacteria | 2252 |
| 820 | Ga0207683_10141762 | 3300026121 | Bacteria | 2166 |
| 821 | Ga0207683_10170683 | 3300026121 | Bacteria | 1970 |
| 822 | Ga0207683_10212682 | 3300026121 | Bacteria | 1760 |
| 823 | Ga0207683_10393726 | 3300026121 | Bacteria | 1274 |
| 824 | Ga0207683_11029184 | 3300026121 | Bacteria | 764 |
| 825 | Ga0207698_10017238 | 3300026142 | Bacteria | 4895 |
| 826 | Ga0207698_10264721 | 3300026142 | Bacteria | 1581 |
| 827 | Ga0207698_10785972 | 3300026142 | Bacteria | 953 |
| 828 | Ga0207698_12321226 | 3300026142 | Bacteria | 548 |
| 829 | Ga0209966_1010510 | 3300027695 | Bacteria | 1670 |
| 830 | Ga0207428_10008373 | 3300027907 | Bacteria | 9340 |
| 831 | Ga0207428_10065628 | 3300027907 | Bacteria | 2862 |
| 832 | Ga0207428_10135745 | 3300027907 | Bacteria | 1881 |
| 833 | Ga0207428_10177002 | 3300027907 | Bacteria | 1613 |
| 834 | Ga0207428_10350594 | 3300027907 | Bacteria | 1086 |
| 835 | Ga0268266_10075392 | 3300028379 | Bacteria | 2930 |
| 836 | Ga0268266_10196349 | 3300028379 | Bacteria | 1845 |
| 837 | Ga0268265_10702823 | 3300028380 | Bacteria | 977 |
| 838 | Ga0268265_10721384 | 3300028380 | Bacteria | 965 |
| 839 | Ga0268264_10325107 | 3300028381 | Bacteria | 1456 |
| 840 | Ga0268264_10334318 | 3300028381 | Bacteria | 1437 |
| 841 | Ga0265319_1017933 | 3300028563 | Bacteria | 2682 |
| 842 | Ga0265336_10115141 | 3300028666 | Bacteria | 801 |
| 843 | Ga0265320_10034685 | 3300031240 | Bacteria | 2564 |
| 844 | Ga0307408_100191017 | 3300031548 | Bacteria | 1650 |
| 845 | Ga0307405_10091971 | 3300031731 | Bacteria | 2011 |
| 846 | Ga0307413_10016101 | 3300031824 | Bacteria | 3851 |
| 847 | Ga0307410_10035377 | 3300031852 | Bacteria | 3243 |
| 848 | Ga0307410_10196538 | 3300031852 | Bacteria | 1537 |
| 849 | Ga0307410_10713524 | 3300031852 | Bacteria | 846 |
| 850 | Ga0307406_10196163 | 3300031901 | Bacteria | 1482 |
| 851 | Ga0307406_10260230 | 3300031901 | Bacteria | 1312 |
| 852 | Ga0307407_10162051 | 3300031903 | Bacteria | 1464 |
| 853 | Ga0307407_10873563 | 3300031903 | Bacteria | 688 |
| 854 | Ga0307412_10119979 | 3300031911 | Bacteria | 1892 |
| 855 | Ga0307412_10140262 | 3300031911 | Bacteria | 1769 |
| 856 | Ga0307409_100008431 | 3300031995 | Bacteria | 6257 |
| 857 | Ga0307409_100020656 | 3300031995 | Bacteria | 4494 |
| 858 | Ga0307409_100347884 | 3300031995 | Bacteria | 1397 |
| 859 | Ga0307409_100633503 | 3300031995 | Bacteria | 1061 |
| 860 | Ga0307416_100118177 | 3300032002 | Bacteria | 2355 |
| 861 | Ga0307416_100158384 | 3300032002 | Bacteria | 2088 |
| 862 | Ga0307416_100332888 | 3300032002 | Bacteria | 1527 |
| 863 | Ga0307416_100409494 | 3300032002 | Bacteria | 1396 |
| 864 | Ga0307416_101692907 | 3300032002 | Bacteria | 737 |
| 865 | Ga0307414_10156013 | 3300032004 | Bacteria | 1807 |
| 866 | Ga0307411_10082526 | 3300032005 | Bacteria | 2217 |
| 867 | Ga0307411_11269228 | 3300032005 | Bacteria | 670 |
| 868 | Ga0307415_100002060 | 3300032126 | Bacteria | 9933 |
| 869 | Ga0307415_100016576 | 3300032126 | Bacteria | 4396 |
| 870 | Ga0307415_101528606 | 3300032126 | Bacteria | 639 |
| 871 | Ga0373930_0016150 | 3300034816 | Bacteria | 1409 |
| 872 | Ga0373950_0078580 | 3300034818 | Bacteria | 686 |
| 873 | Ga0373958_0029367 | 3300034819 | Bacteria | 1070 |
| 874 | Ga0373959_0009849 | 3300034820 | Bacteria | 1658 |
| 875 | Ga0373959_0011086 | 3300034820 | Bacteria | 1586 |
| 876 | Ga0373938_0094675 | 3300034957 | Bacteria | 743 |
| 877 | Ga0373926_0199038 | 3300035083 | Bacteria | 771 |
| 878 | Ga0373926_0264729 | 3300035083 | Bacteria | 668 |
| 879 | Ga0373934_0028206 | 3300035086 | Bacteria | 2186 |
| 880 | Ga0373944_0007084 | 3300035089 | Bacteria | 2997 |
| 881 | Ga0373949_0060086 | 3300035090 | Bacteria | 976 |
| 882 | Ga0373949_0123755 | 3300035090 | Bacteria | 728 |
| 883 | Ga0373951_0009369 | 3300035091 | Bacteria | 2206 |
| 884 | Ga0373951_0023308 | 3300035091 | Bacteria | 1430 |
| 885 | Ga0373952_0014944 | 3300035092 | Bacteria | 1560 |
| 886 | Ga0373923_0053137 | 3300035111 | Bacteria | 1703 |
| 887 | Ga0373932_0067963 | 3300035112 | Bacteria | 1098 |
| 888 | Ga0373936_0483993 | 3300035113 | Bacteria | 574 |
| 889 | Ga0373939_0053177 | 3300035114 | Bacteria | 1264 |
| 890 | Ga0373945_0077931 | 3300035116 | Bacteria | 1265 |
| 891 | Ga0373960_0036232 | 3300035121 | Bacteria | 1404 |
| 892 | Ga0373960_0099734 | 3300035121 | Unclassified | 940 |
| 893 | Ga0373943_0147169 | 3300035170 | Bacteria | 1273 |
| 894 | Ga0373943_0205563 | 3300035170 | Bacteria | 1091 |
| 895 | Ga0373946_0002051 | 3300035171 | Bacteria | 7072 |
| 896 | Ga0373955_0073938 | 3300035172 | Bacteria | 1911 |
| 897 | Ga0373942_0034540 | 3300035207 | Bacteria | 1353 |
| 898 | Ga0373961_0043098 | 3300035241 | Bacteria | 1311 |
| 899 | Ga0373961_0266546 | 3300035241 | Bacteria | 624 |
| 900 | Ga0373924_0004046 | 3300035410 | Bacteria | 5097 |
| 901 | Ga0373931_0026542 | 3300035691 | Bacteria | 2949 |
| 902 | Ga0373931_0412068 | 3300035691 | Bacteria | 857 |
| 903 | Ga0373931_0535234 | 3300035691 | Bacteria | 759 |
| 904 | Ga0373935_0015165 | 3300035692 | Bacteria | 4655 |
| 905 | Ga0373927_0067374 | 3300035695 | Bacteria | 2316 |
| 906 | Ga0373947_0031960 | 3300035725 | Bacteria | 3100 |
| 907 | Ga0373947_0060437 | 3300035725 | Bacteria | 2301 |
| 908 | Ga0373937_0113050 | 3300036401 | Bacteria | 2526 |
| 909 | Ga0373925_0029385 | 3300037068 | Bacteria | 4033 |
| 910 | Ga0373925_0610221 | 3300037068 | Bacteria | 899 |
| 911 | Ga0395899_0002389 | 3300037312 | Bacteria | 15244 |
| 912 | Ga0395899_0004758 | 3300037312 | Bacteria | 10584 |
| 913 | Ga0395899_0005459 | 3300037312 | Bacteria | 9861 |
| 914 | Ga0395899_0031395 | 3300037312 | Bacteria | 3992 |
| 915 | Ga0395899_0073312 | 3300037312 | Bacteria | 2504 |
| 916 | Ga0395899_0140291 | 3300037312 | Bacteria | 1720 |
| 917 | Ga0395899_0999086 | 3300037312 | Bacteria | 505 |
| 918 | Ga0395900_0003865 | 3300037418 | Bacteria | 16006 |
| 919 | Ga0395900_0004269 | 3300037418 | Bacteria | 15155 |
| 920 | Ga0395900_0006467 | 3300037418 | Bacteria | 12217 |
| 921 | Ga0395900_0045074 | 3300037418 | Bacteria | 4542 |
| 922 | Ga0395900_0065219 | 3300037418 | Bacteria | 3741 |
| 923 | Ga0395900_0073472 | 3300037418 | Bacteria | 3516 |
| 924 | Ga0395900_0076922 | 3300037418 | Bacteria | 3429 |
| 925 | Ga0395900_0132622 | 3300037418 | Bacteria | 2552 |
| 926 | Ga0395900_0158166 | 3300037418 | Bacteria | 2313 |
| 927 | Ga0395900_0222536 | 3300037418 | Bacteria | 1901 |
| 928 | Ga0395900_0249710 | 3300037418 | Bacteria | 1776 |
| 929 | Ga0395900_0501994 | 3300037418 | Bacteria | 1163 |
| 930 | Ga0395898_0002662 | 3300037466 | Bacteria | 20752 |
| 931 | Ga0395898_0006058 | 3300037466 | Bacteria | 12981 |
| 932 | Ga0395898_0013863 | 3300037466 | Bacteria | 8284 |
| 933 | Ga0395898_0036964 | 3300037466 | Bacteria | 4846 |
| 934 | Ga0395898_0041218 | 3300037466 | Bacteria | 4561 |
| 935 | Ga0395898_0045759 | 3300037466 | Bacteria | 4300 |
| 936 | Ga0395898_0057707 | 3300037466 | Bacteria | 3782 |
| 937 | Ga0395898_0076593 | 3300037466 | Bacteria | 3230 |
| 938 | Ga0395898_0184384 | 3300037466 | Bacteria | 1994 |
| 939 | Ga0395898_0564027 | 3300037466 | Bacteria | 1081 |
| 940 | Ga0395905_0002146 | 3300037471 | Bacteria | 22374 |
| 941 | Ga0395905_0005265 | 3300037471 | Bacteria | 13233 |
| 942 | Ga0395905_0008385 | 3300037471 | Bacteria | 10191 |
| 943 | Ga0395905_0011371 | 3300037471 | Bacteria | 8605 |
| 944 | Ga0395905_0031674 | 3300037471 | Bacteria | 4976 |
| 945 | Ga0395905_0091134 | 3300037471 | Bacteria | 2858 |
| 946 | Ga0395905_0184014 | 3300037471 | Bacteria | 1961 |
| 947 | Ga0395905_0214012 | 3300037471 | Bacteria | 1805 |
| 948 | Ga0395905_0235168 | 3300037471 | Bacteria | 1713 |
| 949 | Ga0395905_0236416 | 3300037471 | Bacteria | 1708 |
| 950 | Ga0395905_0829839 | 3300037471 | Unclassified | 827 |
| 951 | Ga0395901_0006015 | 3300038443 | Bacteria | 12294 |
| 952 | Ga0395901_0006940 | 3300038443 | Bacteria | 11442 |
| 953 | Ga0395901_0007324 | 3300038443 | Bacteria | 11140 |
| 954 | Ga0395901_0019275 | 3300038443 | Bacteria | 6974 |
| 955 | Ga0395901_0022266 | 3300038443 | Bacteria | 6493 |
| 956 | Ga0395901_0025311 | 3300038443 | Bacteria | 6092 |
| 957 | Ga0395901_0093690 | 3300038443 | Bacteria | 3145 |
| 958 | Ga0395901_0125839 | 3300038443 | Bacteria | 2693 |
| 959 | Ga0395901_0205751 | 3300038443 | Bacteria | 2062 |
| 960 | Ga0395901_0331232 | 3300038443 | Bacteria | 1574 |
| 961 | Ga0395901_0484208 | 3300038443 | Bacteria | 1261 |
| 962 | Ga0395901_0493973 | 3300038443 | Bacteria | 1247 |
| 963 | Ga0395901_0595403 | 3300038443 | Bacteria | 1115 |
| 964 | Ga0395901_0945401 | 3300038443 | Bacteria | 841 |
| 965 | Ga0451806_104958 | 3300041462 | Bacteria | 860 |
| 966 | Ga0451807_2561596 | 3300041486 | Bacteria | 1287 |
| 967 | Ga0451807_2718629 | 3300041486 | Bacteria | 744 |
| 968 | Ga0451835_0716306 | 3300041492 | Bacteria | 978 |
| 969 | Ga0451847_0100796 | 3300041503 | Bacteria | 772 |
| 970 | Ga0451853_1497062 | 3300041512 | Bacteria | 2180 |
| 971 | Ga0451853_2737307 | 3300041512 | Bacteria | 729 |
| 972 | Ga0451853_3950287 | 3300041512 | Bacteria | 710 |
| 973 | Ga0439448_0020774 | 3300042005 | Bacteria | 2034 |
| 974 | Ga0439448_0082300 | 3300042005 | Bacteria | 1082 |
| 975 | Ga0439448_0106957 | 3300042005 | Bacteria | 954 |
| 976 | Ga0439455_0024558 | 3300042012 | Bacteria | 1459 |
| 977 | Ga0439463_012862 | 3300042016 | Bacteria | 2057 |
| 978 | Ga0439463_017975 | 3300042016 | Bacteria | 1758 |
| 979 | Ga0439458_0023962 | 3300042157 | Bacteria | 1425 |
| 980 | Ga0439435_0095507 | 3300042436 | Bacteria | 908 |
| 981 | Ga0439435_0330922 | 3300042436 | Bacteria | 526 |
| 982 | Ga0439459_0036808 | 3300042438 | Bacteria | 1022 |
| 983 | Ga0450918_030128 | 3300042531 | Bacteria | 958 |
| 984 | Ga0439440_0107344 | 3300042993 | Bacteria | 765 |
| 985 | Ga0439440_0130573 | 3300042993 | Bacteria | 706 |
| 986 | Ga0466972_0096530 | 3300044658 | Bacteria | 1400 |
| 987 | Ga0466972_0410359 | 3300044658 | Bacteria | 635 |
| 988 | Ga0466965_0429253 | 3300044683 | Bacteria | 733 |
| 989 | Ga0466963_0039561 | 3300044694 | Bacteria | 3088 |
| 990 | Ga0466964_0000687 | 3300044706 | Bacteria | 10931 |
| 991 | Ga0453684_0055532 | 3300044712 | Bacteria | 5148 |
| 992 | Ga0466968_0038954 | 3300044735 | Bacteria | 1999 |
| 993 | Ga0466957_0098346 | 3300044842 | Bacteria | 1841 |
| 994 | Ga0466960_0031848 | 3300044901 | Bacteria | 2436 |
| 995 | Ga0466960_0086628 | 3300044901 | Bacteria | 1588 |
| 996 | Ga0466960_0203660 | 3300044901 | Bacteria | 1082 |
| 997 | Ga0451576_0057008 | 3300045051 | Bacteria | 4084 |
| 998 | Ga0451576_0884761 | 3300045051 | Unclassified | 937 |
| 999 | Ga0466958_0232209 | 3300045836 | Bacteria | 1178 |
| 1000 | Ga0466967_0001643 | 3300045976 | Bacteria | 13213 |
| 1001 | Ga0466967_0002463 | 3300045976 | Bacteria | 11533 |
| 1002 | Ga0466967_0099330 | 3300045976 | Bacteria | 2658 |
| 1003 | Ga0495592_0366819 | 3300046454 | Bacteria | 919 |
| 1004 | Ga0495603_0024460 | 3300046455 | Bacteria | 3653 |
