F493910

General Info

Members Datasets Scaffolds Average Seq Length
1431 405 2862 158

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0085278|Ga0395899_0085278_1083_1634
Length 183
Sequence LVRIATIRARDGAFGAAFFRKKGCTHVKEVILTPEGYEKLKQEIEALSTTKRREVAERIRVAREFGDIAENAEYDDAKNEQMLLEHRIATLEERLRDARVISKKDIAXXVVSVGSKVKLRDVAAKETIEYHIVGSAEANPAENKLSNESPVGKAIIGHKKGETVEVTAPRGTLKFKIVEIKAA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
122 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
123 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
124 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
226 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
227 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
228 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
261 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
268 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
269 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
270 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
271 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
335 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
336 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
337 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
338 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 10.06
Rhizosphere 89.31
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0085278 3300037312 Bacteria 2295
2 ARCol0yngRDRAFT_1007316 3300000652 Bacteria 794
3 JGI24743J22301_10098292 3300001991 Bacteria 629
4 JGI24738J21930_10024965 3300002075 Bacteria 1229
5 JGI24738J21930_10029631 3300002075 Bacteria 1118
6 JGI24744J21845_10068284 3300002077 Bacteria 649
7 JGI24033J26618_1016728 3300002155 Bacteria 913
8 JGI24742J22300_10020413 3300002244 Bacteria 1128
9 JGI25406J46586_10005431 3300003203 Bacteria 5911
10 JGI25406J46586_10047029 3300003203 Bacteria 1473
11 JGI25407J50210_10047439 3300003373 Bacteria 1092
12 JGI25407J50210_10146433 3300003373 Bacteria 581
13 JGI25404J52841_10067083 3300003659 Bacteria 750
14 JGI25404J52841_10120774 3300003659 Bacteria 552
15 JGI25405J52794_10086632 3300003911 Bacteria 692
16 Ga0070658_10012764 3300005327 Bacteria 6741
17 Ga0070676_10102490 3300005328 Bacteria 1770
18 Ga0070683_100036803 3300005329 Bacteria 4479
19 Ga0070683_100056810 3300005329 Bacteria 3634
20 Ga0070683_100158156 3300005329 Bacteria 2149
21 Ga0070683_100718757 3300005329 Bacteria 957
22 Ga0070683_100943778 3300005329 Bacteria 828
23 Ga0070690_100086107 3300005330 Bacteria 2062
24 Ga0070690_100118177 3300005330 Bacteria 1777
25 Ga0070690_100165901 3300005330 Bacteria 1517
26 Ga0070690_100356842 3300005330 Bacteria 1063
27 Ga0070690_100392097 3300005330 Bacteria 1018
28 Ga0070690_100574117 3300005330 Bacteria 853
29 Ga0070670_100003102 3300005331 Bacteria 13754
30 Ga0070670_100011984 3300005331 Bacteria 7416
31 Ga0070670_100234593 3300005331 Bacteria 1597
32 Ga0070670_100246306 3300005331 Bacteria 1556
33 Ga0070670_100344675 3300005331 Bacteria 1308
34 Ga0068869_100017707 3300005334 Bacteria 4837
35 Ga0068869_100028022 3300005334 Bacteria 3931
36 Ga0068869_100134212 3300005334 Bacteria 1905
37 Ga0068869_100271562 3300005334 Bacteria 1361
38 Ga0068869_100363982 3300005334 Bacteria 1182
39 Ga0068869_100506279 3300005334 Bacteria 1009
40 Ga0070680_100129890 3300005336 Bacteria 2107
41 Ga0070680_100330571 3300005336 Bacteria 1294
42 Ga0070680_100686812 3300005336 Bacteria 881
43 Ga0070682_100067021 3300005337 Bacteria 2285
44 Ga0070682_100130242 3300005337 Bacteria 1702
45 Ga0070682_100199405 3300005337 Bacteria 1411
46 Ga0070682_100316326 3300005337 Bacteria 1151
47 Ga0070682_100901477 3300005337 Bacteria 727
48 Ga0068868_100033190 3300005338 Bacteria 3977
49 Ga0068868_100036439 3300005338 Bacteria 3807
50 Ga0068868_100063177 3300005338 Bacteria 2937
51 Ga0068868_100088014 3300005338 Bacteria 2499
52 Ga0068868_100105931 3300005338 Bacteria 2280
53 Ga0068868_100343013 3300005338 Bacteria 1278
54 Ga0068868_100487510 3300005338 Bacteria 1078
55 Ga0070660_100003416 3300005339 Bacteria 10923
56 Ga0070660_100053871 3300005339 Bacteria 3104
57 Ga0070660_100094885 3300005339 Bacteria 2357
58 Ga0070660_100098570 3300005339 Bacteria 2313
59 Ga0070660_100129993 3300005339 Bacteria 2014
60 Ga0070660_100520196 3300005339 Bacteria 991
61 Ga0070689_100034826 3300005340 Bacteria 3843
62 Ga0070689_100037809 3300005340 Bacteria 3691
63 Ga0070689_100194058 3300005340 Bacteria 1654
64 Ga0070691_10012486 3300005341 Bacteria 3890
65 Ga0070691_10024351 3300005341 Bacteria 2813
66 Ga0070691_10055090 3300005341 Bacteria 1904
67 Ga0070691_10122294 3300005341 Bacteria 1312
68 Ga0070691_10315208 3300005341 Bacteria 859
69 Ga0070687_100022454 3300005343 Bacteria 2984
70 Ga0070687_100099590 3300005343 Bacteria 1625
71 Ga0070661_100165963 3300005344 Bacteria 1675
72 Ga0070661_100477099 3300005344 Bacteria 995
73 Ga0070692_10105630 3300005345 Bacteria 1550
74 Ga0070692_10143032 3300005345 Bacteria 1355
75 Ga0070692_10819898 3300005345 Bacteria 637
76 Ga0070668_100008802 3300005347 Bacteria 7497
77 Ga0070668_100023901 3300005347 Bacteria 4627
78 Ga0070668_100035179 3300005347 Bacteria 3819
79 Ga0070668_100117304 3300005347 Bacteria 2124
80 Ga0070668_100184561 3300005347 Bacteria 1706
81 Ga0070668_100202611 3300005347 Bacteria 1629
82 Ga0070668_100721134 3300005347 Bacteria 881
83 Ga0070669_100069603 3300005353 Bacteria 2599
84 Ga0070669_100102629 3300005353 Bacteria 2160
85 Ga0070669_100585378 3300005353 Bacteria 933
86 Ga0070669_100831493 3300005353 Bacteria 786
87 Ga0070675_100127955 3300005354 Bacteria 2162
88 Ga0070675_100150137 3300005354 Bacteria 1997
89 Ga0070675_100195178 3300005354 Bacteria 1756
90 Ga0070675_100812188 3300005354 Bacteria 855
91 Ga0070675_101031618 3300005354 Bacteria 755
92 Ga0070675_101154434 3300005354 Bacteria 713
93 Ga0070671_100192052 3300005355 Bacteria 1731
94 Ga0070671_100771837 3300005355 Bacteria 836
95 Ga0070674_100002837 3300005356 Bacteria 9578
96 Ga0070674_100003211 3300005356 Bacteria 9123
97 Ga0070674_100005150 3300005356 Bacteria 7517
98 Ga0070674_100110555 3300005356 Bacteria 2017
99 Ga0070674_100116976 3300005356 Bacteria 1968
100 Ga0070674_100155832 3300005356 Bacteria 1728
101 Ga0070674_100367284 3300005356 Bacteria 1167
102 Ga0070674_100432981 3300005356 Bacteria 1082
103 Ga0070674_100593451 3300005356 Bacteria 935
104 Ga0070673_100034265 3300005364 Bacteria 3840
105 Ga0070673_100089041 3300005364 Bacteria 2519
106 Ga0070673_100162218 3300005364 Bacteria 1902
107 Ga0070673_101577948 3300005364 Bacteria 620
108 Ga0070688_100010486 3300005365 Bacteria 5111
109 Ga0070688_100014377 3300005365 Bacteria 4483
110 Ga0070688_100247587 3300005365 Bacteria 1268
111 Ga0070688_100254095 3300005365 Bacteria 1253
112 Ga0070659_100007542 3300005366 Bacteria 7906
113 Ga0070659_100056310 3300005366 Bacteria 3100
114 Ga0070659_100061971 3300005366 Bacteria 2956
115 Ga0070659_100101800 3300005366 Bacteria 2312
116 Ga0070659_100175769 3300005366 Bacteria 1756
117 Ga0070659_100283000 3300005366 Bacteria 1380
118 Ga0070659_100686041 3300005366 Bacteria 885
119 Ga0070667_100089326 3300005367 Bacteria 2647
120 Ga0070667_101287804 3300005367 Bacteria 685
121 Ga0070703_10016533 3300005406 Bacteria 2118
122 Ga0070703_10123241 3300005406 Bacteria 943
123 Ga0070709_10036442 3300005434 Bacteria 2996
124 Ga0070709_10131341 3300005434 Bacteria 1710
125 Ga0070709_10171446 3300005434 Bacteria 1516
126 Ga0070714_100015567 3300005435 Bacteria 6119
127 Ga0070714_100151320 3300005435 Bacteria 2091
128 Ga0070714_101242849 3300005435 Bacteria 727
129 Ga0070714_101889261 3300005435 Bacteria 583
130 Ga0070713_100300116 3300005436 Bacteria 1478
131 Ga0070710_10031988 3300005437 Bacteria 2846
132 Ga0070710_10036978 3300005437 Bacteria 2672
133 Ga0070710_10344604 3300005437 Bacteria 985
134 Ga0070701_10061643 3300005438 Bacteria 1978
135 Ga0070701_10125770 3300005438 Bacteria 1451
136 Ga0070701_10141065 3300005438 Bacteria 1378
137 Ga0070701_10467089 3300005438 Bacteria 813
138 Ga0070701_10542483 3300005438 Bacteria 762
139 Ga0070711_100020712 3300005439 Bacteria 4242
140 Ga0070711_100115395 3300005439 Bacteria 1977
141 Ga0070711_100271269 3300005439 Bacteria 1339
142 Ga0070711_100294442 3300005439 Bacteria 1288
143 Ga0070711_100385808 3300005439 Bacteria 1134
144 Ga0070711_100599230 3300005439 Bacteria 919
145 Ga0070705_100194153 3300005440 Bacteria 1386
146 Ga0070705_100245355 3300005440 Bacteria 1254
147 Ga0070705_100354537 3300005440 Bacteria 1071
148 Ga0070705_100673169 3300005440 Bacteria 809
149 Ga0070700_100064871 3300005441 Bacteria 2313
150 Ga0070700_100068709 3300005441 Bacteria 2254
151 Ga0070700_100123331 3300005441 Bacteria 1739
152 Ga0070700_100158226 3300005441 Bacteria 1557
153 Ga0070700_100193839 3300005441 Bacteria 1423
154 Ga0070700_100352402 3300005441 Bacteria 1092
155 Ga0070694_100016424 3300005444 Bacteria 4659
156 Ga0070694_100067018 3300005444 Bacteria 2463
157 Ga0070694_100144645 3300005444 Bacteria 1730
158 Ga0070694_100427448 3300005444 Bacteria 1042
159 Ga0070694_100993179 3300005444 Bacteria 696
160 Ga0070708_100045730 3300005445 Bacteria 3858
161 Ga0070708_100150463 3300005445 Bacteria 2164
162 Ga0070708_100169739 3300005445 Bacteria 2036
163 Ga0070708_100272667 3300005445 Bacteria 1591
164 Ga0070708_100380477 3300005445 Bacteria 1331
165 Ga0070708_100902686 3300005445 Unclassified 829
166 Ga0070663_100161390 3300005455 Bacteria 1725
167 Ga0070663_100253808 3300005455 Bacteria 1393
168 Ga0070663_100275742 3300005455 Bacteria 1338
169 Ga0070663_100407605 3300005455 Bacteria 1112
170 Ga0070678_100046653 3300005456 Bacteria 3109
171 Ga0070678_100195056 3300005456 Bacteria 1667
172 Ga0070678_100258067 3300005456 Bacteria 1464
173 Ga0070678_100277580 3300005456 Bacteria 1416
174 Ga0070678_100283066 3300005456 Bacteria 1403
175 Ga0070678_100800478 3300005456 Bacteria 856
176 Ga0070678_101365946 3300005456 Bacteria 661
177 Ga0070662_100020948 3300005457 Bacteria 4459
178 Ga0070662_100024496 3300005457 Bacteria 4158
179 Ga0070662_100081598 3300005457 Bacteria 2410
180 Ga0070662_100107635 3300005457 Bacteria 2119
181 Ga0070662_100321113 3300005457 Bacteria 1262
182 Ga0070662_100401268 3300005457 Bacteria 1132
183 Ga0070662_100434494 3300005457 Bacteria 1088
184 Ga0070681_10078887 3300005458 Bacteria 3249
185 Ga0070681_10084272 3300005458 Bacteria 3131
186 Ga0068867_100043441 3300005459 Bacteria 3290
187 Ga0068867_100053243 3300005459 Bacteria 2989
188 Ga0068867_100088986 3300005459 Bacteria 2341
189 Ga0068867_100095339 3300005459 Bacteria 2264
190 Ga0068867_100216070 3300005459 Bacteria 1542
191 Ga0068867_100279417 3300005459 Bacteria 1369
192 Ga0068867_100280288 3300005459 Bacteria 1367
193 Ga0068867_100292442 3300005459 Bacteria 1340
194 Ga0068867_101345094 3300005459 Bacteria 661
195 Ga0070685_10004294 3300005466 Bacteria 7194
196 Ga0070685_10445953 3300005466 Bacteria 906
197 Ga0070685_10905208 3300005466 Bacteria 657
198 Ga0070706_100052019 3300005467 Bacteria 3781
199 Ga0070706_100053033 3300005467 Bacteria 3742
200 Ga0070706_100093204 3300005467 Bacteria 2794
201 Ga0070706_100183580 3300005467 Bacteria 1954
202 Ga0070706_100219495 3300005467 Bacteria 1775
203 Ga0070706_100429968 3300005467 Bacteria 1229
204 Ga0070707_100251581 3300005468 Unclassified 1720
205 Ga0070707_100432889 3300005468 Unclassified 1276
206 Ga0070707_100612050 3300005468 Bacteria 1052
207 Ga0070698_100005110 3300005471 Bacteria 14361
208 Ga0070698_100037645 3300005471 Bacteria 4987
209 Ga0070699_100017154 3300005518 Bacteria 6218
210 Ga0070699_100270836 3300005518 Bacteria 1520
211 Ga0070699_100624051 3300005518 Bacteria 983
212 Ga0070699_100792020 3300005518 Bacteria 867
213 Ga0070679_100047580 3300005530 Bacteria 4274
214 Ga0070679_100064914 3300005530 Bacteria 3639
215 Ga0070679_100111231 3300005530 Bacteria 2725
216 Ga0070679_100209256 3300005530 Bacteria 1915
217 Ga0070679_100370220 3300005530 Bacteria 1380
218 Ga0070679_100474268 3300005530 Bacteria 1196
219 Ga0070684_100004647 3300005535 Bacteria 10478
220 Ga0070684_100007114 3300005535 Bacteria 8695
221 Ga0070684_100012867 3300005535 Bacteria 6724
222 Ga0070684_100066667 3300005535 Bacteria 3160
223 Ga0070684_100099760 3300005535 Bacteria 2592
224 Ga0070684_100103888 3300005535 Bacteria 2542
225 Ga0070684_100270832 3300005535 Bacteria 1554
226 Ga0070684_100494889 3300005535 Bacteria 1132
227 Ga0070684_101082921 3300005535 Bacteria 753
228 Ga0070697_100298371 3300005536 Bacteria 1385
229 Ga0068853_100043518 3300005539 Bacteria 3842
230 Ga0068853_100212305 3300005539 Bacteria 1764
231 Ga0068853_100272235 3300005539 Bacteria 1560
232 Ga0068853_100769707 3300005539 Bacteria 921
233 Ga0070672_100019095 3300005543 Bacteria 4968
234 Ga0070672_100027996 3300005543 Bacteria 4210
235 Ga0070672_100090346 3300005543 Bacteria 2470
236 Ga0070686_100004853 3300005544 Bacteria 7426
237 Ga0070686_100093224 3300005544 Bacteria 2019
238 Ga0070686_100110133 3300005544 Bacteria 1875
239 Ga0070686_100230439 3300005544 Bacteria 1343
240 Ga0070695_100075746 3300005545 Bacteria 2215
241 Ga0070695_100127817 3300005545 Bacteria 1748
242 Ga0070695_100172059 3300005545 Bacteria 1528
243 Ga0070695_100252325 3300005545 Bacteria 1285
244 Ga0070695_100414782 3300005545 Unclassified 1024
245 Ga0070695_100805979 3300005545 Bacteria 753
246 Ga0070696_100013955 3300005546 Bacteria 5394
247 Ga0070696_100098608 3300005546 Bacteria 2090