| 1005 | Ga0495603_0051869 | 3300046455 | Bacteria | 2436 |
| 1006 | Ga0495590_0241143 | 3300046457 | Bacteria | 671 |
| 1007 | Ga0495629_0047837 | 3300046459 | Bacteria | 2999 |
| 1008 | Ga0495629_0088315 | 3300046459 | Bacteria | 2162 |
| 1009 | Ga0495629_0126979 | 3300046459 | Bacteria | 1777 |
| 1010 | Ga0495641_0011598 | 3300046461 | Bacteria | 5004 |
| 1011 | Ga0495641_0029367 | 3300046461 | Bacteria | 2650 |
| 1012 | Ga0495651_0079494 | 3300046462 | Bacteria | 2478 |
| 1013 | Ga0495653_0029808 | 3300046463 | Bacteria | 4351 |
| 1014 | Ga0495580_0290049 | 3300046472 | Bacteria | 1115 |
| 1015 | Ga0495582_0023062 | 3300046473 | Bacteria | 3404 |
| 1016 | Ga0495582_0206229 | 3300046473 | Bacteria | 1123 |
| 1017 | Ga0495639_0009246 | 3300046475 | Bacteria | 4223 |
| 1018 | Ga0495662_0020440 | 3300046476 | Bacteria | 3202 |
| 1019 | Ga0495662_0089407 | 3300046476 | Bacteria | 1501 |
| 1020 | Ga0495584_0147807 | 3300046491 | Bacteria | 1194 |
| 1021 | Ga0495584_0276073 | 3300046491 | Bacteria | 854 |
| 1022 | Ga0495596_0020094 | 3300046500 | Bacteria | 2736 |
| 1023 | Ga0495596_0056305 | 3300046500 | Bacteria | 1536 |
| 1024 | Ga0495608_0007758 | 3300046511 | Bacteria | 7557 |
| 1025 | Ga0495616_0280243 | 3300046513 | Bacteria | 709 |
| 1026 | Ga0495618_0203273 | 3300046514 | Bacteria | 1253 |
| 1027 | Ga0495620_0052722 | 3300046515 | Bacteria | 1726 |
| 1028 | Ga0495628_0217670 | 3300046516 | Bacteria | 1435 |
| 1029 | Ga0495630_0035115 | 3300046517 | Bacteria | 3746 |
| 1030 | Ga0495630_0053277 | 3300046517 | Bacteria | 3029 |
| 1031 | Ga0495630_0288926 | 3300046517 | Bacteria | 1253 |
| 1032 | Ga0495637_0099949 | 3300046520 | Bacteria | 1135 |
| 1033 | Ga0495663_0116328 | 3300046525 | Bacteria | 892 |
| 1034 | Ga0495663_0174097 | 3300046525 | Bacteria | 743 |
| 1035 | Ga0495666_0062918 | 3300046526 | Bacteria | 1771 |
| 1036 | Ga0495642_0142218 | 3300046528 | Bacteria | 1036 |
| 1037 | Ga0495642_0384008 | 3300046528 | Bacteria | 619 |
| 1038 | Ga0495652_0222055 | 3300046529 | Bacteria | 1419 |
| 1039 | Ga0495665_0016491 | 3300046531 | Bacteria | 3980 |
| 1040 | Ga0495665_0275480 | 3300046531 | Bacteria | 864 |
| 1041 | Ga0495640_0017760 | 3300046533 | Bacteria | 5293 |
| 1042 | Ga0495640_0209351 | 3300046533 | Bacteria | 1233 |
| 1043 | Ga0495586_0142236 | 3300046535 | Bacteria | 1347 |
| 1044 | Ga0495586_0198005 | 3300046535 | Bacteria | 1138 |
| 1045 | Ga0495587_0043149 | 3300046536 | Bacteria | 2687 |
| 1046 | Ga0495609_0183594 | 3300046538 | Bacteria | 880 |
| 1047 | Ga0495609_0402179 | 3300046538 | Bacteria | 548 |
| 1048 | Ga0495621_0115396 | 3300046539 | Bacteria | 1034 |
| 1049 | Ga0495645_0096333 | 3300046543 | Bacteria | 2109 |
| 1050 | Ga0495645_0298142 | 3300046543 | Bacteria | 1054 |
| 1051 | Ga0495622_0050981 | 3300046557 | Bacteria | 1920 |
| 1052 | Ga0495656_0019820 | 3300046615 | Bacteria | 2601 |
| 1053 | Ga0495656_0193030 | 3300046615 | Bacteria | 1007 |
| 1054 | Ga0495656_0474704 | 3300046615 | Bacteria | 661 |
| 1055 | Ga0495668_0186241 | 3300046616 | Bacteria | 1137 |
| 1056 | Ga0495668_0269968 | 3300046616 | Unclassified | 932 |
| 1057 | Ga0495634_0053636 | 3300046642 | Bacteria | 2700 |
| 1058 | Ga0495634_0090281 | 3300046642 | Bacteria | 1990 |
| 1059 | Ga0495635_0041227 | 3300046663 | Bacteria | 3189 |
| 1060 | Ga0495588_0017861 | 3300046674 | Bacteria | 3452 |
| 1061 | Ga0495657_0019739 | 3300046675 | Bacteria | 4858 |
| 1062 | Ga0495623_0034248 | 3300046679 | Bacteria | 3258 |
| 1063 | Ga0495646_0145723 | 3300046680 | Bacteria | 1320 |
| 1064 | Ga0495647_0005116 | 3300046681 | Bacteria | 4295 |
| 1065 | Ga0495647_0182152 | 3300046681 | Bacteria | 914 |
| 1066 | Ga0495647_0295180 | 3300046681 | Bacteria | 729 |
| 1067 | Ga0495658_0032658 | 3300046683 | Bacteria | 2843 |
| 1068 | Ga0495658_0093278 | 3300046683 | Bacteria | 1786 |
| 1069 | Ga0495658_0112692 | 3300046683 | Bacteria | 1637 |
| 1070 | Ga0495658_0197255 | 3300046683 | Bacteria | 1253 |
| 1071 | Ga0495613_0036716 | 3300046689 | Bacteria | 3633 |
| 1072 | Ga0495613_0054896 | 3300046689 | Bacteria | 2928 |
| 1073 | Ga0495624_0029854 | 3300046690 | Bacteria | 3554 |
| 1074 | Ga0495624_0174482 | 3300046690 | Bacteria | 1311 |
| 1075 | Ga0495624_0407260 | 3300046690 | Bacteria | 816 |
| 1076 | Ga0495670_0362328 | 3300046691 | Bacteria | 781 |
| 1077 | Ga0495671_0242283 | 3300046692 | Bacteria | 871 |
| 1078 | Ga0495600_0081184 | 3300046809 | Bacteria | 2116 |
| 1079 | Ga0495581_0177672 | 3300047315 | Bacteria | 1244 |
| 1080 | Ga0495581_0211695 | 3300047315 | Bacteria | 1133 |
| 1081 | Ga0495581_0367676 | 3300047315 | Bacteria | 839 |
| 1082 | Ga0495674_0047497 | 3300047319 | Bacteria | 3806 |
| 1083 | Ga0495674_0061440 | 3300047319 | Bacteria | 3274 |
| 1084 | Ga0495676_0010939 | 3300047321 | Bacteria | 8203 |
| 1085 | Ga0495676_0051247 | 3300047321 | Bacteria | 3304 |
| 1086 | Ga0495676_0053327 | 3300047321 | Bacteria | 3223 |
| 1087 | Ga0495680_0120889 | 3300047322 | Bacteria | 1933 |
| 1088 | Ga0495680_0220786 | 3300047322 | Bacteria | 1353 |
| 1089 | Ga0495675_0047895 | 3300047444 | Bacteria | 2719 |
| 1090 | Ga0495677_0074392 | 3300047445 | Bacteria | 1268 |
| 1091 | Ga0495677_0120343 | 3300047445 | Bacteria | 1001 |
| 1092 | Ga0495679_177683 | 3300047446 | Bacteria | 565 |
| 1093 | Ga0495684_0004315 | 3300047471 | Bacteria | 11107 |
| 1094 | Ga0495593_0023967 | 3300047673 | Bacteria | 3386 |
| 1095 | Ga0495593_0221109 | 3300047673 | Bacteria | 950 |
| 1096 | Ga0495602_0145862 | 3300048088 | Bacteria | 1867 |
| 1097 | Ga0495614_0013264 | 3300048089 | Bacteria | 3614 |
| 1098 | Ga0495614_0062659 | 3300048089 | Bacteria | 1598 |
| 1099 | Ga0495614_0076263 | 3300048089 | Bacteria | 1449 |
| 1100 | Ga0496100_0001325 | 3300048903 | Bacteria | 12111 |
| 1101 | Ga0496100_0014418 | 3300048903 | Bacteria | 4589 |
| 1102 | Ga0496100_0189871 | 3300048903 | Bacteria | 1491 |
| 1103 | Ga0496100_0197644 | 3300048903 | Bacteria | 1463 |
| 1104 | Ga0496100_0254268 | 3300048903 | Bacteria | 1300 |
| 1105 | Ga0496100_0267248 | 3300048903 | Bacteria | 1270 |
| 1106 | Ga0496100_0275535 | 3300048903 | Bacteria | 1252 |
| 1107 | Ga0496100_1145432 | 3300048903 | Bacteria | 613 |
| 1108 | Ga0496101_0002083 | 3300048904 | Bacteria | 12184 |
| 1109 | Ga0496101_0084229 | 3300048904 | Bacteria | 2354 |
| 1110 | Ga0496101_0100257 | 3300048904 | Bacteria | 2166 |
| 1111 | Ga0496101_0138684 | 3300048904 | Bacteria | 1852 |
| 1112 | Ga0496101_0153358 | 3300048904 | Bacteria | 1763 |
| 1113 | Ga0496101_0190771 | 3300048904 | Bacteria | 1581 |
| 1114 | Ga0496101_0285946 | 3300048904 | Bacteria | 1290 |
| 1115 | Ga0496101_0320220 | 3300048904 | Bacteria | 1216 |
| 1116 | Ga0496101_0330578 | 3300048904 | Bacteria | 1196 |
| 1117 | Ga0496101_0631819 | 3300048904 | Bacteria | 846 |
| 1118 | Ga0496101_0901128 | 3300048904 | Bacteria | 696 |
| 1119 | Ga0496102_0010767 | 3300048905 | Bacteria | 7877 |
| 1120 | Ga0496102_0069095 | 3300048905 | Bacteria | 3242 |
| 1121 | Ga0496102_0141567 | 3300048905 | Bacteria | 2255 |
| 1122 | Ga0496102_0149447 | 3300048905 | Bacteria | 2194 |
| 1123 | Ga0496102_0213186 | 3300048905 | Bacteria | 1820 |
| 1124 | Ga0496102_0236354 | 3300048905 | Bacteria | 1723 |
| 1125 | Ga0496102_0296880 | 3300048905 | Bacteria | 1523 |
| 1126 | Ga0496102_0743837 | 3300048905 | Bacteria | 903 |
| 1127 | Ga0496103_0012845 | 3300048906 | Bacteria | 4968 |
| 1128 | Ga0496103_0016550 | 3300048906 | Bacteria | 4400 |
| 1129 | Ga0496103_0065854 | 3300048906 | Bacteria | 2260 |
| 1130 | Ga0496103_0307631 | 3300048906 | Bacteria | 1020 |
| 1131 | Ga0496103_0478261 | 3300048906 | Bacteria | 798 |
| 1132 | Ga0496104_0010750 | 3300048907 | Bacteria | 8185 |
| 1133 | Ga0496104_0014894 | 3300048907 | Bacteria | 7030 |
| 1134 | Ga0496104_0028100 | 3300048907 | Bacteria | 5211 |
| 1135 | Ga0496104_0043659 | 3300048907 | Bacteria | 4210 |
| 1136 | Ga0496104_0057015 | 3300048907 | Bacteria | 3696 |
| 1137 | Ga0496104_0178708 | 3300048907 | Bacteria | 2032 |
| 1138 | Ga0496104_1392342 | 3300048907 | Bacteria | 604 |
| 1139 | Ga0496105_0017687 | 3300048908 | Bacteria | 5719 |
| 1140 | Ga0496105_0032706 | 3300048908 | Bacteria | 4269 |
| 1141 | Ga0496105_0047074 | 3300048908 | Bacteria | 3559 |
| 1142 | Ga0496105_0056314 | 3300048908 | Bacteria | 3245 |
| 1143 | Ga0496105_0063560 | 3300048908 | Bacteria | 3045 |
| 1144 | Ga0496105_0067152 | 3300048908 | Bacteria | 2961 |
| 1145 | Ga0496105_0075849 | 3300048908 | Bacteria | 2776 |
| 1146 | Ga0496105_0079130 | 3300048908 | Bacteria | 2715 |
| 1147 | Ga0496106_0001833 | 3300048909 | Bacteria | 15913 |
| 1148 | Ga0496106_0008465 | 3300048909 | Bacteria | 7610 |
| 1149 | Ga0496106_0031141 | 3300048909 | Bacteria | 3975 |
| 1150 | Ga0496106_0037184 | 3300048909 | Bacteria | 3641 |
| 1151 | Ga0496106_0051170 | 3300048909 | Bacteria | 3114 |
| 1152 | Ga0496106_0053858 | 3300048909 | Bacteria | 3039 |
| 1153 | Ga0496106_0496613 | 3300048909 | Bacteria | 980 |
| 1154 | Ga0496106_0521510 | 3300048909 | Bacteria | 954 |
| 1155 | Ga0496106_1145509 | 3300048909 | Bacteria | 608 |
| 1156 | Ga0496107_0002424 | 3300048910 | Bacteria | 12082 |
| 1157 | Ga0496107_0043803 | 3300048910 | Bacteria | 3216 |
| 1158 | Ga0496107_0065945 | 3300048910 | Bacteria | 2624 |
| 1159 | Ga0496107_0109500 | 3300048910 | Bacteria | 2029 |
| 1160 | Ga0496107_0345237 | 3300048910 | Bacteria | 1108 |
| 1161 | Ga0496107_0710373 | 3300048910 | Bacteria | 739 |
| 1162 | Ga0496108_0002788 | 3300048911 | Bacteria | 14000 |
| 1163 | Ga0496108_0021258 | 3300048911 | Bacteria | 5333 |
| 1164 | Ga0496108_0022720 | 3300048911 | Bacteria | 5159 |
| 1165 | Ga0496108_0039483 | 3300048911 | Bacteria | 3934 |
| 1166 | Ga0496108_0087510 | 3300048911 | Bacteria | 2646 |
| 1167 | Ga0496108_0120132 | 3300048911 | Bacteria | 2253 |
| 1168 | Ga0496108_0184958 | 3300048911 | Bacteria | 1804 |
| 1169 | Ga0496108_0531491 | 3300048911 | Bacteria | 1026 |
| 1170 | Ga0496108_0564571 | 3300048911 | Bacteria | 992 |
| 1171 | Ga0496108_0841504 | 3300048911 | Unclassified | 790 |
| 1172 | Ga0496109_0021655 | 3300048912 | Bacteria | 5688 |
| 1173 | Ga0496109_0040526 | 3300048912 | Bacteria | 4218 |
| 1174 | Ga0496109_0067447 | 3300048912 | Bacteria | 3277 |
| 1175 | Ga0496109_0075437 | 3300048912 | Bacteria | 3100 |
| 1176 | Ga0496109_0146897 | 3300048912 | Bacteria | 2206 |
| 1177 | Ga0496109_0244501 | 3300048912 | Bacteria | 1689 |
| 1178 | Ga0496109_0251497 | 3300048912 | Bacteria | 1664 |
| 1179 | Ga0496109_0272671 | 3300048912 | Bacteria | 1594 |
| 1180 | Ga0496109_0307173 | 3300048912 | Bacteria | 1496 |
| 1181 | Ga0496109_0561467 | 3300048912 | Bacteria | 1076 |
| 1182 | Ga0496109_0792792 | 3300048912 | Bacteria | 885 |
| 1183 | Ga0496110_0002875 | 3300048913 | Bacteria | 13014 |
| 1184 | Ga0496110_0024616 | 3300048913 | Bacteria | 5133 |
| 1185 | Ga0496110_0028629 | 3300048913 | Bacteria | 4787 |
| 1186 | Ga0496110_0045873 | 3300048913 | Bacteria | 3822 |
| 1187 | Ga0496110_0124379 | 3300048913 | Bacteria | 2326 |
| 1188 | Ga0496110_0162991 | 3300048913 | Bacteria | 2021 |
| 1189 | Ga0496110_0277864 | 3300048913 | Bacteria | 1525 |
| 1190 | Ga0496110_0325953 | 3300048913 | Bacteria | 1399 |
| 1191 | Ga0496110_0626840 | 3300048913 | Bacteria | 974 |
| 1192 | Ga0496110_0720344 | 3300048913 | Bacteria | 900 |
| 1193 | Ga0496110_1396902 | 3300048913 | Bacteria | 610 |
| 1194 | Ga0496111_0000818 | 3300048914 | Bacteria | 16715 |
| 1195 | Ga0496111_0002896 | 3300048914 | Bacteria | 10479 |
| 1196 | Ga0496111_0020914 | 3300048914 | Bacteria | 4562 |
| 1197 | Ga0496111_0075365 | 3300048914 | Bacteria | 2458 |
| 1198 | Ga0496111_0103995 | 3300048914 | Bacteria | 2089 |
| 1199 | Ga0496111_0113743 | 3300048914 | Bacteria | 1994 |
| 1200 | Ga0496111_0127144 | 3300048914 | Bacteria | 1884 |
| 1201 | Ga0496111_0175778 | 3300048914 | Bacteria | 1591 |
| 1202 | Ga0496111_0287478 | 3300048914 | Bacteria | 1219 |
| 1203 | Ga0496111_0376147 | 3300048914 | Bacteria | 1051 |
| 1204 | Ga0496112_0005661 | 3300048915 | Bacteria | 10852 |
| 1205 | Ga0496112_0061188 | 3300048915 | Bacteria | 3711 |
| 1206 | Ga0496112_0069531 | 3300048915 | Bacteria | 3478 |
| 1207 | Ga0496112_0459549 | 3300048915 | Bacteria | 1211 |
| 1208 | Ga0496112_0565410 | 3300048915 | Bacteria | 1070 |
| 1209 | Ga0496112_1672411 | 3300048915 | Bacteria | 549 |
| 1210 | Ga0496113_0023734 | 3300048916 | Bacteria | 4351 |
| 1211 | Ga0496113_0059262 | 3300048916 | Bacteria | 2884 |
| 1212 | Ga0496113_0084478 | 3300048916 | Bacteria | 2437 |
| 1213 | Ga0496113_0190033 | 3300048916 | Bacteria | 1630 |
| 1214 | Ga0496113_0271843 | 3300048916 | Bacteria | 1354 |
| 1215 | Ga0496113_0344838 | 3300048916 | Bacteria | 1194 |
| 1216 | Ga0496113_0374837 | 3300048916 | Bacteria | 1142 |
| 1217 | Ga0496113_0394053 | 3300048916 | Bacteria | 1112 |
| 1218 | Ga0496113_0400750 | 3300048916 | Bacteria | 1102 |
| 1219 | Ga0496113_0451659 | 3300048916 | Bacteria | 1033 |
| 1220 | Ga0496113_1499670 | 3300048916 | Bacteria | 520 |
| 1221 | Ga0496114_0010067 | 3300048917 | Bacteria | 7518 |
| 1222 | Ga0496114_0013742 | 3300048917 | Bacteria | 6490 |
| 1223 | Ga0496114_0031479 | 3300048917 | Bacteria | 4365 |
| 1224 | Ga0496114_0061345 | 3300048917 | Bacteria | 3144 |
| 1225 | Ga0496114_0086988 | 3300048917 | Bacteria | 2649 |
| 1226 | Ga0496114_0177348 | 3300048917 | Bacteria | 1860 |
| 1227 | Ga0496114_0478300 | 3300048917 | Bacteria | 1102 |
| 1228 | Ga0496114_0552615 | 3300048917 | Unclassified | 1017 |
| 1229 | Ga0496114_1022974 | 3300048917 | Bacteria | 710 |
| 1230 | Ga0496115_0002972 | 3300048918 | Bacteria | 12182 |
| 1231 | Ga0496115_0017580 | 3300048918 | Bacteria | 5471 |
| 1232 | Ga0496115_0030561 | 3300048918 | Bacteria | 4238 |
| 1233 | Ga0496115_0034681 | 3300048918 | Bacteria | 3987 |
| 1234 | Ga0496115_0037444 | 3300048918 | Bacteria | 3843 |
| 1235 | Ga0496115_0082435 | 3300048918 | Bacteria | 2620 |
| 1236 | Ga0496115_0086478 | 3300048918 | Bacteria | 2558 |
| 1237 | Ga0496115_0091189 | 3300048918 | Bacteria | 2490 |
| 1238 | Ga0496115_0126148 | 3300048918 | Bacteria | 2108 |
| 1239 | Ga0496115_0287543 | 3300048918 | Bacteria | 1349 |
| 1240 | Ga0496115_0334019 | 3300048918 | Bacteria | 1238 |
| 1241 | Ga0496122_0212970 | 3300048925 | Bacteria | 1117 |
| 1242 | Ga0501031_0000867 | 3300049568 | Bacteria | 18200 |
| 1243 | Ga0501031_0069852 | 3300049568 | Bacteria | 2288 |
| 1244 | Ga0501031_0347983 | 3300049568 | Bacteria | 959 |
| 1245 | Ga0501031_0370044 | 3300049568 | Bacteria | 927 |
| 1246 | Ga0501031_0526897 | 3300049568 | Bacteria | 761 |
| 1247 | Ga0501032_0382284 | 3300049569 | Bacteria | 905 |
| 1248 | Ga0501033_0029012 | 3300049570 | Bacteria | 4157 |
| 1249 | Ga0501033_0083331 | 3300049570 | Bacteria | 2344 |
| 1250 | Ga0501033_1182291 | 3300049570 | Bacteria | 507 |
| 1251 | Ga0501036_0008436 | 3300049572 | Bacteria | 8443 |
| 1252 | Ga0501036_0117087 | 3300049572 | Bacteria | 2250 |
| 1253 | Ga0501036_0280482 | 3300049572 | Bacteria | 1394 |
| 1254 | Ga0501036_1111489 | 3300049572 | Bacteria | 645 |
| 1255 | Ga0501036_1402326 | 3300049572 | Bacteria | 566 |
| 1256 | Ga0501036_1447807 | 3300049572 | Bacteria | 556 |
| 1257 | Ga0501037_1055400 | 3300049573 | Bacteria | 527 |
| 1258 | Ga0501038_0004809 | 3300049574 | Bacteria | 12547 |
| 1259 | Ga0501038_0048049 | 3300049574 | Bacteria | 3694 |
| 1260 | Ga0501038_0213080 | 3300049574 | Bacteria | 1544 |
| 1261 | Ga0501038_0564377 | 3300049574 | Bacteria | 864 |
| 1262 | Ga0501038_0718327 | 3300049574 | Bacteria | 747 |
| 1263 | Ga0501039_0003561 | 3300049575 | Bacteria | 11670 |
| 1264 | Ga0501039_0027720 | 3300049575 | Bacteria | 4356 |
| 1265 | Ga0501039_0040721 | 3300049575 | Bacteria | 3586 |
| 1266 | Ga0501039_0089408 | 3300049575 | Bacteria | 2400 |
| 1267 | Ga0501039_0188440 | 3300049575 | Bacteria | 1622 |
| 1268 | Ga0501039_0329332 | 3300049575 | Bacteria | 1200 |
| 1269 | Ga0501039_0600390 | 3300049575 | Bacteria | 863 |
| 1270 | Ga0501040_0027816 | 3300049576 | Bacteria | 3808 |
| 1271 | Ga0501040_0063128 | 3300049576 | Bacteria | 2548 |
| 1272 | Ga0501040_0078960 | 3300049576 | Bacteria | 2277 |
| 1273 | Ga0501040_0264516 | 3300049576 | Bacteria | 1227 |
| 1274 | Ga0501041_0000302 | 3300049577 | Bacteria | 23917 |
| 1275 | Ga0501041_0032873 | 3300049577 | Bacteria | 3135 |
| 1276 | Ga0501041_0401351 | 3300049577 | Bacteria | 868 |
| 1277 | Ga0501042_0002652 | 3300049578 | Bacteria | 11006 |
| 1278 | Ga0501042_0096575 | 3300049578 | Bacteria | 2123 |
| 1279 | Ga0501042_0113976 | 3300049578 | Bacteria | 1947 |
| 1280 | Ga0501042_0123965 | 3300049578 | Bacteria | 1860 |
| 1281 | Ga0501043_0436361 | 3300049579 | Bacteria | 986 |
| 1282 | Ga0501046_0006543 | 3300049580 | Bacteria | 10303 |
| 1283 | Ga0501046_0022128 | 3300049580 | Bacteria | 5239 |
| 1284 | Ga0501046_0334206 | 3300049580 | Bacteria | 1102 |
| 1285 | Ga0501048_0001369 | 3300049582 | Bacteria | 18445 |
| 1286 | Ga0501048_0053076 | 3300049582 | Bacteria | 2884 |
| 1287 | Ga0501048_0475315 | 3300049582 | Unclassified | 896 |
| 1288 | Ga0501067_0000759 | 3300049583 | Bacteria | 17365 |
| 1289 | Ga0501067_0031295 | 3300049583 | Bacteria | 2953 |
| 1290 | Ga0501067_0036234 | 3300049583 | Bacteria | 2739 |
| 1291 | Ga0501067_0109440 | 3300049583 | Bacteria | 1536 |
| 1292 | Ga0501068_0001163 | 3300049584 | Bacteria | 13960 |
| 1293 | Ga0501068_0140645 | 3300049584 | Bacteria | 1513 |
| 1294 | Ga0501068_0145949 | 3300049584 | Bacteria | 1485 |
| 1295 | Ga0501068_0396709 | 3300049584 | Bacteria | 889 |
| 1296 | Ga0501068_0585535 | 3300049584 | Bacteria | 726 |
| 1297 | Ga0501069_0000171 | 3300049585 | Bacteria | 29142 |
| 1298 | Ga0501069_0076118 | 3300049585 | Bacteria | 1886 |
| 1299 | Ga0501069_0136285 | 3300049585 | Bacteria | 1407 |
| 1300 | Ga0501069_0351047 | 3300049585 | Bacteria | 869 |
| 1301 | Ga0501070_0042739 | 3300049586 | Bacteria | 3774 |
| 1302 | Ga0501070_0628817 | 3300049586 | Bacteria | 854 |
| 1303 | Ga0501071_0003170 | 3300049587 | Bacteria | 10227 |
| 1304 | Ga0501071_0011907 | 3300049587 | Bacteria | 5876 |
| 1305 | Ga0501071_0041297 | 3300049587 | Bacteria | 3303 |
| 1306 | Ga0501071_0044513 | 3300049587 | Bacteria | 3183 |
| 1307 | Ga0501071_0064726 | 3300049587 | Bacteria | 2653 |
| 1308 | Ga0501072_0004402 | 3300049588 | Bacteria | 10695 |
| 1309 | Ga0501072_0099647 | 3300049588 | Bacteria | 2309 |
| 1310 | Ga0501072_0112961 | 3300049588 | Bacteria | 2163 |
| 1311 | Ga0501072_0363566 | 3300049588 | Bacteria | 1149 |
| 1312 | Ga0501072_0641726 | 3300049588 | Bacteria | 836 |
| 1313 | Ga0501072_0815943 | 3300049588 | Bacteria | 730 |
| 1314 | Ga0501073_0122193 | 3300049589 | Bacteria | 1804 |
| 1315 | Ga0501074_0010885 | 3300049590 | Bacteria | 6605 |
| 1316 | Ga0501074_0036758 | 3300049590 | Bacteria | 3547 |
| 1317 | Ga0501074_0544813 | 3300049590 | Bacteria | 821 |
| 1318 | Ga0501074_1170024 | 3300049590 | Bacteria | 540 |
| 1319 | Ga0501075_0000959 | 3300049591 | Bacteria | 18370 |
| 1320 | Ga0501075_0070520 | 3300049591 | Bacteria | 2641 |
| 1321 | Ga0501075_0100168 | 3300049591 | Bacteria | 2200 |
| 1322 | Ga0501075_0183836 | 3300049591 | Bacteria | 1594 |
| 1323 | Ga0501075_0272457 | 3300049591 | Bacteria | 1290 |
| 1324 | Ga0501075_0396860 | 3300049591 | Bacteria | 1051 |
| 1325 | Ga0501076_0004307 | 3300049592 | Bacteria | 10097 |
| 1326 | Ga0501076_0224182 | 3300049592 | Bacteria | 1536 |
| 1327 | Ga0501076_0323466 | 3300049592 | Bacteria | 1265 |
| 1328 | Ga0501076_0750127 | 3300049592 | Bacteria | 805 |
| 1329 | Ga0501077_0041650 | 3300049593 | Bacteria | 2922 |
| 1330 | Ga0501077_0045356 | 3300049593 | Bacteria | 2792 |
| 1331 | Ga0501077_0140511 | 3300049593 | Bacteria | 1531 |
| 1332 | Ga0501077_0216023 | 3300049593 | Bacteria | 1219 |
| 1333 | Ga0501077_0231788 | 3300049593 | Bacteria | 1174 |
| 1334 | Ga0501077_0281640 | 3300049593 | Bacteria | 1058 |
| 1335 | Ga0501079_0002695 | 3300049741 | Bacteria | 12928 |
| 1336 | Ga0501079_0005575 | 3300049741 | Bacteria | 9393 |
| 1337 | Ga0501079_0070592 | 3300049741 | Bacteria | 2697 |
| 1338 | Ga0501080_0044558 | 3300049742 | Bacteria | 4130 |
| 1339 | Ga0501080_0057471 | 3300049742 | Bacteria | 3622 |
| 1340 | Ga0501080_0782151 | 3300049742 | Bacteria | 838 |
| 1341 | Ga0501080_1543648 | 3300049742 | Bacteria | 563 |
| 1342 | Ga0501081_0000989 | 3300049743 | Bacteria | 16907 |
| 1343 | Ga0501081_0084022 | 3300049743 | Bacteria | 2233 |
| 1344 | Ga0501081_0362428 | 3300049743 | Bacteria | 1069 |
| 1345 | Ga0501081_0681295 | 3300049743 | Bacteria | 771 |
| 1346 | Ga0501083_0016420 | 3300049744 | Bacteria | 5182 |
| 1347 | Ga0501083_0029978 | 3300049744 | Bacteria | 3738 |
| 1348 | Ga0501035_0015404 | 3300049822 | Bacteria | 7054 |
| 1349 | Ga0501035_0056110 | 3300049822 | Bacteria | 3516 |
| 1350 | Ga0501035_0233649 | 3300049822 | Bacteria | 1566 |
| 1351 | Ga0501035_0484485 | 3300049822 | Bacteria | 1020 |
| 1352 | Ga0501044_0260715 | 3300049823 | Bacteria | 1672 |
| 1353 | Ga0501045_0002386 | 3300049824 | Bacteria | 12754 |
| 1354 | Ga0501045_0027435 | 3300049824 | Bacteria | 4104 |
| 1355 | Ga0501045_0029861 | 3300049824 | Bacteria | 3942 |
| 1356 | Ga0501045_0067193 | 3300049824 | Bacteria | 2632 |
| 1357 | Ga0501045_0143875 | 3300049824 | Bacteria | 1773 |
| 1358 | Ga0501045_0168943 | 3300049824 | Bacteria | 1629 |
| 1359 | Ga0501045_0275298 | 3300049824 | Bacteria | 1253 |
| 1360 | nmdc:mga00v17_482346_c1 | 3300050491 | Bacteria | 804 |
| 1361 | nmdc:mga05p37_145474_c1 | 3300050507 | Bacteria | 2903 |
| 1362 | nmdc:mga05p37_148499_c1 | 3300050507 | Bacteria | 2869 |
| 1363 | nmdc:mga05p37_205443_c1 | 3300050507 | Bacteria | 2383 |
| 1364 | nmdc:mga05p37_347129_c1 | 3300050507 | Bacteria | 1748 |
| 1365 | nmdc:mga05p37_35443_c1 | 3300050507 | Bacteria | 6118 |
| 1366 | nmdc:mga05p37_7691_c1 | 3300050507 | Bacteria | 12717 |
| 1367 | nmdc:mga05p37_82724_c1 | 3300050507 | Bacteria | 3956 |
| 1368 | nmdc:mga09592_721872_c1 | 3300050508 | Bacteria | 847 |