248 Ga0070696_100153009 3300005546 Bacteria 1695
249 Ga0070696_100165622 3300005546 Bacteria 1631
250 Ga0070696_100174379 3300005546 Bacteria 1592
251 Ga0070696_100234555 3300005546 Bacteria 1381
252 Ga0070696_100442914 3300005546 Bacteria 1024
253 Ga0070696_100640207 3300005546 Bacteria 861
254 Ga0070696_100727869 3300005546 Bacteria 811
255 Ga0070693_100043202 3300005547 Bacteria 2544
256 Ga0070693_100126027 3300005547 Bacteria 1594
257 Ga0070693_100227862 3300005547 Bacteria 1224
258 Ga0070693_100309411 3300005547 Bacteria 1068
259 Ga0070665_100056627 3300005548 Bacteria 3930
260 Ga0070665_100061371 3300005548 Bacteria 3768
261 Ga0070665_100220542 3300005548 Bacteria 1897
262 Ga0070665_100511080 3300005548 Bacteria 1213
263 Ga0070704_100060975 3300005549 Bacteria 2697
264 Ga0070704_100152483 3300005549 Bacteria 1818
265 Ga0070704_100414945 3300005549 Bacteria 1152
266 Ga0070704_100425608 3300005549 Bacteria 1138
267 Ga0070704_100596115 3300005549 Bacteria 971
268 Ga0068855_100016339 3300005563 Bacteria 8924
269 Ga0068855_100168972 3300005563 Bacteria 2477
270 Ga0068855_100428040 3300005563 Bacteria 1447
271 Ga0068855_100438692 3300005563 Bacteria 1426
272 Ga0068855_100542470 3300005563 Bacteria 1260
273 Ga0068855_101271924 3300005563 Bacteria 762
274 Ga0070664_100100266 3300005564 Bacteria 2517
275 Ga0070664_100142062 3300005564 Bacteria 2114
276 Ga0070664_100405063 3300005564 Bacteria 1248
277 Ga0070664_100407658 3300005564 Bacteria 1244
278 Ga0068857_100004037 3300005577 Bacteria 12356
279 Ga0068857_100011522 3300005577 Bacteria 7692
280 Ga0068857_100020799 3300005577 Bacteria 5773
281 Ga0068857_100292126 3300005577 Bacteria 1501
282 Ga0068854_100123951 3300005578 Bacteria 1965
283 Ga0068854_100179809 3300005578 Bacteria 1652
284 Ga0068854_100247219 3300005578 Bacteria 1423
285 Ga0068854_100726325 3300005578 Unclassified 859
286 Ga0068856_100060848 3300005614 Bacteria 3730
287 Ga0068856_100097795 3300005614 Bacteria 2925
288 Ga0068856_100573304 3300005614 Bacteria 1150
289 Ga0068856_100638362 3300005614 Bacteria 1085
290 Ga0070702_100040905 3300005615 Bacteria 2596
291 Ga0070702_100046445 3300005615 Bacteria 2461
292 Ga0070702_100170928 3300005615 Bacteria 1414
293 Ga0070702_100824379 3300005615 Bacteria 720
294 Ga0068852_100087395 3300005616 Bacteria 2781
295 Ga0068852_100235426 3300005616 Bacteria 1747
296 Ga0068852_100410728 3300005616 Bacteria 1333
297 Ga0068852_100575381 3300005616 Bacteria 1129
298 Ga0068852_100865782 3300005616 Bacteria 920
299 Ga0068852_100873080 3300005616 Bacteria 916
300 Ga0068859_100202672 3300005617 Bacteria 2069
301 Ga0068859_100359435 3300005617 Bacteria 1551
302 Ga0068859_100400274 3300005617 Bacteria 1469
303 Ga0068859_100721639 3300005617 Bacteria 1087
304 Ga0068864_100053215 3300005618 Bacteria 3492
305 Ga0068864_100253783 3300005618 Bacteria 1634
306 Ga0068864_100665662 3300005618 Bacteria 1015
307 Ga0068866_10059006 3300005718 Bacteria 1983
308 Ga0068866_10146938 3300005718 Unclassified 1361
309 Ga0068866_10275803 3300005718 Bacteria 1040
310 Ga0068866_10352421 3300005718 Bacteria 936
311 Ga0068866_10543224 3300005718 Bacteria 776
312 Ga0068861_100000599 3300005719 Bacteria 21360
313 Ga0068861_100046527 3300005719 Bacteria 3271
314 Ga0068861_100048989 3300005719 Bacteria 3197
315 Ga0068861_100069266 3300005719 Bacteria 2729
316 Ga0068861_100113228 3300005719 Bacteria 2176
317 Ga0068861_100900817 3300005719 Bacteria 838
318 Ga0068870_10066313 3300005840 Bacteria 1955
319 Ga0068870_10119604 3300005840 Bacteria 1515
320 Ga0068870_10127191 3300005840 Unclassified 1475
321 Ga0068870_10149567 3300005840 Bacteria 1374
322 Ga0068863_100118758 3300005841 Bacteria 2521
323 Ga0068863_100175600 3300005841 Bacteria 2056
324 Ga0068863_101106831 3300005841 Bacteria 797
325 Ga0068858_100082667 3300005842 Bacteria 2986
326 Ga0068858_100591675 3300005842 Bacteria 1076
327 Ga0068858_100909185 3300005842 Bacteria 861
328 Ga0068860_100135445 3300005843 Bacteria 2365
329 Ga0068860_100321916 3300005843 Bacteria 1518
330 Ga0068860_100336356 3300005843 Bacteria 1484
331 Ga0068862_100034106 3300005844 Bacteria 4305
332 Ga0068862_100108242 3300005844 Bacteria 2437
333 Ga0081455_10037793 3300005937 Bacteria 4281
334 Ga0081455_10046700 3300005937 Bacteria 3755
335 Ga0081538_10002668 3300005981 Bacteria 17209
336 Ga0081538_10030418 3300005981 Bacteria 3666
337 Ga0081538_10065202 3300005981 Bacteria 2053
338 Ga0081538_10097573 3300005981 Bacteria 1493
339 Ga0081540_1000590 3300005983 Bacteria 34934
340 Ga0081540_1001254 3300005983 Bacteria 22178
341 Ga0081539_10000703 3300005985 Bacteria 67184
342 Ga0081539_10081023 3300005985 Bacteria 1706
343 Ga0081539_10171682 3300005985 Bacteria 1025
344 Ga0070717_10091885 3300006028 Bacteria 2563
345 Ga0070717_10117219 3300006028 Bacteria 2277
346 Ga0070717_10770850 3300006028 Bacteria 874
347 Ga0075364_10512529 3300006051 Bacteria 820
348 Ga0075432_10000155 3300006058 Bacteria 16542
349 Ga0070715_10010700 3300006163 Bacteria 3277
350 Ga0070715_10012518 3300006163 Bacteria 3091
351 Ga0070715_10012523 3300006163 Bacteria 3090
352 Ga0070716_100021841 3300006173 Bacteria 3375
353 Ga0070716_100085983 3300006173 Bacteria 1890
354 Ga0070716_100134939 3300006173 Unclassified 1566
355 Ga0070712_100011954 3300006175 Bacteria 5517
356 Ga0070712_100018248 3300006175 Bacteria 4553
357 Ga0070712_100033365 3300006175 Bacteria 3483
358 Ga0070712_100037758 3300006175 Bacteria 3295
359 Ga0070712_100199842 3300006175 Bacteria 1569
360 Ga0070712_100234317 3300006175 Unclassified 1459
361 Ga0070712_100316078 3300006175 Bacteria 1269
362 Ga0070712_100548503 3300006175 Bacteria 974
363 Ga0075366_10412377 3300006195 Bacteria 832
364 Ga0097621_100074602 3300006237 Bacteria 2810
365 Ga0097621_100614578 3300006237 Bacteria 994
366 Ga0068871_100152298 3300006358 Bacteria 1973
367 Ga0068871_100234253 3300006358 Bacteria 1594
368 Ga0068871_100335837 3300006358 Bacteria 1333
369 Ga0068871_100606677 3300006358 Bacteria 996
370 Ga0075428_100073425 3300006844 Bacteria 3736
371 Ga0075428_100365622 3300006844 Bacteria 1547
372 Ga0075428_100554153 3300006844 Bacteria 1229
373 Ga0075431_100153427 3300006847 Bacteria 2371
374 Ga0075431_100188109 3300006847 Bacteria 2116
375 Ga0075431_101092075 3300006847 Bacteria 763
376 Ga0075433_10024795 3300006852 Bacteria 5066
377 Ga0075433_10196771 3300006852 Bacteria 1793
378 Ga0075433_10226438 3300006852 Bacteria 1661
379 Ga0075433_10231012 3300006852 Bacteria 1643
380 Ga0075433_10258125 3300006852 Bacteria 1545
381 Ga0075433_10293584 3300006852 Bacteria 1439
382 Ga0075433_10501386 3300006852 Bacteria 1068
383 Ga0075434_100015405 3300006871 Bacteria 7329
384 Ga0075434_100023080 3300006871 Bacteria 6057
385 Ga0075434_100053669 3300006871 Bacteria 4004
386 Ga0075434_100215977 3300006871 Bacteria 1938
387 Ga0075434_100405360 3300006871 Bacteria 1384
388 Ga0075434_100672199 3300006871 Bacteria 1053
389 Ga0075429_100231728 3300006880 Bacteria 1618
390 Ga0075429_100541247 3300006880 Bacteria 1020
391 Ga0075429_100665094 3300006880 Unclassified 912
392 Ga0068865_100048111 3300006881 Bacteria 2934
393 Ga0068865_100061984 3300006881 Bacteria 2624
394 Ga0068865_100079460 3300006881 Bacteria 2349
395 Ga0068865_100099768 3300006881 Bacteria 2123
396 Ga0068865_100169145 3300006881 Bacteria 1674
397 Ga0068865_100417997 3300006881 Bacteria 1102
398 Ga0068865_100450857 3300006881 Bacteria 1064
399 Ga0068865_100628141 3300006881 Bacteria 911
400 Ga0068865_101043265 3300006881 Bacteria 718
401 Ga0075436_100012943 3300006914 Bacteria 5719
402 Ga0075436_100020689 3300006914 Bacteria 4515
403 Ga0075436_100062021 3300006914 Bacteria 2584
404 Ga0075436_100299784 3300006914 Bacteria 1152
405 Ga0075436_100488538 3300006914 Bacteria 900
406 Ga0075436_100635917 3300006914 Unclassified 788
407 Ga0097620_100202699 3300006931 Bacteria 2069
408 Ga0097620_100359476 3300006931 Bacteria 1551
409 Ga0097620_100400273 3300006931 Bacteria 1469
410 Ga0097620_100721662 3300006931 Bacteria 1087
411 Ga0075435_100006892 3300007076 Bacteria 8061
412 Ga0075435_100016752 3300007076 Bacteria 5529
413 Ga0075435_100021969 3300007076 Bacteria 4917
414 Ga0075435_100024707 3300007076 Bacteria 4667
415 Ga0075435_100225537 3300007076 Bacteria 1591
416 Ga0105244_10079253 3300009036 Unclassified 1628
417 Ga0105240_10769711 3300009093 Bacteria 1045
418 Ga0105240_10796596 3300009093 Bacteria 1024
419 Ga0105240_12033788 3300009093 Bacteria 597
420 Ga0111539_10050201 3300009094 Bacteria 4970
421 Ga0111539_10060535 3300009094 Bacteria 4487
422 Ga0111539_10064029 3300009094 Bacteria 4351
423 Ga0111539_10213992 3300009094 Unclassified 2245
424 Ga0111539_10436134 3300009094 Bacteria 1525
425 Ga0111539_10441308 3300009094 Unclassified 1515
426 Ga0111539_11462295 3300009094 Bacteria 793
427 Ga0105245_10029388 3300009098 Bacteria 4855
428 Ga0105245_10039116 3300009098 Bacteria 4221
429 Ga0105245_10052784 3300009098 Bacteria 3647
430 Ga0105245_10101084 3300009098 Bacteria 2668
431 Ga0105245_10110975 3300009098 Bacteria 2550
432 Ga0105245_10116618 3300009098 Bacteria 2490
433 Ga0105245_10143381 3300009098 Bacteria 2252
434 Ga0105245_10198946 3300009098 Bacteria 1923
435 Ga0105245_10205561 3300009098 Bacteria 1893
436 Ga0105245_10276106 3300009098 Bacteria 1641
437 Ga0105245_10414029 3300009098 Bacteria 1349
438 Ga0105245_10462975 3300009098 Bacteria 1278
439 Ga0105245_11182692 3300009098 Bacteria 812
440 Ga0105247_10009470 3300009101 Bacteria 5910
441 Ga0105247_10773498 3300009101 Bacteria 730
442 Ga0114129_10021521 3300009147 Bacteria 9154
443 Ga0114129_10041728 3300009147 Bacteria 6462
444 Ga0114129_10198491 3300009147 Bacteria 2719
445 Ga0114129_10584178 3300009147 Bacteria 1449
446 Ga0114129_10773584 3300009147 Bacteria 1227
447 Ga0114129_12431135 3300009147 Bacteria 627
448 Ga0105243_10006578 3300009148 Bacteria 8980
449 Ga0105243_10011319 3300009148 Bacteria 6750
450 Ga0105243_10057101 3300009148 Bacteria 3107
451 Ga0105243_10063674 3300009148 Bacteria 2955
452 Ga0105243_10134597 3300009148 Bacteria 2101
453 Ga0105243_10140568 3300009148 Bacteria 2059
454 Ga0105243_10197702 3300009148 Bacteria 1761
455 Ga0105243_10241525 3300009148 Bacteria 1608
456 Ga0105243_10367601 3300009148 Bacteria 1326
457 Ga0105243_11115109 3300009148 Bacteria 798
458 Ga0105241_10055814 3300009174 Bacteria 3026
459 Ga0105241_10093317 3300009174 Bacteria 2378
460 Ga0105241_10271712 3300009174 Bacteria 1444
461 Ga0105242_10016338 3300009176 Bacteria 5772
462 Ga0105242_10030820 3300009176 Bacteria 4284
463 Ga0105242_10032691 3300009176 Bacteria 4161
464 Ga0105242_10052227 3300009176 Bacteria 3335
465 Ga0105242_10076487 3300009176 Bacteria 2790
466 Ga0105242_10077096 3300009176 Bacteria 2780
467 Ga0105242_10096406 3300009176 Bacteria 2499
468 Ga0105242_10096880 3300009176 Bacteria 2493
469 Ga0105242_10759820 3300009176 Bacteria 955
470 Ga0105242_10967007 3300009176 Bacteria 857
471 Ga0105248_10050144 3300009177 Bacteria 4681
472 Ga0105248_10467919 3300009177 Bacteria 1421
473 Ga0105248_10535495 3300009177 Bacteria 1321
474 Ga0105248_10590999 3300009177 Bacteria 1253
475 Ga0105237_10015040 3300009545 Bacteria 8064
476 Ga0105237_10048627 3300009545 Bacteria 4263
477 Ga0105237_10495547 3300009545 Bacteria 1228
478 Ga0105238_10029146 3300009551 Bacteria 5624
479 Ga0105238_10496657 3300009551 Bacteria 1220
480 Ga0105238_10966484 3300009551 Unclassified 872
481 Ga0105249_10021215 3300009553 Bacteria 5815
482 Ga0105249_10086108 3300009553 Bacteria 2930
483 Ga0105249_10163393 3300009553 Bacteria 2154
484 Ga0105249_10228366 3300009553 Bacteria 1835
485 Ga0105249_10248920 3300009553 Bacteria 1761
486 Ga0105249_10368490 3300009553 Bacteria 1459
487 Ga0105249_10378417 3300009553 Bacteria 1441
488 Ga0105249_10688780 3300009553 Bacteria 1081
489 Ga0105249_11336260 3300009553 Bacteria 788
490 Ga0105239_10070973 3300010375 Bacteria 3826
491 Ga0105239_10099109 3300010375 Bacteria 3221
492 Ga0105239_10126075 3300010375 Bacteria 2845
493 Ga0105239_10138061 3300010375 Bacteria 2715
494 Ga0105239_10830870 3300010375 Bacteria 1059
495 Ga0105239_12679287 3300010375 Unclassified 582
496 Ga0105246_10006452 3300011119 Bacteria 7166
497 Ga0105246_10016365 3300011119 Bacteria 4696
498 Ga0105246_10062964 3300011119 Bacteria 2586
499 Ga0105246_10109949 3300011119 Bacteria 2023
500 Ga0105246_10204879 3300011119 Bacteria 1536
501 Ga0105246_10307743 3300011119 Bacteria 1282
502 Ga0157343_1032006 3300012488 Bacteria 534
503 Ga0157345_1007395 3300012498 Bacteria 895
504 Ga0157347_1003770 3300012502 Bacteria 1378
505 Ga0157316_1002248 3300012510 Bacteria 1296
506 Ga0157371_10120348 3300013102 Bacteria 1866
507 Ga0157371_10256471 3300013102 Bacteria 1260
508 Ga0157371_10478408 3300013102 Bacteria 918
509 Ga0157370_10312908 3300013104 Bacteria 1449
510 Ga0157369_10320317 3300013105 Bacteria 1612
511 Ga0157369_10509513 3300013105 Bacteria 1245
512 Ga0157374_10011101 3300013296 Bacteria 7785
513 Ga0157378_10099887 3300013297 Bacteria 2648
514 Ga0157378_10141795 3300013297 Bacteria 2232
515 Ga0157378_10474183 3300013297 Bacteria 1246
516 Ga0163162_10036711 3300013306 Bacteria 4886
517 Ga0163162_10128466 3300013306 Bacteria 2642
518 Ga0163162_10192049 3300013306 Bacteria 2170
519 Ga0163162_10258117 3300013306 Bacteria 1874
520 Ga0163162_10271857 3300013306 Bacteria 1826
521 Ga0163162_10278962 3300013306 Bacteria 1803
522 Ga0163162_10279332 3300013306 Unclassified 1802