| 1369 | nmdc:mga09592_788902_c1 | 3300050508 | Bacteria | 804 |
| 1370 | nmdc:mga06r32_102335_c1 | 3300050510 | Bacteria | 2812 |
| 1371 | nmdc:mga08y16_11403_c1 | 3300050511 | Bacteria | 9340 |
| 1372 | nmdc:mga08y16_235236_c1 | 3300050511 | Bacteria | 1895 |
| 1373 | nmdc:mga08y16_281517_c1 | 3300050511 | Bacteria | 1715 |
| 1374 | nmdc:mga08y16_30020_c1 | 3300050511 | Bacteria | 5725 |
| 1375 | nmdc:mga08y16_521956_c1 | 3300050511 | Bacteria | 1204 |
| 1376 | nmdc:mga08y16_54085_c1 | 3300050511 | Bacteria | 4195 |
| 1377 | nmdc:mga08y16_55039_c1 | 3300050511 | Bacteria | 4158 |
| 1378 | nmdc:mga08y16_566120_c1 | 3300050511 | Bacteria | 1149 |
| 1379 | nmdc:mga08y16_72012_c1 | 3300050511 | Bacteria | 3601 |
| 1380 | nmdc:mga0n895_177987_c1 | 3300050512 | Bacteria | 2158 |
| 1381 | nmdc:mga0n895_227609_c1 | 3300050512 | Bacteria | 1893 |
| 1382 | nmdc:mga0n895_59778_c1 | 3300050512 | Bacteria | 3760 |
| 1383 | nmdc:mga0n895_653165_c1 | 3300050512 | Bacteria | 1050 |
| 1384 | nmdc:mga0n895_6555_c1 | 3300050512 | Bacteria | 9907 |
| 1385 | nmdc:mga0n895_687320_c1 | 3300050512 | Bacteria | 1020 |
| 1386 | nmdc:mga0n895_900_c1 | 3300050512 | Bacteria | 21426 |
| 1387 | nmdc:mga0rr50_15420_c1 | 3300050513 | Bacteria | 5044 |
| 1388 | nmdc:mga0rr50_277795_c1 | 3300050513 | Bacteria | 1397 |
| 1389 | nmdc:mga0rr50_7072_c1 | 3300050513 | Bacteria | 6890 |
| 1390 | nmdc:mga0rr50_8145_c1 | 3300050513 | Bacteria | 6505 |
| 1391 | nmdc:mga0rr50_86118_c1 | 3300050513 | Bacteria | 2436 |
| 1392 | nmdc:mga08x19_19698_c1 | 3300050514 | Bacteria | 4144 |
| 1393 | nmdc:mga08x19_21204_c1 | 3300050514 | Bacteria | 4007 |
| 1394 | nmdc:mga08x19_354437_c1 | 3300050514 | Unclassified | 1025 |
| 1395 | nmdc:mga0a205_151006_c1 | 3300050515 | Bacteria | 2222 |
| 1396 | nmdc:mga0a205_20621_c1 | 3300050515 | Bacteria | 6224 |
| 1397 | nmdc:mga0a205_221349_c1 | 3300050515 | Bacteria | 1778 |
| 1398 | nmdc:mga0a205_282164_c1 | 3300050515 | Bacteria | 1536 |
| 1399 | nmdc:mga0a205_34024_c1 | 3300050515 | Bacteria | 4889 |
| 1400 | nmdc:mga0a205_434062_c1 | 3300050515 | Bacteria | 1175 |
| 1401 | nmdc:mga0a205_438328_c1 | 3300050515 | Bacteria | 1167 |
| 1402 | nmdc:mga0a205_560903_c1 | 3300050515 | Bacteria | 997 |
| 1403 | nmdc:mga0a205_8255_c1 | 3300050515 | Bacteria | 5222 |
| 1404 | Ga0495601_0020395 | 3300053077 | Bacteria | 4049 |
| 1405 | Ga0495601_0047942 | 3300053077 | Bacteria | 2690 |
| 1406 | Ga0495601_0233067 | 3300053077 | Bacteria | 1202 |
| 1407 | Ga0495612_0048423 | 3300053078 | Bacteria | 1742 |
| 1408 | Ga0495595_0018437 | 3300053084 | Bacteria | 3015 |
| 1409 | Ga0495595_0614833 | 3300053084 | Bacteria | 556 |
| 1410 | Ga0495619_0059474 | 3300053085 | Bacteria | 2538 |
| 1411 | Ga0495619_0089671 | 3300053085 | Bacteria | 2081 |
| 1412 | Ga0495619_0243886 | 3300053085 | Bacteria | 1245 |
| 1413 | Ga0501084_0002494 | 3300054114 | Bacteria | 14815 |
| 1414 | Ga0501084_0073655 | 3300054114 | Bacteria | 2860 |
| 1415 | Ga0501084_0105016 | 3300054114 | Bacteria | 2372 |
| 1416 | Ga0501084_0129494 | 3300054114 | Bacteria | 2124 |
| 1417 | Ga0501084_0137193 | 3300054114 | Bacteria | 2059 |
| 1418 | Ga0501084_0259072 | 3300054114 | Bacteria | 1468 |
| 1419 | Ga0501084_0950101 | 3300054114 | Bacteria | 723 |
| 1420 | Ga0587083_0129995 | 3300059505 | Bacteria | 660 |
| 1421 | Ga0587078_048916 | 3300059646 | Bacteria | 615 |
| 1422 | Ga0501082_0003144 | 3300060353 | Bacteria | 14403 |
| 1423 | Ga0501082_0419552 | 3300060353 | Bacteria | 1168 |
| 1424 | Ga0501082_0572145 | 3300060353 | Bacteria | 988 |
| 1425 | Ga0501082_0640066 | 3300060353 | Bacteria | 930 |
| 1426 | Ga0530510_0007675 | 3300061734 | Bacteria | 7513 |
| 1427 | Ga0530510_0022171 | 3300061734 | Bacteria | 4523 |
| 1428 | Ga0530510_0056669 | 3300061734 | Bacteria | 2831 |
| 1429 | Ga0530510_0079764 | 3300061734 | Bacteria | 2381 |
| 1430 | Ga0530510_0084667 | 3300061734 | Bacteria | 2309 |
| 1431 | Ga0530510_1402924 | 3300061734 | Bacteria | 536 |
| 1432 | Ga0395899_0085278 | |||
| 1433 | ARCol0yngRDRAFT_1007316 | |||
| 1434 | JGI24743J22301_10098292 | |||
| 1435 | JGI24738J21930_10024965 | |||
| 1436 | JGI24738J21930_10029631 | |||
| 1437 | JGI24744J21845_10068284 | |||
| 1438 | JGI24033J26618_1016728 | |||
| 1439 | JGI24742J22300_10020413 | |||
| 1440 | JGI25406J46586_10005431 | |||
| 1441 | JGI25406J46586_10047029 | |||
| 1442 | JGI25407J50210_10047439 | |||
| 1443 | JGI25407J50210_10146433 | |||
| 1444 | JGI25404J52841_10067083 | |||
| 1445 | JGI25404J52841_10120774 | |||
| 1446 | JGI25405J52794_10086632 | |||
| 1447 | Ga0070658_10012764 | |||
| 1448 | Ga0070676_10102490 | |||
| 1449 | Ga0070683_100036803 | |||
| 1450 | Ga0070683_100056810 | |||
| 1451 | Ga0070683_100158156 | |||
| 1452 | Ga0070683_100718757 | |||
| 1453 | Ga0070683_100943778 | |||
| 1454 | Ga0070690_100086107 | |||
| 1455 | Ga0070690_100118177 | |||
| 1456 | Ga0070690_100165901 | |||
| 1457 | Ga0070690_100356842 | |||
| 1458 | Ga0070690_100392097 | |||
| 1459 | Ga0070690_100574117 | |||
| 1460 | Ga0070670_100003102 | |||
| 1461 | Ga0070670_100011984 | |||
| 1462 | Ga0070670_100234593 | |||
| 1463 | Ga0070670_100246306 | |||
| 1464 | Ga0070670_100344675 | |||
| 1465 | Ga0068869_100017707 | |||
| 1466 | Ga0068869_100028022 | |||
| 1467 | Ga0068869_100134212 | |||
| 1468 | Ga0068869_100271562 | |||
| 1469 | Ga0068869_100363982 | |||
| 1470 | Ga0068869_100506279 | |||
| 1471 | Ga0070680_100129890 | |||
| 1472 | Ga0070680_100330571 | |||
| 1473 | Ga0070680_100686812 | |||
| 1474 | Ga0070682_100067021 | |||
| 1475 | Ga0070682_100130242 | |||
| 1476 | Ga0070682_100199405 | |||
| 1477 | Ga0070682_100316326 | |||
| 1478 | Ga0070682_100901477 | |||
| 1479 | Ga0068868_100033190 | |||
| 1480 | Ga0068868_100036439 | |||
| 1481 | Ga0068868_100063177 | |||
| 1482 | Ga0068868_100088014 | |||
| 1483 | Ga0068868_100105931 | |||
| 1484 | Ga0068868_100343013 | |||
| 1485 | Ga0068868_100487510 | |||
| 1486 | Ga0070660_100003416 | |||
| 1487 | Ga0070660_100053871 | |||
| 1488 | Ga0070660_100094885 | |||
| 1489 | Ga0070660_100098570 | |||
| 1490 | Ga0070660_100129993 | |||
| 1491 | Ga0070660_100520196 | |||
| 1492 | Ga0070689_100034826 | |||
| 1493 | Ga0070689_100037809 | |||
| 1494 | Ga0070689_100194058 | |||
| 1495 | Ga0070691_10012486 | |||
| 1496 | Ga0070691_10024351 | |||
| 1497 | Ga0070691_10055090 | |||
| 1498 | Ga0070691_10122294 | |||
| 1499 | Ga0070691_10315208 | |||
| 1500 | Ga0070687_100022454 | |||
| 1501 | Ga0070687_100099590 | |||
| 1502 | Ga0070661_100165963 | |||
| 1503 | Ga0070661_100477099 | |||
| 1504 | Ga0070692_10105630 | |||
| 1505 | Ga0070692_10143032 | |||
| 1506 | Ga0070692_10819898 | |||
| 1507 | Ga0070668_100008802 | |||
| 1508 | Ga0070668_100023901 | |||
| 1509 | Ga0070668_100035179 | |||
| 1510 | Ga0070668_100117304 | |||
| 1511 | Ga0070668_100184561 | |||
| 1512 | Ga0070668_100202611 | |||
| 1513 | Ga0070668_100721134 | |||
| 1514 | Ga0070669_100069603 | |||
| 1515 | Ga0070669_100102629 | |||
| 1516 | Ga0070669_100585378 | |||
| 1517 | Ga0070669_100831493 | |||
| 1518 | Ga0070675_100127955 | |||
| 1519 | Ga0070675_100150137 | |||
| 1520 | Ga0070675_100195178 | |||
| 1521 | Ga0070675_100812188 | |||
| 1522 | Ga0070675_101031618 | |||
| 1523 | Ga0070675_101154434 | |||
| 1524 | Ga0070671_100192052 | |||
| 1525 | Ga0070671_100771837 | |||
| 1526 | Ga0070674_100002837 | |||
| 1527 | Ga0070674_100003211 | |||
| 1528 | Ga0070674_100005150 | |||
| 1529 | Ga0070674_100110555 | |||
| 1530 | Ga0070674_100116976 | |||
| 1531 | Ga0070674_100155832 | |||
| 1532 | Ga0070674_100367284 | |||
| 1533 | Ga0070674_100432981 | |||
| 1534 | Ga0070674_100593451 | |||
| 1535 | Ga0070673_100034265 | |||
| 1536 | Ga0070673_100089041 | |||
| 1537 | Ga0070673_100162218 | |||
| 1538 | Ga0070673_101577948 | |||
| 1539 | Ga0070688_100010486 | |||
| 1540 | Ga0070688_100014377 | |||
| 1541 | Ga0070688_100247587 | |||
| 1542 | Ga0070688_100254095 | |||
| 1543 | Ga0070659_100007542 | |||
| 1544 | Ga0070659_100056310 | |||
| 1545 | Ga0070659_100061971 | |||
| 1546 | Ga0070659_100101800 | |||
| 1547 | Ga0070659_100175769 | |||
| 1548 | Ga0070659_100283000 | |||
| 1549 | Ga0070659_100686041 | |||
| 1550 | Ga0070667_100089326 | |||
| 1551 | Ga0070667_101287804 | |||
| 1552 | Ga0070703_10016533 | |||
| 1553 | Ga0070703_10123241 | |||
| 1554 | Ga0070709_10036442 | |||
| 1555 | Ga0070709_10131341 | |||
| 1556 | Ga0070709_10171446 | |||
| 1557 | Ga0070714_100015567 | |||
| 1558 | Ga0070714_100151320 | |||
| 1559 | Ga0070714_101242849 | |||
| 1560 | Ga0070714_101889261 | |||
| 1561 | Ga0070713_100300116 | |||
| 1562 | Ga0070710_10031988 | |||
| 1563 | Ga0070710_10036978 | |||
| 1564 | Ga0070710_10344604 | |||
| 1565 | Ga0070701_10061643 | |||
| 1566 | Ga0070701_10125770 | |||
| 1567 | Ga0070701_10141065 | |||
| 1568 | Ga0070701_10467089 | |||
| 1569 | Ga0070701_10542483 | |||
| 1570 | Ga0070711_100020712 | |||
| 1571 | Ga0070711_100115395 | |||
| 1572 | Ga0070711_100271269 | |||
| 1573 | Ga0070711_100294442 | |||
| 1574 | Ga0070711_100385808 | |||
| 1575 | Ga0070711_100599230 | |||
| 1576 | Ga0070705_100194153 | |||
| 1577 | Ga0070705_100245355 | |||
| 1578 | Ga0070705_100354537 | |||
| 1579 | Ga0070705_100673169 | |||
| 1580 | Ga0070700_100064871 | |||
| 1581 | Ga0070700_100068709 | |||
| 1582 | Ga0070700_100123331 | |||
| 1583 | Ga0070700_100158226 | |||
| 1584 | Ga0070700_100193839 | |||
| 1585 | Ga0070700_100352402 | |||
| 1586 | Ga0070694_100016424 | |||
| 1587 | Ga0070694_100067018 | |||
| 1588 | Ga0070694_100144645 | |||
| 1589 | Ga0070694_100427448 | |||
| 1590 | Ga0070694_100993179 | |||
| 1591 | Ga0070708_100045730 | |||
| 1592 | Ga0070708_100150463 | |||
| 1593 | Ga0070708_100169739 | |||
| 1594 | Ga0070708_100272667 | |||
| 1595 | Ga0070708_100380477 | |||
| 1596 | Ga0070708_100902686 | |||
| 1597 | Ga0070663_100161390 | |||
| 1598 | Ga0070663_100253808 | |||
| 1599 | Ga0070663_100275742 | |||
| 1600 | Ga0070663_100407605 | |||
| 1601 | Ga0070678_100046653 | |||
| 1602 | Ga0070678_100195056 | |||
| 1603 | Ga0070678_100258067 | |||
| 1604 | Ga0070678_100277580 | |||
| 1605 | Ga0070678_100283066 | |||
| 1606 | Ga0070678_100800478 | |||
| 1607 | Ga0070678_101365946 | |||
| 1608 | Ga0070662_100020948 | |||
| 1609 | Ga0070662_100024496 | |||
| 1610 | Ga0070662_100081598 | |||
| 1611 | Ga0070662_100107635 | |||
| 1612 | Ga0070662_100321113 | |||
| 1613 | Ga0070662_100401268 | |||
| 1614 | Ga0070662_100434494 | |||
| 1615 | Ga0070681_10078887 | |||
| 1616 | Ga0070681_10084272 | |||
| 1617 | Ga0068867_100043441 | |||
| 1618 | Ga0068867_100053243 | |||
| 1619 | Ga0068867_100088986 | |||
| 1620 | Ga0068867_100095339 | |||
| 1621 | Ga0068867_100216070 | |||
| 1622 | Ga0068867_100279417 | |||
| 1623 | Ga0068867_100280288 | |||
| 1624 | Ga0068867_100292442 | |||
| 1625 | Ga0068867_101345094 | |||
| 1626 | Ga0070685_10004294 | |||
| 1627 | Ga0070685_10445953 | |||
| 1628 | Ga0070685_10905208 | |||
| 1629 | Ga0070706_100052019 | |||
| 1630 | Ga0070706_100053033 | |||
| 1631 | Ga0070706_100093204 | |||
| 1632 | Ga0070706_100183580 | |||
| 1633 | Ga0070706_100219495 | |||
| 1634 | Ga0070706_100429968 | |||
| 1635 | Ga0070707_100251581 | |||
| 1636 | Ga0070707_100432889 | |||
| 1637 | Ga0070707_100612050 | |||
| 1638 | Ga0070698_100005110 | |||
| 1639 | Ga0070698_100037645 | |||
| 1640 | Ga0070699_100017154 | |||
| 1641 | Ga0070699_100270836 | |||
| 1642 | Ga0070699_100624051 | |||
| 1643 | Ga0070699_100792020 | |||
| 1644 | Ga0070679_100047580 | |||
| 1645 | Ga0070679_100064914 | |||
| 1646 | Ga0070679_100111231 | |||
| 1647 | Ga0070679_100209256 | |||
| 1648 | Ga0070679_100370220 | |||
| 1649 | Ga0070679_100474268 | |||
| 1650 | Ga0070684_100004647 | |||
| 1651 | Ga0070684_100007114 | |||
| 1652 | Ga0070684_100012867 | |||
| 1653 | Ga0070684_100066667 | |||
| 1654 | Ga0070684_100099760 | |||
| 1655 | Ga0070684_100103888 | |||
| 1656 | Ga0070684_100270832 | |||
| 1657 | Ga0070684_100494889 | |||
| 1658 | Ga0070684_101082921 | |||
| 1659 | Ga0070697_100298371 | |||
| 1660 | Ga0068853_100043518 | |||
| 1661 | Ga0068853_100212305 | |||
| 1662 | Ga0068853_100272235 | |||
| 1663 | Ga0068853_100769707 | |||
| 1664 | Ga0070672_100019095 | |||
| 1665 | Ga0070672_100027996 | |||
| 1666 | Ga0070672_100090346 | |||
| 1667 | Ga0070686_100004853 | |||
| 1668 | Ga0070686_100093224 | |||
| 1669 | Ga0070686_100110133 | |||
| 1670 | Ga0070686_100230439 | |||
| 1671 | Ga0070695_100075746 | |||
| 1672 | Ga0070695_100127817 | |||
| 1673 | Ga0070695_100172059 | |||
| 1674 | Ga0070695_100252325 | |||
| 1675 | Ga0070695_100414782 | |||
| 1676 | Ga0070695_100805979 | |||
| 1677 | Ga0070696_100013955 | |||
| 1678 | Ga0070696_100098608 | |||
| 1679 | Ga0070696_100153009 | |||
| 1680 | Ga0070696_100165622 | |||
| 1681 | Ga0070696_100174379 | |||
| 1682 | Ga0070696_100234555 | |||
| 1683 | Ga0070696_100442914 | |||
| 1684 | Ga0070696_100640207 | |||
| 1685 | Ga0070696_100727869 | |||
| 1686 | Ga0070693_100043202 | |||
| 1687 | Ga0070693_100126027 | |||
| 1688 | Ga0070693_100227862 | |||
| 1689 | Ga0070693_100309411 | |||
| 1690 | Ga0070665_100056627 | |||
| 1691 | Ga0070665_100061371 | |||
| 1692 | Ga0070665_100220542 | |||
| 1693 | Ga0070665_100511080 | |||
| 1694 | Ga0070704_100060975 | |||
| 1695 | Ga0070704_100152483 | |||
| 1696 | Ga0070704_100414945 | |||
| 1697 | Ga0070704_100425608 | |||
| 1698 | Ga0070704_100596115 | |||
| 1699 | Ga0068855_100016339 | |||
| 1700 | Ga0068855_100168972 | |||
| 1701 | Ga0068855_100428040 | |||
| 1702 | Ga0068855_100438692 | |||
| 1703 | Ga0068855_100542470 | |||
| 1704 | Ga0068855_101271924 | |||
| 1705 | Ga0070664_100100266 | |||
| 1706 | Ga0070664_100142062 | |||
| 1707 | Ga0070664_100405063 | |||
| 1708 | Ga0070664_100407658 | |||
| 1709 | Ga0068857_100004037 | |||
| 1710 | Ga0068857_100011522 | |||
| 1711 | Ga0068857_100020799 | |||
| 1712 | Ga0068857_100292126 | |||
| 1713 | Ga0068854_100123951 | |||
| 1714 | Ga0068854_100179809 | |||
| 1715 | Ga0068854_100247219 | |||
| 1716 | Ga0068854_100726325 | |||
| 1717 | Ga0068856_100060848 | |||
| 1718 | Ga0068856_100097795 | |||
| 1719 | Ga0068856_100573304 | |||
| 1720 | Ga0068856_100638362 | |||
| 1721 | Ga0070702_100040905 | |||
| 1722 | Ga0070702_100046445 | |||
| 1723 | Ga0070702_100170928 | |||
| 1724 | Ga0070702_100824379 | |||
| 1725 | Ga0068852_100087395 | |||
| 1726 | Ga0068852_100235426 | |||
| 1727 | Ga0068852_100410728 | |||
| 1728 | Ga0068852_100575381 | |||
| 1729 | Ga0068852_100865782 | |||
| 1730 | Ga0068852_100873080 | |||
| 1731 | Ga0068859_100202672 | |||
| 1732 | Ga0068859_100359435 | |||
| 1733 | Ga0068859_100400274 | |||
| 1734 | Ga0068859_100721639 | |||
| 1735 | Ga0068864_100053215 | |||
| 1736 | Ga0068864_100253783 | |||
| 1737 | Ga0068864_100665662 | |||
| 1738 | Ga0068866_10059006 | |||
| 1739 | Ga0068866_10146938 | |||
| 1740 | Ga0068866_10275803 | |||
| 1741 | Ga0068866_10352421 | |||
| 1742 | Ga0068866_10543224 | |||
| 1743 | Ga0068861_100000599 | |||
| 1744 | Ga0068861_100046527 | |||
| 1745 | Ga0068861_100048989 | |||
| 1746 | Ga0068861_100069266 | |||
| 1747 | Ga0068861_100113228 | |||
| 1748 | Ga0068861_100900817 | |||
| 1749 | Ga0068870_10066313 | |||
| 1750 | Ga0068870_10119604 | |||
| 1751 | Ga0068870_10127191 | |||
| 1752 | Ga0068870_10149567 | |||
| 1753 | Ga0068863_100118758 | |||
| 1754 | Ga0068863_100175600 | |||
| 1755 | Ga0068863_101106831 | |||
| 1756 | Ga0068858_100082667 | |||
| 1757 | Ga0068858_100591675 | |||
| 1758 | Ga0068858_100909185 | |||
| 1759 | Ga0068860_100135445 | |||
| 1760 | Ga0068860_100321916 | |||
| 1761 | Ga0068860_100336356 | |||
| 1762 | Ga0068862_100034106 | |||
| 1763 | Ga0068862_100108242 | |||
| 1764 | Ga0081455_10037793 | |||
| 1765 | Ga0081455_10046700 | |||
| 1766 | Ga0081538_10002668 | |||
| 1767 | Ga0081538_10030418 | |||
| 1768 | Ga0081538_10065202 | |||
| 1769 | Ga0081538_10097573 | |||
| 1770 | Ga0081540_1000590 | |||
| 1771 | Ga0081540_1001254 | |||
| 1772 | Ga0081539_10000703 | |||
| 1773 | Ga0081539_10081023 | |||
| 1774 | Ga0081539_10171682 | |||
| 1775 | Ga0070717_10091885 | |||
| 1776 | Ga0070717_10117219 | |||
| 1777 | Ga0070717_10770850 | |||
| 1778 | Ga0075364_10512529 | |||
| 1779 | Ga0075432_10000155 | |||
| 1780 | Ga0070715_10010700 | |||
| 1781 | Ga0070715_10012518 | |||
| 1782 | Ga0070715_10012523 | |||
| 1783 | Ga0070716_100021841 | |||
| 1784 | Ga0070716_100085983 | |||
| 1785 | Ga0070716_100134939 | |||
| 1786 | Ga0070712_100011954 | |||
| 1787 | Ga0070712_100018248 | |||
| 1788 | Ga0070712_100033365 | |||
| 1789 | Ga0070712_100037758 | |||
| 1790 | Ga0070712_100199842 | |||
| 1791 | Ga0070712_100234317 | |||
| 1792 | Ga0070712_100316078 | |||
| 1793 | Ga0070712_100548503 | |||
| 1794 | Ga0075366_10412377 | |||
| 1795 | Ga0097621_100074602 | |||
| 1796 | Ga0097621_100614578 | |||
| 1797 | Ga0068871_100152298 | |||
| 1798 | Ga0068871_100234253 | |||
| 1799 | Ga0068871_100335837 | |||
| 1800 | Ga0068871_100606677 | |||
| 1801 | Ga0075428_100073425 | |||
| 1802 | Ga0075428_100365622 | |||
| 1803 | Ga0075428_100554153 | |||
| 1804 | Ga0075431_100153427 | |||
| 1805 | Ga0075431_100188109 | |||
| 1806 | Ga0075431_101092075 | |||
| 1807 | Ga0075433_10024795 | |||
| 1808 | Ga0075433_10196771 | |||
| 1809 | Ga0075433_10226438 | |||
| 1810 | Ga0075433_10231012 | |||
| 1811 | Ga0075433_10258125 | |||
| 1812 | Ga0075433_10293584 | |||
| 1813 | Ga0075433_10501386 | |||
| 1814 | Ga0075434_100015405 | |||
| 1815 | Ga0075434_100023080 | |||
| 1816 | Ga0075434_100053669 | |||
| 1817 | Ga0075434_100215977 | |||
| 1818 | Ga0075434_100405360 | |||
| 1819 | Ga0075434_100672199 | |||
| 1820 | Ga0075429_100231728 | |||
| 1821 | Ga0075429_100541247 | |||
| 1822 | Ga0075429_100665094 | |||
| 1823 | Ga0068865_100048111 | |||
| 1824 | Ga0068865_100061984 | |||
| 1825 | Ga0068865_100079460 | |||
| 1826 | Ga0068865_100099768 | |||
| 1827 | Ga0068865_100169145 | |||
| 1828 | Ga0068865_100417997 | |||
| 1829 | Ga0068865_100450857 | |||
| 1830 | Ga0068865_100628141 | |||
| 1831 | Ga0068865_101043265 | |||
| 1832 | Ga0075436_100012943 | |||
| 1833 | Ga0075436_100020689 | |||
| 1834 | Ga0075436_100062021 | |||
| 1835 | Ga0075436_100299784 | |||
| 1836 | Ga0075436_100488538 | |||
| 1837 | Ga0075436_100635917 | |||
| 1838 | Ga0097620_100202699 | |||
| 1839 | Ga0097620_100359476 | |||
| 1840 | Ga0097620_100400273 | |||
| 1841 | Ga0097620_100721662 | |||
| 1842 | Ga0075435_100006892 | |||
| 1843 | Ga0075435_100016752 | |||
| 1844 | Ga0075435_100021969 | |||
| 1845 | Ga0075435_100024707 | |||
| 1846 | Ga0075435_100225537 | |||
| 1847 | Ga0105244_10079253 | |||
| 1848 | Ga0105240_10769711 | |||
| 1849 | Ga0105240_10796596 | |||
| 1850 | Ga0105240_12033788 | |||
| 1851 | Ga0111539_10050201 | |||
| 1852 | Ga0111539_10060535 | |||
| 1853 | Ga0111539_10064029 | |||
| 1854 | Ga0111539_10213992 | |||
| 1855 | Ga0111539_10436134 | |||
| 1856 | Ga0111539_10441308 | |||
| 1857 | Ga0111539_11462295 | |||
| 1858 | Ga0105245_10029388 | |||
| 1859 | Ga0105245_10039116 | |||
| 1860 | Ga0105245_10052784 | |||
| 1861 | Ga0105245_10101084 | |||
| 1862 | Ga0105245_10110975 | |||
| 1863 | Ga0105245_10116618 | |||
| 1864 | Ga0105245_10143381 | |||
| 1865 | Ga0105245_10198946 | |||
| 1866 | Ga0105245_10205561 | |||
| 1867 | Ga0105245_10276106 | |||
| 1868 | Ga0105245_10414029 | |||
| 1869 | Ga0105245_10462975 | |||
| 1870 | Ga0105245_11182692 | |||
| 1871 | Ga0105247_10009470 | |||
| 1872 | Ga0105247_10773498 | |||
| 1873 | Ga0114129_10021521 | |||
| 1874 | Ga0114129_10041728 | |||
| 1875 | Ga0114129_10198491 | |||
| 1876 | Ga0114129_10584178 | |||
| 1877 | Ga0114129_10773584 | |||
| 1878 | Ga0114129_12431135 | |||
| 1879 | Ga0105243_10006578 | |||
| 1880 | Ga0105243_10011319 | |||
| 1881 | Ga0105243_10057101 | |||
| 1882 | Ga0105243_10063674 | |||
| 1883 | Ga0105243_10134597 | |||
| 1884 | Ga0105243_10140568 | |||
| 1885 | Ga0105243_10197702 | |||
| 1886 | Ga0105243_10241525 | |||
| 1887 | Ga0105243_10367601 | |||
| 1888 | Ga0105243_11115109 | |||
| 1889 | Ga0105241_10055814 | |||
| 1890 | Ga0105241_10093317 | |||
| 1891 | Ga0105241_10271712 | |||
| 1892 | Ga0105242_10016338 | |||
| 1893 | Ga0105242_10030820 | |||
| 1894 | Ga0105242_10032691 | |||
| 1895 | Ga0105242_10052227 | |||
| 1896 | Ga0105242_10076487 | |||
| 1897 | Ga0105242_10077096 | |||
| 1898 | Ga0105242_10096406 | |||
| 1899 | Ga0105242_10096880 | |||
| 1900 | Ga0105242_10759820 | |||
| 1901 | Ga0105242_10967007 | |||
| 1902 | Ga0105248_10050144 | |||
| 1903 | Ga0105248_10467919 | |||
| 1904 | Ga0105248_10535495 | |||
| 1905 | Ga0105248_10590999 | |||
| 1906 | Ga0105237_10015040 | |||
| 1907 | Ga0105237_10048627 | |||
| 1908 | Ga0105237_10495547 | |||
| 1909 | Ga0105238_10029146 | |||
| 1910 | Ga0105238_10496657 | |||
| 1911 | Ga0105238_10966484 | |||
| 1912 | Ga0105249_10021215 | |||
| 1913 | Ga0105249_10086108 | |||
| 1914 | Ga0105249_10163393 | |||
| 1915 | Ga0105249_10228366 | |||
| 1916 | Ga0105249_10248920 | |||
| 1917 | Ga0105249_10368490 | |||
| 1918 | Ga0105249_10378417 | |||
| 1919 | Ga0105249_10688780 | |||
| 1920 | Ga0105249_11336260 | |||
| 1921 | Ga0105239_10070973 | |||
| 1922 | Ga0105239_10099109 | |||
| 1923 | Ga0105239_10126075 | |||
| 1924 | Ga0105239_10138061 | |||
| 1925 | Ga0105239_10830870 | |||
| 1926 | Ga0105239_12679287 | |||
| 1927 | Ga0105246_10006452 | |||
| 1928 | Ga0105246_10016365 | |||
| 1929 | Ga0105246_10062964 | |||
| 1930 | Ga0105246_10109949 | |||
| 1931 | Ga0105246_10204879 | |||
| 1932 | Ga0105246_10307743 | |||
| 1933 | Ga0157343_1032006 | |||
| 1934 | Ga0157345_1007395 | |||
| 1935 | Ga0157347_1003770 | |||
| 1936 | Ga0157316_1002248 | |||
| 1937 | Ga0157371_10120348 | |||
| 1938 | Ga0157371_10256471 | |||
| 1939 | Ga0157371_10478408 | |||
| 1940 | Ga0157370_10312908 | |||
| 1941 | Ga0157369_10320317 | |||
| 1942 | Ga0157369_10509513 | |||
| 1943 | Ga0157374_10011101 | |||
| 1944 | Ga0157378_10099887 | |||
| 1945 | Ga0157378_10141795 | |||
| 1946 | Ga0157378_10474183 | |||
| 1947 | Ga0163162_10036711 | |||
| 1948 | Ga0163162_10128466 | |||