523 Ga0163162_10497608 3300013306 Bacteria 1349
524 Ga0157372_10067977 3300013307 Bacteria 4006
525 Ga0157372_10093044 3300013307 Bacteria 3430
526 Ga0157372_10246342 3300013307 Bacteria 2074
527 Ga0157372_10834300 3300013307 Bacteria 1070
528 Ga0157375_10195347 3300013308 Bacteria 2178
529 Ga0157375_10922586 3300013308 Bacteria 1016
530 Ga0163163_10015084 3300014325 Bacteria 7130
531 Ga0163163_10375679 3300014325 Bacteria 1479
532 Ga0163163_10882333 3300014325 Bacteria 958
533 Ga0157380_10017463 3300014326 Bacteria 5310
534 Ga0157380_10097198 3300014326 Bacteria 2443
535 Ga0157380_10446768 3300014326 Bacteria 1240
536 Ga0157380_10670005 3300014326 Bacteria 1038
537 Ga0157380_10875598 3300014326 Bacteria 922
538 Ga0157380_10948203 3300014326 Bacteria 890
539 Ga0182008_10054314 3300014497 Bacteria 1982
540 Ga0157377_10003069 3300014745 Bacteria 7493
541 Ga0157377_10021451 3300014745 Bacteria 3398
542 Ga0157377_10058025 3300014745 Bacteria 2203
543 Ga0157377_10072645 3300014745 Bacteria 1992
544 Ga0157377_10246932 3300014745 Bacteria 1155
545 Ga0157377_10672762 3300014745 Bacteria 748
546 Ga0157379_10080456 3300014968 Bacteria 2918
547 Ga0157379_10184896 3300014968 Bacteria 1883
548 Ga0157379_10352025 3300014968 Bacteria 1348
549 Ga0157376_10013044 3300014969 Bacteria 6191
550 Ga0157376_10109741 3300014969 Bacteria 2426
551 Ga0157376_10119793 3300014969 Bacteria 2331
552 Ga0157376_10206466 3300014969 Bacteria 1811
553 Ga0157376_10353997 3300014969 Bacteria 1406
554 Ga0157376_11030461 3300014969 Bacteria 846
555 Ga0163161_10250273 3300017792 Bacteria 1381
556 Ga0163161_10534486 3300017792 Bacteria 959
557 Ga0163161_10588271 3300017792 Bacteria 916
558 Ga0197907_10034126 3300020069 Bacteria 663
559 Ga0206356_10954049 3300020070 Bacteria 979
560 Ga0206351_10526121 3300020077 Bacteria 1014
561 Ga0154015_1595217 3300020610 Bacteria 927
562 Ga0207653_10107940 3300025885 Bacteria 991
563 Ga0207682_10088969 3300025893 Bacteria 1336
564 Ga0207692_10028356 3300025898 Bacteria 2647
565 Ga0207692_10127545 3300025898 Bacteria 1433
566 Ga0207692_10154858 3300025898 Bacteria 1316
567 Ga0207642_10064556 3300025899 Bacteria 1717
568 Ga0207642_10078813 3300025899 Bacteria 1593
569 Ga0207642_10114574 3300025899 Bacteria 1379
570 Ga0207642_10166824 3300025899 Bacteria 1187
571 Ga0207642_10182252 3300025899 Unclassified 1145
572 Ga0207710_10044000 3300025900 Bacteria 1988
573 Ga0207688_10010947 3300025901 Bacteria 4935
574 Ga0207688_10023379 3300025901 Bacteria 3384
575 Ga0207688_10060800 3300025901 Bacteria 2129
576 Ga0207688_10129549 3300025901 Bacteria 1478
577 Ga0207688_10140522 3300025901 Unclassified 1421
578 Ga0207688_10320817 3300025901 Bacteria 950
579 Ga0207647_10228702 3300025904 Bacteria 1070
580 Ga0207647_10384018 3300025904 Unclassified 793
581 Ga0207647_10592550 3300025904 Bacteria 612
582 Ga0207685_10019344 3300025905 Bacteria 2243
583 Ga0207685_10023237 3300025905 Bacteria 2108
584 Ga0207685_10037253 3300025905 Bacteria 1789
585 Ga0207699_10054307 3300025906 Bacteria 2379
586 Ga0207699_10134884 3300025906 Bacteria 1615
587 Ga0207699_10279802 3300025906 Bacteria 1159
588 Ga0207699_10324534 3300025906 Bacteria 1081
589 Ga0207645_10109233 3300025907 Bacteria 1789
590 Ga0207645_10568272 3300025907 Bacteria 769
591 Ga0207643_10002816 3300025908 Bacteria 9385
592 Ga0207643_10025874 3300025908 Bacteria 3246
593 Ga0207643_10040727 3300025908 Bacteria 2616
594 Ga0207643_10062187 3300025908 Bacteria 2133
595 Ga0207643_10117875 3300025908 Bacteria 1570
596 Ga0207643_10239322 3300025908 Bacteria 1115
597 Ga0207643_10268049 3300025908 Bacteria 1056
598 Ga0207643_10315182 3300025908 Bacteria 976
599 Ga0207684_10064241 3300025910 Bacteria 3116
600 Ga0207684_10220098 3300025910 Unclassified 1638
601 Ga0207684_10240866 3300025910 Bacteria 1560
602 Ga0207684_10510184 3300025910 Unclassified 1030
603 Ga0207654_10096981 3300025911 Bacteria 1809
604 Ga0207654_10240261 3300025911 Bacteria 1210
605 Ga0207707_10133645 3300025912 Bacteria 2170
606 Ga0207693_10002498 3300025915 Bacteria 16007
607 Ga0207693_10018661 3300025915 Bacteria 5521
608 Ga0207693_10036223 3300025915 Bacteria 3889
609 Ga0207693_10050225 3300025915 Bacteria 3275
610 Ga0207693_10127663 3300025915 Bacteria 1999
611 Ga0207693_10259736 3300025915 Bacteria 1362
612 Ga0207693_10311402 3300025915 Bacteria 1233
613 Ga0207693_10823905 3300025915 Bacteria 715
614 Ga0207663_10016048 3300025916 Bacteria 4145
615 Ga0207663_10076207 3300025916 Bacteria 2178
616 Ga0207663_10113988 3300025916 Bacteria 1839
617 Ga0207663_10162570 3300025916 Bacteria 1578
618 Ga0207663_10177147 3300025916 Bacteria 1519
619 Ga0207663_10269088 3300025916 Bacteria 1261
620 Ga0207663_10436539 3300025916 Bacteria 1008
621 Ga0207660_10654854 3300025917 Bacteria 856
622 Ga0207660_11499648 3300025917 Bacteria 545
623 Ga0207662_10126476 3300025918 Bacteria 1608
624 Ga0207662_10141647 3300025918 Bacteria 1523
625 Ga0207657_10009576 3300025919 Bacteria 9725
626 Ga0207657_10160038 3300025919 Bacteria 1829
627 Ga0207657_10269221 3300025919 Bacteria 1354
628 Ga0207649_10021599 3300025920 Bacteria 3708
629 Ga0207649_10619038 3300025920 Bacteria 834
630 Ga0207652_10061423 3300025921 Bacteria 3244
631 Ga0207646_10019475 3300025922 Bacteria 6306
632 Ga0207646_10126372 3300025922 Bacteria 2299
633 Ga0207646_10370200 3300025922 Unclassified 1294
634 Ga0207681_10243080 3300025923 Bacteria 1402
635 Ga0207681_10270249 3300025923 Bacteria 1334
636 Ga0207681_10391355 3300025923 Bacteria 1121
637 Ga0207694_10327561 3300025924 Bacteria 1265
638 Ga0207650_10020925 3300025925 Bacteria 4621
639 Ga0207659_10029480 3300025926 Bacteria 3741
640 Ga0207659_10180965 3300025926 Bacteria 1670
641 Ga0207659_10595631 3300025926 Bacteria 942
642 Ga0207687_10004254 3300025927 Bacteria 9575
643 Ga0207687_10012189 3300025927 Bacteria 5623
644 Ga0207687_10015050 3300025927 Bacteria 5067
645 Ga0207687_10114580 3300025927 Bacteria 2007
646 Ga0207687_10208548 3300025927 Bacteria 1532
647 Ga0207687_10219686 3300025927 Bacteria 1495
648 Ga0207687_10223261 3300025927 Bacteria 1485
649 Ga0207687_10224560 3300025927 Bacteria 1481
650 Ga0207687_10463861 3300025927 Bacteria 1052
651 Ga0207687_11060481 3300025927 Bacteria 696
652 Ga0207687_11222077 3300025927 Unclassified 646
653 Ga0207700_10166176 3300025928 Bacteria 1836
654 Ga0207700_10167076 3300025928 Bacteria 1832
655 Ga0207700_10410889 3300025928 Bacteria 1187
656 Ga0207700_10458413 3300025928 Bacteria 1124
657 Ga0207700_10802040 3300025928 Bacteria 842
658 Ga0207664_10021336 3300025929 Bacteria 4813
659 Ga0207664_10029771 3300025929 Bacteria 4162
660 Ga0207664_10186199 3300025929 Bacteria 1785
661 Ga0207664_10246137 3300025929 Bacteria 1558
662 Ga0207664_10272445 3300025929 Bacteria 1483
663 Ga0207664_10524645 3300025929 Bacteria 1061
664 Ga0207644_10020746 3300025931 Bacteria 4470
665 Ga0207690_10050965 3300025932 Bacteria 2766
666 Ga0207690_10059272 3300025932 Bacteria 2593
667 Ga0207690_10103432 3300025932 Bacteria 2038
668 Ga0207690_10133479 3300025932 Bacteria 1820
669 Ga0207690_10282275 3300025932 Bacteria 1293
670 Ga0207690_10376894 3300025932 Bacteria 1127
671 Ga0207690_11147224 3300025932 Bacteria 648
672 Ga0207706_10014996 3300025933 Bacteria 7016
673 Ga0207706_10017665 3300025933 Bacteria 6427
674 Ga0207706_10034581 3300025933 Bacteria 4495
675 Ga0207706_10201463 3300025933 Bacteria 1746
676 Ga0207706_10320465 3300025933 Bacteria 1349
677 Ga0207686_10047744 3300025934 Bacteria 2649
678 Ga0207686_10179831 3300025934 Bacteria 1499
679 Ga0207686_10248019 3300025934 Bacteria 1299
680 Ga0207686_10403144 3300025934 Bacteria 1042
681 Ga0207686_10496213 3300025934 Bacteria 946
682 Ga0207686_10641430 3300025934 Bacteria 839
683 Ga0207709_10007458 3300025935 Bacteria 6090
684 Ga0207709_10028024 3300025935 Bacteria 3253
685 Ga0207709_10049157 3300025935 Bacteria 2573
686 Ga0207709_10059205 3300025935 Bacteria 2384
687 Ga0207709_10063968 3300025935 Bacteria 2308
688 Ga0207709_10073340 3300025935 Bacteria 2181
689 Ga0207709_10229928 3300025935 Bacteria 1343
690 Ga0207709_10781300 3300025935 Bacteria 770
691 Ga0207670_10670937 3300025936 Bacteria 856
692 Ga0207669_10017533 3300025937 Bacteria 3676
693 Ga0207669_10042619 3300025937 Bacteria 2651
694 Ga0207669_10051244 3300025937 Bacteria 2472
695 Ga0207669_10121335 3300025937 Bacteria 1775
696 Ga0207669_10139874 3300025937 Bacteria 1678
697 Ga0207669_10287953 3300025937 Bacteria 1242
698 Ga0207669_11071641 3300025937 Bacteria 679
699 Ga0207704_10101644 3300025938 Bacteria 1918
700 Ga0207704_10161627 3300025938 Bacteria 1594
701 Ga0207704_10317308 3300025938 Bacteria 1201
702 Ga0207704_10341616 3300025938 Bacteria 1162
703 Ga0207704_10461063 3300025938 Bacteria 1016
704 Ga0207704_10557025 3300025938 Bacteria 932
705 Ga0207665_10008549 3300025939 Bacteria 6738
706 Ga0207665_10020234 3300025939 Bacteria 4372
707 Ga0207665_10108498 3300025939 Bacteria 1947
708 Ga0207665_10159043 3300025939 Bacteria 1624
709 Ga0207665_10225971 3300025939 Bacteria 1374
710 Ga0207665_10274467 3300025939 Bacteria 1253
711 Ga0207691_10015901 3300025940 Bacteria 7148
712 Ga0207691_10019041 3300025940 Bacteria 6501
713 Ga0207691_10031849 3300025940 Bacteria 4921
714 Ga0207691_10058080 3300025940 Bacteria 3519
715 Ga0207691_10540158 3300025940 Bacteria 989
716 Ga0207711_10116605 3300025941 Bacteria 2381
717 Ga0207711_10138117 3300025941 Bacteria 2191
718 Ga0207711_10162507 3300025941 Bacteria 2023
719 Ga0207711_10230166 3300025941 Bacteria 1697
720 Ga0207689_10022143 3300025942 Bacteria 5344
721 Ga0207689_10250401 3300025942 Bacteria 1465
722 Ga0207689_10515065 3300025942 Unclassified 1003
723 Ga0207661_10106385 3300025944 Bacteria 2365
724 Ga0207661_10139290 3300025944 Bacteria 2086
725 Ga0207661_10698480 3300025944 Bacteria 933
726 Ga0207661_10793094 3300025944 Bacteria 872
727 Ga0207679_10030086 3300025945 Bacteria 3788
728 Ga0207679_10156956 3300025945 Bacteria 1859
729 Ga0207679_10190185 3300025945 Bacteria 1706
730 Ga0207679_11037327 3300025945 Bacteria 752
731 Ga0207667_10028849 3300025949 Bacteria 6025
732 Ga0207667_10307206 3300025949 Bacteria 1620
733 Ga0207667_10318041 3300025949 Bacteria 1590
734 Ga0207667_10403240 3300025949 Bacteria 1392
735 Ga0207667_10422283 3300025949 Bacteria 1357
736 Ga0207667_10518044 3300025949 Bacteria 1208
737 Ga0207651_10025016 3300025960 Bacteria 3704
738 Ga0207651_10049676 3300025960 Bacteria 2843
739 Ga0207712_10051337 3300025961 Bacteria 2884
740 Ga0207712_10130904 3300025961 Bacteria 1912
741 Ga0207712_10131142 3300025961 Bacteria 1910
742 Ga0207712_10231211 3300025961 Bacteria 1484
743 Ga0207668_10060117 3300025972 Bacteria 2666
744 Ga0207668_10096545 3300025972 Bacteria 2185
745 Ga0207668_10143518 3300025972 Bacteria 1839
746 Ga0207668_10639183 3300025972 Bacteria 930
747 Ga0207668_10698980 3300025972 Bacteria 891
748 Ga0207640_10033675 3300025981 Bacteria 3190
749 Ga0207640_10124284 3300025981 Bacteria 1855
750 Ga0207640_10278763 3300025981 Bacteria 1312
751 Ga0207640_10322705 3300025981 Bacteria 1230
752 Ga0207640_10395194 3300025981 Bacteria 1124
753 Ga0207640_10493448 3300025981 Bacteria 1018
754 Ga0207677_10040146 3300026023 Bacteria 3083
755 Ga0207677_10047667 3300026023 Bacteria 2879
756 Ga0207677_10114534 3300026023 Bacteria 2015
757 Ga0207677_10195662 3300026023 Bacteria 1603
758 Ga0207677_10238564 3300026023 Bacteria 1469
759 Ga0207677_10571198 3300026023 Bacteria 988
760 Ga0207677_10659398 3300026023 Bacteria 924
761 Ga0207703_10073429 3300026035 Bacteria 2830
762 Ga0207703_10294061 3300026035 Bacteria 1479
763 Ga0207703_10294695 3300026035 Bacteria 1477
764 Ga0207703_10448044 3300026035 Bacteria 1205
765 Ga0207703_10618749 3300026035 Bacteria 1025
766 Ga0207639_10006229 3300026041 Bacteria 8104
767 Ga0207639_10048829 3300026041 Bacteria 3205
768 Ga0207639_10522109 3300026041 Unclassified 1087
769 Ga0207639_10722774 3300026041 Bacteria 925
770 Ga0207639_11209501 3300026041 Bacteria 709
771 Ga0207678_10057996 3300026067 Bacteria 3332
772 Ga0207678_10132769 3300026067 Bacteria 2124
773 Ga0207678_10376675 3300026067 Bacteria 1227
774 Ga0207678_10400255 3300026067 Bacteria 1189
775 Ga0207678_10651380 3300026067 Bacteria 925
776 Ga0207708_10002498 3300026075 Bacteria 13532
777 Ga0207708_10002644 3300026075 Bacteria 13175
778 Ga0207708_10010840 3300026075 Bacteria 6780
779 Ga0207708_10034049 3300026075 Bacteria 3874
780 Ga0207708_10051722 3300026075 Bacteria 3128
781 Ga0207708_10099011 3300026075 Bacteria 2254
782 Ga0207708_10196499 3300026075 Bacteria 1608
783 Ga0207708_10212032 3300026075 Bacteria 1549
784 Ga0207708_10841265 3300026075 Bacteria 792
785 Ga0207702_10005791 3300026078 Bacteria 10749
786 Ga0207702_10031806 3300026078 Bacteria 4400
787 Ga0207702_10186855 3300026078 Bacteria 1912
788 Ga0207641_10117643 3300026088 Bacteria 2367
789 Ga0207641_10215924 3300026088 Bacteria 1776
790 Ga0207641_10870587 3300026088 Bacteria 894
791 Ga0207648_10025309 3300026089 Bacteria 5289
792 Ga0207648_10036493 3300026089 Bacteria 4330
793 Ga0207648_10039704 3300026089 Bacteria 4138
794 Ga0207648_10067743 3300026089 Bacteria 3111
795 Ga0207648_10080618 3300026089 Bacteria 2839
796 Ga0207648_10081260 3300026089 Bacteria 2827
797 Ga0207648_10110686 3300026089 Bacteria 2411
798 Ga0207648_10205823 3300026089 Bacteria 1746
799 Ga0207648_10324647 3300026089 Bacteria 1384
800 Ga0207648_10825367 3300026089 Bacteria 864