| 1949 | Ga0163162_10192049 | |||
| 1950 | Ga0163162_10258117 | |||
| 1951 | Ga0163162_10271857 | |||
| 1952 | Ga0163162_10278962 | |||
| 1953 | Ga0163162_10279332 | |||
| 1954 | Ga0163162_10497608 | |||
| 1955 | Ga0157372_10067977 | |||
| 1956 | Ga0157372_10093044 | |||
| 1957 | Ga0157372_10246342 | |||
| 1958 | Ga0157372_10834300 | |||
| 1959 | Ga0157375_10195347 | |||
| 1960 | Ga0157375_10922586 | |||
| 1961 | Ga0163163_10015084 | |||
| 1962 | Ga0163163_10375679 | |||
| 1963 | Ga0163163_10882333 | |||
| 1964 | Ga0157380_10017463 | |||
| 1965 | Ga0157380_10097198 | |||
| 1966 | Ga0157380_10446768 | |||
| 1967 | Ga0157380_10670005 | |||
| 1968 | Ga0157380_10875598 | |||
| 1969 | Ga0157380_10948203 | |||
| 1970 | Ga0182008_10054314 | |||
| 1971 | Ga0157377_10003069 | |||
| 1972 | Ga0157377_10021451 | |||
| 1973 | Ga0157377_10058025 | |||
| 1974 | Ga0157377_10072645 | |||
| 1975 | Ga0157377_10246932 | |||
| 1976 | Ga0157377_10672762 | |||
| 1977 | Ga0157379_10080456 | |||
| 1978 | Ga0157379_10184896 | |||
| 1979 | Ga0157379_10352025 | |||
| 1980 | Ga0157376_10013044 | |||
| 1981 | Ga0157376_10109741 | |||
| 1982 | Ga0157376_10119793 | |||
| 1983 | Ga0157376_10206466 | |||
| 1984 | Ga0157376_10353997 | |||
| 1985 | Ga0157376_11030461 | |||
| 1986 | Ga0163161_10250273 | |||
| 1987 | Ga0163161_10534486 | |||
| 1988 | Ga0163161_10588271 | |||
| 1989 | Ga0197907_10034126 | |||
| 1990 | Ga0206356_10954049 | |||
| 1991 | Ga0206351_10526121 | |||
| 1992 | Ga0154015_1595217 | |||
| 1993 | Ga0207653_10107940 | |||
| 1994 | Ga0207682_10088969 | |||
| 1995 | Ga0207692_10028356 | |||
| 1996 | Ga0207692_10127545 | |||
| 1997 | Ga0207692_10154858 | |||
| 1998 | Ga0207642_10064556 | |||
| 1999 | Ga0207642_10078813 | |||
| 2000 | Ga0207642_10114574 | |||
| 2001 | Ga0207642_10166824 | |||
| 2002 | Ga0207642_10182252 | |||
| 2003 | Ga0207710_10044000 | |||
| 2004 | Ga0207688_10010947 | |||
| 2005 | Ga0207688_10023379 | |||
| 2006 | Ga0207688_10060800 | |||
| 2007 | Ga0207688_10129549 | |||
| 2008 | Ga0207688_10140522 | |||
| 2009 | Ga0207688_10320817 | |||
| 2010 | Ga0207647_10228702 | |||
| 2011 | Ga0207647_10384018 | |||
| 2012 | Ga0207647_10592550 | |||
| 2013 | Ga0207685_10019344 | |||
| 2014 | Ga0207685_10023237 | |||
| 2015 | Ga0207685_10037253 | |||
| 2016 | Ga0207699_10054307 | |||
| 2017 | Ga0207699_10134884 | |||
| 2018 | Ga0207699_10279802 | |||
| 2019 | Ga0207699_10324534 | |||
| 2020 | Ga0207645_10109233 | |||
| 2021 | Ga0207645_10568272 | |||
| 2022 | Ga0207643_10002816 | |||
| 2023 | Ga0207643_10025874 | |||
| 2024 | Ga0207643_10040727 | |||
| 2025 | Ga0207643_10062187 | |||
| 2026 | Ga0207643_10117875 | |||
| 2027 | Ga0207643_10239322 | |||
| 2028 | Ga0207643_10268049 | |||
| 2029 | Ga0207643_10315182 | |||
| 2030 | Ga0207684_10064241 | |||
| 2031 | Ga0207684_10220098 | |||
| 2032 | Ga0207684_10240866 | |||
| 2033 | Ga0207684_10510184 | |||
| 2034 | Ga0207654_10096981 | |||
| 2035 | Ga0207654_10240261 | |||
| 2036 | Ga0207707_10133645 | |||
| 2037 | Ga0207693_10002498 | |||
| 2038 | Ga0207693_10018661 | |||
| 2039 | Ga0207693_10036223 | |||
| 2040 | Ga0207693_10050225 | |||
| 2041 | Ga0207693_10127663 | |||
| 2042 | Ga0207693_10259736 | |||
| 2043 | Ga0207693_10311402 | |||
| 2044 | Ga0207693_10823905 | |||
| 2045 | Ga0207663_10016048 | |||
| 2046 | Ga0207663_10076207 | |||
| 2047 | Ga0207663_10113988 | |||
| 2048 | Ga0207663_10162570 | |||
| 2049 | Ga0207663_10177147 | |||
| 2050 | Ga0207663_10269088 | |||
| 2051 | Ga0207663_10436539 | |||
| 2052 | Ga0207660_10654854 | |||
| 2053 | Ga0207660_11499648 | |||
| 2054 | Ga0207662_10126476 | |||
| 2055 | Ga0207662_10141647 | |||
| 2056 | Ga0207657_10009576 | |||
| 2057 | Ga0207657_10160038 | |||
| 2058 | Ga0207657_10269221 | |||
| 2059 | Ga0207649_10021599 | |||
| 2060 | Ga0207649_10619038 | |||
| 2061 | Ga0207652_10061423 | |||
| 2062 | Ga0207646_10019475 | |||
| 2063 | Ga0207646_10126372 | |||
| 2064 | Ga0207646_10370200 | |||
| 2065 | Ga0207681_10243080 | |||
| 2066 | Ga0207681_10270249 | |||
| 2067 | Ga0207681_10391355 | |||
| 2068 | Ga0207694_10327561 | |||
| 2069 | Ga0207650_10020925 | |||
| 2070 | Ga0207659_10029480 | |||
| 2071 | Ga0207659_10180965 | |||
| 2072 | Ga0207659_10595631 | |||
| 2073 | Ga0207687_10004254 | |||
| 2074 | Ga0207687_10012189 | |||
| 2075 | Ga0207687_10015050 | |||
| 2076 | Ga0207687_10114580 | |||
| 2077 | Ga0207687_10208548 | |||
| 2078 | Ga0207687_10219686 | |||
| 2079 | Ga0207687_10223261 | |||
| 2080 | Ga0207687_10224560 | |||
| 2081 | Ga0207687_10463861 | |||
| 2082 | Ga0207687_11060481 | |||
| 2083 | Ga0207687_11222077 | |||
| 2084 | Ga0207700_10166176 | |||
| 2085 | Ga0207700_10167076 | |||
| 2086 | Ga0207700_10410889 | |||
| 2087 | Ga0207700_10458413 | |||
| 2088 | Ga0207700_10802040 | |||
| 2089 | Ga0207664_10021336 | |||
| 2090 | Ga0207664_10029771 | |||
| 2091 | Ga0207664_10186199 | |||
| 2092 | Ga0207664_10246137 | |||
| 2093 | Ga0207664_10272445 | |||
| 2094 | Ga0207664_10524645 | |||
| 2095 | Ga0207644_10020746 | |||
| 2096 | Ga0207690_10050965 | |||
| 2097 | Ga0207690_10059272 | |||
| 2098 | Ga0207690_10103432 | |||
| 2099 | Ga0207690_10133479 | |||
| 2100 | Ga0207690_10282275 | |||
| 2101 | Ga0207690_10376894 | |||
| 2102 | Ga0207690_11147224 | |||
| 2103 | Ga0207706_10014996 | |||
| 2104 | Ga0207706_10017665 | |||
| 2105 | Ga0207706_10034581 | |||
| 2106 | Ga0207706_10201463 | |||
| 2107 | Ga0207706_10320465 | |||
| 2108 | Ga0207686_10047744 | |||
| 2109 | Ga0207686_10179831 | |||
| 2110 | Ga0207686_10248019 | |||
| 2111 | Ga0207686_10403144 | |||
| 2112 | Ga0207686_10496213 | |||
| 2113 | Ga0207686_10641430 | |||
| 2114 | Ga0207709_10007458 | |||
| 2115 | Ga0207709_10028024 | |||
| 2116 | Ga0207709_10049157 | |||
| 2117 | Ga0207709_10059205 | |||
| 2118 | Ga0207709_10063968 | |||
| 2119 | Ga0207709_10073340 | |||
| 2120 | Ga0207709_10229928 | |||
| 2121 | Ga0207709_10781300 | |||
| 2122 | Ga0207670_10670937 | |||
| 2123 | Ga0207669_10017533 | |||
| 2124 | Ga0207669_10042619 | |||
| 2125 | Ga0207669_10051244 | |||
| 2126 | Ga0207669_10121335 | |||
| 2127 | Ga0207669_10139874 | |||
| 2128 | Ga0207669_10287953 | |||
| 2129 | Ga0207669_11071641 | |||
| 2130 | Ga0207704_10101644 | |||
| 2131 | Ga0207704_10161627 | |||
| 2132 | Ga0207704_10317308 | |||
| 2133 | Ga0207704_10341616 | |||
| 2134 | Ga0207704_10461063 | |||
| 2135 | Ga0207704_10557025 | |||
| 2136 | Ga0207665_10008549 | |||
| 2137 | Ga0207665_10020234 | |||
| 2138 | Ga0207665_10108498 | |||
| 2139 | Ga0207665_10159043 | |||
| 2140 | Ga0207665_10225971 | |||
| 2141 | Ga0207665_10274467 | |||
| 2142 | Ga0207691_10015901 | |||
| 2143 | Ga0207691_10019041 | |||
| 2144 | Ga0207691_10031849 | |||
| 2145 | Ga0207691_10058080 | |||
| 2146 | Ga0207691_10540158 | |||
| 2147 | Ga0207711_10116605 | |||
| 2148 | Ga0207711_10138117 | |||
| 2149 | Ga0207711_10162507 | |||
| 2150 | Ga0207711_10230166 | |||
| 2151 | Ga0207689_10022143 | |||
| 2152 | Ga0207689_10250401 | |||
| 2153 | Ga0207689_10515065 | |||
| 2154 | Ga0207661_10106385 | |||
| 2155 | Ga0207661_10139290 | |||
| 2156 | Ga0207661_10698480 | |||
| 2157 | Ga0207661_10793094 | |||
| 2158 | Ga0207679_10030086 | |||
| 2159 | Ga0207679_10156956 | |||
| 2160 | Ga0207679_10190185 | |||
| 2161 | Ga0207679_11037327 | |||
| 2162 | Ga0207667_10028849 | |||
| 2163 | Ga0207667_10307206 | |||
| 2164 | Ga0207667_10318041 | |||
| 2165 | Ga0207667_10403240 | |||
| 2166 | Ga0207667_10422283 | |||
| 2167 | Ga0207667_10518044 | |||
| 2168 | Ga0207651_10025016 | |||
| 2169 | Ga0207651_10049676 | |||
| 2170 | Ga0207712_10051337 | |||
| 2171 | Ga0207712_10130904 | |||
| 2172 | Ga0207712_10131142 | |||
| 2173 | Ga0207712_10231211 | |||
| 2174 | Ga0207668_10060117 | |||
| 2175 | Ga0207668_10096545 | |||
| 2176 | Ga0207668_10143518 | |||
| 2177 | Ga0207668_10639183 | |||
| 2178 | Ga0207668_10698980 | |||
| 2179 | Ga0207640_10033675 | |||
| 2180 | Ga0207640_10124284 | |||
| 2181 | Ga0207640_10278763 | |||
| 2182 | Ga0207640_10322705 | |||
| 2183 | Ga0207640_10395194 | |||
| 2184 | Ga0207640_10493448 | |||
| 2185 | Ga0207677_10040146 | |||
| 2186 | Ga0207677_10047667 | |||
| 2187 | Ga0207677_10114534 | |||
| 2188 | Ga0207677_10195662 | |||
| 2189 | Ga0207677_10238564 | |||
| 2190 | Ga0207677_10571198 | |||
| 2191 | Ga0207677_10659398 | |||
| 2192 | Ga0207703_10073429 | |||
| 2193 | Ga0207703_10294061 | |||
| 2194 | Ga0207703_10294695 | |||
| 2195 | Ga0207703_10448044 | |||
| 2196 | Ga0207703_10618749 | |||
| 2197 | Ga0207639_10006229 | |||
| 2198 | Ga0207639_10048829 | |||
| 2199 | Ga0207639_10522109 | |||
| 2200 | Ga0207639_10722774 | |||
| 2201 | Ga0207639_11209501 | |||
| 2202 | Ga0207678_10057996 | |||
| 2203 | Ga0207678_10132769 | |||
| 2204 | Ga0207678_10376675 | |||
| 2205 | Ga0207678_10400255 | |||
| 2206 | Ga0207678_10651380 | |||
| 2207 | Ga0207708_10002498 | |||
| 2208 | Ga0207708_10002644 | |||
| 2209 | Ga0207708_10010840 | |||
| 2210 | Ga0207708_10034049 | |||
| 2211 | Ga0207708_10051722 | |||
| 2212 | Ga0207708_10099011 | |||
| 2213 | Ga0207708_10196499 | |||
| 2214 | Ga0207708_10212032 | |||
| 2215 | Ga0207708_10841265 | |||
| 2216 | Ga0207702_10005791 | |||
| 2217 | Ga0207702_10031806 | |||
| 2218 | Ga0207702_10186855 | |||
| 2219 | Ga0207641_10117643 | |||
| 2220 | Ga0207641_10215924 | |||
| 2221 | Ga0207641_10870587 | |||
| 2222 | Ga0207648_10025309 | |||
| 2223 | Ga0207648_10036493 | |||
| 2224 | Ga0207648_10039704 | |||
| 2225 | Ga0207648_10067743 | |||
| 2226 | Ga0207648_10080618 | |||
| 2227 | Ga0207648_10081260 | |||
| 2228 | Ga0207648_10110686 | |||
| 2229 | Ga0207648_10205823 | |||
| 2230 | Ga0207648_10324647 | |||
| 2231 | Ga0207648_10825367 | |||
| 2232 | Ga0207676_10088485 | |||
| 2233 | Ga0207676_10199770 | |||
| 2234 | Ga0207676_10261170 | |||
| 2235 | Ga0207674_10009027 | |||
| 2236 | Ga0207674_10010087 | |||
| 2237 | Ga0207674_10016296 | |||
| 2238 | Ga0207675_100000456 | |||
| 2239 | Ga0207675_100018997 | |||
| 2240 | Ga0207675_100073717 | |||
| 2241 | Ga0207675_100089183 | |||
| 2242 | Ga0207675_100121938 | |||
| 2243 | Ga0207675_100123267 | |||
| 2244 | Ga0207675_100171554 | |||
| 2245 | Ga0207675_100175737 | |||
| 2246 | Ga0207675_100287596 | |||
| 2247 | Ga0207675_100636719 | |||
| 2248 | Ga0207683_10040192 | |||
| 2249 | Ga0207683_10063509 | |||
| 2250 | Ga0207683_10131380 | |||
| 2251 | Ga0207683_10141762 | |||
| 2252 | Ga0207683_10170683 | |||
| 2253 | Ga0207683_10212682 | |||
| 2254 | Ga0207683_10393726 | |||
| 2255 | Ga0207683_11029184 | |||
| 2256 | Ga0207698_10017238 | |||
| 2257 | Ga0207698_10264721 | |||
| 2258 | Ga0207698_10785972 | |||
| 2259 | Ga0207698_12321226 | |||
| 2260 | Ga0209966_1010510 | |||
| 2261 | Ga0207428_10008373 | |||
| 2262 | Ga0207428_10065628 | |||
| 2263 | Ga0207428_10135745 | |||
| 2264 | Ga0207428_10177002 | |||
| 2265 | Ga0207428_10350594 | |||
| 2266 | Ga0268266_10075392 | |||
| 2267 | Ga0268266_10196349 | |||
| 2268 | Ga0268265_10702823 | |||
| 2269 | Ga0268265_10721384 | |||
| 2270 | Ga0268264_10325107 | |||
| 2271 | Ga0268264_10334318 | |||
| 2272 | Ga0265319_1017933 | |||
| 2273 | Ga0265336_10115141 | |||
| 2274 | Ga0265320_10034685 | |||
| 2275 | Ga0307408_100191017 | |||
| 2276 | Ga0307405_10091971 | |||
| 2277 | Ga0307413_10016101 | |||
| 2278 | Ga0307410_10035377 | |||
| 2279 | Ga0307410_10196538 | |||
| 2280 | Ga0307410_10713524 | |||
| 2281 | Ga0307406_10196163 | |||
| 2282 | Ga0307406_10260230 | |||
| 2283 | Ga0307407_10162051 | |||
| 2284 | Ga0307407_10873563 | |||
| 2285 | Ga0307412_10119979 | |||
| 2286 | Ga0307412_10140262 | |||
| 2287 | Ga0307409_100008431 | |||
| 2288 | Ga0307409_100020656 | |||
| 2289 | Ga0307409_100347884 | |||
| 2290 | Ga0307409_100633503 | |||
| 2291 | Ga0307416_100118177 | |||
| 2292 | Ga0307416_100158384 | |||
| 2293 | Ga0307416_100332888 | |||
| 2294 | Ga0307416_100409494 | |||
| 2295 | Ga0307416_101692907 | |||
| 2296 | Ga0307414_10156013 | |||
| 2297 | Ga0307411_10082526 | |||
| 2298 | Ga0307411_11269228 | |||
| 2299 | Ga0307415_100002060 | |||
| 2300 | Ga0307415_100016576 | |||
| 2301 | Ga0307415_101528606 | |||
| 2302 | Ga0373930_0016150 | |||
| 2303 | Ga0373950_0078580 | |||
| 2304 | Ga0373958_0029367 | |||
| 2305 | Ga0373959_0009849 | |||
| 2306 | Ga0373959_0011086 | |||
| 2307 | Ga0373938_0094675 | |||
| 2308 | Ga0373926_0199038 | |||
| 2309 | Ga0373926_0264729 | |||
| 2310 | Ga0373934_0028206 | |||
| 2311 | Ga0373944_0007084 | |||
| 2312 | Ga0373949_0060086 | |||
| 2313 | Ga0373949_0123755 | |||
| 2314 | Ga0373951_0009369 | |||
| 2315 | Ga0373951_0023308 | |||
| 2316 | Ga0373952_0014944 | |||
| 2317 | Ga0373923_0053137 | |||
| 2318 | Ga0373932_0067963 | |||
| 2319 | Ga0373936_0483993 | |||
| 2320 | Ga0373939_0053177 | |||
| 2321 | Ga0373945_0077931 | |||
| 2322 | Ga0373960_0036232 | |||
| 2323 | Ga0373960_0099734 | |||
| 2324 | Ga0373943_0147169 | |||
| 2325 | Ga0373943_0205563 | |||
| 2326 | Ga0373946_0002051 | |||
| 2327 | Ga0373955_0073938 | |||
| 2328 | Ga0373942_0034540 | |||
| 2329 | Ga0373961_0043098 | |||
| 2330 | Ga0373961_0266546 | |||
| 2331 | Ga0373924_0004046 | |||
| 2332 | Ga0373931_0026542 | |||
| 2333 | Ga0373931_0412068 | |||
| 2334 | Ga0373931_0535234 | |||
| 2335 | Ga0373935_0015165 | |||
| 2336 | Ga0373927_0067374 | |||
| 2337 | Ga0373947_0031960 | |||
| 2338 | Ga0373947_0060437 | |||
| 2339 | Ga0373937_0113050 | |||
| 2340 | Ga0373925_0029385 | |||
| 2341 | Ga0373925_0610221 | |||
| 2342 | Ga0395899_0002389 | |||
| 2343 | Ga0395899_0004758 | |||
| 2344 | Ga0395899_0005459 | |||
| 2345 | Ga0395899_0031395 | |||
| 2346 | Ga0395899_0073312 | |||
| 2347 | Ga0395899_0140291 | |||
| 2348 | Ga0395899_0999086 | |||
| 2349 | Ga0395900_0003865 | |||
| 2350 | Ga0395900_0004269 | |||
| 2351 | Ga0395900_0006467 | |||
| 2352 | Ga0395900_0045074 | |||
| 2353 | Ga0395900_0065219 | |||
| 2354 | Ga0395900_0073472 | |||
| 2355 | Ga0395900_0076922 | |||
| 2356 | Ga0395900_0132622 | |||
| 2357 | Ga0395900_0158166 | |||
| 2358 | Ga0395900_0222536 | |||
| 2359 | Ga0395900_0249710 | |||
| 2360 | Ga0395900_0501994 | |||
| 2361 | Ga0395898_0002662 | |||
| 2362 | Ga0395898_0006058 | |||
| 2363 | Ga0395898_0013863 | |||
| 2364 | Ga0395898_0036964 | |||
| 2365 | Ga0395898_0041218 | |||
| 2366 | Ga0395898_0045759 | |||
| 2367 | Ga0395898_0057707 | |||
| 2368 | Ga0395898_0076593 | |||
| 2369 | Ga0395898_0184384 | |||
| 2370 | Ga0395898_0564027 | |||
| 2371 | Ga0395905_0002146 | |||
| 2372 | Ga0395905_0005265 | |||
| 2373 | Ga0395905_0008385 | |||
| 2374 | Ga0395905_0011371 | |||
| 2375 | Ga0395905_0031674 | |||
| 2376 | Ga0395905_0091134 | |||
| 2377 | Ga0395905_0184014 | |||
| 2378 | Ga0395905_0214012 | |||
| 2379 | Ga0395905_0235168 | |||
| 2380 | Ga0395905_0236416 | |||
| 2381 | Ga0395905_0829839 | |||
| 2382 | Ga0395901_0006015 | |||
| 2383 | Ga0395901_0006940 | |||
| 2384 | Ga0395901_0007324 | |||
| 2385 | Ga0395901_0019275 | |||
| 2386 | Ga0395901_0022266 | |||
| 2387 | Ga0395901_0025311 | |||
| 2388 | Ga0395901_0093690 | |||
| 2389 | Ga0395901_0125839 | |||
| 2390 | Ga0395901_0205751 | |||
| 2391 | Ga0395901_0331232 | |||
| 2392 | Ga0395901_0484208 | |||
| 2393 | Ga0395901_0493973 | |||
| 2394 | Ga0395901_0595403 | |||
| 2395 | Ga0395901_0945401 | |||
| 2396 | Ga0451806_104958 | |||
| 2397 | Ga0451807_2561596 | |||
| 2398 | Ga0451807_2718629 | |||
| 2399 | Ga0451835_0716306 | |||
| 2400 | Ga0451847_0100796 | |||
| 2401 | Ga0451853_1497062 | |||
| 2402 | Ga0451853_2737307 | |||
| 2403 | Ga0451853_3950287 | |||
| 2404 | Ga0439448_0020774 | |||
| 2405 | Ga0439448_0082300 | |||
| 2406 | Ga0439448_0106957 | |||
| 2407 | Ga0439455_0024558 | |||
| 2408 | Ga0439463_012862 | |||
| 2409 | Ga0439463_017975 | |||
| 2410 | Ga0439458_0023962 | |||
| 2411 | Ga0439435_0095507 | |||
| 2412 | Ga0439435_0330922 | |||
| 2413 | Ga0439459_0036808 | |||
| 2414 | Ga0450918_030128 | |||
| 2415 | Ga0439440_0107344 | |||
| 2416 | Ga0439440_0130573 | |||
| 2417 | Ga0466972_0096530 | |||
| 2418 | Ga0466972_0410359 | |||
| 2419 | Ga0466965_0429253 | |||
| 2420 | Ga0466963_0039561 | |||
| 2421 | Ga0466964_0000687 | |||
| 2422 | Ga0453684_0055532 | |||
| 2423 | Ga0466968_0038954 | |||
| 2424 | Ga0466957_0098346 | |||
| 2425 | Ga0466960_0031848 | |||
| 2426 | Ga0466960_0086628 | |||
| 2427 | Ga0466960_0203660 | |||
| 2428 | Ga0451576_0057008 | |||
| 2429 | Ga0451576_0884761 | |||
| 2430 | Ga0466958_0232209 | |||
| 2431 | Ga0466967_0001643 | |||
| 2432 | Ga0466967_0002463 | |||
| 2433 | Ga0466967_0099330 | |||
| 2434 | Ga0495592_0366819 | |||
| 2435 | Ga0495603_0024460 | |||
| 2436 | Ga0495603_0051869 | |||
| 2437 | Ga0495590_0241143 | |||
| 2438 | Ga0495629_0047837 | |||
| 2439 | Ga0495629_0088315 | |||
| 2440 | Ga0495629_0126979 | |||
| 2441 | Ga0495641_0011598 | |||
| 2442 | Ga0495641_0029367 | |||
| 2443 | Ga0495651_0079494 | |||
| 2444 | Ga0495653_0029808 | |||
| 2445 | Ga0495580_0290049 | |||
| 2446 | Ga0495582_0023062 | |||
| 2447 | Ga0495582_0206229 | |||
| 2448 | Ga0495639_0009246 | |||
| 2449 | Ga0495662_0020440 | |||
| 2450 | Ga0495662_0089407 | |||
| 2451 | Ga0495584_0147807 | |||
| 2452 | Ga0495584_0276073 | |||
| 2453 | Ga0495596_0020094 | |||
| 2454 | Ga0495596_0056305 | |||
| 2455 | Ga0495608_0007758 | |||
| 2456 | Ga0495616_0280243 | |||
| 2457 | Ga0495618_0203273 | |||
| 2458 | Ga0495620_0052722 | |||
| 2459 | Ga0495628_0217670 | |||
| 2460 | Ga0495630_0035115 | |||
| 2461 | Ga0495630_0053277 | |||
| 2462 | Ga0495630_0288926 | |||
| 2463 | Ga0495637_0099949 | |||
| 2464 | Ga0495663_0116328 | |||
| 2465 | Ga0495663_0174097 | |||
| 2466 | Ga0495666_0062918 | |||
| 2467 | Ga0495642_0142218 | |||
| 2468 | Ga0495642_0384008 | |||
| 2469 | Ga0495652_0222055 | |||
| 2470 | Ga0495665_0016491 | |||
| 2471 | Ga0495665_0275480 | |||
| 2472 | Ga0495640_0017760 | |||
| 2473 | Ga0495640_0209351 | |||
| 2474 | Ga0495586_0142236 | |||
| 2475 | Ga0495586_0198005 | |||
| 2476 | Ga0495587_0043149 | |||
| 2477 | Ga0495609_0183594 | |||
| 2478 | Ga0495609_0402179 | |||
| 2479 | Ga0495621_0115396 | |||
| 2480 | Ga0495645_0096333 | |||
| 2481 | Ga0495645_0298142 | |||
| 2482 | Ga0495622_0050981 | |||
| 2483 | Ga0495656_0019820 | |||
| 2484 | Ga0495656_0193030 | |||
| 2485 | Ga0495656_0474704 | |||
| 2486 | Ga0495668_0186241 | |||
| 2487 | Ga0495668_0269968 | |||
| 2488 | Ga0495634_0053636 | |||
| 2489 | Ga0495634_0090281 | |||
| 2490 | Ga0495635_0041227 | |||
| 2491 | Ga0495588_0017861 | |||
| 2492 | Ga0495657_0019739 | |||
| 2493 | Ga0495623_0034248 | |||
| 2494 | Ga0495646_0145723 | |||
| 2495 | Ga0495647_0005116 | |||
| 2496 | Ga0495647_0182152 | |||
| 2497 | Ga0495647_0295180 | |||
| 2498 | Ga0495658_0032658 | |||
| 2499 | Ga0495658_0093278 | |||
| 2500 | Ga0495658_0112692 | |||
| 2501 | Ga0495658_0197255 | |||
| 2502 | Ga0495613_0036716 | |||
| 2503 | Ga0495613_0054896 | |||
| 2504 | Ga0495624_0029854 | |||
| 2505 | Ga0495624_0174482 | |||
| 2506 | Ga0495624_0407260 | |||
| 2507 | Ga0495670_0362328 | |||
| 2508 | Ga0495671_0242283 | |||
| 2509 | Ga0495600_0081184 | |||
| 2510 | Ga0495581_0177672 | |||
| 2511 | Ga0495581_0211695 | |||
| 2512 | Ga0495581_0367676 | |||
| 2513 | Ga0495674_0047497 | |||
| 2514 | Ga0495674_0061440 | |||
| 2515 | Ga0495676_0010939 | |||
| 2516 | Ga0495676_0051247 | |||
| 2517 | Ga0495676_0053327 | |||
| 2518 | Ga0495680_0120889 | |||
| 2519 | Ga0495680_0220786 | |||
| 2520 | Ga0495675_0047895 | |||
| 2521 | Ga0495677_0074392 | |||
| 2522 | Ga0495677_0120343 | |||
| 2523 | Ga0495679_177683 | |||
| 2524 | Ga0495684_0004315 | |||
| 2525 | Ga0495593_0023967 | |||
| 2526 | Ga0495593_0221109 | |||
| 2527 | Ga0495602_0145862 | |||
| 2528 | Ga0495614_0013264 | |||
| 2529 | Ga0495614_0062659 | |||
| 2530 | Ga0495614_0076263 | |||
| 2531 | Ga0496100_0001325 | |||
| 2532 | Ga0496100_0014418 | |||
| 2533 | Ga0496100_0189871 | |||
| 2534 | Ga0496100_0197644 | |||
| 2535 | Ga0496100_0254268 | |||
| 2536 | Ga0496100_0267248 | |||
| 2537 | Ga0496100_0275535 | |||
| 2538 | Ga0496100_1145432 | |||
| 2539 | Ga0496101_0002083 | |||
| 2540 | Ga0496101_0084229 | |||
| 2541 | Ga0496101_0100257 | |||
| 2542 | Ga0496101_0138684 | |||
| 2543 | Ga0496101_0153358 | |||
| 2544 | Ga0496101_0190771 | |||
| 2545 | Ga0496101_0285946 | |||
| 2546 | Ga0496101_0320220 | |||
| 2547 | Ga0496101_0330578 | |||
| 2548 | Ga0496101_0631819 | |||
| 2549 | Ga0496101_0901128 | |||
| 2550 | Ga0496102_0010767 | |||
| 2551 | Ga0496102_0069095 | |||
| 2552 | Ga0496102_0141567 | |||
| 2553 | Ga0496102_0149447 | |||
| 2554 | Ga0496102_0213186 | |||
| 2555 | Ga0496102_0236354 | |||
| 2556 | Ga0496102_0296880 | |||
| 2557 | Ga0496102_0743837 | |||
| 2558 | Ga0496103_0012845 | |||
| 2559 | Ga0496103_0016550 | |||
| 2560 | Ga0496103_0065854 | |||
| 2561 | Ga0496103_0307631 | |||
| 2562 | Ga0496103_0478261 | |||
| 2563 | Ga0496104_0010750 | |||
| 2564 | Ga0496104_0014894 | |||
| 2565 | Ga0496104_0028100 | |||
| 2566 | Ga0496104_0043659 | |||
| 2567 | Ga0496104_0057015 | |||
| 2568 | Ga0496104_0178708 | |||
| 2569 | Ga0496104_1392342 | |||
| 2570 | Ga0496105_0017687 | |||
| 2571 | Ga0496105_0032706 | |||
| 2572 | Ga0496105_0047074 | |||
| 2573 | Ga0496105_0056314 | |||
| 2574 | Ga0496105_0063560 | |||
| 2575 | Ga0496105_0067152 | |||
| 2576 | Ga0496105_0075849 | |||
| 2577 | Ga0496105_0079130 | |||
| 2578 | Ga0496106_0001833 | |||
| 2579 | Ga0496106_0008465 | |||
| 2580 | Ga0496106_0031141 | |||
| 2581 | Ga0496106_0037184 | |||
| 2582 | Ga0496106_0051170 | |||
| 2583 | Ga0496106_0053858 | |||
| 2584 | Ga0496106_0496613 | |||
| 2585 | Ga0496106_0521510 | |||
| 2586 | Ga0496106_1145509 | |||
| 2587 | Ga0496107_0002424 | |||
| 2588 | Ga0496107_0043803 | |||
| 2589 | Ga0496107_0065945 | |||
| 2590 | Ga0496107_0109500 | |||
| 2591 | Ga0496107_0345237 | |||
| 2592 | Ga0496107_0710373 | |||
| 2593 | Ga0496108_0002788 | |||
| 2594 | Ga0496108_0021258 | |||
| 2595 | Ga0496108_0022720 | |||
| 2596 | Ga0496108_0039483 | |||
| 2597 | Ga0496108_0087510 | |||
| 2598 | Ga0496108_0120132 | |||
| 2599 | Ga0496108_0184958 | |||
| 2600 | Ga0496108_0531491 | |||
| 2601 | Ga0496108_0564571 | |||