801 Ga0207676_10088485 3300026095 Bacteria 2535
802 Ga0207676_10199770 3300026095 Bacteria 1766
803 Ga0207676_10261170 3300026095 Bacteria 1564
804 Ga0207674_10009027 3300026116 Bacteria 11453
805 Ga0207674_10010087 3300026116 Bacteria 10741
806 Ga0207674_10016296 3300026116 Bacteria 8140
807 Ga0207675_100000456 3300026118 Bacteria 39658
808 Ga0207675_100018997 3300026118 Bacteria 6416
809 Ga0207675_100073717 3300026118 Bacteria 3194
810 Ga0207675_100089183 3300026118 Bacteria 2897
811 Ga0207675_100121938 3300026118 Bacteria 2467
812 Ga0207675_100123267 3300026118 Bacteria 2454
813 Ga0207675_100171554 3300026118 Bacteria 2074
814 Ga0207675_100175737 3300026118 Bacteria 2049
815 Ga0207675_100287596 3300026118 Bacteria 1598
816 Ga0207675_100636719 3300026118 Bacteria 1072
817 Ga0207683_10040192 3300026121 Bacteria 4080
818 Ga0207683_10063509 3300026121 Bacteria 3253
819 Ga0207683_10131380 3300026121 Bacteria 2252
820 Ga0207683_10141762 3300026121 Bacteria 2166
821 Ga0207683_10170683 3300026121 Bacteria 1970
822 Ga0207683_10212682 3300026121 Bacteria 1760
823 Ga0207683_10393726 3300026121 Bacteria 1274
824 Ga0207683_11029184 3300026121 Bacteria 764
825 Ga0207698_10017238 3300026142 Bacteria 4895
826 Ga0207698_10264721 3300026142 Bacteria 1581
827 Ga0207698_10785972 3300026142 Bacteria 953
828 Ga0207698_12321226 3300026142 Bacteria 548
829 Ga0209966_1010510 3300027695 Bacteria 1670
830 Ga0207428_10008373 3300027907 Bacteria 9340
831 Ga0207428_10065628 3300027907 Bacteria 2862
832 Ga0207428_10135745 3300027907 Bacteria 1881
833 Ga0207428_10177002 3300027907 Bacteria 1613
834 Ga0207428_10350594 3300027907 Bacteria 1086
835 Ga0268266_10075392 3300028379 Bacteria 2930
836 Ga0268266_10196349 3300028379 Bacteria 1845
837 Ga0268265_10702823 3300028380 Bacteria 977
838 Ga0268265_10721384 3300028380 Bacteria 965
839 Ga0268264_10325107 3300028381 Bacteria 1456
840 Ga0268264_10334318 3300028381 Bacteria 1437
841 Ga0265319_1017933 3300028563 Bacteria 2682
842 Ga0265336_10115141 3300028666 Bacteria 801
843 Ga0265320_10034685 3300031240 Bacteria 2564
844 Ga0307408_100191017 3300031548 Bacteria 1650
845 Ga0307405_10091971 3300031731 Bacteria 2011
846 Ga0307413_10016101 3300031824 Bacteria 3851
847 Ga0307410_10035377 3300031852 Bacteria 3243
848 Ga0307410_10196538 3300031852 Bacteria 1537
849 Ga0307410_10713524 3300031852 Bacteria 846
850 Ga0307406_10196163 3300031901 Bacteria 1482
851 Ga0307406_10260230 3300031901 Bacteria 1312
852 Ga0307407_10162051 3300031903 Bacteria 1464
853 Ga0307407_10873563 3300031903 Bacteria 688
854 Ga0307412_10119979 3300031911 Bacteria 1892
855 Ga0307412_10140262 3300031911 Bacteria 1769
856 Ga0307409_100008431 3300031995 Bacteria 6257
857 Ga0307409_100020656 3300031995 Bacteria 4494
858 Ga0307409_100347884 3300031995 Bacteria 1397
859 Ga0307409_100633503 3300031995 Bacteria 1061
860 Ga0307416_100118177 3300032002 Bacteria 2355
861 Ga0307416_100158384 3300032002 Bacteria 2088
862 Ga0307416_100332888 3300032002 Bacteria 1527
863 Ga0307416_100409494 3300032002 Bacteria 1396
864 Ga0307416_101692907 3300032002 Bacteria 737
865 Ga0307414_10156013 3300032004 Bacteria 1807
866 Ga0307411_10082526 3300032005 Bacteria 2217
867 Ga0307411_11269228 3300032005 Bacteria 670
868 Ga0307415_100002060 3300032126 Bacteria 9933
869 Ga0307415_100016576 3300032126 Bacteria 4396
870 Ga0307415_101528606 3300032126 Bacteria 639
871 Ga0373930_0016150 3300034816 Bacteria 1409
872 Ga0373950_0078580 3300034818 Bacteria 686
873 Ga0373958_0029367 3300034819 Bacteria 1070
874 Ga0373959_0009849 3300034820 Bacteria 1658
875 Ga0373959_0011086 3300034820 Bacteria 1586
876 Ga0373938_0094675 3300034957 Bacteria 743
877 Ga0373926_0199038 3300035083 Bacteria 771
878 Ga0373926_0264729 3300035083 Bacteria 668
879 Ga0373934_0028206 3300035086 Bacteria 2186
880 Ga0373944_0007084 3300035089 Bacteria 2997
881 Ga0373949_0060086 3300035090 Bacteria 976
882 Ga0373949_0123755 3300035090 Bacteria 728
883 Ga0373951_0009369 3300035091 Bacteria 2206
884 Ga0373951_0023308 3300035091 Bacteria 1430
885 Ga0373952_0014944 3300035092 Bacteria 1560
886 Ga0373923_0053137 3300035111 Bacteria 1703
887 Ga0373932_0067963 3300035112 Bacteria 1098
888 Ga0373936_0483993 3300035113 Bacteria 574
889 Ga0373939_0053177 3300035114 Bacteria 1264
890 Ga0373945_0077931 3300035116 Bacteria 1265
891 Ga0373960_0036232 3300035121 Bacteria 1404
892 Ga0373960_0099734 3300035121 Unclassified 940
893 Ga0373943_0147169 3300035170 Bacteria 1273
894 Ga0373943_0205563 3300035170 Bacteria 1091
895 Ga0373946_0002051 3300035171 Bacteria 7072
896 Ga0373955_0073938 3300035172 Bacteria 1911
897 Ga0373942_0034540 3300035207 Bacteria 1353
898 Ga0373961_0043098 3300035241 Bacteria 1311
899 Ga0373961_0266546 3300035241 Bacteria 624
900 Ga0373924_0004046 3300035410 Bacteria 5097
901 Ga0373931_0026542 3300035691 Bacteria 2949
902 Ga0373931_0412068 3300035691 Bacteria 857
903 Ga0373931_0535234 3300035691 Bacteria 759
904 Ga0373935_0015165 3300035692 Bacteria 4655
905 Ga0373927_0067374 3300035695 Bacteria 2316
906 Ga0373947_0031960 3300035725 Bacteria 3100
907 Ga0373947_0060437 3300035725 Bacteria 2301
908 Ga0373937_0113050 3300036401 Bacteria 2526
909 Ga0373925_0029385 3300037068 Bacteria 4033
910 Ga0373925_0610221 3300037068 Bacteria 899
911 Ga0395899_0002389 3300037312 Bacteria 15244
912 Ga0395899_0004758 3300037312 Bacteria 10584
913 Ga0395899_0005459 3300037312 Bacteria 9861
914 Ga0395899_0031395 3300037312 Bacteria 3992
915 Ga0395899_0073312 3300037312 Bacteria 2504
916 Ga0395899_0140291 3300037312 Bacteria 1720
917 Ga0395899_0999086 3300037312 Bacteria 505
918 Ga0395900_0003865 3300037418 Bacteria 16006
919 Ga0395900_0004269 3300037418 Bacteria 15155
920 Ga0395900_0006467 3300037418 Bacteria 12217
921 Ga0395900_0045074 3300037418 Bacteria 4542
922 Ga0395900_0065219 3300037418 Bacteria 3741
923 Ga0395900_0073472 3300037418 Bacteria 3516
924 Ga0395900_0076922 3300037418 Bacteria 3429
925 Ga0395900_0132622 3300037418 Bacteria 2552
926 Ga0395900_0158166 3300037418 Bacteria 2313
927 Ga0395900_0222536 3300037418 Bacteria 1901
928 Ga0395900_0249710 3300037418 Bacteria 1776
929 Ga0395900_0501994 3300037418 Bacteria 1163
930 Ga0395898_0002662 3300037466 Bacteria 20752
931 Ga0395898_0006058 3300037466 Bacteria 12981
932 Ga0395898_0013863 3300037466 Bacteria 8284
933 Ga0395898_0036964 3300037466 Bacteria 4846
934 Ga0395898_0041218 3300037466 Bacteria 4561
935 Ga0395898_0045759 3300037466 Bacteria 4300
936 Ga0395898_0057707 3300037466 Bacteria 3782
937 Ga0395898_0076593 3300037466 Bacteria 3230
938 Ga0395898_0184384 3300037466 Bacteria 1994
939 Ga0395898_0564027 3300037466 Bacteria 1081
940 Ga0395905_0002146 3300037471 Bacteria 22374
941 Ga0395905_0005265 3300037471 Bacteria 13233
942 Ga0395905_0008385 3300037471 Bacteria 10191
943 Ga0395905_0011371 3300037471 Bacteria 8605
944 Ga0395905_0031674 3300037471 Bacteria 4976
945 Ga0395905_0091134 3300037471 Bacteria 2858
946 Ga0395905_0184014 3300037471 Bacteria 1961
947 Ga0395905_0214012 3300037471 Bacteria 1805
948 Ga0395905_0235168 3300037471 Bacteria 1713
949 Ga0395905_0236416 3300037471 Bacteria 1708
950 Ga0395905_0829839 3300037471 Unclassified 827
951 Ga0395901_0006015 3300038443 Bacteria 12294
952 Ga0395901_0006940 3300038443 Bacteria 11442
953 Ga0395901_0007324 3300038443 Bacteria 11140
954 Ga0395901_0019275 3300038443 Bacteria 6974
955 Ga0395901_0022266 3300038443 Bacteria 6493
956 Ga0395901_0025311 3300038443 Bacteria 6092
957 Ga0395901_0093690 3300038443 Bacteria 3145
958 Ga0395901_0125839 3300038443 Bacteria 2693
959 Ga0395901_0205751 3300038443 Bacteria 2062
960 Ga0395901_0331232 3300038443 Bacteria 1574
961 Ga0395901_0484208 3300038443 Bacteria 1261
962 Ga0395901_0493973 3300038443 Bacteria 1247
963 Ga0395901_0595403 3300038443 Bacteria 1115
964 Ga0395901_0945401 3300038443 Bacteria 841
965 Ga0451806_104958 3300041462 Bacteria 860
966 Ga0451807_2561596 3300041486 Bacteria 1287
967 Ga0451807_2718629 3300041486 Bacteria 744
968 Ga0451835_0716306 3300041492 Bacteria 978
969 Ga0451847_0100796 3300041503 Bacteria 772
970 Ga0451853_1497062 3300041512 Bacteria 2180
971 Ga0451853_2737307 3300041512 Bacteria 729
972 Ga0451853_3950287 3300041512 Bacteria 710
973 Ga0439448_0020774 3300042005 Bacteria 2034
974 Ga0439448_0082300 3300042005 Bacteria 1082
975 Ga0439448_0106957 3300042005 Bacteria 954
976 Ga0439455_0024558 3300042012 Bacteria 1459
977 Ga0439463_012862 3300042016 Bacteria 2057
978 Ga0439463_017975 3300042016 Bacteria 1758
979 Ga0439458_0023962 3300042157 Bacteria 1425
980 Ga0439435_0095507 3300042436 Bacteria 908
981 Ga0439435_0330922 3300042436 Bacteria 526
982 Ga0439459_0036808 3300042438 Bacteria 1022
983 Ga0450918_030128 3300042531 Bacteria 958
984 Ga0439440_0107344 3300042993 Bacteria 765
985 Ga0439440_0130573 3300042993 Bacteria 706
986 Ga0466972_0096530 3300044658 Bacteria 1400
987 Ga0466972_0410359 3300044658 Bacteria 635
988 Ga0466965_0429253 3300044683 Bacteria 733
989 Ga0466963_0039561 3300044694 Bacteria 3088
990 Ga0466964_0000687 3300044706 Bacteria 10931
991 Ga0453684_0055532 3300044712 Bacteria 5148
992 Ga0466968_0038954 3300044735 Bacteria 1999
993 Ga0466957_0098346 3300044842 Bacteria 1841
994 Ga0466960_0031848 3300044901 Bacteria 2436
995 Ga0466960_0086628 3300044901 Bacteria 1588
996 Ga0466960_0203660 3300044901 Bacteria 1082
997 Ga0451576_0057008 3300045051 Bacteria 4084
998 Ga0451576_0884761 3300045051 Unclassified 937
999 Ga0466958_0232209 3300045836 Bacteria 1178
1000 Ga0466967_0001643 3300045976 Bacteria 13213
1001 Ga0466967_0002463 3300045976 Bacteria 11533
1002 Ga0466967_0099330 3300045976 Bacteria 2658
1003 Ga0495592_0366819 3300046454 Bacteria 919
1004 Ga0495603_0024460 3300046455 Bacteria 3653
1005 Ga0495603_0051869 3300046455 Bacteria 2436
1006 Ga0495590_0241143 3300046457 Bacteria 671
1007 Ga0495629_0047837 3300046459 Bacteria 2999
1008 Ga0495629_0088315 3300046459 Bacteria 2162
1009 Ga0495629_0126979 3300046459 Bacteria 1777
1010 Ga0495641_0011598 3300046461 Bacteria 5004
1011 Ga0495641_0029367 3300046461 Bacteria 2650
1012 Ga0495651_0079494 3300046462 Bacteria 2478
1013 Ga0495653_0029808 3300046463 Bacteria 4351
1014 Ga0495580_0290049 3300046472 Bacteria 1115
1015 Ga0495582_0023062 3300046473 Bacteria 3404
1016 Ga0495582_0206229 3300046473 Bacteria 1123
1017 Ga0495639_0009246 3300046475 Bacteria 4223
1018 Ga0495662_0020440 3300046476 Bacteria 3202
1019 Ga0495662_0089407 3300046476 Bacteria 1501
1020 Ga0495584_0147807 3300046491 Bacteria 1194
1021 Ga0495584_0276073 3300046491 Bacteria 854
1022 Ga0495596_0020094 3300046500 Bacteria 2736
1023 Ga0495596_0056305 3300046500 Bacteria 1536
1024 Ga0495608_0007758 3300046511 Bacteria 7557
1025 Ga0495616_0280243 3300046513 Bacteria 709
1026 Ga0495618_0203273 3300046514 Bacteria 1253
1027 Ga0495620_0052722 3300046515 Bacteria 1726
1028 Ga0495628_0217670 3300046516 Bacteria 1435
1029 Ga0495630_0035115 3300046517 Bacteria 3746
1030 Ga0495630_0053277 3300046517 Bacteria 3029
1031 Ga0495630_0288926 3300046517 Bacteria 1253
1032 Ga0495637_0099949 3300046520 Bacteria 1135
1033 Ga0495663_0116328 3300046525 Bacteria 892
1034 Ga0495663_0174097 3300046525 Bacteria 743
1035 Ga0495666_0062918 3300046526 Bacteria 1771
1036 Ga0495642_0142218 3300046528 Bacteria 1036
1037 Ga0495642_0384008 3300046528 Bacteria 619
1038 Ga0495652_0222055 3300046529 Bacteria 1419
1039 Ga0495665_0016491 3300046531 Bacteria 3980
1040 Ga0495665_0275480 3300046531 Bacteria 864
1041 Ga0495640_0017760 3300046533 Bacteria 5293
1042 Ga0495640_0209351 3300046533 Bacteria 1233
1043 Ga0495586_0142236 3300046535 Bacteria 1347
1044 Ga0495586_0198005 3300046535 Bacteria 1138
1045 Ga0495587_0043149 3300046536 Bacteria 2687
1046 Ga0495609_0183594 3300046538 Bacteria 880
1047 Ga0495609_0402179 3300046538 Bacteria 548
1048 Ga0495621_0115396 3300046539 Bacteria 1034
1049 Ga0495645_0096333 3300046543 Bacteria 2109
1050 Ga0495645_0298142 3300046543 Bacteria 1054
1051 Ga0495622_0050981 3300046557 Bacteria 1920
1052 Ga0495656_0019820 3300046615 Bacteria 2601
1053 Ga0495656_0193030 3300046615 Bacteria 1007
1054 Ga0495656_0474704 3300046615 Bacteria 661
1055 Ga0495668_0186241 3300046616 Bacteria 1137
1056 Ga0495668_0269968 3300046616 Unclassified 932
1057 Ga0495634_0053636 3300046642 Bacteria 2700
1058 Ga0495634_0090281 3300046642 Bacteria 1990
1059 Ga0495635_0041227 3300046663 Bacteria 3189
1060 Ga0495588_0017861 3300046674 Bacteria 3452
1061 Ga0495657_0019739 3300046675 Bacteria 4858
1062 Ga0495623_0034248 3300046679 Bacteria 3258
1063 Ga0495646_0145723 3300046680 Bacteria 1320
1064 Ga0495647_0005116 3300046681 Bacteria 4295
1065 Ga0495647_0182152 3300046681 Bacteria 914
1066 Ga0495647_0295180 3300046681 Bacteria 729
1067 Ga0495658_0032658 3300046683 Bacteria 2843
1068 Ga0495658_0093278 3300046683 Bacteria 1786
1069 Ga0495658_0112692 3300046683 Bacteria 1637
1070 Ga0495658_0197255 3300046683 Bacteria 1253
1071 Ga0495613_0036716 3300046689 Bacteria 3633
1072 Ga0495613_0054896 3300046689 Bacteria 2928
1073 Ga0495624_0029854 3300046690 Bacteria 3554
1074 Ga0495624_0174482 3300046690 Bacteria 1311
1075 Ga0495624_0407260 3300046690 Bacteria 816
1076 Ga0495670_0362328 3300046691 Bacteria 781
1077 Ga0495671_0242283 3300046692 Bacteria 871
1078 Ga0495600_0081184 3300046809 Bacteria 2116
1079 Ga0495581_0177672 3300047315 Bacteria 1244
1080 Ga0495581_0211695 3300047315 Bacteria 1133
1081 Ga0495581_0367676 3300047315 Bacteria 839
1082 Ga0495674_0047497 3300047319 Bacteria 3806
1083 Ga0495674_0061440 3300047319 Bacteria 3274
1084 Ga0495676_0010939 3300047321 Bacteria 8203
1085 Ga0495676_0051247 3300047321 Bacteria 3304
1086 Ga0495676_0053327 3300047321 Bacteria 3223
1087 Ga0495680_0120889 3300047322 Bacteria 1933
1088 Ga0495680_0220786 3300047322 Bacteria 1353
1089 Ga0495675_0047895 3300047444 Bacteria 2719
1090 Ga0495677_0074392 3300047445 Bacteria 1268
1091 Ga0495677_0120343 3300047445 Bacteria 1001
1092 Ga0495679_177683 3300047446 Bacteria 565
1093 Ga0495684_0004315 3300047471 Bacteria 11107
1094 Ga0495593_0023967 3300047673 Bacteria 3386
1095 Ga0495593_0221109 3300047673 Bacteria 950
1096 Ga0495602_0145862 3300048088 Bacteria 1867
1097 Ga0495614_0013264 3300048089 Bacteria 3614
1098 Ga0495614_0062659 3300048089 Bacteria 1598
1099 Ga0495614_0076263 3300048089 Bacteria 1449
1100 Ga0496100_0001325 3300048903 Bacteria 12111
1101 Ga0496100_0014418 3300048903 Bacteria 4589
1102 Ga0496100_0189871 3300048903 Bacteria 1491
1103 Ga0496100_0197644 3300048903 Bacteria 1463
1104 Ga0496100_0254268 3300048903 Bacteria 1300
1105 Ga0496100_0267248 3300048903 Bacteria 1270
1106 Ga0496100_0275535 3300048903 Bacteria 1252
1107 Ga0496100_1145432 3300048903 Bacteria 613
1108 Ga0496101_0002083 3300048904 Bacteria 12184
1109 Ga0496101_0084229 3300048904 Bacteria 2354
1110 Ga0496101_0100257 3300048904 Bacteria 2166
1111 Ga0496101_0138684 3300048904 Bacteria 1852
1112 Ga0496101_0153358 3300048904 Bacteria 1763
1113 Ga0496101_0190771 3300048904 Bacteria 1581
1114 Ga0496101_0285946 3300048904 Bacteria 1290
1115 Ga0496101_0320220 3300048904 Bacteria 1216
1116 Ga0496101_0330578 3300048904 Bacteria 1196
1117 Ga0496101_0631819 3300048904 Bacteria 846
1118 Ga0496101_0901128 3300048904 Bacteria 696
1119 Ga0496102_0010767 3300048905 Bacteria 7877
1120 Ga0496102_0069095 3300048905 Bacteria 3242
1121 Ga0496102_0141567 3300048905 Bacteria 2255
1122 Ga0496102_0149447 3300048905 Bacteria 2194
1123 Ga0496102_0213186 3300048905 Bacteria 1820
1124 Ga0496102_0236354 3300048905 Bacteria 1723
1125 Ga0496102_0296880 3300048905 Bacteria 1523
1126 Ga0496102_0743837 3300048905 Bacteria 903
1127 Ga0496103_0012845 3300048906 Bacteria 4968
1128 Ga0496103_0016550 3300048906 Bacteria 4400
1129 Ga0496103_0065854 3300048906 Bacteria 2260
1130 Ga0496103_0307631 3300048906 Bacteria 1020
1131 Ga0496103_0478261 3300048906 Bacteria 798
1132 Ga0496104_0010750 3300048907 Bacteria 8185
1133 Ga0496104_0014894 3300048907 Bacteria 7030
1134 Ga0496104_0028100 3300048907 Bacteria 5211
1135 Ga0496104_0043659 3300048907 Bacteria 4210
1136 Ga0496104_0057015 3300048907 Bacteria 3696
1137 Ga0496104_0178708 3300048907 Bacteria 2032
1138 Ga0496104_1392342 3300048907 Bacteria 604
1139 Ga0496105_0017687 3300048908 Bacteria 5719
1140 Ga0496105_0032706 3300048908 Bacteria 4269
1141 Ga0496105_0047074 3300048908 Bacteria 3559
1142 Ga0496105_0056314 3300048908 Bacteria 3245
1143 Ga0496105_0063560 3300048908 Bacteria 3045
1144 Ga0496105_0067152 3300048908 Bacteria 2961
1145 Ga0496105_0075849 3300048908 Bacteria 2776
1146 Ga0496105_0079130 3300048908 Bacteria 2715
1147 Ga0496106_0001833 3300048909 Bacteria 15913
1148 Ga0496106_0008465 3300048909 Bacteria 7610
1149 Ga0496106_0031141 3300048909 Bacteria 3975
1150 Ga0496106_0037184 3300048909 Bacteria 3641
1151 Ga0496106_0051170 3300048909 Bacteria 3114
1152 Ga0496106_0053858 3300048909 Bacteria 3039
1153 Ga0496106_0496613 3300048909 Bacteria 980
1154 Ga0496106_0521510 3300048909 Bacteria 954
1155 Ga0496106_1145509 3300048909 Bacteria 608
1156 Ga0496107_0002424 3300048910 Bacteria 12082
1157 Ga0496107_0043803 3300048910 Bacteria 3216
1158 Ga0496107_0065945 3300048910 Bacteria 2624
1159 Ga0496107_0109500 3300048910 Bacteria 2029
1160 Ga0496107_0345237 3300048910 Bacteria 1108
1161 Ga0496107_0710373 3300048910 Bacteria 739
1162 Ga0496108_0002788 3300048911 Bacteria 14000
1163 Ga0496108_0021258 3300048911 Bacteria 5333
1164 Ga0496108_0022720 3300048911 Bacteria 5159
1165 Ga0496108_0039483 3300048911 Bacteria 3934
1166 Ga0496108_0087510 3300048911 Bacteria 2646
1167 Ga0496108_0120132 3300048911 Bacteria 2253
1168 Ga0496108_0184958 3300048911 Bacteria 1804
1169 Ga0496108_0531491 3300048911 Bacteria 1026
1170 Ga0496108_0564571 3300048911 Bacteria 992
1171 Ga0496108_0841504 3300048911 Unclassified 790
1172 Ga0496109_0021655 3300048912 Bacteria 5688
1173 Ga0496109_0040526 3300048912 Bacteria 4218
1174 Ga0496109_0067447 3300048912 Bacteria 3277
1175 Ga0496109_0075437 3300048912 Bacteria 3100
1176 Ga0496109_0146897 3300048912 Bacteria 2206
1177 Ga0496109_0244501 3300048912 Bacteria 1689
1178 Ga0496109_0251497 3300048912 Bacteria 1664
1179 Ga0496109_0272671 3300048912 Bacteria 1594
1180 Ga0496109_0307173 3300048912 Bacteria 1496
1181 Ga0496109_0561467 3300048912 Bacteria 1076
1182 Ga0496109_0792792 3300048912 Bacteria 885
1183 Ga0496110_0002875 3300048913 Bacteria 13014
1184 Ga0496110_0024616 3300048913 Bacteria 5133
1185 Ga0496110_0028629 3300048913 Bacteria 4787
1186 Ga0496110_0045873 3300048913 Bacteria 3822
1187 Ga0496110_0124379 3300048913 Bacteria 2326
1188 Ga0496110_0162991 3300048913 Bacteria 2021
1189 Ga0496110_0277864 3300048913 Bacteria 1525
1190 Ga0496110_0325953 3300048913 Bacteria 1399
1191 Ga0496110_0626840 3300048913 Bacteria 974
1192 Ga0496110_0720344 3300048913 Bacteria 900
1193 Ga0496110_1396902 3300048913 Bacteria 610
1194 Ga0496111_0000818 3300048914 Bacteria 16715
1195 Ga0496111_0002896 3300048914 Bacteria 10479
1196 Ga0496111_0020914 3300048914 Bacteria 4562
1197 Ga0496111_0075365 3300048914 Bacteria 2458
1198 Ga0496111_0103995 3300048914 Bacteria 2089
1199 Ga0496111_0113743 3300048914 Bacteria 1994
1200 Ga0496111_0127144 3300048914 Bacteria 1884
1201 Ga0496111_0175778 3300048914 Bacteria 1591
1202 Ga0496111_0287478 3300048914 Bacteria 1219
1203 Ga0496111_0376147 3300048914 Bacteria 1051
1204 Ga0496112_0005661 3300048915 Bacteria 10852
1205 Ga0496112_0061188 3300048915 Bacteria 3711
1206 Ga0496112_0069531 3300048915 Bacteria 3478
1207 Ga0496112_0459549 3300048915 Bacteria 1211
1208 Ga0496112_0565410 3300048915 Bacteria 1070
1209 Ga0496112_1672411 3300048915 Bacteria 549
1210 Ga0496113_0023734 3300048916 Bacteria 4351
1211 Ga0496113_0059262 3300048916 Bacteria 2884
1212 Ga0496113_0084478 3300048916 Bacteria 2437
1213 Ga0496113_0190033 3300048916 Bacteria 1630
1214 Ga0496113_0271843 3300048916 Bacteria 1354
1215 Ga0496113_0344838 3300048916 Bacteria 1194
1216 Ga0496113_0374837 3300048916 Bacteria 1142
1217 Ga0496113_0394053 3300048916 Bacteria 1112
1218 Ga0496113_0400750 3300048916 Bacteria 1102
1219 Ga0496113_0451659 3300048916 Bacteria 1033
1220 Ga0496113_1499670 3300048916 Bacteria 520
1221 Ga0496114_0010067 3300048917 Bacteria 7518
1222 Ga0496114_0013742 3300048917 Bacteria 6490
1223 Ga0496114_0031479 3300048917 Bacteria 4365
1224 Ga0496114_0061345 3300048917 Bacteria 3144
1225 Ga0496114_0086988 3300048917 Bacteria 2649
1226 Ga0496114_0177348 3300048917 Bacteria 1860
1227 Ga0496114_0478300 3300048917 Bacteria 1102
1228 Ga0496114_0552615 3300048917 Unclassified 1017
1229 Ga0496114_1022974 3300048917 Bacteria 710
1230 Ga0496115_0002972 3300048918 Bacteria 12182
1231 Ga0496115_0017580 3300048918 Bacteria 5471
1232 Ga0496115_0030561 3300048918 Bacteria 4238
1233 Ga0496115_0034681 3300048918 Bacteria 3987
1234 Ga0496115_0037444 3300048918 Bacteria 3843
1235 Ga0496115_0082435 3300048918 Bacteria 2620
1236 Ga0496115_0086478 3300048918 Bacteria 2558
1237 Ga0496115_0091189 3300048918 Bacteria 2490
1238 Ga0496115_0126148 3300048918 Bacteria 2108
1239 Ga0496115_0287543 3300048918 Bacteria 1349
1240 Ga0496115_0334019 3300048918 Bacteria 1238
1241 Ga0496122_0212970 3300048925 Bacteria 1117
1242 Ga0501031_0000867 3300049568 Bacteria 18200
1243 Ga0501031_0069852 3300049568 Bacteria 2288
1244 Ga0501031_0347983 3300049568 Bacteria 959
1245 Ga0501031_0370044 3300049568 Bacteria 927
1246 Ga0501031_0526897 3300049568 Bacteria 761
1247 Ga0501032_0382284 3300049569 Bacteria 905
1248 Ga0501033_0029012 3300049570 Bacteria 4157
1249 Ga0501033_0083331 3300049570 Bacteria 2344
1250 Ga0501033_1182291 3300049570 Bacteria 507
1251 Ga0501036_0008436 3300049572 Bacteria 8443
1252 Ga0501036_0117087 3300049572 Bacteria 2250
1253 Ga0501036_0280482 3300049572 Bacteria 1394
1254 Ga0501036_1111489 3300049572 Bacteria 645
1255 Ga0501036_1402326 3300049572 Bacteria 566
1256 Ga0501036_1447807 3300049572 Bacteria 556
1257 Ga0501037_1055400 3300049573 Bacteria 527
1258 Ga0501038_0004809 3300049574 Bacteria 12547
1259 Ga0501038_0048049 3300049574 Bacteria 3694
1260 Ga0501038_0213080 3300049574 Bacteria 1544
1261 Ga0501038_0564377 3300049574 Bacteria 864
1262 Ga0501038_0718327 3300049574 Bacteria 747
1263 Ga0501039_0003561 3300049575 Bacteria 11670
1264 Ga0501039_0027720 3300049575 Bacteria 4356
1265 Ga0501039_0040721 3300049575 Bacteria 3586
1266 Ga0501039_0089408 3300049575 Bacteria 2400
1267 Ga0501039_0188440 3300049575 Bacteria 1622
1268 Ga0501039_0329332 3300049575 Bacteria 1200
1269 Ga0501039_0600390 3300049575 Bacteria 863
1270 Ga0501040_0027816 3300049576 Bacteria 3808
1271 Ga0501040_0063128 3300049576 Bacteria 2548
1272 Ga0501040_0078960 3300049576 Bacteria 2277
1273 Ga0501040_0264516 3300049576 Bacteria 1227
1274 Ga0501041_0000302 3300049577 Bacteria 23917
1275 Ga0501041_0032873 3300049577 Bacteria 3135
1276 Ga0501041_0401351 3300049577 Bacteria 868
1277 Ga0501042_0002652 3300049578 Bacteria 11006
1278 Ga0501042_0096575 3300049578 Bacteria 2123
1279 Ga0501042_0113976 3300049578 Bacteria 1947
1280 Ga0501042_0123965 3300049578 Bacteria 1860
1281 Ga0501043_0436361 3300049579 Bacteria 986
1282 Ga0501046_0006543 3300049580 Bacteria 10303
1283 Ga0501046_0022128 3300049580 Bacteria 5239
1284 Ga0501046_0334206 3300049580 Bacteria 1102
1285 Ga0501048_0001369 3300049582 Bacteria 18445
1286 Ga0501048_0053076 3300049582 Bacteria 2884
1287 Ga0501048_0475315 3300049582 Unclassified 896
1288 Ga0501067_0000759 3300049583 Bacteria 17365
1289 Ga0501067_0031295 3300049583 Bacteria 2953
1290 Ga0501067_0036234 3300049583 Bacteria 2739
1291 Ga0501067_0109440 3300049583 Bacteria 1536
1292 Ga0501068_0001163 3300049584 Bacteria 13960
1293 Ga0501068_0140645 3300049584 Bacteria 1513
1294 Ga0501068_0145949 3300049584 Bacteria 1485
1295 Ga0501068_0396709 3300049584 Bacteria 889
1296 Ga0501068_0585535 3300049584 Bacteria 726
1297 Ga0501069_0000171 3300049585 Bacteria 29142
1298 Ga0501069_0076118 3300049585 Bacteria 1886
1299 Ga0501069_0136285 3300049585 Bacteria 1407
1300 Ga0501069_0351047 3300049585 Bacteria 869
1301 Ga0501070_0042739 3300049586 Bacteria 3774
1302 Ga0501070_0628817 3300049586 Bacteria 854
1303 Ga0501071_0003170 3300049587 Bacteria 10227
1304 Ga0501071_0011907 3300049587 Bacteria 5876
1305 Ga0501071_0041297 3300049587 Bacteria 3303
1306 Ga0501071_0044513 3300049587 Bacteria 3183
1307 Ga0501071_0064726 3300049587 Bacteria 2653
1308 Ga0501072_0004402 3300049588 Bacteria 10695
1309 Ga0501072_0099647 3300049588 Bacteria 2309
1310 Ga0501072_0112961 3300049588 Bacteria 2163
1311 Ga0501072_0363566 3300049588 Bacteria 1149
1312 Ga0501072_0641726 3300049588 Bacteria 836
1313 Ga0501072_0815943 3300049588 Bacteria 730
1314 Ga0501073_0122193 3300049589 Bacteria 1804
1315 Ga0501074_0010885 3300049590 Bacteria 6605
1316 Ga0501074_0036758 3300049590 Bacteria 3547
1317 Ga0501074_0544813 3300049590 Bacteria 821
1318 Ga0501074_1170024 3300049590 Bacteria 540
1319 Ga0501075_0000959 3300049591 Bacteria 18370
1320 Ga0501075_0070520 3300049591 Bacteria 2641
1321 Ga0501075_0100168 3300049591 Bacteria 2200
1322 Ga0501075_0183836 3300049591 Bacteria 1594
1323 Ga0501075_0272457 3300049591 Bacteria 1290
1324 Ga0501075_0396860 3300049591 Bacteria 1051
1325 Ga0501076_0004307 3300049592 Bacteria 10097
1326 Ga0501076_0224182 3300049592 Bacteria 1536
1327 Ga0501076_0323466 3300049592 Bacteria 1265
1328 Ga0501076_0750127 3300049592 Bacteria 805
1329 Ga0501077_0041650 3300049593 Bacteria 2922
1330 Ga0501077_0045356 3300049593 Bacteria 2792
1331 Ga0501077_0140511 3300049593 Bacteria 1531
1332 Ga0501077_0216023 3300049593 Bacteria 1219
1333 Ga0501077_0231788 3300049593 Bacteria 1174
1334 Ga0501077_0281640 3300049593 Bacteria 1058
1335 Ga0501079_0002695 3300049741 Bacteria 12928
1336 Ga0501079_0005575 3300049741 Bacteria 9393
1337 Ga0501079_0070592 3300049741 Bacteria 2697
1338 Ga0501080_0044558 3300049742 Bacteria 4130
1339 Ga0501080_0057471 3300049742 Bacteria 3622
1340 Ga0501080_0782151 3300049742 Bacteria 838
1341 Ga0501080_1543648 3300049742 Bacteria 563
1342 Ga0501081_0000989 3300049743 Bacteria 16907
1343 Ga0501081_0084022 3300049743 Bacteria 2233
1344 Ga0501081_0362428 3300049743 Bacteria 1069
1345 Ga0501081_0681295 3300049743 Bacteria 771
1346 Ga0501083_0016420 3300049744 Bacteria 5182
1347 Ga0501083_0029978 3300049744 Bacteria 3738
1348 Ga0501035_0015404 3300049822 Bacteria 7054
1349 Ga0501035_0056110 3300049822 Bacteria 3516
1350 Ga0501035_0233649 3300049822 Bacteria 1566
1351 Ga0501035_0484485 3300049822 Bacteria 1020
1352 Ga0501044_0260715 3300049823 Bacteria 1672
1353 Ga0501045_0002386 3300049824 Bacteria 12754
1354 Ga0501045_0027435 3300049824 Bacteria 4104
1355 Ga0501045_0029861 3300049824 Bacteria 3942
1356 Ga0501045_0067193 3300049824 Bacteria 2632
1357 Ga0501045_0143875 3300049824 Bacteria 1773
1358 Ga0501045_0168943 3300049824 Bacteria 1629
1359 Ga0501045_0275298 3300049824 Bacteria 1253
1360 nmdc:mga00v17_482346_c1 3300050491 Bacteria 804
1361 nmdc:mga05p37_145474_c1 3300050507 Bacteria 2903
1362 nmdc:mga05p37_148499_c1 3300050507 Bacteria 2869
1363 nmdc:mga05p37_205443_c1 3300050507 Bacteria 2383
1364 nmdc:mga05p37_347129_c1 3300050507 Bacteria 1748
1365 nmdc:mga05p37_35443_c1 3300050507 Bacteria 6118
1366 nmdc:mga05p37_7691_c1 3300050507 Bacteria 12717
1367 nmdc:mga05p37_82724_c1 3300050507 Bacteria 3956
1368 nmdc:mga09592_721872_c1 3300050508 Bacteria 847
1369 nmdc:mga09592_788902_c1 3300050508 Bacteria 804
1370 nmdc:mga06r32_102335_c1 3300050510 Bacteria 2812
1371 nmdc:mga08y16_11403_c1 3300050511 Bacteria 9340
1372 nmdc:mga08y16_235236_c1 3300050511 Bacteria 1895
1373 nmdc:mga08y16_281517_c1 3300050511 Bacteria 1715
1374 nmdc:mga08y16_30020_c1 3300050511 Bacteria 5725
1375 nmdc:mga08y16_521956_c1 3300050511 Bacteria 1204
1376 nmdc:mga08y16_54085_c1 3300050511 Bacteria 4195
1377 nmdc:mga08y16_55039_c1 3300050511 Bacteria 4158
1378 nmdc:mga08y16_566120_c1 3300050511 Bacteria 1149
1379 nmdc:mga08y16_72012_c1 3300050511 Bacteria 3601
1380 nmdc:mga0n895_177987_c1 3300050512 Bacteria 2158
1381 nmdc:mga0n895_227609_c1 3300050512 Bacteria 1893
1382 nmdc:mga0n895_59778_c1 3300050512 Bacteria 3760
1383 nmdc:mga0n895_653165_c1 3300050512 Bacteria 1050
1384 nmdc:mga0n895_6555_c1 3300050512 Bacteria 9907
1385 nmdc:mga0n895_687320_c1 3300050512 Bacteria 1020
1386 nmdc:mga0n895_900_c1 3300050512 Bacteria 21426
1387 nmdc:mga0rr50_15420_c1 3300050513 Bacteria 5044
1388 nmdc:mga0rr50_277795_c1 3300050513 Bacteria 1397
1389 nmdc:mga0rr50_7072_c1 3300050513 Bacteria 6890
1390 nmdc:mga0rr50_8145_c1 3300050513 Bacteria 6505
1391 nmdc:mga0rr50_86118_c1 3300050513 Bacteria 2436
1392 nmdc:mga08x19_19698_c1 3300050514 Bacteria 4144
1393 nmdc:mga08x19_21204_c1 3300050514 Bacteria 4007
1394 nmdc:mga08x19_354437_c1 3300050514 Unclassified 1025
1395 nmdc:mga0a205_151006_c1 3300050515 Bacteria 2222
1396 nmdc:mga0a205_20621_c1 3300050515 Bacteria 6224
1397 nmdc:mga0a205_221349_c1 3300050515 Bacteria 1778
1398 nmdc:mga0a205_282164_c1 3300050515 Bacteria 1536
1399 nmdc:mga0a205_34024_c1 3300050515 Bacteria 4889
1400 nmdc:mga0a205_434062_c1 3300050515 Bacteria 1175
1401 nmdc:mga0a205_438328_c1 3300050515 Bacteria 1167
1402 nmdc:mga0a205_560903_c1 3300050515 Bacteria 997
1403 nmdc:mga0a205_8255_c1 3300050515 Bacteria 5222
1404 Ga0495601_0020395 3300053077 Bacteria 4049
1405 Ga0495601_0047942 3300053077 Bacteria 2690
1406 Ga0495601_0233067 3300053077 Bacteria 1202
1407 Ga0495612_0048423 3300053078 Bacteria 1742
1408 Ga0495595_0018437 3300053084 Bacteria 3015
1409 Ga0495595_0614833 3300053084 Bacteria 556
1410 Ga0495619_0059474 3300053085 Bacteria 2538
1411 Ga0495619_0089671 3300053085 Bacteria 2081
1412 Ga0495619_0243886 3300053085 Bacteria 1245
1413 Ga0501084_0002494 3300054114 Bacteria 14815
1414 Ga0501084_0073655 3300054114 Bacteria 2860
1415 Ga0501084_0105016 3300054114 Bacteria 2372
1416 Ga0501084_0129494 3300054114 Bacteria 2124
1417 Ga0501084_0137193 3300054114 Bacteria 2059
1418 Ga0501084_0259072 3300054114 Bacteria 1468
1419 Ga0501084_0950101 3300054114 Bacteria 723
1420 Ga0587083_0129995 3300059505 Bacteria 660
1421 Ga0587078_048916 3300059646 Bacteria 615
1422 Ga0501082_0003144 3300060353 Bacteria 14403
1423 Ga0501082_0419552 3300060353 Bacteria 1168
1424 Ga0501082_0572145 3300060353 Bacteria 988
1425 Ga0501082_0640066 3300060353 Bacteria 930
1426 Ga0530510_0007675 3300061734 Bacteria 7513
1427 Ga0530510_0022171 3300061734 Bacteria 4523
1428 Ga0530510_0056669 3300061734 Bacteria 2831
1429 Ga0530510_0079764 3300061734 Bacteria 2381
1430 Ga0530510_0084667 3300061734 Bacteria 2309
1431 Ga0530510_1402924 3300061734 Bacteria 536
1432 Ga0395899_0085278
1433 ARCol0yngRDRAFT_1007316
1434 JGI24743J22301_10098292
1435 JGI24738J21930_10024965
1436 JGI24738J21930_10029631
1437 JGI24744J21845_10068284
1438 JGI24033J26618_1016728
1439 JGI24742J22300_10020413
1440 JGI25406J46586_10005431
1441 JGI25406J46586_10047029
1442 JGI25407J50210_10047439
1443 JGI25407J50210_10146433
1444 JGI25404J52841_10067083
1445 JGI25404J52841_10120774
1446 JGI25405J52794_10086632
1447 Ga0070658_10012764
1448 Ga0070676_10102490
1449 Ga0070683_100036803
1450 Ga0070683_100056810
1451 Ga0070683_100158156
1452 Ga0070683_100718757
1453 Ga0070683_100943778
1454 Ga0070690_100086107
1455 Ga0070690_100118177
1456 Ga0070690_100165901
1457 Ga0070690_100356842
1458 Ga0070690_100392097
1459 Ga0070690_100574117
1460 Ga0070670_100003102
1461 Ga0070670_100011984
1462 Ga0070670_100234593
1463 Ga0070670_100246306
1464 Ga0070670_100344675
1465 Ga0068869_100017707
1466 Ga0068869_100028022
1467 Ga0068869_100134212
1468 Ga0068869_100271562
1469 Ga0068869_100363982
1470 Ga0068869_100506279
1471 Ga0070680_100129890
1472 Ga0070680_100330571
1473 Ga0070680_100686812
1474 Ga0070682_100067021
1475 Ga0070682_100130242
1476 Ga0070682_100199405
1477 Ga0070682_100316326
1478 Ga0070682_100901477
1479 Ga0068868_100033190
1480 Ga0068868_100036439
1481 Ga0068868_100063177
1482 Ga0068868_100088014
1483 Ga0068868_100105931
1484 Ga0068868_100343013
1485 Ga0068868_100487510
1486 Ga0070660_100003416
1487 Ga0070660_100053871
1488 Ga0070660_100094885
1489 Ga0070660_100098570
1490 Ga0070660_100129993
1491 Ga0070660_100520196
1492 Ga0070689_100034826
1493 Ga0070689_100037809
1494 Ga0070689_100194058
1495 Ga0070691_10012486
1496 Ga0070691_10024351
1497 Ga0070691_10055090
1498 Ga0070691_10122294
1499 Ga0070691_10315208
1500 Ga0070687_100022454
1501 Ga0070687_100099590
1502 Ga0070661_100165963
1503 Ga0070661_100477099
1504 Ga0070692_10105630
1505 Ga0070692_10143032
1506 Ga0070692_10819898
1507 Ga0070668_100008802
1508 Ga0070668_100023901
1509 Ga0070668_100035179
1510 Ga0070668_100117304
1511 Ga0070668_100184561
1512 Ga0070668_100202611
1513 Ga0070668_100721134
1514 Ga0070669_100069603
1515 Ga0070669_100102629
1516 Ga0070669_100585378
1517 Ga0070669_100831493
1518 Ga0070675_100127955
1519 Ga0070675_100150137
1520 Ga0070675_100195178
1521 Ga0070675_100812188
1522 Ga0070675_101031618
1523 Ga0070675_101154434
1524 Ga0070671_100192052
1525 Ga0070671_100771837
1526 Ga0070674_100002837
1527 Ga0070674_100003211
1528 Ga0070674_100005150
1529 Ga0070674_100110555
1530 Ga0070674_100116976
1531 Ga0070674_100155832
1532 Ga0070674_100367284
1533 Ga0070674_100432981
1534 Ga0070674_100593451
1535 Ga0070673_100034265
1536 Ga0070673_100089041
1537 Ga0070673_100162218
1538 Ga0070673_101577948
1539 Ga0070688_100010486
1540 Ga0070688_100014377
1541 Ga0070688_100247587
1542 Ga0070688_100254095
1543 Ga0070659_100007542
1544 Ga0070659_100056310
1545 Ga0070659_100061971
1546 Ga0070659_100101800
1547 Ga0070659_100175769
1548 Ga0070659_100283000
1549 Ga0070659_100686041
1550 Ga0070667_100089326
1551 Ga0070667_101287804
1552 Ga0070703_10016533
1553 Ga0070703_10123241
1554 Ga0070709_10036442
1555 Ga0070709_10131341
1556 Ga0070709_10171446
1557 Ga0070714_100015567
1558 Ga0070714_100151320
1559 Ga0070714_101242849
1560 Ga0070714_101889261
1561 Ga0070713_100300116
1562 Ga0070710_10031988
1563 Ga0070710_10036978
1564 Ga0070710_10344604
1565 Ga0070701_10061643
1566 Ga0070701_10125770
1567 Ga0070701_10141065
1568 Ga0070701_10467089
1569 Ga0070701_10542483
1570 Ga0070711_100020712
1571 Ga0070711_100115395
1572 Ga0070711_100271269
1573 Ga0070711_100294442
1574 Ga0070711_100385808
1575 Ga0070711_100599230
1576 Ga0070705_100194153
1577 Ga0070705_100245355
1578 Ga0070705_100354537
1579 Ga0070705_100673169
1580 Ga0070700_100064871
1581 Ga0070700_100068709
1582 Ga0070700_100123331
1583 Ga0070700_100158226
1584 Ga0070700_100193839
1585 Ga0070700_100352402
1586 Ga0070694_100016424
1587 Ga0070694_100067018
1588 Ga0070694_100144645
1589 Ga0070694_100427448
1590 Ga0070694_100993179
1591 Ga0070708_100045730
1592 Ga0070708_100150463
1593 Ga0070708_100169739
1594 Ga0070708_100272667
1595 Ga0070708_100380477
1596 Ga0070708_100902686
1597 Ga0070663_100161390
1598 Ga0070663_100253808
1599 Ga0070663_100275742
1600 Ga0070663_100407605
1601 Ga0070678_100046653
1602 Ga0070678_100195056
1603 Ga0070678_100258067
1604 Ga0070678_100277580
1605 Ga0070678_100283066
1606 Ga0070678_100800478
1607 Ga0070678_101365946
1608 Ga0070662_100020948
1609 Ga0070662_100024496
1610 Ga0070662_100081598
1611 Ga0070662_100107635
1612 Ga0070662_100321113
1613 Ga0070662_100401268
1614 Ga0070662_100434494
1615 Ga0070681_10078887
1616 Ga0070681_10084272
1617 Ga0068867_100043441
1618 Ga0068867_100053243
1619 Ga0068867_100088986
1620 Ga0068867_100095339
1621 Ga0068867_100216070
1622 Ga0068867_100279417
1623 Ga0068867_100280288
1624 Ga0068867_100292442
1625 Ga0068867_101345094
1626 Ga0070685_10004294
1627 Ga0070685_10445953
1628 Ga0070685_10905208
1629 Ga0070706_100052019
1630 Ga0070706_100053033
1631 Ga0070706_100093204
1632 Ga0070706_100183580
1633 Ga0070706_100219495
1634 Ga0070706_100429968
1635 Ga0070707_100251581
1636 Ga0070707_100432889
1637 Ga0070707_100612050
1638 Ga0070698_100005110
1639 Ga0070698_100037645
1640 Ga0070699_100017154
1641 Ga0070699_100270836
1642 Ga0070699_100624051
1643 Ga0070699_100792020
1644 Ga0070679_100047580
1645 Ga0070679_100064914
1646 Ga0070679_100111231
1647 Ga0070679_100209256
1648 Ga0070679_100370220
1649 Ga0070679_100474268
1650 Ga0070684_100004647
1651 Ga0070684_100007114
1652 Ga0070684_100012867
1653 Ga0070684_100066667
1654 Ga0070684_100099760
1655 Ga0070684_100103888
1656 Ga0070684_100270832
1657 Ga0070684_100494889
1658 Ga0070684_101082921
1659 Ga0070697_100298371
1660 Ga0068853_100043518
1661 Ga0068853_100212305
1662 Ga0068853_100272235
1663 Ga0068853_100769707
1664 Ga0070672_100019095
1665 Ga0070672_100027996
1666 Ga0070672_100090346
1667 Ga0070686_100004853
1668 Ga0070686_100093224
1669 Ga0070686_100110133
1670 Ga0070686_100230439
1671 Ga0070695_100075746
1672 Ga0070695_100127817
1673 Ga0070695_100172059
1674 Ga0070695_100252325
1675 Ga0070695_100414782
1676 Ga0070695_100805979
1677 Ga0070696_100013955
1678 Ga0070696_100098608
1679 Ga0070696_100153009
1680 Ga0070696_100165622
1681 Ga0070696_100174379
1682 Ga0070696_100234555
1683 Ga0070696_100442914
1684 Ga0070696_100640207
1685 Ga0070696_100727869
1686 Ga0070693_100043202
1687 Ga0070693_100126027
1688 Ga0070693_100227862
1689 Ga0070693_100309411
1690 Ga0070665_100056627
1691 Ga0070665_100061371
1692 Ga0070665_100220542
1693 Ga0070665_100511080
1694 Ga0070704_100060975
1695 Ga0070704_100152483
1696 Ga0070704_100414945
1697 Ga0070704_100425608
1698 Ga0070704_100596115
1699 Ga0068855_100016339
1700 Ga0068855_100168972
1701 Ga0068855_100428040
1702 Ga0068855_100438692
1703 Ga0068855_100542470
1704 Ga0068855_101271924
1705 Ga0070664_100100266
1706 Ga0070664_100142062
1707 Ga0070664_100405063
1708 Ga0070664_100407658
1709 Ga0068857_100004037
1710 Ga0068857_100011522
1711 Ga0068857_100020799
1712 Ga0068857_100292126
1713 Ga0068854_100123951
1714 Ga0068854_100179809
1715 Ga0068854_100247219
1716 Ga0068854_100726325
1717 Ga0068856_100060848
1718 Ga0068856_100097795
1719 Ga0068856_100573304
1720 Ga0068856_100638362
1721 Ga0070702_100040905
1722 Ga0070702_100046445
1723 Ga0070702_100170928
1724 Ga0070702_100824379
1725 Ga0068852_100087395
1726 Ga0068852_100235426
1727 Ga0068852_100410728
1728 Ga0068852_100575381
1729 Ga0068852_100865782
1730 Ga0068852_100873080
1731 Ga0068859_100202672
1732 Ga0068859_100359435
1733 Ga0068859_100400274
1734 Ga0068859_100721639
1735 Ga0068864_100053215
1736 Ga0068864_100253783
1737 Ga0068864_100665662
1738 Ga0068866_10059006
1739 Ga0068866_10146938
1740 Ga0068866_10275803
1741 Ga0068866_10352421
1742 Ga0068866_10543224
1743 Ga0068861_100000599
1744 Ga0068861_100046527
1745 Ga0068861_100048989
1746 Ga0068861_100069266
1747 Ga0068861_100113228
1748 Ga0068861_100900817
1749 Ga0068870_10066313
1750 Ga0068870_10119604
1751 Ga0068870_10127191
1752 Ga0068870_10149567
1753 Ga0068863_100118758
1754 Ga0068863_100175600
1755 Ga0068863_101106831
1756 Ga0068858_100082667
1757 Ga0068858_100591675
1758 Ga0068858_100909185
1759 Ga0068860_100135445
1760 Ga0068860_100321916
1761 Ga0068860_100336356
1762 Ga0068862_100034106
1763 Ga0068862_100108242
1764 Ga0081455_10037793
1765 Ga0081455_10046700
1766 Ga0081538_10002668
1767 Ga0081538_10030418
1768 Ga0081538_10065202
1769 Ga0081538_10097573
1770 Ga0081540_1000590
1771 Ga0081540_1001254
1772 Ga0081539_10000703
1773 Ga0081539_10081023
1774 Ga0081539_10171682
1775 Ga0070717_10091885
1776 Ga0070717_10117219
1777 Ga0070717_10770850
1778 Ga0075364_10512529
1779 Ga0075432_10000155
1780 Ga0070715_10010700
1781 Ga0070715_10012518
1782 Ga0070715_10012523
1783 Ga0070716_100021841
1784 Ga0070716_100085983
1785 Ga0070716_100134939
1786 Ga0070712_100011954
1787 Ga0070712_100018248
1788 Ga0070712_100033365
1789 Ga0070712_100037758
1790 Ga0070712_100199842
1791 Ga0070712_100234317
1792 Ga0070712_100316078
1793 Ga0070712_100548503
1794 Ga0075366_10412377
1795 Ga0097621_100074602
1796 Ga0097621_100614578
1797 Ga0068871_100152298
1798 Ga0068871_100234253
1799 Ga0068871_100335837
1800 Ga0068871_100606677
1801 Ga0075428_100073425
1802 Ga0075428_100365622
1803 Ga0075428_100554153
1804 Ga0075431_100153427
1805 Ga0075431_100188109
1806 Ga0075431_101092075
1807 Ga0075433_10024795
1808 Ga0075433_10196771
1809 Ga0075433_10226438
1810 Ga0075433_10231012
1811 Ga0075433_10258125
1812 Ga0075433_10293584
1813 Ga0075433_10501386
1814 Ga0075434_100015405
1815 Ga0075434_100023080
1816 Ga0075434_100053669
1817 Ga0075434_100215977
1818 Ga0075434_100405360
1819 Ga0075434_100672199
1820 Ga0075429_100231728
1821 Ga0075429_100541247
1822 Ga0075429_100665094
1823 Ga0068865_100048111
1824 Ga0068865_100061984
1825 Ga0068865_100079460
1826 Ga0068865_100099768
1827 Ga0068865_100169145
1828 Ga0068865_100417997
1829 Ga0068865_100450857
1830 Ga0068865_100628141
1831 Ga0068865_101043265
1832 Ga0075436_100012943
1833 Ga0075436_100020689
1834 Ga0075436_100062021
1835 Ga0075436_100299784
1836 Ga0075436_100488538
1837 Ga0075436_100635917
1838 Ga0097620_100202699
1839 Ga0097620_100359476
1840 Ga0097620_100400273
1841 Ga0097620_100721662
1842 Ga0075435_100006892
1843 Ga0075435_100016752
1844 Ga0075435_100021969
1845 Ga0075435_100024707
1846 Ga0075435_100225537
1847 Ga0105244_10079253
1848 Ga0105240_10769711
1849 Ga0105240_10796596
1850 Ga0105240_12033788
1851 Ga0111539_10050201
1852 Ga0111539_10060535
1853 Ga0111539_10064029
1854 Ga0111539_10213992
1855 Ga0111539_10436134
1856 Ga0111539_10441308
1857 Ga0111539_11462295
1858 Ga0105245_10029388
1859 Ga0105245_10039116
1860 Ga0105245_10052784
1861 Ga0105245_10101084
1862 Ga0105245_10110975
1863 Ga0105245_10116618
1864 Ga0105245_10143381
1865 Ga0105245_10198946
1866 Ga0105245_10205561
1867 Ga0105245_10276106
1868 Ga0105245_10414029
1869 Ga0105245_10462975
1870 Ga0105245_11182692
1871 Ga0105247_10009470
1872 Ga0105247_10773498
1873 Ga0114129_10021521
1874 Ga0114129_10041728
1875 Ga0114129_10198491
1876 Ga0114129_10584178
1877 Ga0114129_10773584
1878 Ga0114129_12431135
1879 Ga0105243_10006578
1880 Ga0105243_10011319
1881 Ga0105243_10057101
1882 Ga0105243_10063674
1883 Ga0105243_10134597
1884 Ga0105243_10140568
1885 Ga0105243_10197702
1886 Ga0105243_10241525
1887 Ga0105243_10367601
1888 Ga0105243_11115109
1889 Ga0105241_10055814
1890 Ga0105241_10093317
1891 Ga0105241_10271712
1892 Ga0105242_10016338
1893 Ga0105242_10030820
1894 Ga0105242_10032691
1895 Ga0105242_10052227
1896 Ga0105242_10076487
1897 Ga0105242_10077096
1898 Ga0105242_10096406
1899 Ga0105242_10096880
1900 Ga0105242_10759820
1901 Ga0105242_10967007
1902 Ga0105248_10050144
1903 Ga0105248_10467919
1904 Ga0105248_10535495
1905 Ga0105248_10590999
1906 Ga0105237_10015040
1907 Ga0105237_10048627
1908 Ga0105237_10495547
1909 Ga0105238_10029146
1910 Ga0105238_10496657
1911 Ga0105238_10966484
1912 Ga0105249_10021215
1913 Ga0105249_10086108
1914 Ga0105249_10163393
1915 Ga0105249_10228366
1916 Ga0105249_10248920
1917 Ga0105249_10368490
1918 Ga0105249_10378417
1919 Ga0105249_10688780
1920 Ga0105249_11336260
1921 Ga0105239_10070973
1922 Ga0105239_10099109
1923 Ga0105239_10126075
1924 Ga0105239_10138061
1925 Ga0105239_10830870
1926 Ga0105239_12679287
1927 Ga0105246_10006452
1928 Ga0105246_10016365
1929 Ga0105246_10062964
1930 Ga0105246_10109949
1931 Ga0105246_10204879
1932 Ga0105246_10307743
1933 Ga0157343_1032006
1934 Ga0157345_1007395
1935 Ga0157347_1003770
1936 Ga0157316_1002248
1937 Ga0157371_10120348
1938 Ga0157371_10256471
1939 Ga0157371_10478408
1940 Ga0157370_10312908
1941 Ga0157369_10320317
1942 Ga0157369_10509513
1943 Ga0157374_10011101
1944 Ga0157378_10099887
1945 Ga0157378_10141795
1946 Ga0157378_10474183
1947 Ga0163162_10036711
1948 Ga0163162_10128466
1949 Ga0163162_10192049
1950 Ga0163162_10258117
1951 Ga0163162_10271857
1952 Ga0163162_10278962
1953 Ga0163162_10279332
1954 Ga0163162_10497608
1955 Ga0157372_10067977
1956 Ga0157372_10093044
1957 Ga0157372_10246342
1958 Ga0157372_10834300
1959 Ga0157375_10195347
1960 Ga0157375_10922586
1961 Ga0163163_10015084
1962 Ga0163163_10375679
1963 Ga0163163_10882333
1964 Ga0157380_10017463
1965 Ga0157380_10097198
1966 Ga0157380_10446768
1967 Ga0157380_10670005
1968 Ga0157380_10875598
1969 Ga0157380_10948203
1970 Ga0182008_10054314
1971 Ga0157377_10003069
1972 Ga0157377_10021451
1973 Ga0157377_10058025
1974 Ga0157377_10072645
1975 Ga0157377_10246932
1976 Ga0157377_10672762
1977 Ga0157379_10080456
1978 Ga0157379_10184896
1979 Ga0157379_10352025
1980 Ga0157376_10013044
1981 Ga0157376_10109741
1982 Ga0157376_10119793
1983 Ga0157376_10206466
1984 Ga0157376_10353997
1985 Ga0157376_11030461
1986 Ga0163161_10250273
1987 Ga0163161_10534486
1988 Ga0163161_10588271
1989 Ga0197907_10034126
1990 Ga0206356_10954049
1991 Ga0206351_10526121
1992 Ga0154015_1595217
1993 Ga0207653_10107940
1994 Ga0207682_10088969
1995 Ga0207692_10028356
1996 Ga0207692_10127545
1997 Ga0207692_10154858
1998 Ga0207642_10064556
1999 Ga0207642_10078813
2000 Ga0207642_10114574
2001 Ga0207642_10166824
2002 Ga0207642_10182252
2003 Ga0207710_10044000
2004 Ga0207688_10010947
2005 Ga0207688_10023379
2006 Ga0207688_10060800
2007 Ga0207688_10129549
2008 Ga0207688_10140522
2009 Ga0207688_10320817
2010 Ga0207647_10228702
2011 Ga0207647_10384018
2012 Ga0207647_10592550
2013 Ga0207685_10019344
2014 Ga0207685_10023237
2015 Ga0207685_10037253
2016 Ga0207699_10054307
2017 Ga0207699_10134884
2018 Ga0207699_10279802
2019 Ga0207699_10324534
2020 Ga0207645_10109233
2021 Ga0207645_10568272
2022 Ga0207643_10002816
2023 Ga0207643_10025874
2024 Ga0207643_10040727
2025 Ga0207643_10062187
2026 Ga0207643_10117875
2027 Ga0207643_10239322
2028 Ga0207643_10268049
2029 Ga0207643_10315182
2030 Ga0207684_10064241
2031 Ga0207684_10220098
2032 Ga0207684_10240866
2033 Ga0207684_10510184
2034 Ga0207654_10096981
2035 Ga0207654_10240261
2036 Ga0207707_10133645
2037 Ga0207693_10002498
2038 Ga0207693_10018661
2039 Ga0207693_10036223
2040 Ga0207693_10050225
2041 Ga0207693_10127663
2042 Ga0207693_10259736
2043 Ga0207693_10311402
2044 Ga0207693_10823905
2045 Ga0207663_10016048
2046 Ga0207663_10076207
2047 Ga0207663_10113988
2048 Ga0207663_10162570
2049 Ga0207663_10177147
2050 Ga0207663_10269088
2051 Ga0207663_10436539
2052 Ga0207660_10654854
2053 Ga0207660_11499648
2054 Ga0207662_10126476
2055 Ga0207662_10141647
2056 Ga0207657_10009576
2057 Ga0207657_10160038
2058 Ga0207657_10269221
2059 Ga0207649_10021599
2060 Ga0207649_10619038
2061 Ga0207652_10061423
2062 Ga0207646_10019475
2063 Ga0207646_10126372
2064 Ga0207646_10370200
2065 Ga0207681_10243080
2066 Ga0207681_10270249
2067 Ga0207681_10391355
2068 Ga0207694_10327561
2069 Ga0207650_10020925
2070 Ga0207659_10029480
2071 Ga0207659_10180965
2072 Ga0207659_10595631
2073 Ga0207687_10004254
2074 Ga0207687_10012189
2075 Ga0207687_10015050
2076 Ga0207687_10114580
2077 Ga0207687_10208548
2078 Ga0207687_10219686
2079 Ga0207687_10223261
2080 Ga0207687_10224560
2081 Ga0207687_10463861
2082 Ga0207687_11060481
2083 Ga0207687_11222077
2084 Ga0207700_10166176
2085 Ga0207700_10167076
2086 Ga0207700_10410889
2087 Ga0207700_10458413
2088 Ga0207700_10802040
2089 Ga0207664_10021336
2090 Ga0207664_10029771
2091 Ga0207664_10186199
2092 Ga0207664_10246137
2093 Ga0207664_10272445
2094 Ga0207664_10524645
2095 Ga0207644_10020746
2096 Ga0207690_10050965
2097 Ga0207690_10059272
2098 Ga0207690_10103432
2099 Ga0207690_10133479
2100 Ga0207690_10282275
2101 Ga0207690_10376894
2102 Ga0207690_11147224
2103 Ga0207706_10014996
2104 Ga0207706_10017665
2105 Ga0207706_10034581
2106 Ga0207706_10201463
2107 Ga0207706_10320465
2108 Ga0207686_10047744
2109 Ga0207686_10179831
2110 Ga0207686_10248019
2111 Ga0207686_10403144
2112 Ga0207686_10496213
2113 Ga0207686_10641430
2114 Ga0207709_10007458
2115 Ga0207709_10028024
2116 Ga0207709_10049157
2117 Ga0207709_10059205
2118 Ga0207709_10063968
2119 Ga0207709_10073340
2120 Ga0207709_10229928
2121 Ga0207709_10781300
2122 Ga0207670_10670937
2123 Ga0207669_10017533
2124 Ga0207669_10042619
2125 Ga0207669_10051244
2126 Ga0207669_10121335
2127 Ga0207669_10139874
2128 Ga0207669_10287953
2129 Ga0207669_11071641
2130 Ga0207704_10101644
2131 Ga0207704_10161627
2132 Ga0207704_10317308
2133 Ga0207704_10341616
2134 Ga0207704_10461063
2135 Ga0207704_10557025
2136 Ga0207665_10008549
2137 Ga0207665_10020234
2138 Ga0207665_10108498
2139 Ga0207665_10159043
2140 Ga0207665_10225971
2141 Ga0207665_10274467
2142 Ga0207691_10015901
2143 Ga0207691_10019041
2144 Ga0207691_10031849
2145 Ga0207691_10058080
2146 Ga0207691_10540158
2147 Ga0207711_10116605
2148 Ga0207711_10138117
2149 Ga0207711_10162507
2150 Ga0207711_10230166
2151 Ga0207689_10022143
2152 Ga0207689_10250401
2153 Ga0207689_10515065
2154 Ga0207661_10106385
2155 Ga0207661_10139290
2156 Ga0207661_10698480
2157 Ga0207661_10793094
2158 Ga0207679_10030086
2159 Ga0207679_10156956
2160 Ga0207679_10190185
2161 Ga0207679_11037327
2162 Ga0207667_10028849
2163 Ga0207667_10307206
2164 Ga0207667_10318041
2165 Ga0207667_10403240
2166 Ga0207667_10422283
2167 Ga0207667_10518044
2168 Ga0207651_10025016
2169 Ga0207651_10049676
2170 Ga0207712_10051337
2171 Ga0207712_10130904
2172 Ga0207712_10131142
2173 Ga0207712_10231211
2174 Ga0207668_10060117
2175 Ga0207668_10096545
2176 Ga0207668_10143518
2177 Ga0207668_10639183
2178 Ga0207668_10698980
2179 Ga0207640_10033675
2180 Ga0207640_10124284
2181 Ga0207640_10278763
2182 Ga0207640_10322705
2183 Ga0207640_10395194
2184 Ga0207640_10493448
2185 Ga0207677_10040146
2186 Ga0207677_10047667
2187 Ga0207677_10114534
2188 Ga0207677_10195662
2189 Ga0207677_10238564
2190 Ga0207677_10571198
2191 Ga0207677_10659398
2192 Ga0207703_10073429
2193 Ga0207703_10294061
2194 Ga0207703_10294695
2195 Ga0207703_10448044
2196 Ga0207703_10618749
2197 Ga0207639_10006229
2198 Ga0207639_10048829
2199 Ga0207639_10522109
2200 Ga0207639_10722774
2201 Ga0207639_11209501
2202 Ga0207678_10057996
2203 Ga0207678_10132769
2204 Ga0207678_10376675
2205 Ga0207678_10400255
2206 Ga0207678_10651380
2207 Ga0207708_10002498
2208 Ga0207708_10002644
2209 Ga0207708_10010840
2210 Ga0207708_10034049
2211 Ga0207708_10051722
2212 Ga0207708_10099011
2213 Ga0207708_10196499
2214 Ga0207708_10212032
2215 Ga0207708_10841265
2216 Ga0207702_10005791
2217 Ga0207702_10031806
2218 Ga0207702_10186855
2219 Ga0207641_10117643
2220 Ga0207641_10215924
2221 Ga0207641_10870587
2222 Ga0207648_10025309
2223 Ga0207648_10036493
2224 Ga0207648_10039704
2225 Ga0207648_10067743
2226 Ga0207648_10080618
2227 Ga0207648_10081260
2228 Ga0207648_10110686
2229 Ga0207648_10205823
2230 Ga0207648_10324647
2231 Ga0207648_10825367
2232 Ga0207676_10088485
2233 Ga0207676_10199770
2234 Ga0207676_10261170
2235 Ga0207674_10009027
2236 Ga0207674_10010087
2237 Ga0207674_10016296
2238 Ga0207675_100000456
2239 Ga0207675_100018997
2240 Ga0207675_100073717
2241 Ga0207675_100089183
2242 Ga0207675_100121938
2243 Ga0207675_100123267
2244 Ga0207675_100171554
2245 Ga0207675_100175737
2246 Ga0207675_100287596
2247 Ga0207675_100636719
2248 Ga0207683_10040192
2249 Ga0207683_10063509
2250 Ga0207683_10131380
2251 Ga0207683_10141762
2252 Ga0207683_10170683
2253 Ga0207683_10212682
2254 Ga0207683_10393726
2255 Ga0207683_11029184
2256 Ga0207698_10017238
2257 Ga0207698_10264721
2258 Ga0207698_10785972
2259 Ga0207698_12321226
2260 Ga0209966_1010510
2261 Ga0207428_10008373
2262 Ga0207428_10065628
2263 Ga0207428_10135745
2264 Ga0207428_10177002
2265 Ga0207428_10350594
2266 Ga0268266_10075392
2267 Ga0268266_10196349
2268 Ga0268265_10702823
2269 Ga0268265_10721384
2270 Ga0268264_10325107
2271 Ga0268264_10334318
2272 Ga0265319_1017933
2273 Ga0265336_10115141
2274 Ga0265320_10034685
2275 Ga0307408_100191017
2276 Ga0307405_10091971
2277 Ga0307413_10016101
2278 Ga0307410_10035377
2279 Ga0307410_10196538
2280 Ga0307410_10713524
2281 Ga0307406_10196163
2282 Ga0307406_10260230
2283 Ga0307407_10162051
2284 Ga0307407_10873563
2285 Ga0307412_10119979
2286 Ga0307412_10140262
2287 Ga0307409_100008431
2288 Ga0307409_100020656
2289 Ga0307409_100347884
2290 Ga0307409_100633503
2291 Ga0307416_100118177
2292 Ga0307416_100158384
2293 Ga0307416_100332888
2294 Ga0307416_100409494
2295 Ga0307416_101692907
2296 Ga0307414_10156013
2297 Ga0307411_10082526
2298 Ga0307411_11269228
2299 Ga0307415_100002060
2300 Ga0307415_100016576
2301 Ga0307415_101528606
2302 Ga0373930_0016150
2303 Ga0373950_0078580
2304 Ga0373958_0029367
2305 Ga0373959_0009849
2306 Ga0373959_0011086
2307 Ga0373938_0094675
2308 Ga0373926_0199038
2309 Ga0373926_0264729
2310 Ga0373934_0028206
2311 Ga0373944_0007084
2312 Ga0373949_0060086
2313 Ga0373949_0123755
2314 Ga0373951_0009369
2315 Ga0373951_0023308
2316 Ga0373952_0014944
2317 Ga0373923_0053137
2318 Ga0373932_0067963
2319 Ga0373936_0483993
2320 Ga0373939_0053177
2321 Ga0373945_0077931
2322 Ga0373960_0036232
2323 Ga0373960_0099734
2324 Ga0373943_0147169
2325 Ga0373943_0205563
2326 Ga0373946_0002051
2327 Ga0373955_0073938
2328 Ga0373942_0034540
2329 Ga0373961_0043098
2330 Ga0373961_0266546
2331 Ga0373924_0004046
2332 Ga0373931_0026542
2333 Ga0373931_0412068
2334 Ga0373931_0535234
2335 Ga0373935_0015165
2336 Ga0373927_0067374
2337 Ga0373947_0031960
2338 Ga0373947_0060437
2339 Ga0373937_0113050
2340 Ga0373925_0029385
2341 Ga0373925_0610221
2342 Ga0395899_0002389
2343 Ga0395899_0004758
2344 Ga0395899_0005459
2345 Ga0395899_0031395
2346 Ga0395899_0073312
2347 Ga0395899_0140291
2348 Ga0395899_0999086
2349 Ga0395900_0003865
2350 Ga0395900_0004269
2351 Ga0395900_0006467
2352 Ga0395900_0045074
2353 Ga0395900_0065219
2354 Ga0395900_0073472
2355 Ga0395900_0076922
2356 Ga0395900_0132622
2357 Ga0395900_0158166
2358 Ga0395900_0222536
2359 Ga0395900_0249710
2360 Ga0395900_0501994
2361 Ga0395898_0002662
2362 Ga0395898_0006058
2363 Ga0395898_0013863
2364 Ga0395898_0036964
2365 Ga0395898_0041218
2366 Ga0395898_0045759
2367 Ga0395898_0057707
2368 Ga0395898_0076593
2369 Ga0395898_0184384
2370 Ga0395898_0564027
2371 Ga0395905_0002146
2372 Ga0395905_0005265
2373 Ga0395905_0008385
2374 Ga0395905_0011371
2375 Ga0395905_0031674
2376 Ga0395905_0091134
2377 Ga0395905_0184014
2378 Ga0395905_0214012
2379 Ga0395905_0235168
2380 Ga0395905_0236416
2381 Ga0395905_0829839
2382 Ga0395901_0006015
2383 Ga0395901_0006940
2384 Ga0395901_0007324
2385 Ga0395901_0019275
2386 Ga0395901_0022266
2387 Ga0395901_0025311
2388 Ga0395901_0093690
2389 Ga0395901_0125839
2390 Ga0395901_0205751
2391 Ga0395901_0331232
2392 Ga0395901_0484208
2393 Ga0395901_0493973
2394 Ga0395901_0595403
2395 Ga0395901_0945401
2396 Ga0451806_104958
2397 Ga0451807_2561596
2398 Ga0451807_2718629
2399 Ga0451835_0716306
2400 Ga0451847_0100796
2401 Ga0451853_1497062
2402 Ga0451853_2737307
2403 Ga0451853_3950287
2404 Ga0439448_0020774
2405 Ga0439448_0082300
2406 Ga0439448_0106957
2407 Ga0439455_0024558
2408 Ga0439463_012862
2409 Ga0439463_017975
2410 Ga0439458_0023962
2411 Ga0439435_0095507
2412 Ga0439435_0330922
2413 Ga0439459_0036808
2414 Ga0450918_030128
2415 Ga0439440_0107344
2416 Ga0439440_0130573
2417 Ga0466972_0096530
2418 Ga0466972_0410359
2419 Ga0466965_0429253
2420 Ga0466963_0039561
2421 Ga0466964_0000687
2422 Ga0453684_0055532
2423 Ga0466968_0038954
2424 Ga0466957_0098346
2425 Ga0466960_0031848
2426 Ga0466960_0086628
2427 Ga0466960_0203660
2428 Ga0451576_0057008
2429 Ga0451576_0884761
2430 Ga0466958_0232209
2431 Ga0466967_0001643
2432 Ga0466967_0002463
2433 Ga0466967_0099330
2434 Ga0495592_0366819
2435 Ga0495603_0024460
2436 Ga0495603_0051869
2437 Ga0495590_0241143
2438 Ga0495629_0047837
2439 Ga0495629_0088315
2440 Ga0495629_0126979
2441 Ga0495641_0011598
2442 Ga0495641_0029367
2443 Ga0495651_0079494
2444 Ga0495653_0029808
2445 Ga0495580_0290049
2446 Ga0495582_0023062
2447 Ga0495582_0206229
2448 Ga0495639_0009246
2449 Ga0495662_0020440
2450 Ga0495662_0089407
2451 Ga0495584_0147807
2452 Ga0495584_0276073
2453 Ga0495596_0020094
2454 Ga0495596_0056305
2455 Ga0495608_0007758
2456 Ga0495616_0280243
2457 Ga0495618_0203273
2458 Ga0495620_0052722
2459 Ga0495628_0217670
2460 Ga0495630_0035115
2461 Ga0495630_0053277
2462 Ga0495630_0288926
2463 Ga0495637_0099949
2464 Ga0495663_0116328
2465 Ga0495663_0174097
2466 Ga0495666_0062918
2467 Ga0495642_0142218
2468 Ga0495642_0384008
2469 Ga0495652_0222055
2470 Ga0495665_0016491
2471 Ga0495665_0275480
2472 Ga0495640_0017760
2473 Ga0495640_0209351
2474 Ga0495586_0142236
2475 Ga0495586_0198005
2476 Ga0495587_0043149
2477 Ga0495609_0183594
2478 Ga0495609_0402179
2479 Ga0495621_0115396
2480 Ga0495645_0096333
2481 Ga0495645_0298142
2482 Ga0495622_0050981
2483 Ga0495656_0019820
2484 Ga0495656_0193030
2485 Ga0495656_0474704
2486 Ga0495668_0186241
2487 Ga0495668_0269968
2488 Ga0495634_0053636
2489 Ga0495634_0090281
2490 Ga0495635_0041227
2491 Ga0495588_0017861
2492 Ga0495657_0019739
2493 Ga0495623_0034248
2494 Ga0495646_0145723
2495 Ga0495647_0005116
2496 Ga0495647_0182152
2497 Ga0495647_0295180
2498 Ga0495658_0032658
2499 Ga0495658_0093278
2500 Ga0495658_0112692
2501 Ga0495658_0197255
2502 Ga0495613_0036716
2503 Ga0495613_0054896
2504 Ga0495624_0029854
2505 Ga0495624_0174482
2506 Ga0495624_0407260
2507 Ga0495670_0362328
2508 Ga0495671_0242283
2509 Ga0495600_0081184
2510 Ga0495581_0177672
2511 Ga0495581_0211695
2512 Ga0495581_0367676
2513 Ga0495674_0047497
2514 Ga0495674_0061440
2515 Ga0495676_0010939
2516 Ga0495676_0051247
2517 Ga0495676_0053327
2518 Ga0495680_0120889
2519 Ga0495680_0220786
2520 Ga0495675_0047895
2521 Ga0495677_0074392
2522 Ga0495677_0120343
2523 Ga0495679_177683
2524 Ga0495684_0004315
2525 Ga0495593_0023967
2526 Ga0495593_0221109
2527 Ga0495602_0145862
2528 Ga0495614_0013264
2529 Ga0495614_0062659
2530 Ga0495614_0076263
2531 Ga0496100_0001325
2532 Ga0496100_0014418
2533 Ga0496100_0189871
2534 Ga0496100_0197644
2535 Ga0496100_0254268
2536 Ga0496100_0267248
2537 Ga0496100_0275535
2538 Ga0496100_1145432
2539 Ga0496101_0002083
2540 Ga0496101_0084229
2541 Ga0496101_0100257
2542 Ga0496101_0138684
2543 Ga0496101_0153358
2544 Ga0496101_0190771
2545 Ga0496101_0285946
2546 Ga0496101_0320220
2547 Ga0496101_0330578
2548 Ga0496101_0631819
2549 Ga0496101_0901128
2550 Ga0496102_0010767
2551 Ga0496102_0069095
2552 Ga0496102_0141567
2553 Ga0496102_0149447
2554 Ga0496102_0213186
2555 Ga0496102_0236354
2556 Ga0496102_0296880
2557 Ga0496102_0743837
2558 Ga0496103_0012845
2559 Ga0496103_0016550
2560 Ga0496103_0065854
2561 Ga0496103_0307631
2562 Ga0496103_0478261
2563 Ga0496104_0010750
2564 Ga0496104_0014894
2565 Ga0496104_0028100
2566 Ga0496104_0043659
2567 Ga0496104_0057015
2568 Ga0496104_0178708
2569 Ga0496104_1392342
2570 Ga0496105_0017687
2571 Ga0496105_0032706
2572 Ga0496105_0047074
2573 Ga0496105_0056314
2574 Ga0496105_0063560
2575 Ga0496105_0067152
2576 Ga0496105_0075849
2577 Ga0496105_0079130
2578 Ga0496106_0001833
2579 Ga0496106_0008465
2580 Ga0496106_0031141
2581 Ga0496106_0037184
2582 Ga0496106_0051170
2583 Ga0496106_0053858
2584 Ga0496106_0496613
2585 Ga0496106_0521510
2586 Ga0496106_1145509
2587 Ga0496107_0002424
2588 Ga0496107_0043803
2589 Ga0496107_0065945
2590 Ga0496107_0109500
2591 Ga0496107_0345237
2592 Ga0496107_0710373
2593 Ga0496108_0002788
2594 Ga0496108_0021258
2595 Ga0496108_0022720
2596 Ga0496108_0039483
2597 Ga0496108_0087510
2598 Ga0496108_0120132
2599 Ga0496108_0184958
2600 Ga0496108_0531491
2601 Ga0496108_0564571
2602 Ga0496108_0841504
2603 Ga0496109_0021655
2604 Ga0496109_0040526
2605 Ga0496109_0067447
2606 Ga0496109_0075437
2607 Ga0496109_0146897
2608 Ga0496109_0244501
2609 Ga0496109_0251497
2610 Ga0496109_0272671
2611 Ga0496109_0307173
2612 Ga0496109_0561467
2613 Ga0496109_0792792
2614 Ga0496110_0002875
2615 Ga0496110_0024616
2616 Ga0496110_0028629
2617 Ga0496110_0045873
2618 Ga0496110_0124379
2619 Ga0496110_0162991
2620 Ga0496110_0277864
2621 Ga0496110_0325953
2622 Ga0496110_0626840
2623 Ga0496110_0720344
2624 Ga0496110_1396902
2625 Ga0496111_0000818
2626 Ga0496111_0002896
2627 Ga0496111_0020914
2628 Ga0496111_0075365
2629 Ga0496111_0103995
2630 Ga0496111_0113743
2631 Ga0496111_0127144
2632 Ga0496111_0175778
2633 Ga0496111_0287478
2634 Ga0496111_0376147
2635 Ga0496112_0005661
2636 Ga0496112_0061188
2637 Ga0496112_0069531
2638 Ga0496112_0459549
2639 Ga0496112_0565410
2640 Ga0496112_1672411
2641 Ga0496113_0023734
2642 Ga0496113_0059262
2643 Ga0496113_0084478
2644 Ga0496113_0190033
2645 Ga0496113_0271843
2646 Ga0496113_0344838
2647 Ga0496113_0374837
2648 Ga0496113_0394053
2649 Ga0496113_0400750
2650 Ga0496113_0451659
2651 Ga0496113_1499670
2652 Ga0496114_0010067
2653 Ga0496114_0013742
2654 Ga0496114_0031479
2655 Ga0496114_0061345
2656 Ga0496114_0086988
2657 Ga0496114_0177348
2658 Ga0496114_0478300
2659 Ga0496114_0552615
2660 Ga0496114_1022974
2661 Ga0496115_0002972
2662 Ga0496115_0017580
2663 Ga0496115_0030561
2664 Ga0496115_0034681
2665 Ga0496115_0037444
2666 Ga0496115_0082435
2667 Ga0496115_0086478
2668 Ga0496115_0091189
2669 Ga0496115_0126148
2670 Ga0496115_0287543
2671 Ga0496115_0334019
2672 Ga0496122_0212970
2673 Ga0501031_0000867
2674 Ga0501031_0069852
2675 Ga0501031_0347983
2676 Ga0501031_0370044
2677 Ga0501031_0526897
2678 Ga0501032_0382284
2679 Ga0501033_0029012
2680 Ga0501033_0083331
2681 Ga0501033_1182291
2682 Ga0501036_0008436
2683 Ga0501036_0117087
2684 Ga0501036_0280482
2685 Ga0501036_1111489
2686 Ga0501036_1402326
2687 Ga0501036_1447807
2688 Ga0501037_1055400
2689 Ga0501038_0004809
2690 Ga0501038_0048049
2691 Ga0501038_0213080
2692 Ga0501038_0564377
2693 Ga0501038_0718327
2694 Ga0501039_0003561
2695 Ga0501039_0027720
2696 Ga0501039_0040721
2697 Ga0501039_0089408
2698 Ga0501039_0188440
2699 Ga0501039_0329332
2700 Ga0501039_0600390
2701 Ga0501040_0027816
2702 Ga0501040_0063128
2703 Ga0501040_0078960
2704 Ga0501040_0264516
2705 Ga0501041_0000302
2706 Ga0501041_0032873
2707 Ga0501041_0401351
2708 Ga0501042_0002652
2709 Ga0501042_0096575
2710 Ga0501042_0113976
2711 Ga0501042_0123965
2712 Ga0501043_0436361
2713 Ga0501046_0006543
2714 Ga0501046_0022128
2715 Ga0501046_0334206
2716 Ga0501048_0001369
2717 Ga0501048_0053076
2718 Ga0501048_0475315
2719 Ga0501067_0000759
2720 Ga0501067_0031295
2721 Ga0501067_0036234
2722 Ga0501067_0109440
2723 Ga0501068_0001163
2724 Ga0501068_0140645
2725 Ga0501068_0145949
2726 Ga0501068_0396709
2727 Ga0501068_0585535
2728 Ga0501069_0000171
2729 Ga0501069_0076118
2730 Ga0501069_0136285
2731 Ga0501069_0351047
2732 Ga0501070_0042739
2733 Ga0501070_0628817
2734 Ga0501071_0003170
2735 Ga0501071_0011907
2736 Ga0501071_0041297
2737 Ga0501071_0044513
2738 Ga0501071_0064726
2739 Ga0501072_0004402
2740 Ga0501072_0099647
2741 Ga0501072_0112961
2742 Ga0501072_0363566
2743 Ga0501072_0641726
2744 Ga0501072_0815943
2745 Ga0501073_0122193
2746 Ga0501074_0010885
2747 Ga0501074_0036758
2748 Ga0501074_0544813
2749 Ga0501074_1170024
2750 Ga0501075_0000959
2751 Ga0501075_0070520
2752 Ga0501075_0100168
2753 Ga0501075_0183836
2754 Ga0501075_0272457
2755 Ga0501075_0396860
2756 Ga0501076_0004307
2757 Ga0501076_0224182
2758 Ga0501076_0323466
2759 Ga0501076_0750127
2760 Ga0501077_0041650
2761 Ga0501077_0045356
2762 Ga0501077_0140511
2763 Ga0501077_0216023
2764 Ga0501077_0231788
2765 Ga0501077_0281640
2766 Ga0501079_0002695
2767 Ga0501079_0005575
2768 Ga0501079_0070592
2769 Ga0501080_0044558
2770 Ga0501080_0057471
2771 Ga0501080_0782151
2772 Ga0501080_1543648
2773 Ga0501081_0000989
2774 Ga0501081_0084022
2775 Ga0501081_0362428
2776 Ga0501081_0681295
2777 Ga0501083_0016420
2778 Ga0501083_0029978
2779 Ga0501035_0015404
2780 Ga0501035_0056110
2781 Ga0501035_0233649
2782 Ga0501035_0484485
2783 Ga0501044_0260715
2784 Ga0501045_0002386
2785 Ga0501045_0027435
2786 Ga0501045_0029861
2787 Ga0501045_0067193
2788 Ga0501045_0143875
2789 Ga0501045_0168943
2790 Ga0501045_0275298
2791 nmdc:mga00v17_482346_c1
2792 nmdc:mga05p37_145474_c1
2793 nmdc:mga05p37_148499_c1
2794 nmdc:mga05p37_205443_c1
2795 nmdc:mga05p37_347129_c1
2796 nmdc:mga05p37_35443_c1
2797 nmdc:mga05p37_7691_c1
2798 nmdc:mga05p37_82724_c1
2799 nmdc:mga09592_721872_c1
2800 nmdc:mga09592_788902_c1
2801 nmdc:mga06r32_102335_c1
2802 nmdc:mga08y16_11403_c1
2803 nmdc:mga08y16_235236_c1
2804 nmdc:mga08y16_281517_c1
2805 nmdc:mga08y16_30020_c1
2806 nmdc:mga08y16_521956_c1
2807 nmdc:mga08y16_54085_c1
2808 nmdc:mga08y16_55039_c1
2809 nmdc:mga08y16_566120_c1
2810 nmdc:mga08y16_72012_c1
2811 nmdc:mga0n895_177987_c1
2812 nmdc:mga0n895_227609_c1
2813 nmdc:mga0n895_59778_c1
2814 nmdc:mga0n895_653165_c1
2815 nmdc:mga0n895_6555_c1
2816 nmdc:mga0n895_687320_c1
2817 nmdc:mga0n895_900_c1
2818 nmdc:mga0rr50_15420_c1
2819 nmdc:mga0rr50_277795_c1
2820 nmdc:mga0rr50_7072_c1
2821 nmdc:mga0rr50_8145_c1
2822 nmdc:mga0rr50_86118_c1
2823 nmdc:mga08x19_19698_c1
2824 nmdc:mga08x19_21204_c1
2825 nmdc:mga08x19_354437_c1
2826 nmdc:mga0a205_151006_c1
2827 nmdc:mga0a205_20621_c1
2828 nmdc:mga0a205_221349_c1
2829 nmdc:mga0a205_282164_c1
2830 nmdc:mga0a205_34024_c1
2831 nmdc:mga0a205_434062_c1
2832 nmdc:mga0a205_438328_c1
2833 nmdc:mga0a205_560903_c1
2834 nmdc:mga0a205_8255_c1
2835 Ga0495601_0020395
2836 Ga0495601_0047942
2837 Ga0495601_0233067
2838 Ga0495612_0048423
2839 Ga0495595_0018437
2840 Ga0495595_0614833
2841 Ga0495619_0059474
2842 Ga0495619_0089671
2843 Ga0495619_0243886
2844 Ga0501084_0002494
2845 Ga0501084_0073655
2846 Ga0501084_0105016
2847 Ga0501084_0129494
2848 Ga0501084_0137193
2849 Ga0501084_0259072
2850 Ga0501084_0950101
2851 Ga0587083_0129995
2852 Ga0587078_048916
2853 Ga0501082_0003144
2854 Ga0501082_0419552
2855 Ga0501082_0572145
2856 Ga0501082_0640066
2857 Ga0530510_0007675
2858 Ga0530510_0022171
2859 Ga0530510_0056669
2860 Ga0530510_0079764
2861 Ga0530510_0084667
2862 Ga0530510_1402924

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

30

100

0.98

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

106

182

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1grj-assembly1.cif.gz_A grea transcript cleavage factor from escherichia coli 0.9044 2 157
1grj-assembly1.cif.gz_A grea transcript cleavage factor from escherichia coli 0.8988 2 157
7o40-assembly1.cif.gz_F structural basis for vipp1 oligomerization and maintenance of thylakoid membrane integrity 0.8976 11 70
7o3z-assembly1.cif.gz_D structural basis for vipp1 oligomerization and maintenance of thylakoid membrane integrity 0.894 11 70
6zw6-assembly1.cif.gz_G c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.8926 11 70
ID Description Score Start End Superfamily
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9417 1 75 1.10.287.180
af_Q2FXW7_79_158_3.10.50.30 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.941 81 155 3.10.50.30
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.93 1 75 1.10.287.180
af_Q10SX2_9_185_6.10.140.1230 Special;Helix non-globular;Helix Hairpins; 0.9133 11 67 6.10.140.1230
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9112 1 75 1.10.287.180
ID Description Score Start End GO Terms
AF-A0A3E0ND48-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.9782 83 157 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A6L8Q7V6-F1-model_v4 GreA/GreB family elongation factor 0.9782 83 154 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A661Z7U8-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.977 91 155 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A837NC34-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.9727 83 157 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A7V6H520-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9686 5 155 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063

Map