| 2602 | Ga0496108_0841504 | |||
| 2603 | Ga0496109_0021655 | |||
| 2604 | Ga0496109_0040526 | |||
| 2605 | Ga0496109_0067447 | |||
| 2606 | Ga0496109_0075437 | |||
| 2607 | Ga0496109_0146897 | |||
| 2608 | Ga0496109_0244501 | |||
| 2609 | Ga0496109_0251497 | |||
| 2610 | Ga0496109_0272671 | |||
| 2611 | Ga0496109_0307173 | |||
| 2612 | Ga0496109_0561467 | |||
| 2613 | Ga0496109_0792792 | |||
| 2614 | Ga0496110_0002875 | |||
| 2615 | Ga0496110_0024616 | |||
| 2616 | Ga0496110_0028629 | |||
| 2617 | Ga0496110_0045873 | |||
| 2618 | Ga0496110_0124379 | |||
| 2619 | Ga0496110_0162991 | |||
| 2620 | Ga0496110_0277864 | |||
| 2621 | Ga0496110_0325953 | |||
| 2622 | Ga0496110_0626840 | |||
| 2623 | Ga0496110_0720344 | |||
| 2624 | Ga0496110_1396902 | |||
| 2625 | Ga0496111_0000818 | |||
| 2626 | Ga0496111_0002896 | |||
| 2627 | Ga0496111_0020914 | |||
| 2628 | Ga0496111_0075365 | |||
| 2629 | Ga0496111_0103995 | |||
| 2630 | Ga0496111_0113743 | |||
| 2631 | Ga0496111_0127144 | |||
| 2632 | Ga0496111_0175778 | |||
| 2633 | Ga0496111_0287478 | |||
| 2634 | Ga0496111_0376147 | |||
| 2635 | Ga0496112_0005661 | |||
| 2636 | Ga0496112_0061188 | |||
| 2637 | Ga0496112_0069531 | |||
| 2638 | Ga0496112_0459549 | |||
| 2639 | Ga0496112_0565410 | |||
| 2640 | Ga0496112_1672411 | |||
| 2641 | Ga0496113_0023734 | |||
| 2642 | Ga0496113_0059262 | |||
| 2643 | Ga0496113_0084478 | |||
| 2644 | Ga0496113_0190033 | |||
| 2645 | Ga0496113_0271843 | |||
| 2646 | Ga0496113_0344838 | |||
| 2647 | Ga0496113_0374837 | |||
| 2648 | Ga0496113_0394053 | |||
| 2649 | Ga0496113_0400750 | |||
| 2650 | Ga0496113_0451659 | |||
| 2651 | Ga0496113_1499670 | |||
| 2652 | Ga0496114_0010067 | |||
| 2653 | Ga0496114_0013742 | |||
| 2654 | Ga0496114_0031479 | |||
| 2655 | Ga0496114_0061345 | |||
| 2656 | Ga0496114_0086988 | |||
| 2657 | Ga0496114_0177348 | |||
| 2658 | Ga0496114_0478300 | |||
| 2659 | Ga0496114_0552615 | |||
| 2660 | Ga0496114_1022974 | |||
| 2661 | Ga0496115_0002972 | |||
| 2662 | Ga0496115_0017580 | |||
| 2663 | Ga0496115_0030561 | |||
| 2664 | Ga0496115_0034681 | |||
| 2665 | Ga0496115_0037444 | |||
| 2666 | Ga0496115_0082435 | |||
| 2667 | Ga0496115_0086478 | |||
| 2668 | Ga0496115_0091189 | |||
| 2669 | Ga0496115_0126148 | |||
| 2670 | Ga0496115_0287543 | |||
| 2671 | Ga0496115_0334019 | |||
| 2672 | Ga0496122_0212970 | |||
| 2673 | Ga0501031_0000867 | |||
| 2674 | Ga0501031_0069852 | |||
| 2675 | Ga0501031_0347983 | |||
| 2676 | Ga0501031_0370044 | |||
| 2677 | Ga0501031_0526897 | |||
| 2678 | Ga0501032_0382284 | |||
| 2679 | Ga0501033_0029012 | |||
| 2680 | Ga0501033_0083331 | |||
| 2681 | Ga0501033_1182291 | |||
| 2682 | Ga0501036_0008436 | |||
| 2683 | Ga0501036_0117087 | |||
| 2684 | Ga0501036_0280482 | |||
| 2685 | Ga0501036_1111489 | |||
| 2686 | Ga0501036_1402326 | |||
| 2687 | Ga0501036_1447807 | |||
| 2688 | Ga0501037_1055400 | |||
| 2689 | Ga0501038_0004809 | |||
| 2690 | Ga0501038_0048049 | |||
| 2691 | Ga0501038_0213080 | |||
| 2692 | Ga0501038_0564377 | |||
| 2693 | Ga0501038_0718327 | |||
| 2694 | Ga0501039_0003561 | |||
| 2695 | Ga0501039_0027720 | |||
| 2696 | Ga0501039_0040721 | |||
| 2697 | Ga0501039_0089408 | |||
| 2698 | Ga0501039_0188440 | |||
| 2699 | Ga0501039_0329332 | |||
| 2700 | Ga0501039_0600390 | |||
| 2701 | Ga0501040_0027816 | |||
| 2702 | Ga0501040_0063128 | |||
| 2703 | Ga0501040_0078960 | |||
| 2704 | Ga0501040_0264516 | |||
| 2705 | Ga0501041_0000302 | |||
| 2706 | Ga0501041_0032873 | |||
| 2707 | Ga0501041_0401351 | |||
| 2708 | Ga0501042_0002652 | |||
| 2709 | Ga0501042_0096575 | |||
| 2710 | Ga0501042_0113976 | |||
| 2711 | Ga0501042_0123965 | |||
| 2712 | Ga0501043_0436361 | |||
| 2713 | Ga0501046_0006543 | |||
| 2714 | Ga0501046_0022128 | |||
| 2715 | Ga0501046_0334206 | |||
| 2716 | Ga0501048_0001369 | |||
| 2717 | Ga0501048_0053076 | |||
| 2718 | Ga0501048_0475315 | |||
| 2719 | Ga0501067_0000759 | |||
| 2720 | Ga0501067_0031295 | |||
| 2721 | Ga0501067_0036234 | |||
| 2722 | Ga0501067_0109440 | |||
| 2723 | Ga0501068_0001163 | |||
| 2724 | Ga0501068_0140645 | |||
| 2725 | Ga0501068_0145949 | |||
| 2726 | Ga0501068_0396709 | |||
| 2727 | Ga0501068_0585535 | |||
| 2728 | Ga0501069_0000171 | |||
| 2729 | Ga0501069_0076118 | |||
| 2730 | Ga0501069_0136285 | |||
| 2731 | Ga0501069_0351047 | |||
| 2732 | Ga0501070_0042739 | |||
| 2733 | Ga0501070_0628817 | |||
| 2734 | Ga0501071_0003170 | |||
| 2735 | Ga0501071_0011907 | |||
| 2736 | Ga0501071_0041297 | |||
| 2737 | Ga0501071_0044513 | |||
| 2738 | Ga0501071_0064726 | |||
| 2739 | Ga0501072_0004402 | |||
| 2740 | Ga0501072_0099647 | |||
| 2741 | Ga0501072_0112961 | |||
| 2742 | Ga0501072_0363566 | |||
| 2743 | Ga0501072_0641726 | |||
| 2744 | Ga0501072_0815943 | |||
| 2745 | Ga0501073_0122193 | |||
| 2746 | Ga0501074_0010885 | |||
| 2747 | Ga0501074_0036758 | |||
| 2748 | Ga0501074_0544813 | |||
| 2749 | Ga0501074_1170024 | |||
| 2750 | Ga0501075_0000959 | |||
| 2751 | Ga0501075_0070520 | |||
| 2752 | Ga0501075_0100168 | |||
| 2753 | Ga0501075_0183836 | |||
| 2754 | Ga0501075_0272457 | |||
| 2755 | Ga0501075_0396860 | |||
| 2756 | Ga0501076_0004307 | |||
| 2757 | Ga0501076_0224182 | |||
| 2758 | Ga0501076_0323466 | |||
| 2759 | Ga0501076_0750127 | |||
| 2760 | Ga0501077_0041650 | |||
| 2761 | Ga0501077_0045356 | |||
| 2762 | Ga0501077_0140511 | |||
| 2763 | Ga0501077_0216023 | |||
| 2764 | Ga0501077_0231788 | |||
| 2765 | Ga0501077_0281640 | |||
| 2766 | Ga0501079_0002695 | |||
| 2767 | Ga0501079_0005575 | |||
| 2768 | Ga0501079_0070592 | |||
| 2769 | Ga0501080_0044558 | |||
| 2770 | Ga0501080_0057471 | |||
| 2771 | Ga0501080_0782151 | |||
| 2772 | Ga0501080_1543648 | |||
| 2773 | Ga0501081_0000989 | |||
| 2774 | Ga0501081_0084022 | |||
| 2775 | Ga0501081_0362428 | |||
| 2776 | Ga0501081_0681295 | |||
| 2777 | Ga0501083_0016420 | |||
| 2778 | Ga0501083_0029978 | |||
| 2779 | Ga0501035_0015404 | |||
| 2780 | Ga0501035_0056110 | |||
| 2781 | Ga0501035_0233649 | |||
| 2782 | Ga0501035_0484485 | |||
| 2783 | Ga0501044_0260715 | |||
| 2784 | Ga0501045_0002386 | |||
| 2785 | Ga0501045_0027435 | |||
| 2786 | Ga0501045_0029861 | |||
| 2787 | Ga0501045_0067193 | |||
| 2788 | Ga0501045_0143875 | |||
| 2789 | Ga0501045_0168943 | |||
| 2790 | Ga0501045_0275298 | |||
| 2791 | nmdc:mga00v17_482346_c1 | |||
| 2792 | nmdc:mga05p37_145474_c1 | |||
| 2793 | nmdc:mga05p37_148499_c1 | |||
| 2794 | nmdc:mga05p37_205443_c1 | |||
| 2795 | nmdc:mga05p37_347129_c1 | |||
| 2796 | nmdc:mga05p37_35443_c1 | |||
| 2797 | nmdc:mga05p37_7691_c1 | |||
| 2798 | nmdc:mga05p37_82724_c1 | |||
| 2799 | nmdc:mga09592_721872_c1 | |||
| 2800 | nmdc:mga09592_788902_c1 | |||
| 2801 | nmdc:mga06r32_102335_c1 | |||
| 2802 | nmdc:mga08y16_11403_c1 | |||
| 2803 | nmdc:mga08y16_235236_c1 | |||
| 2804 | nmdc:mga08y16_281517_c1 | |||
| 2805 | nmdc:mga08y16_30020_c1 | |||
| 2806 | nmdc:mga08y16_521956_c1 | |||
| 2807 | nmdc:mga08y16_54085_c1 | |||
| 2808 | nmdc:mga08y16_55039_c1 | |||
| 2809 | nmdc:mga08y16_566120_c1 | |||
| 2810 | nmdc:mga08y16_72012_c1 | |||
| 2811 | nmdc:mga0n895_177987_c1 | |||
| 2812 | nmdc:mga0n895_227609_c1 | |||
| 2813 | nmdc:mga0n895_59778_c1 | |||
| 2814 | nmdc:mga0n895_653165_c1 | |||
| 2815 | nmdc:mga0n895_6555_c1 | |||
| 2816 | nmdc:mga0n895_687320_c1 | |||
| 2817 | nmdc:mga0n895_900_c1 | |||
| 2818 | nmdc:mga0rr50_15420_c1 | |||
| 2819 | nmdc:mga0rr50_277795_c1 | |||
| 2820 | nmdc:mga0rr50_7072_c1 | |||
| 2821 | nmdc:mga0rr50_8145_c1 | |||
| 2822 | nmdc:mga0rr50_86118_c1 | |||
| 2823 | nmdc:mga08x19_19698_c1 | |||
| 2824 | nmdc:mga08x19_21204_c1 | |||
| 2825 | nmdc:mga08x19_354437_c1 | |||
| 2826 | nmdc:mga0a205_151006_c1 | |||
| 2827 | nmdc:mga0a205_20621_c1 | |||
| 2828 | nmdc:mga0a205_221349_c1 | |||
| 2829 | nmdc:mga0a205_282164_c1 | |||
| 2830 | nmdc:mga0a205_34024_c1 | |||
| 2831 | nmdc:mga0a205_434062_c1 | |||
| 2832 | nmdc:mga0a205_438328_c1 | |||
| 2833 | nmdc:mga0a205_560903_c1 | |||
| 2834 | nmdc:mga0a205_8255_c1 | |||
| 2835 | Ga0495601_0020395 | |||
| 2836 | Ga0495601_0047942 | |||
| 2837 | Ga0495601_0233067 | |||
| 2838 | Ga0495612_0048423 | |||
| 2839 | Ga0495595_0018437 | |||
| 2840 | Ga0495595_0614833 | |||
| 2841 | Ga0495619_0059474 | |||
| 2842 | Ga0495619_0089671 | |||
| 2843 | Ga0495619_0243886 | |||
| 2844 | Ga0501084_0002494 | |||
| 2845 | Ga0501084_0073655 | |||
| 2846 | Ga0501084_0105016 | |||
| 2847 | Ga0501084_0129494 | |||
| 2848 | Ga0501084_0137193 | |||
| 2849 | Ga0501084_0259072 | |||
| 2850 | Ga0501084_0950101 | |||
| 2851 | Ga0587083_0129995 | |||
| 2852 | Ga0587078_048916 | |||
| 2853 | Ga0501082_0003144 | |||
| 2854 | Ga0501082_0419552 | |||
| 2855 | Ga0501082_0572145 | |||
| 2856 | Ga0501082_0640066 | |||
| 2857 | Ga0530510_0007675 | |||
| 2858 | Ga0530510_0022171 | |||
| 2859 | Ga0530510_0056669 | |||
| 2860 | Ga0530510_0079764 | |||
| 2861 | Ga0530510_0084667 | |||
| 2862 | Ga0530510_1402924 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1grj-assembly1.cif.gz_A | grea transcript cleavage factor from escherichia coli | 0.9044 | 2 | 157 |
| 1grj-assembly1.cif.gz_A | grea transcript cleavage factor from escherichia coli | 0.8988 | 2 | 157 |
| 7o40-assembly1.cif.gz_F | structural basis for vipp1 oligomerization and maintenance of thylakoid membrane integrity | 0.8976 | 11 | 70 |
| 7o3z-assembly1.cif.gz_D | structural basis for vipp1 oligomerization and maintenance of thylakoid membrane integrity | 0.894 | 11 | 70 |
| 6zw6-assembly1.cif.gz_G | c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.8926 | 11 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXW7_4_78_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9417 | 1 | 75 | 1.10.287.180 |
| af_Q2FXW7_79_158_3.10.50.30 | Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain | 0.941 | 81 | 155 | 3.10.50.30 |
| af_Q2FXW7_4_78_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.93 | 1 | 75 | 1.10.287.180 |
| af_Q10SX2_9_185_6.10.140.1230 | Special;Helix non-globular;Helix Hairpins; | 0.9133 | 11 | 67 | 6.10.140.1230 |
| af_P0A6W5_1_75_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.9112 | 1 | 75 | 1.10.287.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E0ND48-F1-model_v4 | Transcription elongation factor GreA/GreB C-terminal domain-containing protein | 0.9782 | 83 | 157 |
GO:0003677
GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A6L8Q7V6-F1-model_v4 | GreA/GreB family elongation factor | 0.9782 | 83 | 154 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A661Z7U8-F1-model_v4 | Transcription elongation factor GreA/GreB C-terminal domain-containing protein | 0.977 | 91 | 155 |
GO:0003677
GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A837NC34-F1-model_v4 | Transcription elongation factor GreA/GreB C-terminal domain-containing protein | 0.9727 | 83 | 157 |
GO:0003677
GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A7V6H520-F1-model_v4 | Transcription elongation factor GreA (Transcript cleavage factor GreA) | 0.9686 | 5 | 155 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |