F493873

General Info

Members Datasets Scaffolds Average Seq Length
1426 431 1426 154

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0005623|Ga0501070_0005623_6213_6752
Length 179
Sequence VGSDRRLDGGPDGAHAGSAGARDNETELVPIGKVGKPHGLDGSFFVEGPSDRPGAFARGTVVHVDGEPAEIVGSKRGGGGRPVIKLDRSAPRGATLAVPRDALPELPEDEYYAFQLVGLAVEEEGGRVLGRVREVLDYPANDVLELDSGLSLPLVGACVRQVDLAAGRIVVAQGFAEPE

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
202 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
203 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
207 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
237 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
251 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
270 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
271 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
272 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
273 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
274 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
275 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
276 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
285 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
355 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
356 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
357 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
361 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
362 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
365 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
366 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
370 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
371 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
372 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
395 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
412 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
413 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
414 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
415 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
424 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
427 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 9.12
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10004964 3300002077 Bacteria 2755
2 rootH2_10267484 3300003320 Bacteria 1218
3 Ga0070658_10011118 3300005327 Bacteria 7216
4 Ga0070658_10012511 3300005327 Bacteria 6808
5 Ga0070658_10037607 3300005327 Bacteria 3902
6 Ga0070658_10089363 3300005327 Bacteria 2537
7 Ga0070658_10306405 3300005327 Bacteria 1355
8 Ga0070658_10631686 3300005327 Bacteria 929
9 Ga0070658_10894912 3300005327 Bacteria 772
10 Ga0070676_10632294 3300005328 Bacteria 775
11 Ga0070676_10640114 3300005328 Unclassified 771
12 Ga0070683_100001865 3300005329 Bacteria 16455
13 Ga0070683_100018209 3300005329 Bacteria 6217
14 Ga0070683_100045953 3300005329 Bacteria 4032
15 Ga0070683_100114047 3300005329 Bacteria 2551
16 Ga0070683_100125154 3300005329 Bacteria 2430
17 Ga0070683_100211448 3300005329 Bacteria 1843
18 Ga0070683_100640123 3300005329 Bacteria 1018
19 Ga0070683_100898386 3300005329 Bacteria 850
20 Ga0070690_100058653 3300005330 Bacteria 2473
21 Ga0070670_100200263 3300005331 Bacteria 1735
22 Ga0070670_100305911 3300005331 Bacteria 1391
23 Ga0068869_100109194 3300005334 Bacteria 2102
24 Ga0068869_100390992 3300005334 Bacteria 1142
25 Ga0068869_100663872 3300005334 Unclassified 886
26 Ga0070680_100052359 3300005336 Bacteria 3332
27 Ga0070680_100189779 3300005336 Bacteria 1731
28 Ga0070680_100253354 3300005336 Bacteria 1488
29 Ga0070680_100270173 3300005336 Bacteria 1439
30 Ga0070680_100327017 3300005336 Bacteria 1302
31 Ga0070680_100359769 3300005336 Bacteria 1238
32 Ga0070680_100965166 3300005336 Bacteria 736
33 Ga0070682_100003833 3300005337 Bacteria 8355
34 Ga0070682_100082599 3300005337 Bacteria 2083
35 Ga0070682_100399959 3300005337 Bacteria 1038
36 Ga0070682_101445996 3300005337 Bacteria 589
37 Ga0068868_100022640 3300005338 Bacteria 4746
38 Ga0068868_100058917 3300005338 Bacteria 3036
39 Ga0068868_100487761 3300005338 Bacteria 1077
40 Ga0068868_100739802 3300005338 Bacteria 883
41 Ga0070660_100001665 3300005339 Bacteria 15269
42 Ga0070660_100022103 3300005339 Bacteria 4699
43 Ga0070660_100025708 3300005339 Bacteria 4378
44 Ga0070660_100170114 3300005339 Bacteria 1760
45 Ga0070660_100191282 3300005339 Bacteria 1658
46 Ga0070689_100006793 3300005340 Bacteria 7958
47 Ga0070689_100009236 3300005340 Bacteria 6982
48 Ga0070689_101175301 3300005340 Bacteria 688
49 Ga0070691_10063991 3300005341 Bacteria 1774
50 Ga0070687_100067615 3300005343 Bacteria 1908
51 Ga0070687_100356478 3300005343 Bacteria 946
52 Ga0070687_100649141 3300005343 Bacteria 731
53 Ga0070661_100006189 3300005344 Bacteria 8251
54 Ga0070661_100051629 3300005344 Bacteria 3010
55 Ga0070661_100070597 3300005344 Bacteria 2569
56 Ga0070692_10020687 3300005345 Bacteria 3192
57 Ga0070692_10041713 3300005345 Bacteria 2353
58 Ga0070668_100065272 3300005347 Bacteria 2824
59 Ga0070668_100363655 3300005347 Bacteria 1227
60 Ga0070668_100447433 3300005347 Bacteria 1110
61 Ga0070668_100501464 3300005347 Bacteria 1051
62 Ga0070668_100541673 3300005347 Bacteria 1012
63 Ga0070668_101003657 3300005347 Bacteria 750
64 Ga0070675_100129240 3300005354 Bacteria 2151
65 Ga0070675_100180631 3300005354 Bacteria 1824
66 Ga0070671_100085522 3300005355 Bacteria 2638
67 Ga0070671_100657015 3300005355 Bacteria 908
68 Ga0070671_100812433 3300005355 Bacteria 814
69 Ga0070674_100001487 3300005356 Bacteria 12492
70 Ga0070674_100192082 3300005356 Bacteria 1571
71 Ga0070674_100236314 3300005356 Bacteria 1428
72 Ga0070673_100013725 3300005364 Bacteria 5616
73 Ga0070673_100334532 3300005364 Bacteria 1340
74 Ga0070673_100388213 3300005364 Bacteria 1246
75 Ga0070673_100824512 3300005364 Bacteria 857
76 Ga0070673_101263998 3300005364 Unclassified 693
77 Ga0070688_100002522 3300005365 Bacteria 9267
78 Ga0070688_100010262 3300005365 Bacteria 5158
79 Ga0070688_100084993 3300005365 Bacteria 2056
80 Ga0070659_100038064 3300005366 Bacteria 3750
81 Ga0070659_100206030 3300005366 Bacteria 1620
82 Ga0070659_100212504 3300005366 Bacteria 1594
83 Ga0070659_100277829 3300005366 Bacteria 1393
84 Ga0070659_100722101 3300005366 Bacteria 863
85 Ga0070659_101090207 3300005366 Unclassified 704
86 Ga0070667_100160723 3300005367 Bacteria 1978
87 Ga0070667_101140473 3300005367 Bacteria 729
88 Ga0070703_10058900 3300005406 Bacteria 1251
89 Ga0070703_10154078 3300005406 Bacteria 866
90 Ga0070709_10013590 3300005434 Bacteria 4582
91 Ga0070709_10069690 3300005434 Bacteria 2265
92 Ga0070709_10216300 3300005434 Bacteria 1364
93 Ga0070709_10414217 3300005434 Bacteria 1008
94 Ga0070709_10980341 3300005434 Bacteria 671
95 Ga0070714_100007827 3300005435 Bacteria 8326
96 Ga0070714_100036119 3300005435 Bacteria 4143
97 Ga0070714_100046971 3300005435 Bacteria 3665
98 Ga0070714_100090873 3300005435 Bacteria 2674
99 Ga0070714_100091767 3300005435 Bacteria 2661
100 Ga0070714_100122082 3300005435 Bacteria 2318
101 Ga0070714_100328993 3300005435 Bacteria 1431
102 Ga0070714_100761416 3300005435 Bacteria 936
103 Ga0070714_100894301 3300005435 Bacteria 862
104 Ga0070714_101135714 3300005435 Bacteria 762
105 Ga0070714_101249265 3300005435 Unclassified 725
106 Ga0070714_101407980 3300005435 Bacteria 681
107 Ga0070713_100015287 3300005436 Bacteria 5729
108 Ga0070713_100050363 3300005436 Bacteria 3440
109 Ga0070713_100141221 3300005436 Bacteria 2134
110 Ga0070713_100365203 3300005436 Bacteria 1342
111 Ga0070713_100424007 3300005436 Bacteria 1246
112 Ga0070713_100815088 3300005436 Bacteria 895
113 Ga0070710_10007091 3300005437 Bacteria 5413
114 Ga0070710_10229996 3300005437 Bacteria 1183
115 Ga0070710_10296203 3300005437 Bacteria 1054
116 Ga0070701_10005157 3300005438 Bacteria 5366
117 Ga0070701_10069525 3300005438 Bacteria 1878
118 Ga0070701_10098075 3300005438 Bacteria 1618
119 Ga0070711_100017676 3300005439 Bacteria 4543
120 Ga0070711_100397166 3300005439 Bacteria 1118
121 Ga0070711_100613518 3300005439 Unclassified 909
122 Ga0070711_100617375 3300005439 Bacteria 906
123 Ga0070705_100101804 3300005440 Bacteria 1815
124 Ga0070705_100130889 3300005440 Bacteria 1636
125 Ga0070705_100328817 3300005440 Bacteria 1106
126 Ga0070705_100860483 3300005440 Bacteria 726
127 Ga0070705_101167859 3300005440 Bacteria 633
128 Ga0070700_100014136 3300005441 Bacteria 4504
129 Ga0070700_100067625 3300005441 Bacteria 2270
130 Ga0070700_100432058 3300005441 Bacteria 997
131 Ga0070700_101470507 3300005441 Bacteria 578
132 Ga0070700_101697924 3300005441 Bacteria 542
133 Ga0070694_101172416 3300005444 Bacteria 643
134 Ga0070708_100051628 3300005445 Bacteria 3643
135 Ga0070708_100073049 3300005445 Bacteria 3091
136 Ga0070708_100158297 3300005445 Bacteria 2109
137 Ga0070708_100555542 3300005445 Bacteria 1083
138 Ga0070708_100779445 3300005445 Bacteria 899
139 Ga0070663_100023999 3300005455 Bacteria 4097
140 Ga0070663_100161765 3300005455 Bacteria 1724
141 Ga0070663_100794333 3300005455 Unclassified 811
142 Ga0070678_100027620 3300005456 Bacteria 3856
143 Ga0070678_100036946 3300005456 Bacteria 3424
144 Ga0070678_100378111 3300005456 Bacteria 1225
145 Ga0070678_100387508 3300005456 Bacteria 1211
146 Ga0070678_100671009 3300005456 Bacteria 931
147 Ga0070662_100040778 3300005457 Bacteria 3308
148 Ga0070662_100286360 3300005457 Bacteria 1335
149 Ga0070662_100342603 3300005457 Bacteria 1223
150 Ga0070662_100509698 3300005457 Bacteria 1004
151 Ga0070681_10096407 3300005458 Bacteria 2906
152 Ga0070681_10176057 3300005458 Bacteria 2061
153 Ga0070681_10183017 3300005458 Bacteria 2016
154 Ga0070681_10235384 3300005458 Bacteria 1745
155 Ga0070681_10304925 3300005458 Bacteria 1502
156 Ga0070681_10362313 3300005458 Bacteria 1360
157 Ga0070681_10827745 3300005458 Bacteria 843
158 Ga0068867_100185756 3300005459 Bacteria 1655
159 Ga0070685_10003020 3300005466 Bacteria 8578
160 Ga0070685_10044857 3300005466 Bacteria 2533
161 Ga0070685_10086138 3300005466 Bacteria 1893
162 Ga0070706_100012667 3300005467 Bacteria 7801
163 Ga0070706_100064342 3300005467 Bacteria 3390
164 Ga0070706_100631250 3300005467 Bacteria 995
165 Ga0070707_100000987 3300005468 Bacteria 28141
166 Ga0070707_100068327 3300005468 Bacteria 3420
167 Ga0070707_100556034 3300005468 Bacteria 1110
168 Ga0070707_100754072 3300005468 Bacteria 937
169 Ga0070698_100056233 3300005471 Bacteria 3988
170 Ga0070698_100091026 3300005471 Bacteria 3033
171 Ga0070698_100111023 3300005471 Bacteria 2707
172 Ga0070698_100131851 3300005471 Bacteria 2454
173 Ga0070698_100179237 3300005471 Bacteria 2057
174 Ga0070698_100582973 3300005471 Bacteria 1058
175 Ga0070699_100008491 3300005518 Bacteria 8899
176 Ga0070699_100657917 3300005518 Archaea 956
177 Ga0070699_100724963 3300005518 Bacteria 909
178 Ga0070699_101247537 3300005518 Bacteria 682
179 Ga0070679_100040934 3300005530 Bacteria 4611
180 Ga0070679_100070341 3300005530 Bacteria 3491
181 Ga0070679_100070763 3300005530 Bacteria 3480
182 Ga0070679_100073299 3300005530 Bacteria 3416
183 Ga0070679_100117957 3300005530 Bacteria 2639
184 Ga0070679_100196807 3300005530 Bacteria 1983
185 Ga0070679_100407711 3300005530 Bacteria 1305
186 Ga0070679_100992516 3300005530 Bacteria 784
187 Ga0070684_100005586 3300005535 Bacteria 9659
188 Ga0070684_100008065 3300005535 Bacteria 8221
189 Ga0070684_100013208 3300005535 Bacteria 6650
190 Ga0070684_100034692 3300005535 Bacteria 4315
191 Ga0070684_100043198 3300005535 Bacteria 3891
192 Ga0070684_100053652 3300005535 Bacteria 3510
193 Ga0070684_100098475 3300005535 Bacteria 2609
194 Ga0070684_100154543 3300005535 Bacteria 2080
195 Ga0070684_100279306 3300005535 Bacteria 1530
196 Ga0070684_101725277 3300005535 Bacteria 591
197 Ga0070697_100062360 3300005536 Bacteria 3043
198 Ga0070697_100564454 3300005536 Bacteria 999
199 Ga0070697_101110109 3300005536 Bacteria 704
200 Ga0068853_100002166 3300005539 Bacteria 14624
201 Ga0068853_100757590 3300005539 Bacteria 928
202 Ga0070672_100010856 3300005543 Bacteria 6334
203 Ga0070686_100004390 3300005544 Bacteria 7776
204 Ga0070686_100240954 3300005544 Bacteria 1317
205 Ga0070695_100043829 3300005545 Bacteria 2846
206 Ga0070695_100047626 3300005545 Bacteria 2739
207 Ga0070695_100159387 3300005545 Bacteria 1582
208 Ga0070696_100037309 3300005546 Bacteria 3352
209 Ga0070696_100046541 3300005546 Bacteria 3008
210 Ga0070696_100387985 3300005546 Bacteria 1090
211 Ga0070693_100017969 3300005547 Bacteria 3687
212 Ga0070693_100019127 3300005547 Bacteria 3586
213 Ga0070693_100328492 3300005547 Bacteria 1040
214 Ga0070693_100446426 3300005547 Bacteria 907
215 Ga0070693_101306923 3300005547 Bacteria 561
216 Ga0070665_100087403 3300005548 Bacteria 3122
217 Ga0070704_100009096 3300005549 Bacteria 5993
218 Ga0070704_100084422 3300005549 Bacteria 2347
219 Ga0070704_100088247 3300005549 Bacteria 2304
220 Ga0070704_100250786 3300005549 Bacteria 1453
221 Ga0070704_100686008 3300005549 Bacteria 907
222 Ga0070704_101774681 3300005549 Unclassified 571
223 Ga0068855_100009395 3300005563 Bacteria 11809
224 Ga0068855_100071675 3300005563 Bacteria 4028
225 Ga0068855_100488131 3300005563 Bacteria 1340
226 Ga0068855_101932917 3300005563 Bacteria 597
227 Ga0070664_100108047 3300005564 Bacteria 2426
228 Ga0070664_100312896 3300005564 Bacteria 1421
229 Ga0070664_100558379 3300005564 Unclassified 1059
230 Ga0070664_100878453 3300005564 Unclassified 840
231 Ga0070664_101116997 3300005564 Bacteria 743
232 Ga0068857_100025094 3300005577 Bacteria 5250
233 Ga0068857_100046363 3300005577 Bacteria 3857
234 Ga0068857_100049533 3300005577 Bacteria 3726
235 Ga0068857_100129966 3300005577 Bacteria 2271
236 Ga0068857_100245039 3300005577 Bacteria 1642
237 Ga0068854_100013567 3300005578 Bacteria 5352
238 Ga0068854_101000978 3300005578 Bacteria 740
239 Ga0068854_101211075 3300005578 Unclassified 677
240 Ga0068854_101452107 3300005578 Unclassified 621
241 Ga0068856_100004140 3300005614 Bacteria 14490
242 Ga0068856_100023638 3300005614 Bacteria 5976
243 Ga0068856_100229998 3300005614 Bacteria 1869
244 Ga0068856_100455686 3300005614 Unclassified 1300
245 Ga0068856_100634250 3300005614 Bacteria 1089
246 Ga0068856_101841534 3300005614 Bacteria 617
247 Ga0070702_100015884 3300005615 Bacteria 3853
248 Ga0070702_100108432 3300005615 Bacteria 1717
249 Ga0070702_100158477 3300005615 Bacteria 1460
250 Ga0070702_100253560 3300005615 Bacteria 1194
251 Ga0070702_100554431 3300005615 Bacteria 854
252 Ga0068852_100047539 3300005616 Bacteria 3661
253 Ga0068852_100158542 3300005616 Bacteria 2111
254 Ga0068852_100667715 3300005616 Bacteria 1048
255 Ga0068852_100983481 3300005616 Bacteria 862
256 Ga0068852_101439485 3300005616 Unclassified 711
257 Ga0068852_101817403 3300005616 Bacteria 632
258 Ga0068859_100127625 3300005617 Bacteria 2614
259 Ga0068864_100017795 3300005618 Bacteria 5928
260 Ga0068864_100090622 3300005618 Bacteria 2696
261 Ga0068866_10021510 3300005718 Bacteria 2972
262 Ga0068866_10624547 3300005718 Bacteria 730
263 Ga0068861_100023044 3300005719 Bacteria 4489
264 Ga0068861_100029073 3300005719 Bacteria 4039
265 Ga0068861_100072076 3300005719 Bacteria 2679
266 Ga0068861_101194767 3300005719 Bacteria 735
267 Ga0068851_10574101 3300005834 Bacteria 684
268 Ga0068870_10242405 3300005840 Bacteria 1113
269 Ga0068863_100050395 3300005841 Bacteria 3946
270 Ga0068858_100106776 3300005842 Bacteria 2613
271 Ga0068860_100200289 3300005843 Bacteria 1934
272 Ga0068862_100283483 3300005844 Bacteria 1519
273 Ga0081455_10016804 3300005937 Bacteria 7040
274 Ga0081455_10020547 3300005937 Bacteria 6213
275 Ga0081538_10022731 3300005981 Bacteria 4533
276 Ga0081540_1010729 3300005983 Bacteria 6172
277 Ga0081540_1011619 3300005983 Bacteria 5873
278 Ga0070717_10433736 3300006028 Bacteria 1183
279 Ga0070717_10513344 3300006028 Bacteria 1084
280 Ga0070717_10664003 3300006028 Bacteria 946
281 Ga0070717_10773534 3300006028 Unclassified 873
282 Ga0070717_11306724 3300006028 Unclassified 659
283 Ga0075365_10256185 3300006038 Bacteria 1230
284 Ga0075364_10043764 3300006051 Bacteria 2911
285 Ga0075432_10044548 3300006058 Bacteria 1556
286 Ga0075432_10062548 3300006058 Unclassified 1328
287 Ga0070715_10006638 3300006163 Bacteria 3947
288 Ga0070715_10067143 3300006163 Bacteria 1592
289 Ga0070715_10089779 3300006163 Bacteria 1411
290 Ga0070715_10109589 3300006163 Bacteria 1301
291 Ga0070716_100054970 3300006173 Bacteria 2276
292 Ga0070716_100119106 3300006173 Bacteria 1650
293 Ga0070716_100978886 3300006173 Bacteria 667
294 Ga0070712_100003526 3300006175 Bacteria 9628
295 Ga0070712_100009687 3300006175 Bacteria 6071
296 Ga0070712_100143768 3300006175 Bacteria 1823
297 Ga0070712_100194905 3300006175 Bacteria 1588
298 Ga0070712_100651146 3300006175 Unclassified 895
299 Ga0070712_100792742 3300006175 Unclassified 812
300 Ga0070712_100886429 3300006175 Unclassified 769
301 Ga0075367_10728467 3300006178 Bacteria 631
302 Ga0068871_100139276 3300006358 Bacteria 2062
303 Ga0068871_100480435 3300006358 Bacteria 1117
304 Ga0068871_100511796 3300006358 Bacteria 1083
305 Ga0075428_100016481 3300006844 Bacteria 8159
306 Ga0075428_100188399 3300006844 Bacteria 2232
307 Ga0075428_100326174 3300006844 Bacteria 1649
308 Ga0075428_100455701 3300006844 Unclassified 1370
309 Ga0075430_100063435 3300006846 Bacteria 3104
310 Ga0075430_100102558 3300006846 Bacteria 2388
311 Ga0075431_100201548 3300006847 Bacteria 2036
312 Ga0075433_10004929 3300006852 Bacteria 10451
313 Ga0075433_10039121 3300006852 Bacteria 4099
314 Ga0075433_10080533 3300006852 Bacteria 2871
315 Ga0075433_10226935 3300006852 Bacteria 1659
316 Ga0075433_10618119 3300006852 Bacteria 951
317 Ga0075434_100008326 3300006871 Bacteria 9634
318 Ga0075434_100010386 3300006871 Bacteria 8726
319 Ga0075434_100077763 3300006871 Bacteria 3313
320 Ga0075434_100093791 3300006871 Bacteria 3006
321 Ga0075434_100153659 3300006871 Bacteria 2321
322 Ga0075434_100247750 3300006871 Bacteria 1801
323 Ga0075434_100621659 3300006871 Bacteria 1099
324 Ga0075429_100007369 3300006880 Bacteria 9550
325 Ga0075429_100477969 3300006880 Bacteria 1092
326 Ga0068865_100000845 3300006881 Bacteria 17301
327 Ga0068865_100156529 3300006881 Bacteria 1734
328 Ga0068865_100237350 3300006881 Bacteria 1433
329 Ga0068865_100319230 3300006881 Bacteria 1249
330 Ga0068865_100636349 3300006881 Bacteria 905
331 Ga0068865_100671653 3300006881 Bacteria 882
332 Ga0075436_100003895 3300006914 Bacteria 10229
333 Ga0075436_100065686 3300006914 Bacteria 2507
334 Ga0075436_100140314 3300006914 Bacteria 1698
335 Ga0097620_100127621 3300006931 Bacteria 2614
336 Ga0097620_100155374 3300006931 Bacteria 2365
337 Ga0075435_100000608 3300007076 Bacteria 21974
338 Ga0075435_100002068 3300007076 Bacteria 13160
339 Ga0075435_100019166 3300007076 Bacteria 5217
340 Ga0075435_100232237 3300007076 Bacteria 1567
341 Ga0075435_100651760 3300007076 Bacteria 914
342 Ga0075435_101559249 3300007076 Bacteria 579
343 Ga0105240_10009485 3300009093 Bacteria 13778
344 Ga0105240_10093466 3300009093 Bacteria 3670
345 Ga0105240_10094783 3300009093 Bacteria 3640
346 Ga0105240_10167086 3300009093 Bacteria 2609
347 Ga0111539_10136922 3300009094 Bacteria 2868
348 Ga0111539_10251402 3300009094 Bacteria 2058
349 Ga0111539_10557627 3300009094 Unclassified 1334
350 Ga0111539_11280496 3300009094 Bacteria 851
351 Ga0111539_11729589 3300009094 Unclassified 725
352 Ga0105245_10033229 3300009098 Bacteria 4571
353 Ga0105245_10053596 3300009098 Bacteria 3620
354 Ga0105245_10058534 3300009098 Bacteria 3468
355 Ga0105245_10077224 3300009098 Bacteria 3036
356 Ga0105245_10131976 3300009098 Bacteria 2344
357 Ga0105245_10160864 3300009098 Bacteria 2130
358 Ga0105245_10188387 3300009098 Bacteria 1975
359 Ga0105245_10531229 3300009098 Bacteria 1196
360 Ga0105245_11167698 3300009098 Bacteria 817
361 Ga0105245_11633487 3300009098 Bacteria 696
362 Ga0105247_10031737 3300009101 Bacteria 3207
363 Ga0105247_10036573 3300009101 Bacteria 2993
364 Ga0105247_10067377 3300009101 Bacteria 2230
365 Ga0114129_10002455 3300009147 Bacteria 25739
366 Ga0114129_10064370 3300009147 Bacteria 5116
367 Ga0114129_10109054 3300009147 Bacteria 3821
368 Ga0114129_10137377 3300009147 Bacteria 3353
369 Ga0114129_10352222 3300009147 Bacteria 1950
370 Ga0114129_10399901 3300009147 Bacteria 1810
371 Ga0114129_10706584 3300009147 Bacteria 1295
372 Ga0114129_11081848 3300009147 Bacteria 1005
373 Ga0105243_10009252 3300009148 Bacteria 7522
374 Ga0105243_10149359 3300009148 Bacteria 2003
375 Ga0105243_10526822 3300009148 Bacteria 1125
376 Ga0105243_10603928 3300009148 Bacteria 1057
377 Ga0105243_11306491 3300009148 Bacteria 743
378 Ga0105241_10094158 3300009174 Bacteria 2368
379 Ga0105241_10381409 3300009174 Bacteria 1232
380 Ga0105241_10450509 3300009174 Bacteria 1138
381 Ga0105242_10134311 3300009176 Bacteria 2140
382 Ga0105242_10224533 3300009176 Bacteria 1680
383 Ga0105242_10574181 3300009176 Bacteria 1085
384 Ga0105242_11271182 3300009176 Bacteria 758
385 Ga0105248_10040417 3300009177 Bacteria 5228
386 Ga0105248_10070587 3300009177 Bacteria 3922
387 Ga0105248_10137270 3300009177 Bacteria 2759
388 Ga0105248_10404552 3300009177 Bacteria 1537
389 Ga0105237_10133279 3300009545 Bacteria 2479
390 Ga0105237_11935439 3300009545 Bacteria 598
391 Ga0105238_10031793 3300009551 Bacteria 5370
392 Ga0105238_10074585 3300009551 Bacteria 3385
393 Ga0105238_10165254 3300009551 Bacteria 2189
394 Ga0105238_10589443 3300009551 Bacteria 1119
395 Ga0105238_10616049 3300009551 Bacteria 1094
396 Ga0105238_10708736 3300009551 Bacteria 1019
397 Ga0105238_12726499 3300009551 Unclassified 531
398 Ga0105249_10003671 3300009553 Bacteria 13234
399 Ga0105249_10538150 3300009553 Bacteria 1217
400 Ga0105249_11182639 3300009553 Bacteria 835
401 Ga0105239_10013480 3300010375 Bacteria 9078
402 Ga0105239_10205940 3300010375 Bacteria 2204
403 Ga0105239_10214981 3300010375 Bacteria 2155
404 Ga0105239_10246359 3300010375 Bacteria 2007
405 Ga0105239_10883245 3300010375 Bacteria 1026
406 Ga0105239_10892872 3300010375 Unclassified 1020
407 Ga0105246_10043027 3300011119 Bacteria 3062
408 Ga0105246_10082165 3300011119 Bacteria 2299
409 Ga0105246_10139095 3300011119 Bacteria 1824
410 Ga0105246_10140462 3300011119 Bacteria 1815
411 Ga0105246_10369835 3300011119 Bacteria 1181
412 Ga0105246_10941343 3300011119 Unclassified 778
413 Ga0157373_10138060 3300013100 Bacteria 1714
414 Ga0157371_10206561 3300013102 Bacteria 1409
415 Ga0157371_10967644 3300013102 Bacteria 648
416 Ga0157370_10008347 3300013104 Bacteria 11172
417 Ga0157370_10356510 3300013104 Bacteria 1348
418 Ga0157370_10489841 3300013104 Bacteria 1129
419 Ga0157370_10587314 3300013104 Bacteria 1020
420 Ga0157369_10032504 3300013105 Bacteria 5737
421 Ga0157369_10177672 3300013105 Bacteria 2241
422 Ga0157369_10256308 3300013105 Bacteria 1825
423 Ga0157369_10417961 3300013105 Bacteria 1390
424 Ga0157374_10031825 3300013296 Bacteria 4798
425 Ga0157374_10046244 3300013296 Bacteria 4030
426 Ga0157374_10188421 3300013296 Bacteria 2017
427 Ga0157374_10201066 3300013296 Bacteria 1951
428 Ga0157378_10035568 3300013297 Bacteria 4406
429 Ga0157378_10126919 3300013297 Bacteria 2357
430 Ga0157378_10335215 3300013297 Bacteria 1473
431 Ga0157378_10420671 3300013297 Bacteria 1320
432 Ga0157378_12487804 3300013297 Bacteria 570
433 Ga0163162_10013357 3300013306 Bacteria 8019
434 Ga0163162_10088659 3300013306 Bacteria 3173
435 Ga0163162_10190664 3300013306 Bacteria 2177
436 Ga0157372_10162686 3300013307 Bacteria 2580
437 Ga0157372_10519684 3300013307 Bacteria 1388
438 Ga0157372_10584613 3300013307 Unclassified 1302
439 Ga0157372_11127040 3300013307 Bacteria 907
440 Ga0157372_11579879 3300013307 Bacteria 755
441 Ga0157375_10012526 3300013308 Bacteria 7526
442 Ga0157375_10027240 3300013308 Bacteria 5340
443 Ga0157375_10063999 3300013308 Bacteria 3661
444 Ga0157375_10173675 3300013308 Bacteria 2304
445 Ga0157375_10260119 3300013308 Bacteria 1897
446 Ga0157375_10460462 3300013308 Bacteria 1437
447 Ga0157375_11029040 3300013308 Bacteria 962
448 Ga0157375_12010254 3300013308 Bacteria 687
449 Ga0163163_10012277 3300014325 Bacteria 7801
450 Ga0157380_10173862 3300014326 Bacteria 1885
451 Ga0182008_10003536 3300014497 Bacteria 9390
452 Ga0182008_10072470 3300014497 Bacteria 1695
453 Ga0182008_10312614 3300014497 Bacteria 825
454 Ga0157377_10001386 3300014745 Bacteria 10436
455 Ga0157377_10057601 3300014745 Bacteria 2210
456 Ga0157377_10063446 3300014745 Bacteria 2116
457 Ga0157377_10320802 3300014745 Bacteria 1029
458 Ga0157379_10004792 3300014968 Bacteria 11622
459 Ga0157379_10033687 3300014968 Bacteria 4568
460 Ga0157379_10596329 3300014968 Bacteria 1031
461 Ga0157379_10792774 3300014968 Bacteria 894
462 Ga0157376_10010525 3300014969 Bacteria 6771
463 Ga0157376_10024111 3300014969 Bacteria 4772
464 Ga0182006_1053309 3300015261 Bacteria 1551
465 Ga0182005_1226018 3300015265 Unclassified 571
466 Ga0163161_10088999 3300017792 Bacteria 2283
467 Ga0163161_10269736 3300017792 Bacteria 1331
468 Ga0197907_10020787 3300020069 Bacteria 3324
469 Ga0206356_10612056 3300020070 Bacteria 3250
470 Ga0206354_10736297 3300020081 Bacteria 3386
471 Ga0206354_10956645 3300020081 Bacteria 1106
472 Ga0206353_10000551 3300020082 Unclassified 776
473 Ga0206353_10185240 3300020082 Bacteria 3896
474 Ga0206353_10294215 3300020082 Bacteria 652
475 Ga0206353_10315338 3300020082 Bacteria 896
476 Ga0206353_12070731 3300020082 Bacteria 3197
477 Ga0207656_10426048 3300025321 Bacteria 669
478 Ga0207653_10006528 3300025885 Bacteria 3643
479 Ga0207653_10044755 3300025885 Bacteria 1460
480 Ga0207692_10031828 3300025898 Bacteria 2529
481 Ga0207642_10001681 3300025899 Bacteria 6835
482 Ga0207642_10528561 3300025899 Bacteria 726
483 Ga0207710_10075242 3300025900 Bacteria 1556
484 Ga0207710_10082560 3300025900 Bacteria 1493
485 Ga0207688_10021233 3300025901 Bacteria 3547
486 Ga0207688_10029657 3300025901 Bacteria 3013
487 Ga0207688_10034349 3300025901 Bacteria 2808
488 Ga0207688_10051972 3300025901 Bacteria 2296
489 Ga0207688_10335215 3300025901 Bacteria 930
490 Ga0207647_10042320 3300025904 Bacteria 2858
491 Ga0207685_10249571 3300025905 Bacteria 858
492 Ga0207699_10040133 3300025906 Bacteria 2695
493 Ga0207699_10156234 3300025906 Bacteria 1514
494 Ga0207699_10267664 3300025906 Bacteria 1183
495 Ga0207699_10304513 3300025906 Bacteria 1114
496 Ga0207699_10587496 3300025906 Bacteria 810
497 Ga0207645_10204427 3300025907 Bacteria 1300
498 Ga0207643_10345643 3300025908 Bacteria 933
499 Ga0207705_10011067 3300025909 Bacteria 6540
500 Ga0207705_10018112 3300025909 Bacteria 5036
501 Ga0207705_10074140 3300025909 Bacteria 2470
502 Ga0207705_10175334 3300025909 Bacteria 1616
503 Ga0207705_10202786 3300025909 Bacteria 1503
504 Ga0207705_10412958 3300025909 Unclassified 1044
505 Ga0207684_10203152 3300025910 Bacteria 1709
506 Ga0207684_10774335 3300025910 Bacteria 812
507 Ga0207654_10074829 3300025911 Bacteria 2022
508 Ga0207707_10019294 3300025912 Bacteria 5950
509 Ga0207707_10051474 3300025912 Bacteria 3586
510 Ga0207707_10092840 3300025912 Bacteria 2637
511 Ga0207707_10174626 3300025912 Bacteria 1877
512 Ga0207707_10233044 3300025912 Bacteria 1602
513 Ga0207707_10358052 3300025912 Bacteria 1257
514 Ga0207707_10513191 3300025912 Bacteria 1021
515 Ga0207707_10684810 3300025912 Bacteria 862
516 Ga0207695_10029265 3300025913 Bacteria 6092
517 Ga0207695_10216670 3300025913 Bacteria 1823
518 Ga0207695_10319656 3300025913 Bacteria 1442
519 Ga0207695_10869274 3300025913 Bacteria 781
520 Ga0207671_10060994 3300025914 Bacteria 2798
521 Ga0207693_10001729 3300025915 Bacteria 19191
522 Ga0207693_10010374 3300025915 Bacteria 7562
523 Ga0207693_10020626 3300025915 Bacteria 5240
524 Ga0207693_10099526 3300025915 Bacteria 2280
525 Ga0207693_10100461 3300025915 Bacteria 2268
526 Ga0207693_10228354 3300025915 Bacteria 1462
527 Ga0207693_10336566 3300025915 Bacteria 1181
528 Ga0207693_10714617 3300025915 Unclassified 776
529 Ga0207663_10062388 3300025916 Bacteria 2369
530 Ga0207663_10069152 3300025916 Bacteria 2271
531 Ga0207663_10137729 3300025916 Bacteria 1696
532 Ga0207663_10509315 3300025916 Bacteria 936
533 Ga0207663_10586449 3300025916 Bacteria 875
534 Ga0207660_10041302 3300025917 Bacteria 3232
535 Ga0207660_10049161 3300025917 Bacteria 2987
536 Ga0207660_10105314 3300025917 Bacteria 2114
537 Ga0207660_10205808 3300025917 Bacteria 1539
538 Ga0207660_10243334 3300025917 Bacteria 1418
539 Ga0207660_10367722 3300025917 Bacteria 1154
540 Ga0207660_10666974 3300025917 Bacteria 848
541 Ga0207660_10732096 3300025917 Bacteria 807
542 Ga0207660_10747622 3300025917 Bacteria 798
543 Ga0207660_10747665 3300025917 Bacteria 798
544 Ga0207662_10013402 3300025918 Bacteria 4586
545 Ga0207662_10717073 3300025918 Bacteria 702
546 Ga0207657_10006843 3300025919 Bacteria 11761
547 Ga0207657_10015818 3300025919 Bacteria 7292
548 Ga0207657_10020680 3300025919 Bacteria 6213
549 Ga0207657_10024620 3300025919 Bacteria 5568
550 Ga0207657_10074499 3300025919 Bacteria 2866
551 Ga0207657_10095024 3300025919 Bacteria 2481
552 Ga0207649_10033475 3300025920 Bacteria 3071
553 Ga0207649_11007527 3300025920 Unclassified 655
554 Ga0207652_10025179 3300025921 Bacteria 4944
555 Ga0207652_10045263 3300025921 Bacteria 3751
556 Ga0207652_10051061 3300025921 Bacteria 3545
557 Ga0207652_10057548 3300025921 Bacteria 3348
558 Ga0207652_10263623 3300025921 Bacteria 1554
559 Ga0207652_10265708 3300025921 Bacteria 1548
560 Ga0207652_10524768 3300025921 Bacteria 1065
561 Ga0207652_10764269 3300025921 Bacteria 859
562 Ga0207646_10007181 3300025922 Bacteria 11376
563 Ga0207646_10072158 3300025922 Bacteria 3084
564 Ga0207646_10423163 3300025922 Bacteria 1202
565 Ga0207646_10448107 3300025922 Bacteria 1165
566 Ga0207681_10043023 3300025923 Bacteria 3021
567 Ga0207694_10021341 3300025924 Bacteria 4907
568 Ga0207694_10427034 3300025924 Bacteria 1104
569 Ga0207694_10566623 3300025924 Bacteria 954
570 Ga0207650_10797649 3300025925 Bacteria 800
571 Ga0207650_11498942 3300025925 Unclassified 573
572 Ga0207659_10070135 3300025926 Bacteria 2555
573 Ga0207687_10011630 3300025927 Bacteria 5752
574 Ga0207687_10014242 3300025927 Bacteria 5202
575 Ga0207687_10096561 3300025927 Bacteria 2166
576 Ga0207687_10097397 3300025927 Bacteria 2157
577 Ga0207687_10114078 3300025927 Bacteria 2011
578 Ga0207687_10117843 3300025927 Bacteria 1981
579 Ga0207687_10811583 3300025927 Bacteria 798
580 Ga0207687_10915467 3300025927 Bacteria 751
581 Ga0207700_10000002 3300025928 Bacteria 775978
582 Ga0207700_10158598 3300025928 Bacteria 1877
583 Ga0207700_10399199 3300025928 Bacteria 1205
584 Ga0207664_10011939 3300025929 Bacteria 6201
585 Ga0207664_10040081 3300025929 Bacteria 3639
586 Ga0207664_10074512 3300025929 Bacteria 2743
587 Ga0207664_10102254 3300025929 Bacteria 2369
588 Ga0207664_10143788 3300025929 Bacteria 2021
589 Ga0207664_10144754 3300025929 Bacteria 2014
590 Ga0207664_10170683 3300025929 Bacteria 1861
591 Ga0207664_10343003 3300025929 Bacteria 1321
592 Ga0207664_10789820 3300025929 Bacteria 854
593 Ga0207664_10842925 3300025929 Unclassified 824
594 Ga0207664_10875789 3300025929 Bacteria 807
595 Ga0207644_10087477 3300025931 Bacteria 2316
596 Ga0207644_10220217 3300025931 Bacteria 1504
597 Ga0207644_10363922 3300025931 Unclassified 1177
598 Ga0207644_10534772 3300025931 Bacteria 969
599 Ga0207690_10166655 3300025932 Bacteria 1647
600 Ga0207690_10290736 3300025932 Bacteria 1275
601 Ga0207690_10532228 3300025932 Bacteria 953
602 Ga0207690_10576338 3300025932 Bacteria 917
603 Ga0207690_10918883 3300025932 Bacteria 726
604 Ga0207690_11094299 3300025932 Unclassified 664
605 Ga0207706_10130383 3300025933 Bacteria 2211
606 Ga0207706_10268699 3300025933 Bacteria 1488
607 Ga0207706_10519221 3300025933 Bacteria 1027
608 Ga0207686_10014123 3300025934 Bacteria 4438
609 Ga0207686_10043218 3300025934 Bacteria 2760
610 Ga0207686_10301950 3300025934 Bacteria 1189
611 Ga0207686_11001330 3300025934 Bacteria 678
612 Ga0207709_10020292 3300025935 Bacteria 3747
613 Ga0207709_10055785 3300025935 Bacteria 2443
614 Ga0207709_10090721 3300025935 Bacteria 1997
615 Ga0207709_10149518 3300025935 Bacteria 1616
616 Ga0207709_10150539 3300025935 Bacteria 1611
617 Ga0207709_10504419 3300025935 Bacteria 945
618 Ga0207670_10075446 3300025936 Bacteria 2344
619 Ga0207670_10332026 3300025936 Bacteria 1199
620 Ga0207669_10191948 3300025937 Bacteria 1474
621 Ga0207669_10370518 3300025937 Bacteria 1113
622 Ga0207669_10556960 3300025937 Bacteria 926
623 Ga0207669_10735304 3300025937 Unclassified 814
624 Ga0207704_10033753 3300025938 Bacteria 2913
625 Ga0207704_10081409 3300025938 Bacteria 2094
626 Ga0207704_10301315 3300025938 Bacteria 1228
627 Ga0207704_10327223 3300025938 Bacteria 1184
628 Ga0207704_11073316 3300025938 Bacteria 683
629 Ga0207665_10012934 3300025939 Bacteria 5490
630 Ga0207665_10035914 3300025939 Bacteria 3292
631 Ga0207665_10062204 3300025939 Bacteria 2532
632 Ga0207665_10095487 3300025939 Bacteria 2066
633 Ga0207665_10184280 3300025939 Bacteria 1513
634 Ga0207665_10417134 3300025939 Bacteria 1025
635 Ga0207665_11120967 3300025939 Unclassified 627
636 Ga0207691_10029592 3300025940 Bacteria 5123
637 Ga0207691_10054938 3300025940 Bacteria 3632
638 Ga0207691_10296654 3300025940 Bacteria 1389
639 Ga0207711_10157993 3300025941 Bacteria 2050
640 Ga0207711_10390333 3300025941 Bacteria 1292
641 Ga0207711_10499100 3300025941 Bacteria 1134
642 Ga0207689_10055243 3300025942 Bacteria 3269
643 Ga0207689_10196149 3300025942 Bacteria 1666
644 Ga0207689_10209693 3300025942 Bacteria 1609
645 Ga0207661_10003567 3300025944 Bacteria 10820
646 Ga0207661_10004931 3300025944 Bacteria 9358
647 Ga0207661_10078773 3300025944 Bacteria 2714
648 Ga0207661_10118789 3300025944 Bacteria 2248
649 Ga0207661_10226515 3300025944 Bacteria 1654
650 Ga0207661_10260953 3300025944 Bacteria 1543
651 Ga0207661_11236294 3300025944 Bacteria 687
652 Ga0207661_11304693 3300025944 Bacteria 667
653 Ga0207679_10125225 3300025945 Bacteria 2052
654 Ga0207679_10157043 3300025945 Bacteria 1858
655 Ga0207667_10065584 3300025949 Bacteria 3786
656 Ga0207667_10089450 3300025949 Bacteria 3182
657 Ga0207667_10487412 3300025949 Bacteria 1251
658 Ga0207667_10845329 3300025949 Bacteria 910
659 Ga0207667_11515018 3300025949 Bacteria 641
660 Ga0207651_10067143 3300025960 Bacteria 2523
661 Ga0207651_10110571 3300025960 Bacteria 2062
662 Ga0207651_10276063 3300025960 Bacteria 1387
663 Ga0207651_10899009 3300025960 Bacteria 788
664 Ga0207651_11327744 3300025960 Unclassified 647
665 Ga0207712_10029720 3300025961 Bacteria 3669
666 Ga0207712_10122701 3300025961 Bacteria 1968
667 Ga0207712_10173897 3300025961 Bacteria 1686
668 Ga0207712_10446324 3300025961 Bacteria 1096
669 Ga0207668_10016042 3300025972 Bacteria 4667
670 Ga0207668_10107386 3300025972 Bacteria 2087
671 Ga0207668_10195115 3300025972 Bacteria 1608
672 Ga0207668_10248203 3300025972 Bacteria 1444
673 Ga0207668_10586120 3300025972 Bacteria 970
674 Ga0207640_10091189 3300025981 Bacteria 2111
675 Ga0207640_10468276 3300025981 Bacteria 1042
676 Ga0207640_11654201 3300025981 Bacteria 577
677 Ga0207677_10015646 3300026023 Bacteria 4470
678 Ga0207677_10040183 3300026023 Bacteria 3082
679 Ga0207677_10178702 3300026023 Bacteria 1667
680 Ga0207677_10349741 3300026023 Unclassified 1238
681 Ga0207703_10523642 3300026035 Bacteria 1115
682 Ga0207703_10635694 3300026035 Bacteria 1011
683 Ga0207639_10287699 3300026041 Bacteria 1448
684 Ga0207639_10311139 3300026041 Bacteria 1395
685 Ga0207639_10444900 3300026041 Bacteria 1175
686 Ga0207639_10849627 3300026041 Bacteria 852
687 Ga0207678_10009877 3300026067 Bacteria 8379
688 Ga0207678_10765420 3300026067 Bacteria 852
689 Ga0207708_10010297 3300026075 Bacteria 6943
690 Ga0207708_10054174 3300026075 Bacteria 3058
691 Ga0207708_10122673 3300026075 Bacteria 2026
692 Ga0207708_10459694 3300026075 Bacteria 1061
693 Ga0207702_10053207 3300026078 Bacteria 3427
694 Ga0207702_10086545 3300026078 Bacteria 2733
695 Ga0207702_10094423 3300026078 Bacteria 2625
696 Ga0207702_10183304 3300026078 Bacteria 1929
697 Ga0207702_10493406 3300026078 Bacteria 1193
698 Ga0207702_11082788 3300026078 Bacteria 795
699 Ga0207641_10165231 3300026088 Bacteria 2015
700 Ga0207648_10001442 3300026089 Bacteria 26183
701 Ga0207648_10406491 3300026089 Bacteria 1234
702 Ga0207648_10802444 3300026089 Bacteria 876
703 Ga0207676_10199410 3300026095 Bacteria 1767
704 Ga0207676_10220799 3300026095 Bacteria 1688
705 Ga0207674_10015445 3300026116 Bacteria 8389
706 Ga0207674_10035259 3300026116 Bacteria 5223
707 Ga0207674_10125196 3300026116 Bacteria 2536
708 Ga0207674_10379823 3300026116 Bacteria 1366
709 Ga0207675_100013703 3300026118 Bacteria 7568
710 Ga0207675_100164794 3300026118 Bacteria 2116
711 Ga0207675_100371134 3300026118 Bacteria 1405
712 Ga0207675_100616201 3300026118 Bacteria 1089
713 Ga0207675_101015797 3300026118 Bacteria 848
714 Ga0207683_10001430 3300026121 Bacteria 21604
715 Ga0207683_10014362 3300026121 Bacteria 6746
716 Ga0207683_10029388 3300026121 Bacteria 4759
717 Ga0207683_10148540 3300026121 Bacteria 2115
718 Ga0207698_10082618 3300026142 Bacteria 2597
719 Ga0207698_10367156 3300026142 Bacteria 1365
720 Ga0207698_10548089 3300026142 Bacteria 1133
721 Ga0207428_10033394 3300027907 Bacteria 4227
722 Ga0207428_10050102 3300027907 Bacteria 3342
723 Ga0207428_10067936 3300027907 Bacteria 2805
724 Ga0207428_10495778 3300027907 Unclassified 887
725 Ga0268266_10050608 3300028379 Bacteria 3565
726 Ga0268266_10128416 3300028379 Bacteria 2265
727 Ga0268265_10255612 3300028380 Bacteria 1555
728 Ga0268265_10412795 3300028380 Bacteria 1251
729 Ga0268264_10096251 3300028381 Bacteria 2563
730 Ga0268264_10251761 3300028381 Bacteria 1641
731 Ga0268264_10472505 3300028381 Bacteria 1218
732 Ga0265337_1053257 3300028556 Bacteria 1135
733 Ga0265337_1081506 3300028556 Bacteria 885
734 Ga0265326_10016459 3300028558 Bacteria 2137
735 Ga0265319_1002815 3300028563 Bacteria 9303
736 Ga0265319_1003098 3300028563 Bacteria 8785
737 Ga0265334_10017903 3300028573 Bacteria 2922
738 Ga0265334_10030810 3300028573 Bacteria 2145
739 Ga0265334_10114807 3300028573 Bacteria 965
740 Ga0265318_10000752 3300028577 Bacteria 21581
741 Ga0265318_10002259 3300028577 Bacteria 10378
742 Ga0265318_10063297 3300028577 Bacteria 1377
743 Ga0265323_10182622 3300028653 Bacteria 664
744 Ga0265322_10080384 3300028654 Bacteria 925
745 Ga0265336_10004451 3300028666 Bacteria 5293
746 Ga0265336_10053548 3300028666 Bacteria 1216
747 Ga0265338_10003630 3300028800 Bacteria 21488
748 Ga0265338_10008799 3300028800 Bacteria 12184
749 Ga0265338_10011714 3300028800 Bacteria 10095
750 Ga0265338_10013077 3300028800 Bacteria 9406
751 Ga0265338_10017093 3300028800 Bacteria 7840
752 Ga0265338_10026816 3300028800 Bacteria 5798
753 Ga0265338_10048449 3300028800 Bacteria 3865
754 Ga0265338_10219106 3300028800 Bacteria 1423
755 Ga0265324_10039634 3300029957 Bacteria 1633
756 Ga0265324_10080263 3300029957 Bacteria 1110
757 Ga0265330_10002499 3300031235 Bacteria 10000
758 Ga0265330_10019710 3300031235 Bacteria 3087
759 Ga0265330_10131203 3300031235 Bacteria 1066
760 Ga0265332_10055543 3300031238 Bacteria 1697
761 Ga0265320_10140187 3300031240 Bacteria 1095
762 Ga0265320_10185693 3300031240 Bacteria 931
763 Ga0265325_10000754 3300031241 Bacteria 23431
764 Ga0265325_10242041 3300031241 Unclassified 819
765 Ga0265329_10034614 3300031242 Bacteria 1631
766 Ga0265340_10025820 3300031247 Bacteria 2972
767 Ga0265340_10048307 3300031247 Bacteria 2069
768 Ga0265339_10003846 3300031249 Bacteria 10418
769 Ga0265339_10006014 3300031249 Bacteria 8020
770 Ga0265339_10184345 3300031249 Unclassified 1038
771 Ga0265331_10002131 3300031250 Bacteria 13615
772 Ga0265331_10104504 3300031250 Bacteria 1302
773 Ga0265327_10007600 3300031251 Bacteria 8319
774 Ga0265327_10010689 3300031251 Bacteria 6414
775 Ga0265327_10016471 3300031251 Bacteria 4692
776 Ga0265327_10170027 3300031251 Bacteria 1002
777 Ga0265316_10005704 3300031344 Bacteria 12036
778 Ga0265316_10006899 3300031344 Bacteria 10777
779 Ga0265316_10093360 3300031344 Bacteria 2293
780 Ga0265316_10261810 3300031344 Bacteria 1268
781 Ga0307408_100033156 3300031548 Bacteria 3606
782 Ga0265313_10015960 3300031595 Bacteria 4343
783 Ga0265313_10017597 3300031595 Bacteria 4052
784 Ga0265313_10076357 3300031595 Bacteria 1531
785 Ga0265314_10005119 3300031711 Bacteria 11933
786 Ga0265314_10102489 3300031711 Bacteria 1836
787 Ga0265314_10108971 3300031711 Bacteria 1763
788 Ga0265342_10012427 3300031712 Bacteria 5768
789 Ga0265342_10016563 3300031712 Bacteria 4811
790 Ga0265342_10136676 3300031712 Bacteria 1370
791 Ga0307405_10691708 3300031731 Bacteria 843
792 Ga0307413_10817718 3300031824 Bacteria 784
793 Ga0307410_10047990 3300031852 Bacteria 2857
794 Ga0307406_10031027 3300031901 Bacteria 3251
795 Ga0307407_10034034 3300031903 Bacteria 2785
796 Ga0307412_10116401 3300031911 Bacteria 1917
797 Ga0307409_100050665 3300031995 Bacteria 3172
798 Ga0307409_100702210 3300031995 Bacteria 1011
799 Ga0307416_100255914 3300032002 Bacteria 1707
800 Ga0307416_100338443 3300032002 Bacteria 1516
801 Ga0307416_100429384 3300032002 Bacteria 1368
802 Ga0307416_100935322 3300032002 Unclassified 968
803 Ga0307414_10288543 3300032004 Bacteria 1382
804 Ga0307411_10058165 3300032005 Bacteria 2557
805 Ga0307415_100241808 3300032126 Bacteria 1460
806 Ga0307415_100457732 3300032126 Bacteria 1105
807 Ga0307415_100478049 3300032126 Bacteria 1084
808 Ga0307415_101852001 3300032126 Bacteria 585
809 Ga0316583_10032926 3300032133 Bacteria 1842
810 Ga0373948_0002819 3300034817 Bacteria 2610
811 Ga0373958_0009639 3300034819 Bacteria 1593
812 Ga0373959_0102966 3300034820 Bacteria 681
813 Ga0373938_0007565 3300034957 Bacteria 1915
814 Ga0373926_0086434 3300035083 Bacteria 1164
815 Ga0373929_0022857 3300035085 Bacteria 1279
816 Ga0373940_0026721 3300035088 Bacteria 1512
817 Ga0373944_0017358 3300035089 Bacteria 2042
818 Ga0373949_0083375 3300035090 Bacteria 855
819 Ga0373952_0034305 3300035092 Bacteria 1143
820 Ga0373923_0113379 3300035111 Bacteria 1206
821 Ga0373932_0010080 3300035112 Bacteria 2281
822 Ga0373932_0218421 3300035112 Bacteria 684
823 Ga0373954_0090186 3300035118 Bacteria 1472
824 Ga0373954_0561690 3300035118 Bacteria 566
825 Ga0373956_0081930 3300035119 Bacteria 1481
826 Ga0373960_0004970 3300035121 Bacteria 3064
827 Ga0373960_0005836 3300035121 Bacteria 2865
828 Ga0373943_0002716 3300035170 Bacteria 8038
829 Ga0373943_0195813 3300035170 Bacteria 1117
830 Ga0373943_0235465 3300035170 Bacteria 1024
831 Ga0373942_0015185 3300035207 Bacteria 1873
832 Ga0373942_0051946 3300035207 Bacteria 1152
833 Ga0373961_0015262 3300035241 Bacteria 1962
834 Ga0373961_0179809 3300035241 Bacteria 736
835 Ga0373962_0004789 3300035242 Bacteria 3267
836 Ga0373962_0023110 3300035242 Bacteria 1654
837 Ga0373924_0119663 3300035410 Bacteria 1142
838 Ga0373924_0155952 3300035410 Bacteria 1000
839 Ga0373931_0222263 3300035691 Bacteria 1137
840 Ga0373931_0591029 3300035691 Unclassified 725
841 Ga0373935_0038598 3300035692 Bacteria 2991
842 Ga0373935_0093333 3300035692 Bacteria 1973
843 Ga0373935_0771687 3300035692 Bacteria 709
844 Ga0373927_0208877 3300035695 Bacteria 1282
845 Ga0373933_0040393 3300035724 Bacteria 2749
846 Ga0373933_0106048 3300035724 Bacteria 1748
847 Ga0373947_0042177 3300035725 Bacteria 2723
848 Ga0373947_0060004 3300035725 Bacteria 2308
849 Ga0373937_0165030 3300036401 Bacteria 2076
850 Ga0373937_0279812 3300036401 Bacteria 1575
851 Ga0373925_0037063 3300037068 Bacteria 3598
852 Ga0373925_0132914 3300037068 Bacteria 1942
853 Ga0395899_0002534 3300037312 Bacteria 14800
854 Ga0395899_0003213 3300037312 Bacteria 12958
855 Ga0395899_0007467 3300037312 Bacteria 8444
856 Ga0395899_0014422 3300037312 Bacteria 6033
857 Ga0395899_0037790 3300037312 Bacteria 3618
858 Ga0395899_0042680 3300037312 Bacteria 3385
859 Ga0395899_0089125 3300037312 Bacteria 2238
860 Ga0395899_0100216 3300037312 Bacteria 2092
861 Ga0395899_0118909 3300037312 Bacteria 1895
862 Ga0395899_0188370 3300037312 Bacteria 1445
863 Ga0395899_0432691 3300037312 Bacteria 865
864 Ga0395899_0456122 3300037312 Bacteria 836
865 Ga0395900_0003108 3300037418 Bacteria 18026
866 Ga0395900_0004199 3300037418 Bacteria 15285
867 Ga0395900_0011417 3300037418 Bacteria 9091
868 Ga0395900_0036662 3300037418 Bacteria 5055
869 Ga0395900_0038196 3300037418 Bacteria 4950
870 Ga0395900_0093859 3300037418 Bacteria 3082
871 Ga0395900_0109835 3300037418 Bacteria 2833
872 Ga0395900_0130827 3300037418 Bacteria 2572
873 Ga0395900_0139602 3300037418 Bacteria 2482
874 Ga0395900_0177119 3300037418 Bacteria 2168
875 Ga0395900_0207979 3300037418 Bacteria 1977
876 Ga0395900_0277163 3300037418 Bacteria 1670
877 Ga0395900_0319289 3300037418 Bacteria 1534
878 Ga0395900_0425658 3300037418 Bacteria 1288
879 Ga0395900_0737116 3300037418 Bacteria 916
880 Ga0395900_0913130 3300037418 Bacteria 801
881 Ga0395900_1135164 3300037418 Bacteria 698
882 Ga0395898_0002003 3300037466 Bacteria 25556
883 Ga0395898_0002942 3300037466 Bacteria 19375
884 Ga0395898_0004139 3300037466 Bacteria 15908
885 Ga0395898_0024764 3300037466 Bacteria 6051
886 Ga0395898_0048454 3300037466 Bacteria 4166
887 Ga0395898_0075456 3300037466 Bacteria 3257
888 Ga0395898_0122096 3300037466 Bacteria 2496
889 Ga0395898_0188871 3300037466 Bacteria 1969
890 Ga0395898_0233447 3300037466 Bacteria 1754
891 Ga0395898_0249371 3300037466 Bacteria 1693
892 Ga0395898_0349709 3300037466 Bacteria 1409
893 Ga0395898_0391041 3300037466 Bacteria 1326
894 Ga0395898_0418927 3300037466 Bacteria 1276
895 Ga0395898_0435357 3300037466 Bacteria 1249
896 Ga0395898_0437020 3300037466 Bacteria 1247
897 Ga0395898_0444326 3300037466 Bacteria 1235
898 Ga0395898_0692861 3300037466 Bacteria 961
899 Ga0395898_0706291 3300037466 Bacteria 950
900 Ga0395898_0818406 3300037466 Bacteria 871
901 Ga0395898_1066842 3300037466 Bacteria 742
902 Ga0395898_1284158 3300037466 Bacteria 662
903 Ga0395905_0000960 3300037471 Bacteria 37034
904 Ga0395905_0001321 3300037471 Bacteria 30316
905 Ga0395905_0007613 3300037471 Bacteria 10753
906 Ga0395905_0007644 3300037471 Bacteria 10728
907 Ga0395905_0010323 3300037471 Bacteria 9088
908 Ga0395905_0098067 3300037471 Bacteria 2752
909 Ga0395905_0118194 3300037471 Bacteria 2492
910 Ga0395905_0233244 3300037471 Bacteria 1721
911 Ga0395905_0282842 3300037471 Bacteria 1545
912 Ga0395905_0365069 3300037471 Bacteria 1337
913 Ga0395905_0451728 3300037471 Bacteria 1183
914 Ga0395905_0492925 3300037471 Bacteria 1125
915 Ga0395905_0571024 3300037471 Bacteria 1032
916 Ga0395901_0003508 3300038443 Bacteria 15802
917 Ga0395901_0008538 3300038443 Bacteria 10350
918 Ga0395901_0018292 3300038443 Bacteria 7154
919 Ga0395901_0018862 3300038443 Bacteria 7051
920 Ga0395901_0025878 3300038443 Bacteria 6026
921 Ga0395901_0045428 3300038443 Bacteria 4558
922 Ga0395901_0082095 3300038443 Bacteria 3367
923 Ga0395901_0143043 3300038443 Bacteria 2514
924 Ga0395901_0162688 3300038443 Bacteria 2344
925 Ga0395901_0220964 3300038443 Unclassified 1980
926 Ga0395901_0230608 3300038443 Bacteria 1933
927 Ga0395901_0237361 3300038443 Bacteria 1902
928 Ga0395901_0266311 3300038443 Bacteria 1783
929 Ga0395901_0368797 3300038443 Bacteria 1479
930 Ga0395901_0382849 3300038443 Bacteria 1447
931 Ga0395901_0482314 3300038443 Bacteria 1264
932 Ga0395901_0496573 3300038443 Bacteria 1243
933 Ga0395901_0508705 3300038443 Bacteria 1225
934 Ga0395901_0517224 3300038443 Bacteria 1213
935 Ga0395901_0639407 3300038443 Bacteria 1068
936 Ga0395901_0999216 3300038443 Unclassified 813
937 Ga0395901_1054848 3300038443 Bacteria 785
938 Ga0395901_1158285 3300038443 Bacteria 741
939 Ga0436363_1249881 3300039450 Unclassified 887
940 Ga0451835_1049948 3300041492 Bacteria 544
941 Ga0451855_1429443 3300041511 Bacteria 805
942 Ga0451853_1424996 3300041512 Bacteria 2704
943 Ga0451853_2062307 3300041512 Unclassified 896
944 Ga0439463_094204 3300042016 Unclassified 771
945 Ga0450915_000047 3300042119 Bacteria 2322
946 Ga0451577_0189172 3300042876 Bacteria 1857
947 Ga0451577_1017293 3300042876 Bacteria 744
948 Ga0439440_0050016 3300042993 Bacteria 1042
949 Ga0439440_0132378 3300042993 Unclassified 702
950 Ga0466969_0026994 3300044656 Bacteria 2942
951 Ga0466972_0158720 3300044658 Bacteria 1063
952 Ga0466972_0236415 3300044658 Bacteria 855
953 Ga0466965_0274609 3300044683 Bacteria 909
954 Ga0466965_0504426 3300044683 Bacteria 679
955 Ga0466966_0001610 3300044684 Bacteria 14537
956 Ga0466961_0231645 3300044693 Bacteria 1136
957 Ga0466963_0002415 3300044694 Bacteria 10451
958 Ga0466963_0003590 3300044694 Bacteria 8917
959 Ga0466963_0029254 3300044694 Bacteria 3544
960 Ga0466963_0036255 3300044694 Bacteria 3215
961 Ga0466963_0124507 3300044694 Bacteria 1776
962 Ga0466963_0188387 3300044694 Bacteria 1441
963 Ga0466963_0845998 3300044694 Bacteria 645
964 Ga0466964_0058243 3300044706 Bacteria 1601
965 Ga0466964_0209689 3300044706 Unclassified 940
966 Ga0466964_0317276 3300044706 Bacteria 791
967 Ga0466971_0024920 3300044719 Bacteria 2671
968 Ga0466968_0036487 3300044735 Bacteria 2061
969 Ga0466957_0254250 3300044842 Bacteria 1169
970 Ga0466957_0257397 3300044842 Bacteria 1162
971 Ga0466957_0375257 3300044842 Bacteria 969
972 Ga0466959_0012465 3300045049 Bacteria 6143
973 Ga0466959_0013332 3300045049 Bacteria 5957
974 Ga0466959_0464064 3300045049 Bacteria 858
975 Ga0451576_0061634 3300045051 Bacteria 3911
976 Ga0451576_0203451 3300045051 Bacteria 2068
977 Ga0451576_1131079 3300045051 Bacteria 819
978 Ga0466958_0015520 3300045836 Bacteria 4366
979 Ga0466958_0031868 3300045836 Bacteria 3133
980 Ga0466958_0069160 3300045836 Bacteria 2159
981 Ga0466958_0245650 3300045836 Bacteria 1144
982 Ga0466967_0000086 3300045976 Bacteria 34116
983 Ga0466967_0018967 3300045976 Bacteria 5518
984 Ga0466967_0048869 3300045976 Bacteria 3697
985 Ga0466967_0050867 3300045976 Bacteria 3629
986 Ga0466967_0068710 3300045976 Bacteria 3164
987 Ga0466967_0078386 3300045976 Bacteria 2976
988 Ga0466967_0102976 3300045976 Bacteria 2612
989 Ga0466967_0182085 3300045976 Bacteria 1982
990 Ga0466967_0194467 3300045976 Bacteria 1918
991 Ga0466967_0198837 3300045976 Bacteria 1897
992 Ga0466967_0243480 3300045976 Bacteria 1716
993 Ga0466967_0320172 3300045976 Bacteria 1495
994 Ga0466967_0370756 3300045976 Bacteria 1388
995 Ga0466967_0388945 3300045976 Bacteria 1355
996 Ga0466967_0427196 3300045976 Bacteria 1292
997 Ga0466967_0470619 3300045976 Bacteria 1230
998 Ga0466967_0793379 3300045976 Bacteria 940
999 Ga0466967_1179105 3300045976 Bacteria 763
1000 Ga0495592_0122065 3300046454 Bacteria 1831
1001 Ga0495592_0199585 3300046454 Bacteria 1351
1002 Ga0495603_0026884 3300046455 Bacteria 3475
1003 Ga0495603_0028368 3300046455 Bacteria 3376
1004 Ga0495603_0036835 3300046455 Bacteria 2936
1005 Ga0495603_0080457 3300046455 Bacteria 1909
1006 Ga0495591_022963 3300046458 Bacteria 2008
1007 Ga0495591_131925 3300046458 Bacteria 606
1008 Ga0495629_0010449 3300046459 Bacteria 6753
1009 Ga0495629_0078151 3300046459 Bacteria 2310
1010 Ga0495629_0168066 3300046459 Bacteria 1523
1011 Ga0495629_0480321 3300046459 Bacteria 839
1012 Ga0495641_0020256 3300046461 Bacteria 3377
1013 Ga0495641_0024645 3300046461 Bacteria 2966
1014 Ga0495641_0281457 3300046461 Unclassified 749
1015 Ga0495653_0054781 3300046463 Bacteria 3046
1016 Ga0495653_0074790 3300046463 Bacteria 2523
1017 Ga0495653_0096120 3300046463 Bacteria 2154
1018 Ga0495580_0013292 3300046472 Bacteria 6289
1019 Ga0495582_0033590 3300046473 Bacteria 2820
1020 Ga0495582_0045404 3300046473 Bacteria 2419
1021 Ga0495582_0052700 3300046473 Bacteria 2243
1022 Ga0495582_0073683 3300046473 Bacteria 1890
1023 Ga0495582_0088683 3300046473 Bacteria 1723
1024 Ga0495582_0130543 3300046473 Unclassified 1420
1025 Ga0495582_0169841 3300046473 Bacteria 1241
1026 Ga0495605_0032432 3300046474 Bacteria 2659
1027 Ga0495605_0060561 3300046474 Bacteria 1814
1028 Ga0495605_0234245 3300046474 Bacteria 790
1029 Ga0495605_0270493 3300046474 Bacteria 724
1030 Ga0495639_0003552 3300046475 Bacteria 6731
1031 Ga0495639_0054652 3300046475 Bacteria 1820
1032 Ga0495662_0002055 3300046476 Bacteria 10095
1033 Ga0495662_0218786 3300046476 Bacteria 938
1034 Ga0495584_0072754 3300046491 Bacteria 1727
1035 Ga0495585_0163484 3300046492 Unclassified 1154
1036 Ga0495594_0003495 3300046499 Bacteria 8093
1037 Ga0495594_0018912 3300046499 Bacteria 3656
1038 Ga0495594_0049017 3300046499 Bacteria 2321
1039 Ga0495594_0218653 3300046499 Bacteria 1086
1040 Ga0495596_0038534 3300046500 Bacteria 1889
1041 Ga0495596_0099177 3300046500 Bacteria 1131
1042 Ga0495607_0240612 3300046501 Unclassified 876
1043 Ga0495608_0013337 3300046511 Bacteria 5701
1044 Ga0495608_0027170 3300046511 Bacteria 3895
1045 Ga0495608_0112900 3300046511 Bacteria 1746
1046 Ga0495608_0379057 3300046511 Bacteria 867
1047 Ga0495616_0246467 3300046513 Bacteria 769
1048 Ga0495618_0057495 3300046514 Bacteria 2463
1049 Ga0495618_0401390 3300046514 Bacteria 838
1050 Ga0495630_0132192 3300046517 Bacteria 1895
1051 Ga0495630_0273371 3300046517 Bacteria 1291
1052 Ga0495630_0332115 3300046517 Bacteria 1163
1053 Ga0495630_1039954 3300046517 Unclassified 622
1054 Ga0495631_0061138 3300046518 Bacteria 1634
1055 Ga0495631_0298010 3300046518 Bacteria 686
1056 Ga0495632_0152748 3300046519 Bacteria 1067
1057 Ga0495637_0027020 3300046520 Bacteria 2571
1058 Ga0495644_0064966 3300046523 Bacteria 1371
1059 Ga0495663_0037106 3300046525 Unclassified 1469
1060 Ga0495666_0007148 3300046526 Bacteria 5609
1061 Ga0495642_0118157 3300046528 Bacteria 1137
1062 Ga0495652_0108724 3300046529 Bacteria 2234
1063 Ga0495652_0518399 3300046529 Bacteria 824
1064 Ga0495665_0007412 3300046531 Bacteria 5931
1065 Ga0495665_0062568 3300046531 Bacteria 1965
1066 Ga0495640_0132444 3300046533 Bacteria 1612
1067 Ga0495640_0419325 3300046533 Unclassified 820
1068 Ga0495586_0033426 3300046535 Bacteria 2760
1069 Ga0495586_0066898 3300046535 Bacteria 1959
1070 Ga0495586_0082234 3300046535 Bacteria 1771
1071 Ga0495587_0041550 3300046536 Bacteria 2743
1072 Ga0495587_0282994 3300046536 Unclassified 929
1073 Ga0495598_0122860 3300046537 Bacteria 882
1074 Ga0495609_0032353 3300046538 Bacteria 2376
1075 Ga0495609_0392187 3300046538 Unclassified 556
1076 Ga0495597_0188579 3300046542 Bacteria 830
1077 Ga0495645_0125235 3300046543 Bacteria 1806
1078 Ga0495667_0015394 3300046559 Bacteria 5166
1079 Ga0495667_0201710 3300046559 Bacteria 1273
1080 Ga0495667_0219690 3300046559 Bacteria 1213
1081 Ga0495667_0981557 3300046559 Bacteria 516
1082 Ga0495656_0023739 3300046615 Bacteria 2416
1083 Ga0495668_0091391 3300046616 Bacteria 1668
1084 Ga0495668_0116952 3300046616 Bacteria 1458
1085 Ga0495634_0026676 3300046642 Bacteria 4030
1086 Ga0495634_0030280 3300046642 Bacteria 3739
1087 Ga0495634_0042072 3300046642 Bacteria 3101
1088 Ga0495634_0089487 3300046642 Bacteria 2001
1089 Ga0495635_0027661 3300046663 Bacteria 3943
1090 Ga0495659_0074257 3300046664 Bacteria 1279
1091 Ga0495588_0068881 3300046674 Bacteria 1838
1092 Ga0495588_0108297 3300046674 Bacteria 1463
1093 Ga0495588_0160562 3300046674 Bacteria 1189
1094 Ga0495588_0161041 3300046674 Unclassified 1187
1095 Ga0495657_0040642 3300046675 Bacteria 3188
1096 Ga0495657_0041059 3300046675 Bacteria 3168
1097 Ga0495657_0087186 3300046675 Bacteria 2009
1098 Ga0495599_0121640 3300046678 Bacteria 1622
1099 Ga0495623_0024714 3300046679 Bacteria 3868
1100 Ga0495623_0145691 3300046679 Bacteria 1405
1101 Ga0495646_0063399 3300046680 Bacteria 2194
1102 Ga0495647_0006599 3300046681 Bacteria 3850
1103 Ga0495647_0034491 3300046681 Bacteria 1895
1104 Ga0495647_0199443 3300046681 Bacteria 877
1105 Ga0495658_0031612 3300046683 Bacteria 2884
1106 Ga0495658_0035298 3300046683 Bacteria 2750
1107 Ga0495658_0422604 3300046683 Bacteria 850
1108 Ga0495658_0946167 3300046683 Bacteria 550
1109 Ga0495669_0081982 3300046684 Bacteria 1481
1110 Ga0495613_0032094 3300046689 Bacteria 3901
1111 Ga0495613_0086476 3300046689 Bacteria 2273
1112 Ga0495613_0222616 3300046689 Bacteria 1324
1113 Ga0495613_0227682 3300046689 Bacteria 1307
1114 Ga0495613_0256006 3300046689 Bacteria 1220
1115 Ga0495613_0299046 3300046689 Bacteria 1114
1116 Ga0495624_0021415 3300046690 Bacteria 4287
1117 Ga0495670_0133263 3300046691 Bacteria 1296
1118 Ga0495671_0032432 3300046692 Bacteria 2667
1119 Ga0495589_0023756 3300046794 Bacteria 3121
1120 Ga0495589_0103324 3300046794 Bacteria 1378
1121 Ga0495589_0273183 3300046794 Bacteria 787
1122 Ga0495600_0020664 3300046809 Bacteria 4210
1123 Ga0495660_0073146 3300046810 Bacteria 1814
1124 Ga0495581_0005520 3300047315 Bacteria 7324
1125 Ga0495581_0008376 3300047315 Bacteria 5993
1126 Ga0495581_0008581 3300047315 Bacteria 5919
1127 Ga0495581_0009533 3300047315 Bacteria 5618
1128 Ga0495581_0466876 3300047315 Bacteria 735
1129 Ga0495604_0077797 3300047317 Bacteria 2491
1130 Ga0495674_0200167 3300047319 Bacteria 1657
1131 Ga0495674_0227941 3300047319 Bacteria 1538
1132 Ga0495674_0458869 3300047319 Bacteria 1023
1133 Ga0495676_0024547 3300047321 Bacteria 5215
1134 Ga0495676_0062485 3300047321 Bacteria 2907
1135 Ga0495676_0096031 3300047321 Bacteria 2204
1136 Ga0495676_0376314 3300047321 Bacteria 945
1137 Ga0495680_0021619 3300047322 Bacteria 5382
1138 Ga0495680_0027337 3300047322 Bacteria 4689
1139 Ga0495680_0149911 3300047322 Bacteria 1701
1140 Ga0495680_0596748 3300047322 Bacteria 739
1141 Ga0495683_0332604 3300047323 Unclassified 645
1142 Ga0495675_0091901 3300047444 Bacteria 1904
1143 Ga0495677_0074525 3300047445 Bacteria 1267
1144 Ga0495681_0217030 3300047470 Bacteria 769
1145 Ga0495684_0007177 3300047471 Bacteria 8650
1146 Ga0495684_0017745 3300047471 Bacteria 5481
1147 Ga0495684_0220784 3300047471 Bacteria 1390
1148 Ga0495593_0003587 3300047673 Bacteria 9272
1149 Ga0495593_0143805 3300047673 Bacteria 1208
1150 Ga0495602_0048531 3300048088 Bacteria 3814
1151 Ga0495602_0142008 3300048088 Bacteria 1900
1152 Ga0495602_0310260 3300048088 Bacteria 1151
1153 Ga0495602_0865708 3300048088 Bacteria 603
1154 Ga0495614_0005804 3300048089 Bacteria 5561
1155 Ga0495615_0129367 3300048090 Bacteria 737
1156 Ga0495626_0119287 3300048091 Bacteria 1136
1157 Ga0496100_0011597 3300048903 Bacteria 5021
1158 Ga0496100_0018401 3300048903 Bacteria 4143
1159 Ga0496100_0048646 3300048903 Bacteria 2738
1160 Ga0496100_0086761 3300048903 Bacteria 2126
1161 Ga0496100_0148420 3300048903 Bacteria 1669
1162 Ga0496100_0230211 3300048903 Bacteria 1363
1163 Ga0496100_0418492 3300048903 Bacteria 1023
1164 Ga0496101_0002160 3300048904 Bacteria 12014
1165 Ga0496101_0012292 3300048904 Bacteria 5710
1166 Ga0496101_0125417 3300048904 Bacteria 1945
1167 Ga0496101_0132915 3300048904 Bacteria 1891
1168 Ga0496101_0140291 3300048904 Bacteria 1841
1169 Ga0496101_0352776 3300048904 Bacteria 1156
1170 Ga0496102_0036684 3300048905 Bacteria 4417
1171 Ga0496102_0038900 3300048905 Bacteria 4295
1172 Ga0496102_0063510 3300048905 Bacteria 3381
1173 Ga0496102_0187495 3300048905 Bacteria 1949
1174 Ga0496102_0188109 3300048905 Bacteria 1946
1175 Ga0496102_0301658 3300048905 Bacteria 1510
1176 Ga0496102_0521426 3300048905 Bacteria 1111
1177 Ga0496102_0855650 3300048905 Bacteria 831
1178 Ga0496103_0019370 3300048906 Bacteria 4086
1179 Ga0496103_0034564 3300048906 Bacteria 3091
1180 Ga0496103_0194402 3300048906 Bacteria 1304
1181 Ga0496103_0221215 3300048906 Bacteria 1218
1182 Ga0496104_0017796 3300048907 Bacteria 6480
1183 Ga0496104_0068082 3300048907 Bacteria 3383
1184 Ga0496104_0226599 3300048907 Bacteria 1781
1185 Ga0496104_0313161 3300048907 Bacteria 1482
1186 Ga0496104_0638886 3300048907 Bacteria 973
1187 Ga0496105_0009243 3300048908 Bacteria 7699
1188 Ga0496105_0048430 3300048908 Bacteria 3508
1189 Ga0496105_0112015 3300048908 Bacteria 2252
1190 Ga0496105_0221595 3300048908 Bacteria 1540
1191 Ga0496105_0221843 3300048908 Bacteria 1539
1192 Ga0496105_0440424 3300048908 Bacteria 1030
1193 Ga0496105_0812596 3300048908 Bacteria 710
1194 Ga0496105_0889813 3300048908 Bacteria 672
1195 Ga0496106_0008805 3300048909 Bacteria 7457
1196 Ga0496106_0015307 3300048909 Bacteria 5674
1197 Ga0496106_0016560 3300048909 Bacteria 5454
1198 Ga0496106_0018353 3300048909 Bacteria 5170
1199 Ga0496106_0061625 3300048909 Bacteria 2846
1200 Ga0496106_0065555 3300048909 Bacteria 2765
1201 Ga0496106_0174851 3300048909 Bacteria 1703
1202 Ga0496106_0270862 3300048909 Bacteria 1359
1203 Ga0496106_0294001 3300048909 Bacteria 1302
1204 Ga0496106_0371601 3300048909 Bacteria 1149
1205 Ga0496107_0012150 3300048910 Bacteria 6006
1206 Ga0496107_0019766 3300048910 Bacteria 4754
1207 Ga0496107_0067714 3300048910 Bacteria 2591
1208 Ga0496107_0093550 3300048910 Bacteria 2198
1209 Ga0496107_0147562 3300048910 Bacteria 1739
1210 Ga0496107_0162072 3300048910 Bacteria 1657
1211 Ga0496107_0327494 3300048910 Bacteria 1140
1212 Ga0496107_0408488 3300048910 Bacteria 1010
1213 Ga0496107_0503290 3300048910 Bacteria 898
1214 Ga0496108_0006053 3300048911 Bacteria 9791
1215 Ga0496108_0007049 3300048911 Bacteria 9098
1216 Ga0496108_0008016 3300048911 Bacteria 8571
1217 Ga0496108_0015690 3300048911 Bacteria 6179
1218 Ga0496108_0080088 3300048911 Bacteria 2766
1219 Ga0496108_0211620 3300048911 Bacteria 1683
1220 Ga0496108_0400650 3300048911 Bacteria 1198
1221 Ga0496108_0530187 3300048911 Bacteria 1028
1222 Ga0496108_1226014 3300048911 Unclassified 633
1223 Ga0496109_0002666 3300048912 Bacteria 14979
1224 Ga0496109_0018917 3300048912 Bacteria 6064
1225 Ga0496109_0035566 3300048912 Bacteria 4494
1226 Ga0496109_0044089 3300048912 Bacteria 4045
1227 Ga0496109_0044177 3300048912 Bacteria 4041
1228 Ga0496109_0120278 3300048912 Bacteria 2446
1229 Ga0496109_0209778 3300048912 Bacteria 1832
1230 Ga0496109_0234880 3300048912 Bacteria 1725
1231 Ga0496109_0281433 3300048912 Bacteria 1567
1232 Ga0496109_0288291 3300048912 Bacteria 1547
1233 Ga0496109_0701614 3300048912 Bacteria 949
1234 Ga0496110_0019386 3300048913 Bacteria 5723
1235 Ga0496110_0042015 3300048913 Bacteria 3990
1236 Ga0496110_0044771 3300048913 Bacteria 3866
1237 Ga0496110_0047937 3300048913 Bacteria 3743
1238 Ga0496110_0174766 3300048913 Bacteria 1949
1239 Ga0496110_0220344 3300048913 Bacteria 1725
1240 Ga0496110_0987586 3300048913 Bacteria 749
1241 Ga0496110_1444920 3300048913 Unclassified 597
1242 Ga0496110_1761878 3300048913 Bacteria 529
1243 Ga0496111_0008675 3300048914 Bacteria 6742
1244 Ga0496111_0014750 3300048914 Bacteria 5347
1245 Ga0496111_0048567 3300048914 Bacteria 3057
1246 Ga0496111_0055309 3300048914 Bacteria 2870
1247 Ga0496111_0257244 3300048914 Bacteria 1295
1248 Ga0496111_0393917 3300048914 Bacteria 1024
1249 Ga0496111_0424970 3300048914 Unclassified 981
1250 Ga0496112_0003370 3300048915 Bacteria 13194
1251 Ga0496112_0020478 3300048915 Bacteria 6272
1252 Ga0496112_0048093 3300048915 Bacteria 4183
1253 Ga0496112_0057209 3300048915 Bacteria 3839
1254 Ga0496112_0063401 3300048915 Bacteria 3645
1255 Ga0496112_0084263 3300048915 Bacteria 3144
1256 Ga0496112_0086555 3300048915 Bacteria 3100
1257 Ga0496112_0090643 3300048915 Bacteria 3026
1258 Ga0496112_0150996 3300048915 Bacteria 2290
1259 Ga0496112_0177279 3300048915 Bacteria 2096
1260 Ga0496112_0216595 3300048915 Bacteria 1871
1261 Ga0496112_0279582 3300048915 Bacteria 1616
1262 Ga0496112_0326854 3300048915 Bacteria 1477
1263 Ga0496112_0533215 3300048915 Bacteria 1108
1264 Ga0496112_1010542 3300048915 Unclassified 751
1265 Ga0496113_0003046 3300048916 Bacteria 9929
1266 Ga0496113_0012139 3300048916 Bacteria 5780
1267 Ga0496113_0036377 3300048916 Bacteria 3607
1268 Ga0496113_0080717 3300048916 Bacteria 2492
1269 Ga0496113_0141221 3300048916 Bacteria 1895
1270 Ga0496113_0195794 3300048916 Bacteria 1605
1271 Ga0496113_0293003 3300048916 Bacteria 1302
1272 Ga0496113_0326221 3300048916 Bacteria 1231
1273 Ga0496113_0429029 3300048916 Bacteria 1062
1274 Ga0496113_0690307 3300048916 Bacteria 815
1275 Ga0496113_1162616 3300048916 Unclassified 604
1276 Ga0496114_0043825 3300048917 Bacteria 3710
1277 Ga0496114_0047329 3300048917 Bacteria 3577
1278 Ga0496114_0144090 3300048917 Bacteria 2064
1279 Ga0496114_0359036 3300048917 Unclassified 1289
1280 Ga0496114_0678764 3300048917 Bacteria 904
1281 Ga0496115_0003373 3300048918 Bacteria 11460
1282 Ga0496115_0027654 3300048918 Bacteria 4438
1283 Ga0496115_0041287 3300048918 Bacteria 3670
1284 Ga0496115_0119413 3300048918 Bacteria 2169
1285 Ga0496115_0389753 3300048918 Bacteria 1131
1286 Ga0496115_0729668 3300048918 Bacteria 776
1287 Ga0501031_0011482 3300049568 Bacteria 5772
1288 Ga0501031_0340991 3300049568 Bacteria 970
1289 Ga0501032_0218771 3300049569 Bacteria 1240
1290 Ga0501033_0002618 3300049570 Bacteria 15153
1291 Ga0501034_0193712 3300049571 Bacteria 1994
1292 Ga0501036_0002190 3300049572 Bacteria 15260
1293 Ga0501036_0923808 3300049572 Unclassified 716
1294 Ga0501037_0010609 3300049573 Bacteria 6768
1295 Ga0501038_0048464 3300049574 Bacteria 3676
1296 Ga0501038_0439688 3300049574 Bacteria 1004
1297 Ga0501039_0001316 3300049575 Bacteria 18165
1298 Ga0501040_0002822 3300049576 Bacteria 11209
1299 Ga0501041_0001149 3300049577 Bacteria 14484
1300 Ga0501042_0000525 3300049578 Bacteria 19981
1301 Ga0501042_0129042 3300049578 Bacteria 1822
1302 Ga0501043_0004620 3300049579 Bacteria 11164
1303 Ga0501046_0003002 3300049580 Bacteria 15603
1304 Ga0501046_0290980 3300049580 Bacteria 1195
1305 Ga0501047_0074417 3300049581 Bacteria 3270
1306 Ga0501047_0270011 3300049581 Bacteria 1547
1307 Ga0501048_0001463 3300049582 Bacteria 17915
1308 Ga0501067_0009408 3300049583 Bacteria 5414
1309 Ga0501067_0052561 3300049583 Bacteria 2257
1310 Ga0501067_0419748 3300049583 Bacteria 746
1311 Ga0501068_0000081 3300049584 Bacteria 39342
1312 Ga0501068_0004349 3300049584 Bacteria 7699
1313 Ga0501068_0028035 3300049584 Bacteria 3328
1314 Ga0501069_0001757 3300049585 Bacteria 10814
1315 Ga0501069_0010998 3300049585 Bacteria 4800
1316 Ga0501069_0011496 3300049585 Bacteria 4690
1317 Ga0501069_0489424 3300049585 Bacteria 733
1318 Ga0501070_0005623 3300049586 Bacteria 10690
1319 Ga0501070_0008716 3300049586 Bacteria 8576
1320 Ga0501070_0025860 3300049586 Bacteria 4924
1321 Ga0501070_0346762 3300049586 Bacteria 1206
1322 Ga0501071_0074908 3300049587 Bacteria 2470
1323 Ga0501071_0104017 3300049587 Bacteria 2095
1324 Ga0501071_0211570 3300049587 Bacteria 1458
1325 Ga0501072_0004413 3300049588 Bacteria 10685
1326 Ga0501072_0466412 3300049588 Bacteria 1000
1327 Ga0501072_1024817 3300049588 Unclassified 643
1328 Ga0501073_0041522 3300049589 Bacteria 3250
1329 Ga0501073_0480297 3300049589 Bacteria 859
1330 Ga0501074_0006341 3300049590 Bacteria 8544
1331 Ga0501074_0053264 3300049590 Bacteria 2919
1332 Ga0501074_0282302 3300049590 Bacteria 1180
1333 Ga0501075_0011067 3300049591 Bacteria 6367
1334 Ga0501076_0002474 3300049592 Bacteria 12696
1335 Ga0501076_0716800 3300049592 Bacteria 826
1336 Ga0501076_0726574 3300049592 Bacteria 820
1337 Ga0501077_0002841 3300049593 Bacteria 10384
1338 Ga0501079_0004723 3300049741 Bacteria 10087
1339 Ga0501079_0172134 3300049741 Bacteria 1688
1340 Ga0501079_0539005 3300049741 Bacteria 918
1341 Ga0501079_0820642 3300049741 Bacteria 732
1342 Ga0501080_0002379 3300049742 Bacteria 16405
1343 Ga0501080_0266540 3300049742 Bacteria 1559
1344 Ga0501080_0301008 3300049742 Bacteria 1454
1345 Ga0501080_0738379 3300049742 Bacteria 866
1346 Ga0501080_0757355 3300049742 Bacteria 854
1347 Ga0501081_0004968 3300049743 Bacteria 8560
1348 Ga0501081_0274137 3300049743 Bacteria 1234
1349 Ga0501081_0311129 3300049743 Bacteria 1157
1350 Ga0501083_0001009 3300049744 Bacteria 18749
1351 Ga0501035_0011163 3300049822 Bacteria 8317
1352 Ga0501044_0059674 3300049823 Bacteria 3908
1353 Ga0501044_0091308 3300049823 Bacteria 3072
1354 Ga0501044_0571169 3300049823 Bacteria 1026
1355 Ga0501045_0004283 3300049824 Bacteria 9838
1356 Ga0501045_0068634 3300049824 Bacteria 2605
1357 Ga0501045_0348905 3300049824 Bacteria 1102
1358 nmdc:mga03683_19224_c1 3300050489 Bacteria 2606
1359 nmdc:mga00v17_12753_c1 3300050491 Bacteria 4643
1360 nmdc:mga0yw44_13192_c1 3300050492 Bacteria 4341
1361 nmdc:mga0yw44_136359_c1 3300050492 Bacteria 1592
1362 nmdc:mga0yw44_468218_c1 3300050492 Unclassified 854
1363 nmdc:mga06z11_490434_c1 3300050494 Bacteria 744
1364 nmdc:mga05p37_135308_c1 3300050507 Bacteria 3023
1365 nmdc:mga05p37_145331_c1 3300050507 Bacteria 2904
1366 nmdc:mga05p37_1484394_c1 3300050507 Unclassified 676
1367 nmdc:mga05p37_290299_c1 3300050507 Bacteria 1947
1368 nmdc:mga05p37_31594_c1 3300050507 Bacteria 6468
1369 nmdc:mga05p37_41768_c1 3300050507 Bacteria 5631
1370 nmdc:mga05p37_655507_c1 3300050507 Bacteria 1175
1371 nmdc:mga05p37_8229_c1 3300050507 Bacteria 12334
1372 nmdc:mga09592_1023671_c1 3300050508 Bacteria 689
1373 nmdc:mga09592_263752_c1 3300050508 Bacteria 1494
1374 nmdc:mga09592_5244_c1 3300050508 Bacteria 10529
1375 nmdc:mga0qj67_204768_c1 3300050509 Bacteria 1603
1376 nmdc:mga0qj67_22569_c1 3300050509 Bacteria 4834
1377 nmdc:mga06r32_170195_c1 3300050510 Bacteria 2162
1378 nmdc:mga06r32_23196_c1 3300050510 Bacteria 5740
1379 nmdc:mga08y16_1209559_c1 3300050511 Bacteria 726
1380 nmdc:mga08y16_130261_c1 3300050511 Bacteria 2617
1381 nmdc:mga08y16_426995_c1 3300050511 Unclassified 1354
1382 nmdc:mga08y16_809306_c1 3300050511 Bacteria 929
1383 nmdc:mga08y16_87398_c1 3300050511 Bacteria 3248
1384 nmdc:mga0n895_14594_c1 3300050512 Bacteria 7141
1385 nmdc:mga0n895_30167_c1 3300050512 Bacteria 5179
1386 nmdc:mga0n895_432002_c1 3300050512 Bacteria 1331
1387 nmdc:mga0n895_438850_c1 3300050512 Bacteria 1319
1388 nmdc:mga0n895_97761_c1 3300050512 Bacteria 2942
1389 nmdc:mga0rr50_137768_c1 3300050513 Bacteria 1961
1390 nmdc:mga0rr50_1458445_c1 3300050513 Bacteria 579
1391 nmdc:mga0rr50_1712534_c1 3300050513 Bacteria 530
1392 nmdc:mga0rr50_2115_c1 3300050513 Bacteria 11099
1393 nmdc:mga0rr50_24439_c1 3300050513 Bacteria 4185
1394 nmdc:mga0rr50_294893_c1 3300050513 Bacteria 1356
1395 nmdc:mga08x19_12265_c1 3300050514 Bacteria 5159
1396 nmdc:mga08x19_20999_c1 3300050514 Bacteria 4028
1397 nmdc:mga08x19_259231_c1 3300050514 Bacteria 1202
1398 nmdc:mga0a205_112192_c1 3300050515 Bacteria 2626
1399 nmdc:mga0a205_158356_c1 3300050515 Bacteria 2162
1400 nmdc:mga0a205_17014_c1 3300050515 Bacteria 6807
1401 nmdc:mga0a205_422922_c1 3300050515 Unclassified 1194
1402 nmdc:mga0a205_456057_c1 3300050515 Bacteria 1138
1403 nmdc:mga0a205_541128_c1 3300050515 Bacteria 1020
1404 nmdc:mga0a205_751018_c1 3300050515 Bacteria 824
1405 nmdc:mga0a205_929767_c1 3300050515 Bacteria 716
1406 Ga0495601_0241739 3300053077 Bacteria 1179
1407 Ga0495601_0257126 3300053077 Unclassified 1140
1408 Ga0495595_0098722 3300053084 Bacteria 1407
1409 Ga0495595_0289677 3300053084 Bacteria 823
1410 Ga0495595_0610745 3300053084 Bacteria 558
1411 Ga0495619_0119469 3300053085 Bacteria 1806
1412 Ga0495619_0157727 3300053085 Bacteria 1566
1413 Ga0501084_0017257 3300054114 Bacteria 5996
1414 Ga0501084_0102877 3300054114 Bacteria 2399
1415 Ga0501084_0128161 3300054114 Bacteria 2136
1416 Ga0501082_0039678 3300060353 Bacteria 4061
1417 Ga0501082_0846214 3300060353 Bacteria 800
1418 Ga0501082_1052037 3300060353 Bacteria 712
1419 Ga0501082_1367385 3300060353 Bacteria 619
1420 Ga0466962_0003630 3300061719 Bacteria 7359
1421 Ga0466962_0229038 3300061719 Bacteria 911
1422 Ga0466962_0367801 3300061719 Bacteria 717
1423 Ga0466962_0384284 3300061719 Bacteria 702
1424 Ga0530510_0014539 3300061734 Bacteria 5553
1425 Ga0530510_0167942 3300061734 Bacteria 1625
1426 Ga0530510_0262845 3300061734 Unclassified 1287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10184280 Ga0207665_101842802 122
2 3300046463 Ga0495653_0096120 Ga0495653_0096120_25_438 128
3 3300006051 Ga0075364_10043764 Ga0075364_100437643 133
4 3300006058 Ga0075432_10044548 Ga0075432_100445483 133
5 3300006844 Ga0075428_100326174 Ga0075428_1003261742 133
6 3300006846 Ga0075430_100102558 Ga0075430_1001025582 133
7 3300006880 Ga0075429_100007369 Ga0075429_1000073697 133
8 3300026089 Ga0207648_10406491 Ga0207648_104064911 133
9 3300027907 Ga0207428_10033394 Ga0207428_100333943 133
10 3300042016 Ga0439463_094204 Ga0439463_094204_175_582 133
11 3300042119 Ga0450915_000047 Ga0450915_000047_564_971 133
12 3300042993 Ga0439440_0132378 Ga0439440_0132378_119_526 133
13 3300050489 nmdc:mga03683_19224_c1 nmdc:mga03683_19224_c1_914_1321 133
14 3300050491 nmdc:mga00v17_12753_c1 nmdc:mga00v17_12753_c1_225_632 133
15 3300050492 nmdc:mga0yw44_13192_c1 nmdc:mga0yw44_13192_c1_165_572 133
16 3300050507 nmdc:mga05p37_655507_c1 nmdc:mga05p37_655507_c1_622_1029 133
17 3300050508 nmdc:mga09592_5244_c1 nmdc:mga09592_5244_c1_9363_9770 133
18 3300050509 nmdc:mga0qj67_204768_c1 nmdc:mga0qj67_204768_c1_348_755 133
19 3300050510 nmdc:mga06r32_23196_c1 nmdc:mga06r32_23196_c1_1757_2164 133
20 3300050511 nmdc:mga08y16_130261_c1 nmdc:mga08y16_130261_c1_887_1294 133
21 3300034820 Ga0373959_0102966 Ga0373959_0102966_220_657 137
22 3300050515 nmdc:mga0a205_456057_c1 nmdc:mga0a205_456057_c1_131_574 138
23 3300005981 Ga0081538_10022731 Ga0081538_100227317 142
24 3300006871 Ga0075434_100010386 Ga0075434_10001038612 142
25 3300006914 Ga0075436_100140314 Ga0075436_1001403144 142
26 3300007076 Ga0075435_100000608 Ga0075435_1000006088 142
27 3300009093 Ga0105240_10093466 Ga0105240_100934665 142
28 3300009098 Ga0105245_10058534 Ga0105245_100585342 142
29 3300009101 Ga0105247_10036573 Ga0105247_100365732 142
30 3300009174 Ga0105241_10381409 Ga0105241_103814092 142
31 3300009176 Ga0105242_10224533 Ga0105242_102245334 142
32 3300009177 Ga0105248_10404552 Ga0105248_104045522 142
33 3300009545 Ga0105237_10133279 Ga0105237_101332794 142
34 3300009551 Ga0105238_10031793 Ga0105238_100317934 142
35 3300010375 Ga0105239_10214981 Ga0105239_102149812 142
36 3300011119 Ga0105246_10139095 Ga0105246_101390952 142
37 3300013105 Ga0157369_10417961 Ga0157369_104179611 142
38 3300013296 Ga0157374_10201066 Ga0157374_102010664 142
39 3300013297 Ga0157378_10126919 Ga0157378_101269194 142
40 3300013306 Ga0163162_10190664 Ga0163162_101906642 142
41 3300013307 Ga0157372_10162686 Ga0157372_101626864 142
42 3300013308 Ga0157375_10063999 Ga0157375_100639994 142
43 3300014325 Ga0163163_10012277 Ga0163163_100122775 142
44 3300014745 Ga0157377_10063446 Ga0157377_100634462 142
45 3300014968 Ga0157379_10033687 Ga0157379_100336876 142
46 3300014968 Ga0157379_10792774 Ga0157379_107927741 142
47 3300014969 Ga0157376_10010525 Ga0157376_100105254 142
48 3300035083 Ga0373926_0086434 Ga0373926_0086434_594_1049 142
49 3300035089 Ga0373944_0017358 Ga0373944_0017358_297_752 142
50 3300035118 Ga0373954_0090186 Ga0373954_0090186_481_936 142
51 3300035119 Ga0373956_0081930 Ga0373956_0081930_219_674 142
52 3300035170 Ga0373943_0002716 Ga0373943_0002716_4783_5238 142
53 3300035241 Ga0373961_0179809 Ga0373961_0179809_183_638 142
54 3300035410 Ga0373924_0155952 Ga0373924_0155952_140_595 142
55 3300035692 Ga0373935_0093333 Ga0373935_0093333_595_1050 142
56 3300035695 Ga0373927_0208877 Ga0373927_0208877_603_1058 142
57 3300035724 Ga0373933_0106048 Ga0373933_0106048_570_1025 142
58 3300035725 Ga0373947_0042177 Ga0373947_0042177_1948_2403 142
59 3300036401 Ga0373937_0165030 Ga0373937_0165030_1481_1936 142
60 3300037068 Ga0373925_0037063 Ga0373925_0037063_2338_2793 142
61 3300037418 Ga0395900_1135164 Ga0395900_1135164_62_517 142
62 3300037466 Ga0395898_0706291 Ga0395898_0706291_234_689 142
63 3300042876 Ga0451577_1017293 Ga0451577_1017293_251_706 142
64 3300046454 Ga0495592_0122065 Ga0495592_0122065_280_735 142
65 3300046455 Ga0495603_0080457 Ga0495603_0080457_467_922 142
66 3300046459 Ga0495629_0078151 Ga0495629_0078151_1796_2251 142
67 3300046461 Ga0495641_0020256 Ga0495641_0020256_182_637 142
68 3300046472 Ga0495580_0013292 Ga0495580_0013292_4974_5429 142
69 3300046473 Ga0495582_0045404 Ga0495582_0045404_1905_2360 142
70 3300046473 Ga0495582_0169841 Ga0495582_0169841_202_657 142
71 3300046475 Ga0495639_0003552 Ga0495639_0003552_3441_3896 142
72 3300046476 Ga0495662_0002055 Ga0495662_0002055_2483_2938 142
73 3300046476 Ga0495662_0218786 Ga0495662_0218786_306_761 142
74 3300046499 Ga0495594_0003495 Ga0495594_0003495_2855_3310 142
75 3300046511 Ga0495608_0013337 Ga0495608_0013337_141_596 142
76 3300046517 Ga0495630_0132192 Ga0495630_0132192_283_738 142
77 3300046526 Ga0495666_0007148 Ga0495666_0007148_2868_3323 142
78 3300046531 Ga0495665_0007412 Ga0495665_0007412_757_1212 142
79 3300046533 Ga0495640_0132444 Ga0495640_0132444_1098_1553 142
80 3300046535 Ga0495586_0033426 Ga0495586_0033426_116_571 142
81 3300046536 Ga0495587_0041550 Ga0495587_0041550_2212_2667 142
82 3300046543 Ga0495645_0125235 Ga0495645_0125235_1287_1742 142
83 3300046559 Ga0495667_0015394 Ga0495667_0015394_4243_4698 142
84 3300046642 Ga0495634_0030280 Ga0495634_0030280_484_939 142
85 3300046663 Ga0495635_0027661 Ga0495635_0027661_625_1080 142
86 3300046674 Ga0495588_0068881 Ga0495588_0068881_321_776 142
87 3300046675 Ga0495657_0041059 Ga0495657_0041059_1331_1786 142
88 3300046678 Ga0495599_0121640 Ga0495599_0121640_549_1004 142
89 3300046679 Ga0495623_0024714 Ga0495623_0024714_2144_2599 142
90 3300046680 Ga0495646_0063399 Ga0495646_0063399_1371_1826 142
91 3300046681 Ga0495647_0006599 Ga0495647_0006599_2801_3256 142
92 3300046683 Ga0495658_0031612 Ga0495658_0031612_1686_2141 142
93 3300046689 Ga0495613_0256006 Ga0495613_0256006_706_1161 142
94 3300046690 Ga0495624_0021415 Ga0495624_0021415_2531_2986 142
95 3300046809 Ga0495600_0020664 Ga0495600_0020664_3259_3714 142
96 3300047315 Ga0495581_0009533 Ga0495581_0009533_4773_5228 142
97 3300047317 Ga0495604_0077797 Ga0495604_0077797_784_1239 142
98 3300047319 Ga0495674_0227941 Ga0495674_0227941_595_1050 142
99 3300047321 Ga0495676_0024547 Ga0495676_0024547_3551_4006 142
100 3300047322 Ga0495680_0027337 Ga0495680_0027337_141_596 142
101 3300047444 Ga0495675_0091901 Ga0495675_0091901_979_1434 142
102 3300047471 Ga0495684_0007177 Ga0495684_0007177_4678_5133 142
103 3300047673 Ga0495593_0003587 Ga0495593_0003587_5428_5883 142
104 3300048089 Ga0495614_0005804 Ga0495614_0005804_2115_2570 142
105 3300048903 Ga0496100_0148420 Ga0496100_0148420_273_728 142
106 3300048904 Ga0496101_0125417 Ga0496101_0125417_898_1353 142
107 3300048905 Ga0496102_0063510 Ga0496102_0063510_668_1123 142
108 3300048905 Ga0496102_0187495 Ga0496102_0187495_913_1368 142
109 3300048906 Ga0496103_0194402 Ga0496103_0194402_183_638 142
110 3300048907 Ga0496104_0313161 Ga0496104_0313161_507_962 142
111 3300048908 Ga0496105_0812596 Ga0496105_0812596_236_691 142
112 3300048908 Ga0496105_0889813 Ga0496105_0889813_36_491 142
113 3300048909 Ga0496106_0016560 Ga0496106_0016560_4642_5097 142
114 3300048909 Ga0496106_0270862 Ga0496106_0270862_386_841 142
115 3300048910 Ga0496107_0147562 Ga0496107_0147562_751_1206 142
116 3300048910 Ga0496107_0162072 Ga0496107_0162072_496_951 142
117 3300048911 Ga0496108_0006053 Ga0496108_0006053_6356_6811 142
118 3300048911 Ga0496108_0007049 Ga0496108_0007049_4184_4639 142
119 3300048911 Ga0496108_0400650 Ga0496108_0400650_518_973 142
120 3300048912 Ga0496109_0044177 Ga0496109_0044177_1672_2127 142
121 3300048912 Ga0496109_0288291 Ga0496109_0288291_243_698 142
122 3300048912 Ga0496109_0701614 Ga0496109_0701614_330_785 142
123 3300048913 Ga0496110_0044771 Ga0496110_0044771_747_1202 142
124 3300048913 Ga0496110_0047937 Ga0496110_0047937_1593_2048 142
125 3300048914 Ga0496111_0008675 Ga0496111_0008675_2403_2858 142
126 3300048915 Ga0496112_0063401 Ga0496112_0063401_2637_3092 142
127 3300048915 Ga0496112_0533215 Ga0496112_0533215_143_598 142
128 3300048916 Ga0496113_0012139 Ga0496113_0012139_3149_3604 142
129 3300048916 Ga0496113_0690307 Ga0496113_0690307_107_562 142
130 3300048917 Ga0496114_0144090 Ga0496114_0144090_1543_1998 142
131 3300048917 Ga0496114_0678764 Ga0496114_0678764_316_771 142
132 3300048918 Ga0496115_0027654 Ga0496115_0027654_934_1389 142
133 3300048918 Ga0496115_0389753 Ga0496115_0389753_459_914 142
134 3300048918 Ga0496115_0729668 Ga0496115_0729668_61_516 142
135 3300050512 nmdc:mga0n895_30167_c1 nmdc:mga0n895_30167_c1_4464_4919 142
136 3300050513 nmdc:mga0rr50_294893_c1 nmdc:mga0rr50_294893_c1_411_866 142
137 3300050514 nmdc:mga08x19_259231_c1 nmdc:mga08x19_259231_c1_36_491 142
138 3300053084 Ga0495595_0098722 Ga0495595_0098722_141_596 142
139 3300053085 Ga0495619_0119469 Ga0495619_0119469_1292_1747 142
140 3300053085 Ga0495619_0157727 Ga0495619_0157727_710_1165 142
141 3300005366 Ga0070659_101090207 Ga0070659_1010902072 143
142 3300005445 Ga0070708_100158297 Ga0070708_1001582972 143
143 3300005578 Ga0068854_101211075 Ga0068854_1012110751 143
144 3300025916 Ga0207663_10586449 Ga0207663_105864492 143
145 3300025929 Ga0207664_10875789 Ga0207664_108757891 143
146 3300025932 Ga0207690_10290736 Ga0207690_102907362 143
147 3300025944 Ga0207661_11304693 Ga0207661_113046931 143
148 3300042993 Ga0439440_0050016 Ga0439440_0050016_226_663 143
149 3300044683 Ga0466965_0274609 Ga0466965_0274609_419_877 143
150 3300045976 Ga0466967_0320172 Ga0466967_0320172_541_999 143
151 3300046455 Ga0495603_0028368 Ga0495603_0028368_688_1122 143
152 3300046674 Ga0495588_0108297 Ga0495588_0108297_404_838 143
153 3300049568 Ga0501031_0011482 Ga0501031_0011482_3835_4272 143
154 3300049569 Ga0501032_0218771 Ga0501032_0218771_676_1113 143
155 3300049570 Ga0501033_0002618 Ga0501033_0002618_5841_6278 143
156 3300049572 Ga0501036_0002190 Ga0501036_0002190_10694_11131 143
157 3300049573 Ga0501037_0010609 Ga0501037_0010609_6064_6501 143
158 3300049574 Ga0501038_0048464 Ga0501038_0048464_563_1000 143
159 3300049575 Ga0501039_0001316 Ga0501039_0001316_12948_13385 143
160 3300049576 Ga0501040_0002822 Ga0501040_0002822_3827_4264 143
161 3300049577 Ga0501041_0001149 Ga0501041_0001149_987_1424 143
162 3300049578 Ga0501042_0000525 Ga0501042_0000525_18135_18572 143
163 3300049579 Ga0501043_0004620 Ga0501043_0004620_5781_6218 143
164 3300049580 Ga0501046_0003002 Ga0501046_0003002_5259_5696 143
165 3300049582 Ga0501048_0001463 Ga0501048_0001463_9780_10217 143
166 3300049584 Ga0501068_0000081 Ga0501068_0000081_35405_35842 143
167 3300049585 Ga0501069_0001757 Ga0501069_0001757_4533_4970 143
168 3300049586 Ga0501070_0008716 Ga0501070_0008716_5063_5500 143
169 3300049587 Ga0501071_0074908 Ga0501071_0074908_1659_2096 143
170 3300049588 Ga0501072_0004413 Ga0501072_0004413_3128_3565 143
171 3300049590 Ga0501074_0006341 Ga0501074_0006341_7121_7558 143
172 3300049591 Ga0501075_0011067 Ga0501075_0011067_4521_4958 143
173 3300049592 Ga0501076_0002474 Ga0501076_0002474_5562_5999 143
174 3300049593 Ga0501077_0002841 Ga0501077_0002841_2955_3392 143
175 3300049741 Ga0501079_0004723 Ga0501079_0004723_5649_6086 143
176 3300049742 Ga0501080_0002379 Ga0501080_0002379_6960_7397 143
177 3300049743 Ga0501081_0004968 Ga0501081_0004968_6826_7263 143
178 3300049744 Ga0501083_0001009 Ga0501083_0001009_3577_4014 143
179 3300049822 Ga0501035_0011163 Ga0501035_0011163_4130_4567 143
180 3300049823 Ga0501044_0059674 Ga0501044_0059674_499_936 143
181 3300049824 Ga0501045_0004283 Ga0501045_0004283_2442_2879 143
182 3300054114 Ga0501084_0017257 Ga0501084_0017257_3128_3565 143
183 3300060353 Ga0501082_0039678 Ga0501082_0039678_2432_2869 143
184 3300061734 Ga0530510_0014539 Ga0530510_0014539_4130_4567 143
185 3300005347 Ga0070668_100363655 Ga0070668_1003636554 144
186 3300047673 Ga0495593_0143805 Ga0495593_0143805_43_504 144
187 3300005364 Ga0070673_100824512 Ga0070673_1008245121 145
188 3300005434 Ga0070709_10216300 Ga0070709_102163004 145
189 3300005435 Ga0070714_100894301 Ga0070714_1008943012 145
190 3300005436 Ga0070713_100050363 Ga0070713_1000503635 145
191 3300005437 Ga0070710_10229996 Ga0070710_102299962 145
192 3300005445 Ga0070708_100555542 Ga0070708_1005555422 145
193 3300005456 Ga0070678_100027620 Ga0070678_1000276203 145
194 3300005518 Ga0070699_101247537 Ga0070699_1012475371 145
195 3300005536 Ga0070697_100062360 Ga0070697_1000623604 145
196 3300005544 Ga0070686_100240954 Ga0070686_1002409542 145
197 3300005545 Ga0070695_100043829 Ga0070695_1000438294 145
198 3300005547 Ga0070693_100446426 Ga0070693_1004464262 145
199 3300005615 Ga0070702_100554431 Ga0070702_1005544313 145
200 3300006028 Ga0070717_10664003 Ga0070717_106640032 145
201 3300006163 Ga0070715_10006638 Ga0070715_100066386 145
202 3300006173 Ga0070716_100978886 Ga0070716_1009788861 145
203 3300006175 Ga0070712_100003526 Ga0070712_1000035266 145
204 3300006358 Ga0068871_100480435 Ga0068871_1004804352 145
205 3300006852 Ga0075433_10039121 Ga0075433_100391214 145
206 3300006871 Ga0075434_100077763 Ga0075434_1000777634 145
207 3300006871 Ga0075434_100153659 Ga0075434_1001536593 145
208 3300006914 Ga0075436_100065686 Ga0075436_1000656862 145
209 3300007076 Ga0075435_100232237 Ga0075435_1002322372 145
210 3300009094 Ga0111539_11280496 Ga0111539_112804962 145
211 3300009094 Ga0111539_11729589 Ga0111539_117295892 145
212 3300009147 Ga0114129_10109054 Ga0114129_101090543 145
213 3300009147 Ga0114129_10399901 Ga0114129_103999013 145
214 3300009174 Ga0105241_10094158 Ga0105241_100941584 145
215 3300009176 Ga0105242_10134311 Ga0105242_101343113 145
216 3300010375 Ga0105239_10883245 Ga0105239_108832453 145
217 3300011119 Ga0105246_10369835 Ga0105246_103698352 145
218 3300025885 Ga0207653_10006528 Ga0207653_100065283 145
219 3300025898 Ga0207692_10031828 Ga0207692_100318283 145
220 3300025905 Ga0207685_10249571 Ga0207685_102495712 145
221 3300025911 Ga0207654_10074829 Ga0207654_100748294 145
222 3300025915 Ga0207693_10010374 Ga0207693_100103744 145
223 3300025916 Ga0207663_10137729 Ga0207663_101377293 145
224 3300025922 Ga0207646_10448107 Ga0207646_104481072 145
225 3300025929 Ga0207664_10102254 Ga0207664_101022542 145
226 3300025929 Ga0207664_10144754 Ga0207664_101447542 145
227 3300025934 Ga0207686_11001330 Ga0207686_110013302 145
228 3300025937 Ga0207669_10556960 Ga0207669_105569601 145
229 3300025939 Ga0207665_10012934 Ga0207665_100129344 145
230 3300025960 Ga0207651_10110571 Ga0207651_101105713 145
231 3300026078 Ga0207702_10493406 Ga0207702_104934063 145
232 3300026089 Ga0207648_10802444 Ga0207648_108024441 145
233 3300026121 Ga0207683_10014362 Ga0207683_100143629 145
234 3300027907 Ga0207428_10495778 Ga0207428_104957781 145
235 3300028556 Ga0265337_1081506 Ga0265337_10815062 145
236 3300028800 Ga0265338_10026816 Ga0265338_100268164 145
237 3300031595 Ga0265313_10015960 Ga0265313_100159606 145
238 3300031731 Ga0307405_10691708 Ga0307405_106917082 145
239 3300034817 Ga0373948_0002819 Ga0373948_0002819_379_825 145
240 3300034819 Ga0373958_0009639 Ga0373958_0009639_853_1299 145
241 3300034957 Ga0373938_0007565 Ga0373938_0007565_772_1218 145
242 3300035085 Ga0373929_0022857 Ga0373929_0022857_294_740 145
243 3300035088 Ga0373940_0026721 Ga0373940_0026721_185_631 145
244 3300035092 Ga0373952_0034305 Ga0373952_0034305_409_855 145
245 3300035112 Ga0373932_0010080 Ga0373932_0010080_961_1407 145
246 3300035118 Ga0373954_0561690 Ga0373954_0561690_85_525 145
247 3300035121 Ga0373960_0004970 Ga0373960_0004970_568_1014 145
248 3300035207 Ga0373942_0015185 Ga0373942_0015185_673_1119 145
249 3300035242 Ga0373962_0004789 Ga0373962_0004789_262_708 145
250 3300035691 Ga0373931_0222263 Ga0373931_0222263_124_570 145
251 3300045976 Ga0466967_0068710 Ga0466967_0068710_28_468 145
252 3300046474 Ga0495605_0270493 Ga0495605_0270493_129_575 145
253 3300046794 Ga0495589_0103324 Ga0495589_0103324_820_1266 145
254 3300048903 Ga0496100_0086761 Ga0496100_0086761_1271_1717 145
255 3300048904 Ga0496101_0140291 Ga0496101_0140291_773_1219 145
256 3300048905 Ga0496102_0036684 Ga0496102_0036684_906_1352 145
257 3300048906 Ga0496103_0034564 Ga0496103_0034564_921_1367 145
258 3300048907 Ga0496104_0017796 Ga0496104_0017796_4812_5258 145
259 3300048908 Ga0496105_0009243 Ga0496105_0009243_4512_4958 145
260 3300048909 Ga0496106_0061625 Ga0496106_0061625_1151_1597 145
261 3300048910 Ga0496107_0503290 Ga0496107_0503290_53_499 145
262 3300048911 Ga0496108_0008016 Ga0496108_0008016_6261_6707 145
263 3300048912 Ga0496109_0281433 Ga0496109_0281433_482_928 145
264 3300048913 Ga0496110_1444920 Ga0496110_1444920_122_562 145
265 3300048914 Ga0496111_0257244 Ga0496111_0257244_537_983 145
266 3300048915 Ga0496112_0279582 Ga0496112_0279582_410_856 145
267 3300048916 Ga0496113_0036377 Ga0496113_0036377_1944_2390 145
268 3300048918 Ga0496115_0003373 Ga0496115_0003373_1211_1657 145
269 3300050507 nmdc:mga05p37_135308_c1 nmdc:mga05p37_135308_c1_2044_2490 145
270 3300050507 nmdc:mga05p37_41768_c1 nmdc:mga05p37_41768_c1_2688_3143 145
271 3300050512 nmdc:mga0n895_97761_c1 nmdc:mga0n895_97761_c1_1737_2183 145
272 3300050513 nmdc:mga0rr50_24439_c1 nmdc:mga0rr50_24439_c1_3261_3707 145
273 3300050514 nmdc:mga08x19_20999_c1 nmdc:mga08x19_20999_c1_3362_3808 145
274 3300050515 nmdc:mga0a205_112192_c1 nmdc:mga0a205_112192_c1_1299_1745 145
275 3300050515 nmdc:mga0a205_422922_c1 nmdc:mga0a205_422922_c1_298_771 145
276 3300005328 Ga0070676_10640114 Ga0070676_106401142 146
277 3300005330 Ga0070690_100058653 Ga0070690_1000586533 146
278 3300005334 Ga0068869_100109194 Ga0068869_1001091943 146
279 3300005336 Ga0070680_100253354 Ga0070680_1002533544 146
280 3300005337 Ga0070682_100399959 Ga0070682_1003999592 146
281 3300005338 Ga0068868_100487761 Ga0068868_1004877613 146
282 3300005339 Ga0070660_100191282 Ga0070660_1001912823 146
283 3300005340 Ga0070689_100006793 Ga0070689_1000067937 146
284 3300005343 Ga0070687_100067615 Ga0070687_1000676153 146
285 3300005344 Ga0070661_100051629 Ga0070661_1000516295 146
286 3300005345 Ga0070692_10020687 Ga0070692_100206875 146
287 3300005354 Ga0070675_100129240 Ga0070675_1001292403 146
288 3300005355 Ga0070671_100812433 Ga0070671_1008124332 146
289 3300005356 Ga0070674_100236314 Ga0070674_1002363142 146
290 3300005364 Ga0070673_100334532 Ga0070673_1003345323 146
291 3300005364 Ga0070673_101263998 Ga0070673_1012639982 146
292 3300005365 Ga0070688_100010262 Ga0070688_1000102625 146
293 3300005366 Ga0070659_100038064 Ga0070659_1000380645 146
294 3300005367 Ga0070667_100160723 Ga0070667_1001607232 146
295 3300005438 Ga0070701_10069525 Ga0070701_100695254 146
296 3300005441 Ga0070700_100432058 Ga0070700_1004320581 146
297 3300005455 Ga0070663_100161765 Ga0070663_1001617652 146
298 3300005456 Ga0070678_100671009 Ga0070678_1006710092 146
299 3300005457 Ga0070662_100286360 Ga0070662_1002863602 146
300 3300005466 Ga0070685_10086138 Ga0070685_100861383 146
301 3300005530 Ga0070679_100992516 Ga0070679_1009925162 146
302 3300005535 Ga0070684_100008065 Ga0070684_1000080659 146
303 3300005546 Ga0070696_100387985 Ga0070696_1003879852 146
304 3300005548 Ga0070665_100087403 Ga0070665_1000874034 146
305 3300005549 Ga0070704_100088247 Ga0070704_1000882472 146
306 3300005564 Ga0070664_100312896 Ga0070664_1003128962 146
307 3300005577 Ga0068857_100245039 Ga0068857_1002450392 146
308 3300005618 Ga0068864_100017795 Ga0068864_1000177955 146
309 3300005718 Ga0068866_10021510 Ga0068866_100215103 146
310 3300005719 Ga0068861_100072076 Ga0068861_1000720762 146
311 3300005840 Ga0068870_10242405 Ga0068870_102424052 146
312 3300005841 Ga0068863_100050395 Ga0068863_1000503956 146
313 3300005842 Ga0068858_100106776 Ga0068858_1001067764 146
314 3300005843 Ga0068860_100200289 Ga0068860_1002002893 146
315 3300006881 Ga0068865_100671653 Ga0068865_1006716531 146
316 3300009098 Ga0105245_10160864 Ga0105245_101608643 146
317 3300009101 Ga0105247_10031737 Ga0105247_100317376 146
318 3300009148 Ga0105243_10009252 Ga0105243_100092521 146
319 3300009177 Ga0105248_10040417 Ga0105248_100404174 146
320 3300009545 Ga0105237_11935439 Ga0105237_119354392 146
321 3300009551 Ga0105238_10708736 Ga0105238_107087361 146
322 3300010375 Ga0105239_10205940 Ga0105239_102059401 146
323 3300011119 Ga0105246_10043027 Ga0105246_100430275 146
324 3300011119 Ga0105246_10941343 Ga0105246_109413432 146
325 3300013296 Ga0157374_10188421 Ga0157374_101884213 146
326 3300013306 Ga0163162_10088659 Ga0163162_100886593 146
327 3300014326 Ga0157380_10173862 Ga0157380_101738622 146
328 3300014745 Ga0157377_10057601 Ga0157377_100576013 146
329 3300014968 Ga0157379_10004792 Ga0157379_1000479212 146
330 3300025900 Ga0207710_10075242 Ga0207710_100752423 146
331 3300025901 Ga0207688_10029657 Ga0207688_100296574 146
332 3300025904 Ga0207647_10042320 Ga0207647_100423204 146
333 3300025907 Ga0207645_10204427 Ga0207645_102044274 146
334 3300025909 Ga0207705_10412958 Ga0207705_104129582 146
335 3300025912 Ga0207707_10513191 Ga0207707_105131912 146
336 3300025917 Ga0207660_10666974 Ga0207660_106669741 146
337 3300025918 Ga0207662_10013402 Ga0207662_100134024 146
338 3300025920 Ga0207649_11007527 Ga0207649_110075272 146
339 3300025923 Ga0207681_10043023 Ga0207681_100430235 146
340 3300025925 Ga0207650_11498942 Ga0207650_114989421 146
341 3300025926 Ga0207659_10070135 Ga0207659_100701353 146
342 3300025927 Ga0207687_10915467 Ga0207687_109154672 146
343 3300025931 Ga0207644_10220217 Ga0207644_102202172 146
344 3300025932 Ga0207690_11094299 Ga0207690_110942991 146
345 3300025933 Ga0207706_10519221 Ga0207706_105192212 146
346 3300025935 Ga0207709_10090721 Ga0207709_100907214 146
347 3300025936 Ga0207670_10332026 Ga0207670_103320263 146
348 3300025940 Ga0207691_10054938 Ga0207691_100549383 146
349 3300025941 Ga0207711_10157993 Ga0207711_101579933 146
350 3300025942 Ga0207689_10196149 Ga0207689_101961492 146
351 3300025944 Ga0207661_10260953 Ga0207661_102609534 146
352 3300025945 Ga0207679_10125225 Ga0207679_101252252 146
353 3300025960 Ga0207651_10899009 Ga0207651_108990092 146
354 3300025960 Ga0207651_11327744 Ga0207651_113277442 146
355 3300025972 Ga0207668_10107386 Ga0207668_101073863 146
356 3300026023 Ga0207677_10178702 Ga0207677_101787022 146
357 3300026035 Ga0207703_10635694 Ga0207703_106356942 146
358 3300026041 Ga0207639_10849627 Ga0207639_108496272 146
359 3300026067 Ga0207678_10765420 Ga0207678_107654202 146
360 3300026075 Ga0207708_10054174 Ga0207708_100541741 146
361 3300026088 Ga0207641_10165231 Ga0207641_101652313 146
362 3300026118 Ga0207675_100371134 Ga0207675_1003711342 146
363 3300027907 Ga0207428_10050102 Ga0207428_100501025 146
364 3300028379 Ga0268266_10128416 Ga0268266_101284162 146
365 3300028381 Ga0268264_10096251 Ga0268264_100962513 146
366 3300035090 Ga0373949_0083375 Ga0373949_0083375_202_675 146
367 3300035121 Ga0373960_0005836 Ga0373960_0005836_1136_1609 146
368 3300035207 Ga0373942_0051946 Ga0373942_0051946_130_603 146
369 3300035241 Ga0373961_0015262 Ga0373961_0015262_1250_1723 146
370 3300035242 Ga0373962_0023110 Ga0373962_0023110_91_564 146
371 3300048904 Ga0496101_0352776 Ga0496101_0352776_505_978 146
372 3300048907 Ga0496104_0226599 Ga0496104_0226599_1152_1625 146
373 3300048908 Ga0496105_0048430 Ga0496105_0048430_537_1010 146
374 3300048909 Ga0496106_0294001 Ga0496106_0294001_316_789 146
375 3300048910 Ga0496107_0067714 Ga0496107_0067714_900_1373 146
376 3300048911 Ga0496108_1226014 Ga0496108_1226014_21_494 146
377 3300048912 Ga0496109_0120278 Ga0496109_0120278_429_902 146
378 3300048913 Ga0496110_0042015 Ga0496110_0042015_3405_3878 146
379 3300048914 Ga0496111_0424970 Ga0496111_0424970_93_566 146
380 3300048917 Ga0496114_0043825 Ga0496114_0043825_2321_2794 146
381 3300048918 Ga0496115_0119413 Ga0496115_0119413_860_1333 146
382 3300049572 Ga0501036_0923808 Ga0501036_0923808_226_672 146
383 3300049578 Ga0501042_0129042 Ga0501042_0129042_524_970 146
384 3300049592 Ga0501076_0716800 Ga0501076_0716800_314_760 146
385 3300049741 Ga0501079_0820642 Ga0501079_0820642_128_574 146
386 3300049743 Ga0501081_0274137 Ga0501081_0274137_550_996 146
387 3300050515 nmdc:mga0a205_929767_c1 nmdc:mga0a205_929767_c1_38_511 146
388 3300054114 Ga0501084_0102877 Ga0501084_0102877_415_861 146
389 3300005327 Ga0070658_10306405 Ga0070658_103064053 147
390 3300005329 Ga0070683_100898386 Ga0070683_1008983861 147
391 3300005338 Ga0068868_100022640 Ga0068868_1000226404 147
392 3300005339 Ga0070660_100170114 Ga0070660_1001701143 147
393 3300005347 Ga0070668_100447433 Ga0070668_1004474333 147
394 3300005354 Ga0070675_100180631 Ga0070675_1001806312 147
395 3300005364 Ga0070673_100388213 Ga0070673_1003882131 147
396 3300005365 Ga0070688_100084993 Ga0070688_1000849931 147
397 3300005367 Ga0070667_101140473 Ga0070667_1011404731 147
398 3300005406 Ga0070703_10154078 Ga0070703_101540782 147
399 3300005435 Ga0070714_100007827 Ga0070714_1000078275 147
400 3300005435 Ga0070714_100046971 Ga0070714_1000469713 147
401 3300005435 Ga0070714_100091767 Ga0070714_1000917673 147
402 3300005436 Ga0070713_100815088 Ga0070713_1008150882 147
403 3300005437 Ga0070710_10296203 Ga0070710_102962031 147
404 3300005439 Ga0070711_100397166 Ga0070711_1003971663 147
405 3300005456 Ga0070678_100378111 Ga0070678_1003781113 147
406 3300005457 Ga0070662_100342603 Ga0070662_1003426032 147
407 3300005458 Ga0070681_10183017 Ga0070681_101830174 147
408 3300005545 Ga0070695_100047626 Ga0070695_1000476264 147
409 3300005547 Ga0070693_100017969 Ga0070693_1000179695 147
410 3300005549 Ga0070704_100084422 Ga0070704_1000844224 147
411 3300005549 Ga0070704_101774681 Ga0070704_1017746811 147
412 3300005563 Ga0068855_100071675 Ga0068855_1000716755 147
413 3300005578 Ga0068854_100013567 Ga0068854_1000135674 147
414 3300005614 Ga0068856_100004140 Ga0068856_10000414020 147
415 3300005615 Ga0070702_100108432 Ga0070702_1001084322 147
416 3300005616 Ga0068852_100047539 Ga0068852_1000475394 147
417 3300005616 Ga0068852_101817403 Ga0068852_1018174031 147
418 3300005617 Ga0068859_100127625 Ga0068859_1001276254 147
419 3300005618 Ga0068864_100090622 Ga0068864_1000906223 147
420 3300005834 Ga0068851_10574101 Ga0068851_105741012 147
421 3300006028 Ga0070717_10513344 Ga0070717_105133443 147
422 3300006163 Ga0070715_10067143 Ga0070715_100671434 147
423 3300006175 Ga0070712_100143768 Ga0070712_1001437683 147
424 3300006852 Ga0075433_10080533 Ga0075433_100805332 147
425 3300006881 Ga0068865_100156529 Ga0068865_1001565294 147
426 3300006931 Ga0097620_100127621 Ga0097620_1001276214 147
427 3300009098 Ga0105245_10188387 Ga0105245_101883874 147
428 3300009148 Ga0105243_10526822 Ga0105243_105268222 147
429 3300017792 Ga0163161_10269736 Ga0163161_102697362 147
430 3300025321 Ga0207656_10426048 Ga0207656_104260482 147
431 3300025900 Ga0207710_10082560 Ga0207710_100825602 147
432 3300025901 Ga0207688_10021233 Ga0207688_100212334 147
433 3300025906 Ga0207699_10587496 Ga0207699_105874962 147
434 3300025912 Ga0207707_10684810 Ga0207707_106848102 147
435 3300025914 Ga0207671_10060994 Ga0207671_100609944 147
436 3300025915 Ga0207693_10099526 Ga0207693_100995264 147
437 3300025919 Ga0207657_10020680 Ga0207657_100206808 147
438 3300025924 Ga0207694_10021341 Ga0207694_100213416 147
439 3300025927 Ga0207687_10097397 Ga0207687_100973972 147
440 3300025929 Ga0207664_10040081 Ga0207664_100400814 147
441 3300025929 Ga0207664_10170683 Ga0207664_101706832 147
442 3300025929 Ga0207664_10343003 Ga0207664_103430033 147
443 3300025931 Ga0207644_10534772 Ga0207644_105347722 147
444 3300025932 Ga0207690_10918883 Ga0207690_109188832 147
445 3300025933 Ga0207706_10268699 Ga0207706_102686992 147
446 3300025935 Ga0207709_10149518 Ga0207709_101495184 147
447 3300025938 Ga0207704_10033753 Ga0207704_100337534 147
448 3300025939 Ga0207665_10062204 Ga0207665_100622044 147
449 3300025941 Ga0207711_10499100 Ga0207711_104991002 147
450 3300025942 Ga0207689_10055243 Ga0207689_100552434 147
451 3300025949 Ga0207667_10089450 Ga0207667_100894502 147
452 3300025961 Ga0207712_10122701 Ga0207712_101227014 147
453 3300025972 Ga0207668_10195115 Ga0207668_101951154 147
454 3300025981 Ga0207640_10091189 Ga0207640_100911894 147
455 3300026023 Ga0207677_10015646 Ga0207677_100156463 147
456 3300026041 Ga0207639_10287699 Ga0207639_102876994 147
457 3300026078 Ga0207702_10053207 Ga0207702_100532073 147
458 3300026078 Ga0207702_10094423 Ga0207702_100944234 147
459 3300026095 Ga0207676_10199410 Ga0207676_101994103 147
460 3300026118 Ga0207675_100616201 Ga0207675_1006162013 147
461 3300026121 Ga0207683_10029388 Ga0207683_100293885 147
462 3300026142 Ga0207698_10082618 Ga0207698_100826182 147
463 3300048903 Ga0496100_0018401 Ga0496100_0018401_261_761 147
464 3300048903 Ga0496100_0048646 Ga0496100_0048646_947_1447 147
465 3300048904 Ga0496101_0002160 Ga0496101_0002160_6631_7131 147
466 3300048904 Ga0496101_0132915 Ga0496101_0132915_824_1324 147
467 3300048909 Ga0496106_0018353 Ga0496106_0018353_243_743 147
468 3300048910 Ga0496107_0093550 Ga0496107_0093550_1367_1867 147
469 3300048915 Ga0496112_0003370 Ga0496112_0003370_4827_5327 147
470 3300048916 Ga0496113_0003046 Ga0496113_0003046_3195_3695 147
471 3300005329 Ga0070683_100001865 Ga0070683_10000186514 148
472 3300005331 Ga0070670_100200263 Ga0070670_1002002632 148
473 3300005334 Ga0068869_100390992 Ga0068869_1003909922 148
474 3300005336 Ga0070680_100965166 Ga0070680_1009651662 148
475 3300005338 Ga0068868_100739802 Ga0068868_1007398022 148
476 3300005340 Ga0070689_101175301 Ga0070689_1011753012 148
477 3300005341 Ga0070691_10063991 Ga0070691_100639914 148
478 3300005343 Ga0070687_100649141 Ga0070687_1006491412 148
479 3300005347 Ga0070668_101003657 Ga0070668_1010036571 148
480 3300005438 Ga0070701_10098075 Ga0070701_100980754 148
481 3300005441 Ga0070700_100067625 Ga0070700_1000676253 148
482 3300005444 Ga0070694_101172416 Ga0070694_1011724161 148
483 3300005466 Ga0070685_10044857 Ga0070685_100448574 148
484 3300005530 Ga0070679_100070341 Ga0070679_1000703415 148
485 3300005535 Ga0070684_100013208 Ga0070684_1000132082 148
486 3300005564 Ga0070664_100878453 Ga0070664_1008784531 148
487 3300005577 Ga0068857_100129966 Ga0068857_1001299663 148
488 3300005578 Ga0068854_101452107 Ga0068854_1014521072 148
489 3300005718 Ga0068866_10624547 Ga0068866_106245471 148
490 3300006881 Ga0068865_100319230 Ga0068865_1003192302 148
491 3300006931 Ga0097620_100155374 Ga0097620_1001553744 148
492 3300009098 Ga0105245_10131976 Ga0105245_101319761 148
493 3300009147 Ga0114129_10706584 Ga0114129_107065842 148
494 3300009551 Ga0105238_10165254 Ga0105238_101652543 148
495 3300010375 Ga0105239_10892872 Ga0105239_108928721 148
496 3300025901 Ga0207688_10034349 Ga0207688_100343493 148
497 3300025908 Ga0207643_10345643 Ga0207643_103456433 148
498 3300025917 Ga0207660_10747622 Ga0207660_107476221 148
499 3300025918 Ga0207662_10717073 Ga0207662_107170731 148
500 3300025927 Ga0207687_10011630 Ga0207687_100116304 148
501 3300025937 Ga0207669_10370518 Ga0207669_103705182 148
502 3300025944 Ga0207661_10004931 Ga0207661_1000493111 148
503 3300025981 Ga0207640_10468276 Ga0207640_104682762 148
504 3300026023 Ga0207677_10349741 Ga0207677_103497412 148
505 3300026075 Ga0207708_10122673 Ga0207708_101226733 148
506 3300026116 Ga0207674_10125196 Ga0207674_101251963 148
507 3300028380 Ga0268265_10412795 Ga0268265_104127953 148
508 3300028666 Ga0265336_10004451 Ga0265336_100044516 148
509 3300041492 Ga0451835_1049948 Ga0451835_1049948_81_533 148
510 3300044656 Ga0466969_0026994 Ga0466969_0026994_56_505 148
511 3300044693 Ga0466961_0231645 Ga0466961_0231645_500_949 148
512 3300044719 Ga0466971_0024920 Ga0466971_0024920_1735_2184 148
513 3300045049 Ga0466959_0012465 Ga0466959_0012465_3596_4045 148
514 3300045049 Ga0466959_0464064 Ga0466959_0464064_224_673 148
515 3300046459 Ga0495629_0480321 Ga0495629_0480321_43_540 148
516 3300046473 Ga0495582_0088683 Ga0495582_0088683_188_685 148
517 3300046689 Ga0495613_0227682 Ga0495613_0227682_529_1026 148
518 3300047315 Ga0495581_0466876 Ga0495581_0466876_185_682 148
519 3300048915 Ga0496112_0150996 Ga0496112_0150996_1332_1829 148
520 3300048916 Ga0496113_0195794 Ga0496113_0195794_261_758 148
521 3300049586 Ga0501070_0346762 Ga0501070_0346762_364_810 148
522 3300050508 nmdc:mga09592_1023671_c1 nmdc:mga09592_1023671_c1_56_547 148
523 3300061719 Ga0466962_0003630 Ga0466962_0003630_4503_4952 148
524 3300005329 Ga0070683_100018209 Ga0070683_1000182095 149
525 3300005329 Ga0070683_100211448 Ga0070683_1002114483 149
526 3300005331 Ga0070670_100305911 Ga0070670_1003059112 149
527 3300005334 Ga0068869_100663872 Ga0068869_1006638722 149
528 3300005441 Ga0070700_101697924 Ga0070700_1016979241 149
529 3300005457 Ga0070662_100509698 Ga0070662_1005096982 149
530 3300005535 Ga0070684_100005586 Ga0070684_10000558611 149
531 3300005535 Ga0070684_100043198 Ga0070684_1000431985 149
532 3300005535 Ga0070684_100053652 Ga0070684_1000536522 149
533 3300005547 Ga0070693_101306923 Ga0070693_1013069231 149
534 3300005564 Ga0070664_100108047 Ga0070664_1001080472 149
535 3300005564 Ga0070664_101116997 Ga0070664_1011169972 149
536 3300005577 Ga0068857_100025094 Ga0068857_1000250944 149
537 3300005577 Ga0068857_100046363 Ga0068857_1000463635 149
538 3300005577 Ga0068857_100049533 Ga0068857_1000495334 149
539 3300005614 Ga0068856_100634250 Ga0068856_1006342502 149
540 3300005616 Ga0068852_101439485 Ga0068852_1014394852 149
541 3300006871 Ga0075434_100247750 Ga0075434_1002477502 149
542 3300006881 Ga0068865_100636349 Ga0068865_1006363492 149
543 3300009098 Ga0105245_10033229 Ga0105245_100332294 149
544 3300009148 Ga0105243_10149359 Ga0105243_101493592 149
545 3300009553 Ga0105249_10538150 Ga0105249_105381502 149
546 3300011119 Ga0105246_10140462 Ga0105246_101404622 149
547 3300013105 Ga0157369_10177672 Ga0157369_101776722 149
548 3300013297 Ga0157378_12487804 Ga0157378_124878041 149
549 3300013307 Ga0157372_11579879 Ga0157372_115798792 149
550 3300013308 Ga0157375_10173675 Ga0157375_101736752 149
551 3300013308 Ga0157375_12010254 Ga0157375_120102541 149
552 3300014497 Ga0182008_10312614 Ga0182008_103126142 149
553 3300014745 Ga0157377_10320802 Ga0157377_103208022 149
554 3300025916 Ga0207663_10509315 Ga0207663_105093152 149
555 3300025925 Ga0207650_10797649 Ga0207650_107976492 149
556 3300025934 Ga0207686_10043218 Ga0207686_100432185 149
557 3300025935 Ga0207709_10150539 Ga0207709_101505394 149
558 3300025938 Ga0207704_11073316 Ga0207704_110733161 149
559 3300025940 Ga0207691_10296654 Ga0207691_102966544 149
560 3300025944 Ga0207661_10003567 Ga0207661_100035675 149
561 3300025944 Ga0207661_10078773 Ga0207661_100787735 149
562 3300025945 Ga0207679_10157043 Ga0207679_101570433 149
563 3300025960 Ga0207651_10276063 Ga0207651_102760632 149
564 3300025961 Ga0207712_10173897 Ga0207712_101738973 149
565 3300025972 Ga0207668_10586120 Ga0207668_105861201 149
566 3300026075 Ga0207708_10459694 Ga0207708_104596942 149
567 3300026095 Ga0207676_10220799 Ga0207676_102207992 149
568 3300026116 Ga0207674_10015445 Ga0207674_100154459 149
569 3300026116 Ga0207674_10035259 Ga0207674_100352593 149
570 3300026116 Ga0207674_10379823 Ga0207674_103798232 149
571 3300026121 Ga0207683_10148540 Ga0207683_101485404 149
572 3300035170 Ga0373943_0235465 Ga0373943_0235465_205_660 149
573 3300035691 Ga0373931_0591029 Ga0373931_0591029_174_629 149
574 3300037312 Ga0395899_0002534 Ga0395899_0002534_9174_9629 149
575 3300037312 Ga0395899_0042680 Ga0395899_0042680_512_967 149
576 3300037312 Ga0395899_0100216 Ga0395899_0100216_175_624 149
577 3300037418 Ga0395900_0011417 Ga0395900_0011417_5789_6244 149
578 3300037418 Ga0395900_0277163 Ga0395900_0277163_1125_1580 149
579 3300037466 Ga0395898_0002003 Ga0395898_0002003_18912_19367 149
580 3300037466 Ga0395898_0435357 Ga0395898_0435357_165_614 149
581 3300037466 Ga0395898_0437020 Ga0395898_0437020_28_477 149
582 3300037471 Ga0395905_0007644 Ga0395905_0007644_9992_10447 149
583 3300037471 Ga0395905_0098067 Ga0395905_0098067_2219_2668 149
584 3300037471 Ga0395905_0233244 Ga0395905_0233244_149_601 149
585 3300037471 Ga0395905_0451728 Ga0395905_0451728_501_956 149
586 3300038443 Ga0395901_0018862 Ga0395901_0018862_2283_2738 149
587 3300038443 Ga0395901_0025878 Ga0395901_0025878_5402_5857 149
588 3300038443 Ga0395901_0482314 Ga0395901_0482314_85_534 149
589 3300041512 Ga0451853_1424996 Ga0451853_1424996_1443_1898 149
590 3300044706 Ga0466964_0058243 Ga0466964_0058243_484_933 149
591 3300046458 Ga0495591_022963 Ga0495591_022963_67_522 149
592 3300046461 Ga0495641_0024645 Ga0495641_0024645_1337_1792 149
593 3300046473 Ga0495582_0033590 Ga0495582_0033590_1694_2149 149
594 3300046473 Ga0495582_0130543 Ga0495582_0130543_561_1016 149
595 3300046474 Ga0495605_0032432 Ga0495605_0032432_1196_1651 149
596 3300046491 Ga0495584_0072754 Ga0495584_0072754_1073_1528 149
597 3300046492 Ga0495585_0163484 Ga0495585_0163484_28_483 149
598 3300046499 Ga0495594_0049017 Ga0495594_0049017_736_1191 149
599 3300046500 Ga0495596_0038534 Ga0495596_0038534_1401_1856 149
600 3300046513 Ga0495616_0246467 Ga0495616_0246467_98_553 149
601 3300046517 Ga0495630_0273371 Ga0495630_0273371_520_975 149
602 3300046518 Ga0495631_0061138 Ga0495631_0061138_747_1202 149
603 3300046519 Ga0495632_0152748 Ga0495632_0152748_250_705 149
604 3300046520 Ga0495637_0027020 Ga0495637_0027020_716_1171 149
605 3300046523 Ga0495644_0064966 Ga0495644_0064966_812_1267 149
606 3300046535 Ga0495586_0066898 Ga0495586_0066898_1144_1599 149
607 3300046537 Ga0495598_0122860 Ga0495598_0122860_237_692 149
608 3300046538 Ga0495609_0032353 Ga0495609_0032353_909_1364 149
609 3300046542 Ga0495597_0188579 Ga0495597_0188579_199_654 149
610 3300046616 Ga0495668_0116952 Ga0495668_0116952_654_1109 149
611 3300046674 Ga0495588_0160562 Ga0495588_0160562_371_826 149
612 3300046683 Ga0495658_0422604 Ga0495658_0422604_70_525 149
613 3300046683 Ga0495658_0946167 Ga0495658_0946167_47_502 149
614 3300046684 Ga0495669_0081982 Ga0495669_0081982_577_1032 149
615 3300046689 Ga0495613_0299046 Ga0495613_0299046_234_689 149
616 3300046691 Ga0495670_0133263 Ga0495670_0133263_768_1223 149
617 3300046692 Ga0495671_0032432 Ga0495671_0032432_1116_1571 149
618 3300046794 Ga0495589_0023756 Ga0495589_0023756_2519_2974 149
619 3300046794 Ga0495589_0273183 Ga0495589_0273183_206_661 149
620 3300046810 Ga0495660_0073146 Ga0495660_0073146_1241_1696 149
621 3300047315 Ga0495581_0008581 Ga0495581_0008581_3474_3929 149
622 3300047321 Ga0495676_0096031 Ga0495676_0096031_1268_1723 149
623 3300047470 Ga0495681_0217030 Ga0495681_0217030_184_639 149
624 3300048090 Ga0495615_0129367 Ga0495615_0129367_119_574 149
625 3300048091 Ga0495626_0119287 Ga0495626_0119287_334_789 149
626 3300048909 Ga0496106_0371601 Ga0496106_0371601_347_802 149
627 3300048911 Ga0496108_0530187 Ga0496108_0530187_361_816 149
628 3300048912 Ga0496109_0018917 Ga0496109_0018917_5256_5711 149
629 3300048912 Ga0496109_0234880 Ga0496109_0234880_336_791 149
630 3300048913 Ga0496110_1761878 Ga0496110_1761878_55_510 149
631 3300048915 Ga0496112_0084263 Ga0496112_0084263_250_705 149
632 3300048916 Ga0496113_0326221 Ga0496113_0326221_113_568 149
633 3300050513 nmdc:mga0rr50_1712534_c1 nmdc:mga0rr50_1712534_c1_43_498 149
634 3300050515 nmdc:mga0a205_751018_c1 nmdc:mga0a205_751018_c1_13_468 149
635 3300005336 Ga0070680_100052359 Ga0070680_1000523595 150
636 3300005336 Ga0070680_100327017 Ga0070680_1003270172 150
637 3300005337 Ga0070682_101445996 Ga0070682_1014459961 150
638 3300005435 Ga0070714_101135714 Ga0070714_1011357141 150
639 3300005458 Ga0070681_10362313 Ga0070681_103623132 150
640 3300005471 Ga0070698_100091026 Ga0070698_1000910265 150
641 3300005535 Ga0070684_100279306 Ga0070684_1002793063 150
642 3300005539 Ga0068853_100757590 Ga0068853_1007575902 150
643 3300005546 Ga0070696_100037309 Ga0070696_1000373092 150
644 3300005563 Ga0068855_100488131 Ga0068855_1004881312 150
645 3300005563 Ga0068855_101932917 Ga0068855_1019329171 150
646 3300005578 Ga0068854_101000978 Ga0068854_1010009782 150
647 3300005719 Ga0068861_101194767 Ga0068861_1011947672 150
648 3300005844 Ga0068862_100283483 Ga0068862_1002834833 150
649 3300005937 Ga0081455_10016804 Ga0081455_100168049 150
650 3300006028 Ga0070717_10773534 Ga0070717_107735342 150
651 3300006038 Ga0075365_10256185 Ga0075365_102561852 150
652 3300006163 Ga0070715_10109589 Ga0070715_101095892 150
653 3300006844 Ga0075428_100016481 Ga0075428_10001648110 150
654 3300006844 Ga0075428_100455701 Ga0075428_1004557012 150
655 3300006846 Ga0075430_100063435 Ga0075430_1000634355 150
656 3300006847 Ga0075431_100201548 Ga0075431_1002015484 150
657 3300009147 Ga0114129_10064370 Ga0114129_100643705 150
658 3300009147 Ga0114129_10352222 Ga0114129_103522224 150
659 3300009147 Ga0114129_11081848 Ga0114129_110818482 150
660 3300009553 Ga0105249_11182639 Ga0105249_111826392 150
661 3300013102 Ga0157371_10967644 Ga0157371_109676441 150
662 3300025906 Ga0207699_10304513 Ga0207699_103045132 150
663 3300025910 Ga0207684_10774335 Ga0207684_107743352 150
664 3300025912 Ga0207707_10092840 Ga0207707_100928403 150
665 3300025912 Ga0207707_10174626 Ga0207707_101746262 150
666 3300025917 Ga0207660_10105314 Ga0207660_101053142 150
667 3300025917 Ga0207660_10205808 Ga0207660_102058082 150
668 3300025917 Ga0207660_10732096 Ga0207660_107320962 150
669 3300025919 Ga0207657_10015818 Ga0207657_100158184 150
670 3300025921 Ga0207652_10263623 Ga0207652_102636233 150
671 3300025921 Ga0207652_10764269 Ga0207652_107642692 150
672 3300025929 Ga0207664_10789820 Ga0207664_107898202 150
673 3300025932 Ga0207690_10532228 Ga0207690_105322282 150
674 3300025949 Ga0207667_10487412 Ga0207667_104874122 150
675 3300025949 Ga0207667_11515018 Ga0207667_115150182 150
676 3300025961 Ga0207712_10446324 Ga0207712_104463242 150
677 3300028380 Ga0268265_10255612 Ga0268265_102556122 150
678 3300031240 Ga0265320_10185693 Ga0265320_101856932 150
679 3300031548 Ga0307408_100033156 Ga0307408_1000331566 150
680 3300031712 Ga0265342_10136676 Ga0265342_101366764 150
681 3300031824 Ga0307413_10817718 Ga0307413_108177182 150
682 3300031852 Ga0307410_10047990 Ga0307410_100479902 150
683 3300031901 Ga0307406_10031027 Ga0307406_100310274 150
684 3300031903 Ga0307407_10034034 Ga0307407_100340342 150
685 3300031911 Ga0307412_10116401 Ga0307412_101164013 150
686 3300031995 Ga0307409_100050665 Ga0307409_1000506654 150
687 3300032002 Ga0307416_100255914 Ga0307416_1002559143 150
688 3300032002 Ga0307416_100429384 Ga0307416_1004293842 150
689 3300032004 Ga0307414_10288543 Ga0307414_102885433 150
690 3300032005 Ga0307411_10058165 Ga0307411_100581652 150
691 3300032126 Ga0307415_100241808 Ga0307415_1002418084 150
692 3300032126 Ga0307415_100457732 Ga0307415_1004577322 150
693 3300032126 Ga0307415_101852001 Ga0307415_1018520011 150
694 3300037312 Ga0395899_0014422 Ga0395899_0014422_787_1248 150
695 3300037312 Ga0395899_0089125 Ga0395899_0089125_293_751 150
696 3300037418 Ga0395900_0003108 Ga0395900_0003108_11677_12138 150
697 3300037418 Ga0395900_0038196 Ga0395900_0038196_3559_4017 150
698 3300037418 Ga0395900_0109835 Ga0395900_0109835_2116_2574 150
699 3300037466 Ga0395898_0004139 Ga0395898_0004139_1044_1505 150
700 3300037466 Ga0395898_0024764 Ga0395898_0024764_5293_5751 150
701 3300037466 Ga0395898_0233447 Ga0395898_0233447_859_1317 150
702 3300037466 Ga0395898_0418927 Ga0395898_0418927_421_879 150
703 3300037471 Ga0395905_0001321 Ga0395905_0001321_11841_12302 150
704 3300037471 Ga0395905_0571024 Ga0395905_0571024_379_837 150
705 3300038443 Ga0395901_0008538 Ga0395901_0008538_7339_7800 150
706 3300038443 Ga0395901_0045428 Ga0395901_0045428_144_602 150
707 3300038443 Ga0395901_0082095 Ga0395901_0082095_2435_2893 150
708 3300038443 Ga0395901_0230608 Ga0395901_0230608_82_540 150
709 3300038443 Ga0395901_0237361 Ga0395901_0237361_348_806 150
710 3300042876 Ga0451577_0189172 Ga0451577_0189172_696_1151 150
711 3300045051 Ga0451576_1131079 Ga0451576_1131079_247_702 150
712 3300046458 Ga0495591_131925 Ga0495591_131925_78_536 150
713 3300046642 Ga0495634_0089487 Ga0495634_0089487_856_1308 150
714 3300048910 Ga0496107_0019766 Ga0496107_0019766_2905_3360 150
715 3300049580 Ga0501046_0290980 Ga0501046_0290980_168_626 150
716 3300049581 Ga0501047_0074417 Ga0501047_0074417_530_991 150
717 3300049581 Ga0501047_0270011 Ga0501047_0270011_469_930 150
718 3300049584 Ga0501068_0028035 Ga0501068_0028035_977_1438 150
719 3300049588 Ga0501072_0466412 Ga0501072_0466412_528_986 150
720 3300049741 Ga0501079_0539005 Ga0501079_0539005_91_549 150
721 3300049742 Ga0501080_0738379 Ga0501080_0738379_142_603 150
722 3300049823 Ga0501044_0091308 Ga0501044_0091308_983_1444 150
723 3300049823 Ga0501044_0571169 Ga0501044_0571169_271_732 150
724 3300049824 Ga0501045_0348905 Ga0501045_0348905_139_597 150
725 3300050492 nmdc:mga0yw44_468218_c1 nmdc:mga0yw44_468218_c1_247_705 150
726 3300050507 nmdc:mga05p37_290299_c1 nmdc:mga05p37_290299_c1_1068_1535 150
727 3300050507 nmdc:mga05p37_31594_c1 nmdc:mga05p37_31594_c1_3110_3568 150
728 3300050508 nmdc:mga09592_263752_c1 nmdc:mga09592_263752_c1_1004_1462 150
729 3300050509 nmdc:mga0qj67_22569_c1 nmdc:mga0qj67_22569_c1_3833_4291 150
730 3300050510 nmdc:mga06r32_170195_c1 nmdc:mga06r32_170195_c1_1495_1953 150
731 3300060353 Ga0501082_0846214 Ga0501082_0846214_197_658 150
732 3300060353 Ga0501082_1052037 Ga0501082_1052037_91_552 150
733 3300005455 Ga0070663_100794333 Ga0070663_1007943332 151
734 3300005458 Ga0070681_10827745 Ga0070681_108277451 151
735 3300005535 Ga0070684_100034692 Ga0070684_1000346921 151
736 3300005536 Ga0070697_100564454 Ga0070697_1005644542 151
737 3300006175 Ga0070712_100886429 Ga0070712_1008864292 151
738 3300006852 Ga0075433_10226935 Ga0075433_102269354 151
739 3300007076 Ga0075435_100019166 Ga0075435_1000191668 151
740 3300009147 Ga0114129_10137377 Ga0114129_101373774 151
741 3300013297 Ga0157378_10335215 Ga0157378_103352153 151
742 3300025901 Ga0207688_10051972 Ga0207688_100519722 151
743 3300025936 Ga0207670_10075446 Ga0207670_100754462 151
744 3300025944 Ga0207661_10118789 Ga0207661_101187895 151
745 3300037312 Ga0395899_0432691 Ga0395899_0432691_123_587 151
746 3300037418 Ga0395900_0093859 Ga0395900_0093859_791_1255 151
747 3300037418 Ga0395900_0207979 Ga0395900_0207979_1320_1784 151
748 3300037466 Ga0395898_0444326 Ga0395898_0444326_674_1162 151
749 3300037466 Ga0395898_0818406 Ga0395898_0818406_44_508 151
750 3300037471 Ga0395905_0010323 Ga0395905_0010323_7882_8346 151
751 3300037471 Ga0395905_0492925 Ga0395905_0492925_334_798 151
752 3300038443 Ga0395901_0018292 Ga0395901_0018292_5948_6412 151
753 3300038443 Ga0395901_0220964 Ga0395901_0220964_730_1194 151
754 3300038443 Ga0395901_0508705 Ga0395901_0508705_63_551 151
755 3300049568 Ga0501031_0340991 Ga0501031_0340991_370_834 151
756 3300049587 Ga0501071_0211570 Ga0501071_0211570_632_1096 151
757 3300049824 Ga0501045_0068634 Ga0501045_0068634_1216_1680 151
758 3300050507 nmdc:mga05p37_145331_c1 nmdc:mga05p37_145331_c1_2082_2567 151
759 3300050512 nmdc:mga0n895_432002_c1 nmdc:mga0n895_432002_c1_609_1094 151
760 3300050513 nmdc:mga0rr50_137768_c1 nmdc:mga0rr50_137768_c1_786_1271 151
761 3300050515 nmdc:mga0a205_158356_c1 nmdc:mga0a205_158356_c1_1198_1683 151
762 3300060353 Ga0501082_1367385 Ga0501082_1367385_101_565 151
763 3300005440 Ga0070705_100860483 Ga0070705_1008604832 152
764 3300005445 Ga0070708_100779445 Ga0070708_1007794452 152
765 3300005616 Ga0068852_100158542 Ga0068852_1001585421 152
766 3300006028 Ga0070717_11306724 Ga0070717_113067242 152
767 3300009094 Ga0111539_10136922 Ga0111539_101369222 152
768 3300009098 Ga0105245_11633487 Ga0105245_116334871 152
769 3300009176 Ga0105242_10574181 Ga0105242_105741813 152
770 3300015265 Ga0182005_1226018 Ga0182005_12260182 152
771 3300020082 Ga0206353_10294215 Ga0206353_102942152 152
772 3300025899 Ga0207642_10528561 Ga0207642_105285612 152
773 3300025910 Ga0207684_10203152 Ga0207684_102031522 152
774 3300025937 Ga0207669_10735304 Ga0207669_107353042 152
775 3300032126 Ga0307415_100478049 Ga0307415_1004780492 152
776 3300035170 Ga0373943_0195813 Ga0373943_0195813_560_1027 152
777 3300037312 Ga0395899_0188370 Ga0395899_0188370_55_513 152
778 3300044658 Ga0466972_0236415 Ga0466972_0236415_29_487 152
779 3300045051 Ga0451576_0203451 Ga0451576_0203451_414_878 152
780 3300046501 Ga0495607_0240612 Ga0495607_0240612_371_847 152
781 3300050511 nmdc:mga08y16_87398_c1 nmdc:mga08y16_87398_c1_1122_1598 152
782 3300005329 Ga0070683_100640123 Ga0070683_1006401232 153
783 3300005343 Ga0070687_100356478 Ga0070687_1003564783 153
784 3300005347 Ga0070668_100541673 Ga0070668_1005416732 153
785 3300005355 Ga0070671_100657015 Ga0070671_1006570151 153
786 3300005356 Ga0070674_100192082 Ga0070674_1001920824 153
787 3300005434 Ga0070709_10069690 Ga0070709_100696904 153
788 3300005435 Ga0070714_100036119 Ga0070714_1000361194 153
789 3300005436 Ga0070713_100015287 Ga0070713_1000152873 153
790 3300005439 Ga0070711_100617375 Ga0070711_1006173752 153
791 3300005440 Ga0070705_101167859 Ga0070705_1011678591 153
792 3300005441 Ga0070700_101470507 Ga0070700_1014705071 153
793 3300005456 Ga0070678_100387508 Ga0070678_1003875082 153
794 3300005547 Ga0070693_100328492 Ga0070693_1003284922 153
795 3300005549 Ga0070704_100686008 Ga0070704_1006860082 153
796 3300005564 Ga0070664_100558379 Ga0070664_1005583793 153
797 3300005614 Ga0068856_100229998 Ga0068856_1002299982 153
798 3300005615 Ga0070702_100253560 Ga0070702_1002535602 153
799 3300005937 Ga0081455_10020547 Ga0081455_100205478 153
800 3300006028 Ga0070717_10433736 Ga0070717_104337362 153
801 3300006173 Ga0070716_100054970 Ga0070716_1000549701 153
802 3300006175 Ga0070712_100651146 Ga0070712_1006511462 153
803 3300006358 Ga0068871_100511796 Ga0068871_1005117961 153
804 3300006871 Ga0075434_100621659 Ga0075434_1006216592 153
805 3300006881 Ga0068865_100237350 Ga0068865_1002373504 153
806 3300007076 Ga0075435_101559249 Ga0075435_1015592491 153
807 3300009098 Ga0105245_10053596 Ga0105245_100535961 153
808 3300009098 Ga0105245_10531229 Ga0105245_105312291 153
809 3300009176 Ga0105242_11271182 Ga0105242_112711822 153
810 3300009177 Ga0105248_10137270 Ga0105248_101372702 153
811 3300010375 Ga0105239_10246359 Ga0105239_102463594 153
812 3300013296 Ga0157374_10046244 Ga0157374_100462445 153
813 3300013308 Ga0157375_10027240 Ga0157375_100272407 153
814 3300013308 Ga0157375_10260119 Ga0157375_102601193 153
815 3300013308 Ga0157375_10460462 Ga0157375_104604624 153
816 3300014968 Ga0157379_10596329 Ga0157379_105963292 153
817 3300025906 Ga0207699_10156234 Ga0207699_101562343 153
818 3300025915 Ga0207693_10100461 Ga0207693_101004613 153
819 3300025915 Ga0207693_10228354 Ga0207693_102283542 153
820 3300025916 Ga0207663_10062388 Ga0207663_100623884 153
821 3300025927 Ga0207687_10096561 Ga0207687_100965611 153
822 3300025927 Ga0207687_10117843 Ga0207687_101178434 153
823 3300025928 Ga0207700_10000002 Ga0207700_10000002425 153
824 3300025929 Ga0207664_10074512 Ga0207664_100745122 153
825 3300025931 Ga0207644_10363922 Ga0207644_103639224 153
826 3300025937 Ga0207669_10191948 Ga0207669_101919482 153
827 3300025938 Ga0207704_10081409 Ga0207704_100814093 153
828 3300025938 Ga0207704_10301315 Ga0207704_103013152 153
829 3300025939 Ga0207665_10035914 Ga0207665_100359146 153
830 3300025941 Ga0207711_10390333 Ga0207711_103903332 153
831 3300025981 Ga0207640_11654201 Ga0207640_116542012 153
832 3300032002 Ga0307416_100338443 Ga0307416_1003384433 153
833 3300035725 Ga0373947_0060004 Ga0373947_0060004_1124_1585 153
834 3300037418 Ga0395900_0319289 Ga0395900_0319289_1056_1517 153
835 3300037418 Ga0395900_0913130 Ga0395900_0913130_149_619 153
836 3300037466 Ga0395898_0075456 Ga0395898_0075456_1317_1781 153
837 3300037471 Ga0395905_0282842 Ga0395905_0282842_39_500 153
838 3300038443 Ga0395901_0162688 Ga0395901_0162688_1542_2006 153
839 3300038443 Ga0395901_0368797 Ga0395901_0368797_103_564 153
840 3300038443 Ga0395901_0517224 Ga0395901_0517224_410_874 153
841 3300046455 Ga0495603_0036835 Ga0495603_0036835_526_987 153
842 3300046459 Ga0495629_0010449 Ga0495629_0010449_5261_5722 153
843 3300046474 Ga0495605_0060561 Ga0495605_0060561_1201_1668 153
844 3300046517 Ga0495630_0332115 Ga0495630_0332115_459_920 153
845 3300046525 Ga0495663_0037106 Ga0495663_0037106_59_526 153
846 3300046538 Ga0495609_0392187 Ga0495609_0392187_44_511 153
847 3300046615 Ga0495656_0023739 Ga0495656_0023739_878_1345 153
848 3300046616 Ga0495668_0091391 Ga0495668_0091391_129_596 153
849 3300046642 Ga0495634_0026676 Ga0495634_0026676_2348_2809 153
850 3300046683 Ga0495658_0035298 Ga0495658_0035298_1420_1881 153
851 3300046689 Ga0495613_0032094 Ga0495613_0032094_20_481 153
852 3300047321 Ga0495676_0376314 Ga0495676_0376314_278_739 153
853 3300047323 Ga0495683_0332604 Ga0495683_0332604_115_582 153
854 3300047445 Ga0495677_0074525 Ga0495677_0074525_607_1074 153
855 3300048903 Ga0496100_0230211 Ga0496100_0230211_659_1132 153
856 3300048905 Ga0496102_0188109 Ga0496102_0188109_980_1441 153
857 3300048905 Ga0496102_0301658 Ga0496102_0301658_1024_1491 153
858 3300048906 Ga0496103_0221215 Ga0496103_0221215_161_622 153
859 3300048907 Ga0496104_0638886 Ga0496104_0638886_335_799 153
860 3300048908 Ga0496105_0112015 Ga0496105_0112015_561_1028 153
861 3300048908 Ga0496105_0440424 Ga0496105_0440424_28_489 153
862 3300048909 Ga0496106_0065555 Ga0496106_0065555_1958_2431 153
863 3300048911 Ga0496108_0015690 Ga0496108_0015690_4475_4942 153
864 3300048912 Ga0496109_0002666 Ga0496109_0002666_13921_14388 153
865 3300048913 Ga0496110_0019386 Ga0496110_0019386_235_699 153
866 3300048913 Ga0496110_0174766 Ga0496110_0174766_1150_1611 153
867 3300048914 Ga0496111_0014750 Ga0496111_0014750_1275_1742 153
868 3300048914 Ga0496111_0048567 Ga0496111_0048567_228_692 153
869 3300048916 Ga0496113_0141221 Ga0496113_0141221_509_976 153
870 3300048916 Ga0496113_1162616 Ga0496113_1162616_76_537 153
871 3300048917 Ga0496114_0359036 Ga0496114_0359036_379_846 153
872 3300049583 Ga0501067_0009408 Ga0501067_0009408_4044_4508 153
873 3300049584 Ga0501068_0004349 Ga0501068_0004349_3748_4212 153
874 3300049585 Ga0501069_0010998 Ga0501069_0010998_3877_4341 153
875 3300049587 Ga0501071_0104017 Ga0501071_0104017_1304_1768 153
876 3300049743 Ga0501081_0311129 Ga0501081_0311129_199_663 153
877 3300050511 nmdc:mga08y16_809306_c1 nmdc:mga08y16_809306_c1_64_537 153
878 3300050513 nmdc:mga0rr50_1458445_c1 nmdc:mga0rr50_1458445_c1_42_506 153
879 3300061734 Ga0530510_0262845 Ga0530510_0262845_28_492 153
880 3300002077 JGI24744J21845_10004964 JGI24744J21845_100049645 154
881 3300003320 rootH2_10267484 rootH2_102674842 154
882 3300005327 Ga0070658_10011118 Ga0070658_100111185 154
883 3300005327 Ga0070658_10012511 Ga0070658_100125118 154
884 3300005327 Ga0070658_10037607 Ga0070658_100376074 154
885 3300005327 Ga0070658_10089363 Ga0070658_100893635 154
886 3300005327 Ga0070658_10631686 Ga0070658_106316862 154
887 3300005327 Ga0070658_10894912 Ga0070658_108949121 154
888 3300005328 Ga0070676_10632294 Ga0070676_106322942 154
889 3300005329 Ga0070683_100045953 Ga0070683_1000459535 154
890 3300005329 Ga0070683_100114047 Ga0070683_1001140473 154
891 3300005329 Ga0070683_100125154 Ga0070683_1001251545 154
892 3300005336 Ga0070680_100189779 Ga0070680_1001897792 154
893 3300005336 Ga0070680_100270173 Ga0070680_1002701733 154
894 3300005336 Ga0070680_100359769 Ga0070680_1003597692 154
895 3300005337 Ga0070682_100003833 Ga0070682_1000038335 154
896 3300005337 Ga0070682_100082599 Ga0070682_1000825992 154
897 3300005338 Ga0068868_100058917 Ga0068868_1000589174 154
898 3300005339 Ga0070660_100001665 Ga0070660_10000166512 154
899 3300005339 Ga0070660_100022103 Ga0070660_1000221032 154
900 3300005339 Ga0070660_100025708 Ga0070660_1000257084 154
901 3300005340 Ga0070689_100009236 Ga0070689_1000092365 154
902 3300005344 Ga0070661_100006189 Ga0070661_1000061895 154
903 3300005344 Ga0070661_100070597 Ga0070661_1000705975 154
904 3300005345 Ga0070692_10041713 Ga0070692_100417134 154
905 3300005347 Ga0070668_100065272 Ga0070668_1000652722 154
906 3300005347 Ga0070668_100501464 Ga0070668_1005014642 154
907 3300005355 Ga0070671_100085522 Ga0070671_1000855223 154
908 3300005356 Ga0070674_100001487 Ga0070674_1000014873 154
909 3300005364 Ga0070673_100013725 Ga0070673_1000137256 154
910 3300005365 Ga0070688_100002522 Ga0070688_1000025225 154
911 3300005366 Ga0070659_100206030 Ga0070659_1002060302 154
912 3300005366 Ga0070659_100212504 Ga0070659_1002125042 154
913 3300005366 Ga0070659_100277829 Ga0070659_1002778292 154
914 3300005366 Ga0070659_100722101 Ga0070659_1007221011 154
915 3300005406 Ga0070703_10058900 Ga0070703_100589002 154
916 3300005434 Ga0070709_10013590 Ga0070709_100135904 154
917 3300005434 Ga0070709_10414217 Ga0070709_104142172 154
918 3300005434 Ga0070709_10980341 Ga0070709_109803411 154
919 3300005435 Ga0070714_100090873 Ga0070714_1000908734 154
920 3300005435 Ga0070714_100122082 Ga0070714_1001220825 154
921 3300005435 Ga0070714_100328993 Ga0070714_1003289932 154
922 3300005435 Ga0070714_100761416 Ga0070714_1007614161 154
923 3300005435 Ga0070714_101249265 Ga0070714_1012492651 154
924 3300005435 Ga0070714_101407980 Ga0070714_1014079801 154
925 3300005436 Ga0070713_100141221 Ga0070713_1001412214 154
926 3300005436 Ga0070713_100365203 Ga0070713_1003652032 154
927 3300005436 Ga0070713_100424007 Ga0070713_1004240072 154
928 3300005437 Ga0070710_10007091 Ga0070710_100070915 154
929 3300005438 Ga0070701_10005157 Ga0070701_100051573 154
930 3300005439 Ga0070711_100017676 Ga0070711_1000176766 154
931 3300005439 Ga0070711_100613518 Ga0070711_1006135182 154
932 3300005440 Ga0070705_100101804 Ga0070705_1001018044 154
933 3300005440 Ga0070705_100130889 Ga0070705_1001308894 154
934 3300005440 Ga0070705_100328817 Ga0070705_1003288172 154
935 3300005441 Ga0070700_100014136 Ga0070700_1000141365 154
936 3300005445 Ga0070708_100051628 Ga0070708_1000516283 154
937 3300005445 Ga0070708_100073049 Ga0070708_1000730492 154
938 3300005455 Ga0070663_100023999 Ga0070663_1000239994 154
939 3300005456 Ga0070678_100036946 Ga0070678_1000369463 154
940 3300005457 Ga0070662_100040778 Ga0070662_1000407784 154
941 3300005458 Ga0070681_10096407 Ga0070681_100964075 154
942 3300005458 Ga0070681_10176057 Ga0070681_101760572 154
943 3300005458 Ga0070681_10235384 Ga0070681_102353842 154
944 3300005458 Ga0070681_10304925 Ga0070681_103049252 154
945 3300005459 Ga0068867_100185756 Ga0068867_1001857562 154
946 3300005466 Ga0070685_10003020 Ga0070685_100030203 154
947 3300005467 Ga0070706_100012667 Ga0070706_1000126675 154
948 3300005467 Ga0070706_100064342 Ga0070706_1000643424 154
949 3300005467 Ga0070706_100631250 Ga0070706_1006312502 154
950 3300005468 Ga0070707_100000987 Ga0070707_10000098711 154
951 3300005468 Ga0070707_100068327 Ga0070707_1000683273 154
952 3300005468 Ga0070707_100556034 Ga0070707_1005560342 154
953 3300005468 Ga0070707_100754072 Ga0070707_1007540722 154
954 3300005471 Ga0070698_100056233 Ga0070698_1000562333 154
955 3300005471 Ga0070698_100111023 Ga0070698_1001110232 154
956 3300005471 Ga0070698_100131851 Ga0070698_1001318512 154
957 3300005471 Ga0070698_100179237 Ga0070698_1001792374 154
958 3300005471 Ga0070698_100582973 Ga0070698_1005829731 154
959 3300005518 Ga0070699_100008491 Ga0070699_1000084919 154
960 3300005518 Ga0070699_100657917 Ga0070699_1006579171 154
961 3300005518 Ga0070699_100724963 Ga0070699_1007249632 154
962 3300005530 Ga0070679_100040934 Ga0070679_1000409345 154
963 3300005530 Ga0070679_100070763 Ga0070679_1000707633 154
964 3300005530 Ga0070679_100073299 Ga0070679_1000732995 154
965 3300005530 Ga0070679_100117957 Ga0070679_1001179573 154
966 3300005530 Ga0070679_100196807 Ga0070679_1001968074 154
967 3300005530 Ga0070679_100407711 Ga0070679_1004077112 154
968 3300005535 Ga0070684_100098475 Ga0070684_1000984752 154
969 3300005535 Ga0070684_100154543 Ga0070684_1001545435 154
970 3300005535 Ga0070684_101725277 Ga0070684_1017252771 154
971 3300005536 Ga0070697_101110109 Ga0070697_1011101092 154
972 3300005539 Ga0068853_100002166 Ga0068853_10000216612 154
973 3300005543 Ga0070672_100010856 Ga0070672_1000108563 154
974 3300005544 Ga0070686_100004390 Ga0070686_1000043907 154
975 3300005545 Ga0070695_100159387 Ga0070695_1001593873 154
976 3300005546 Ga0070696_100046541 Ga0070696_1000465414 154
977 3300005547 Ga0070693_100019127 Ga0070693_1000191275 154
978 3300005549 Ga0070704_100009096 Ga0070704_1000090963 154
979 3300005549 Ga0070704_100250786 Ga0070704_1002507862 154
980 3300005563 Ga0068855_100009395 Ga0068855_10000939513 154
981 3300005614 Ga0068856_100023638 Ga0068856_1000236387 154
982 3300005614 Ga0068856_100455686 Ga0068856_1004556863 154
983 3300005614 Ga0068856_101841534 Ga0068856_1018415342 154
984 3300005615 Ga0070702_100015884 Ga0070702_1000158844 154
985 3300005615 Ga0070702_100158477 Ga0070702_1001584771 154
986 3300005616 Ga0068852_100667715 Ga0068852_1006677152 154
987 3300005616 Ga0068852_100983481 Ga0068852_1009834811 154
988 3300005719 Ga0068861_100023044 Ga0068861_1000230445 154
989 3300005719 Ga0068861_100029073 Ga0068861_1000290735 154
990 3300005983 Ga0081540_1010729 Ga0081540_10107292 154
991 3300005983 Ga0081540_1011619 Ga0081540_10116195 154
992 3300006058 Ga0075432_10062548 Ga0075432_100625483 154
993 3300006163 Ga0070715_10089779 Ga0070715_100897792 154
994 3300006173 Ga0070716_100119106 Ga0070716_1001191062 154
995 3300006175 Ga0070712_100009687 Ga0070712_1000096875 154
996 3300006175 Ga0070712_100194905 Ga0070712_1001949054 154
997 3300006175 Ga0070712_100792742 Ga0070712_1007927421 154
998 3300006178 Ga0075367_10728467 Ga0075367_107284672 154
999 3300006358 Ga0068871_100139276 Ga0068871_1001392762 154
1000 3300006844 Ga0075428_100188399 Ga0075428_1001883992 154
1001 3300006852 Ga0075433_10004929 Ga0075433_1000492911 154
1002 3300006852 Ga0075433_10618119 Ga0075433_106181192 154
1003 3300006871 Ga0075434_100008326 Ga0075434_1000083266 154
1004 3300006871 Ga0075434_100093791 Ga0075434_1000937912 154
1005 3300006880 Ga0075429_100477969 Ga0075429_1004779693 154
1006 3300006881 Ga0068865_100000845 Ga0068865_10000084519 154
1007 3300006914 Ga0075436_100003895 Ga0075436_1000038956 154
1008 3300007076 Ga0075435_100002068 Ga0075435_1000020687 154
1009 3300007076 Ga0075435_100651760 Ga0075435_1006517602 154
1010 3300009093 Ga0105240_10009485 Ga0105240_100094859 154
1011 3300009093 Ga0105240_10094783 Ga0105240_100947835 154
1012 3300009093 Ga0105240_10167086 Ga0105240_101670863 154
1013 3300009094 Ga0111539_10251402 Ga0111539_102514022 154
1014 3300009094 Ga0111539_10557627 Ga0111539_105576272 154
1015 3300009098 Ga0105245_10077224 Ga0105245_100772242 154
1016 3300009098 Ga0105245_11167698 Ga0105245_111676983 154
1017 3300009101 Ga0105247_10067377 Ga0105247_100673774 154
1018 3300009147 Ga0114129_10002455 Ga0114129_1000245518 154
1019 3300009148 Ga0105243_10603928 Ga0105243_106039284 154
1020 3300009148 Ga0105243_11306491 Ga0105243_113064912 154
1021 3300009174 Ga0105241_10450509 Ga0105241_104505092 154
1022 3300009177 Ga0105248_10070587 Ga0105248_100705877 154
1023 3300009551 Ga0105238_10074585 Ga0105238_100745853 154
1024 3300009551 Ga0105238_10589443 Ga0105238_105894432 154
1025 3300009551 Ga0105238_10616049 Ga0105238_106160492 154
1026 3300009551 Ga0105238_12726499 Ga0105238_127264991 154
1027 3300009553 Ga0105249_10003671 Ga0105249_100036716 154
1028 3300010375 Ga0105239_10013480 Ga0105239_100134805 154
1029 3300011119 Ga0105246_10082165 Ga0105246_100821653 154
1030 3300013100 Ga0157373_10138060 Ga0157373_101380603 154
1031 3300013102 Ga0157371_10206561 Ga0157371_102065612 154
1032 3300013104 Ga0157370_10008347 Ga0157370_1000834713 154
1033 3300013104 Ga0157370_10356510 Ga0157370_103565102 154
1034 3300013104 Ga0157370_10489841 Ga0157370_104898412 154
1035 3300013104 Ga0157370_10587314 Ga0157370_105873142 154
1036 3300013105 Ga0157369_10032504 Ga0157369_100325046 154
1037 3300013105 Ga0157369_10256308 Ga0157369_102563084 154
1038 3300013296 Ga0157374_10031825 Ga0157374_100318253 154
1039 3300013297 Ga0157378_10035568 Ga0157378_100355684 154
1040 3300013297 Ga0157378_10420671 Ga0157378_104206713 154
1041 3300013306 Ga0163162_10013357 Ga0163162_100133575 154
1042 3300013307 Ga0157372_10519684 Ga0157372_105196842 154
1043 3300013307 Ga0157372_10584613 Ga0157372_105846131 154
1044 3300013307 Ga0157372_11127040 Ga0157372_111270402 154
1045 3300013308 Ga0157375_10012526 Ga0157375_100125268 154
1046 3300013308 Ga0157375_11029040 Ga0157375_110290402 154
1047 3300014497 Ga0182008_10003536 Ga0182008_1000353612 154
1048 3300014497 Ga0182008_10072470 Ga0182008_100724702 154
1049 3300014745 Ga0157377_10001386 Ga0157377_100013869 154
1050 3300014969 Ga0157376_10024111 Ga0157376_100241115 154
1051 3300015261 Ga0182006_1053309 Ga0182006_10533092 154
1052 3300017792 Ga0163161_10088999 Ga0163161_100889993 154
1053 3300020069 Ga0197907_10020787 Ga0197907_100207873 154
1054 3300020070 Ga0206356_10612056 Ga0206356_106120563 154
1055 3300020081 Ga0206354_10736297 Ga0206354_107362973 154
1056 3300020081 Ga0206354_10956645 Ga0206354_109566452 154
1057 3300020082 Ga0206353_10000551 Ga0206353_100005512 154
1058 3300020082 Ga0206353_10185240 Ga0206353_101852404 154
1059 3300020082 Ga0206353_10315338 Ga0206353_103153382 154
1060 3300020082 Ga0206353_12070731 Ga0206353_120707315 154
1061 3300025885 Ga0207653_10044755 Ga0207653_100447552 154
1062 3300025899 Ga0207642_10001681 Ga0207642_100016815 154
1063 3300025901 Ga0207688_10335215 Ga0207688_103352152 154
1064 3300025906 Ga0207699_10040133 Ga0207699_100401333 154
1065 3300025906 Ga0207699_10267664 Ga0207699_102676644 154
1066 3300025909 Ga0207705_10011067 Ga0207705_100110674 154
1067 3300025909 Ga0207705_10018112 Ga0207705_100181123 154
1068 3300025909 Ga0207705_10074140 Ga0207705_100741402 154
1069 3300025909 Ga0207705_10175334 Ga0207705_101753342 154
1070 3300025909 Ga0207705_10202786 Ga0207705_102027863 154
1071 3300025912 Ga0207707_10019294 Ga0207707_100192942 154
1072 3300025912 Ga0207707_10051474 Ga0207707_100514741 154
1073 3300025912 Ga0207707_10233044 Ga0207707_102330443 154
1074 3300025912 Ga0207707_10358052 Ga0207707_103580522 154
1075 3300025913 Ga0207695_10029265 Ga0207695_100292657 154
1076 3300025913 Ga0207695_10216670 Ga0207695_102166704 154
1077 3300025913 Ga0207695_10319656 Ga0207695_103196562 154
1078 3300025913 Ga0207695_10869274 Ga0207695_108692742 154
1079 3300025915 Ga0207693_10001729 Ga0207693_1000172919 154
1080 3300025915 Ga0207693_10020626 Ga0207693_100206264 154
1081 3300025915 Ga0207693_10336566 Ga0207693_103365662 154
1082 3300025915 Ga0207693_10714617 Ga0207693_107146172 154
1083 3300025916 Ga0207663_10069152 Ga0207663_100691524 154
1084 3300025917 Ga0207660_10041302 Ga0207660_100413024 154
1085 3300025917 Ga0207660_10049161 Ga0207660_100491612 154
1086 3300025917 Ga0207660_10243334 Ga0207660_102433342 154
1087 3300025917 Ga0207660_10367722 Ga0207660_103677222 154
1088 3300025917 Ga0207660_10747665 Ga0207660_107476651 154
1089 3300025919 Ga0207657_10006843 Ga0207657_1000684312 154
1090 3300025919 Ga0207657_10024620 Ga0207657_100246206 154
1091 3300025919 Ga0207657_10074499 Ga0207657_100744994 154
1092 3300025919 Ga0207657_10095024 Ga0207657_100950245 154
1093 3300025920 Ga0207649_10033475 Ga0207649_100334755 154
1094 3300025921 Ga0207652_10025179 Ga0207652_100251791 154
1095 3300025921 Ga0207652_10045263 Ga0207652_100452636 154
1096 3300025921 Ga0207652_10051061 Ga0207652_100510612 154
1097 3300025921 Ga0207652_10057548 Ga0207652_100575485 154
1098 3300025921 Ga0207652_10265708 Ga0207652_102657082 154
1099 3300025921 Ga0207652_10524768 Ga0207652_105247682 154
1100 3300025922 Ga0207646_10007181 Ga0207646_100071814 154
1101 3300025922 Ga0207646_10072158 Ga0207646_100721584 154
1102 3300025922 Ga0207646_10423163 Ga0207646_104231632 154
1103 3300025924 Ga0207694_10427034 Ga0207694_104270342 154
1104 3300025924 Ga0207694_10566623 Ga0207694_105666233 154
1105 3300025927 Ga0207687_10014242 Ga0207687_100142425 154
1106 3300025927 Ga0207687_10114078 Ga0207687_101140783 154
1107 3300025927 Ga0207687_10811583 Ga0207687_108115831 154
1108 3300025928 Ga0207700_10158598 Ga0207700_101585982 154
1109 3300025928 Ga0207700_10399199 Ga0207700_103991992 154
1110 3300025929 Ga0207664_10011939 Ga0207664_100119397 154
1111 3300025929 Ga0207664_10143788 Ga0207664_101437883 154
1112 3300025929 Ga0207664_10842925 Ga0207664_108429252 154
1113 3300025931 Ga0207644_10087477 Ga0207644_100874771 154
1114 3300025932 Ga0207690_10166655 Ga0207690_101666552 154
1115 3300025932 Ga0207690_10576338 Ga0207690_105763382 154
1116 3300025933 Ga0207706_10130383 Ga0207706_101303832 154
1117 3300025934 Ga0207686_10014123 Ga0207686_100141235 154
1118 3300025934 Ga0207686_10301950 Ga0207686_103019502 154
1119 3300025935 Ga0207709_10020292 Ga0207709_100202927 154
1120 3300025935 Ga0207709_10055785 Ga0207709_100557854 154
1121 3300025935 Ga0207709_10504419 Ga0207709_105044192 154
1122 3300025938 Ga0207704_10327223 Ga0207704_103272232 154
1123 3300025939 Ga0207665_10095487 Ga0207665_100954874 154
1124 3300025939 Ga0207665_10417134 Ga0207665_104171342 154
1125 3300025939 Ga0207665_11120967 Ga0207665_111209672 154
1126 3300025940 Ga0207691_10029592 Ga0207691_100295921 154
1127 3300025942 Ga0207689_10209693 Ga0207689_102096933 154
1128 3300025944 Ga0207661_10226515 Ga0207661_102265153 154
1129 3300025944 Ga0207661_11236294 Ga0207661_112362941 154
1130 3300025949 Ga0207667_10065584 Ga0207667_100655844 154
1131 3300025949 Ga0207667_10845329 Ga0207667_108453292 154
1132 3300025960 Ga0207651_10067143 Ga0207651_100671432 154
1133 3300025961 Ga0207712_10029720 Ga0207712_100297205 154
1134 3300025972 Ga0207668_10016042 Ga0207668_100160425 154
1135 3300025972 Ga0207668_10248203 Ga0207668_102482032 154
1136 3300026023 Ga0207677_10040183 Ga0207677_100401834 154
1137 3300026035 Ga0207703_10523642 Ga0207703_105236422 154
1138 3300026041 Ga0207639_10311139 Ga0207639_103111392 154
1139 3300026041 Ga0207639_10444900 Ga0207639_104449002 154
1140 3300026067 Ga0207678_10009877 Ga0207678_100098774 154
1141 3300026075 Ga0207708_10010297 Ga0207708_100102974 154
1142 3300026078 Ga0207702_10086545 Ga0207702_100865455 154
1143 3300026078 Ga0207702_10183304 Ga0207702_101833042 154
1144 3300026078 Ga0207702_11082788 Ga0207702_110827882 154
1145 3300026089 Ga0207648_10001442 Ga0207648_1000144224 154
1146 3300026118 Ga0207675_100013703 Ga0207675_1000137034 154
1147 3300026118 Ga0207675_100164794 Ga0207675_1001647943 154
1148 3300026118 Ga0207675_101015797 Ga0207675_1010157972 154
1149 3300026121 Ga0207683_10001430 Ga0207683_1000143014 154
1150 3300026142 Ga0207698_10367156 Ga0207698_103671563 154
1151 3300026142 Ga0207698_10548089 Ga0207698_105480892 154
1152 3300027907 Ga0207428_10067936 Ga0207428_100679362 154
1153 3300028379 Ga0268266_10050608 Ga0268266_100506084 154
1154 3300028381 Ga0268264_10251761 Ga0268264_102517613 154
1155 3300028381 Ga0268264_10472505 Ga0268264_104725052 154
1156 3300028556 Ga0265337_1053257 Ga0265337_10532572 154
1157 3300028558 Ga0265326_10016459 Ga0265326_100164592 154
1158 3300028563 Ga0265319_1002815 Ga0265319_100281513 154
1159 3300028563 Ga0265319_1003098 Ga0265319_10030982 154
1160 3300028573 Ga0265334_10017903 Ga0265334_100179034 154
1161 3300028573 Ga0265334_10030810 Ga0265334_100308102 154
1162 3300028573 Ga0265334_10114807 Ga0265334_101148072 154
1163 3300028577 Ga0265318_10000752 Ga0265318_1000075214 154
1164 3300028577 Ga0265318_10002259 Ga0265318_100022595 154
1165 3300028577 Ga0265318_10063297 Ga0265318_100632972 154
1166 3300028653 Ga0265323_10182622 Ga0265323_101826222 154
1167 3300028654 Ga0265322_10080384 Ga0265322_100803842 154
1168 3300028666 Ga0265336_10053548 Ga0265336_100535482 154
1169 3300028800 Ga0265338_10003630 Ga0265338_1000363015 154
1170 3300028800 Ga0265338_10008799 Ga0265338_1000879915 154
1171 3300028800 Ga0265338_10011714 Ga0265338_100117147 154
1172 3300028800 Ga0265338_10013077 Ga0265338_100130776 154
1173 3300028800 Ga0265338_10017093 Ga0265338_100170936 154
1174 3300028800 Ga0265338_10048449 Ga0265338_100484496 154
1175 3300028800 Ga0265338_10219106 Ga0265338_102191062 154
1176 3300029957 Ga0265324_10039634 Ga0265324_100396342 154
1177 3300029957 Ga0265324_10080263 Ga0265324_100802632 154
1178 3300031235 Ga0265330_10002499 Ga0265330_100024992 154
1179 3300031235 Ga0265330_10019710 Ga0265330_100197103 154
1180 3300031235 Ga0265330_10131203 Ga0265330_101312032 154
1181 3300031238 Ga0265332_10055543 Ga0265332_100555432 154
1182 3300031240 Ga0265320_10140187 Ga0265320_101401872 154
1183 3300031241 Ga0265325_10000754 Ga0265325_1000075416 154
1184 3300031241 Ga0265325_10242041 Ga0265325_102420412 154
1185 3300031242 Ga0265329_10034614 Ga0265329_100346142 154
1186 3300031247 Ga0265340_10025820 Ga0265340_100258204 154
1187 3300031247 Ga0265340_10048307 Ga0265340_100483073 154
1188 3300031249 Ga0265339_10003846 Ga0265339_100038463 154
1189 3300031249 Ga0265339_10006014 Ga0265339_100060147 154
1190 3300031249 Ga0265339_10184345 Ga0265339_101843453 154
1191 3300031250 Ga0265331_10002131 Ga0265331_1000213113 154
1192 3300031250 Ga0265331_10104504 Ga0265331_101045043 154
1193 3300031251 Ga0265327_10007600 Ga0265327_100076008 154
1194 3300031251 Ga0265327_10010689 Ga0265327_100106892 154
1195 3300031251 Ga0265327_10016471 Ga0265327_100164715 154
1196 3300031251 Ga0265327_10170027 Ga0265327_101700271 154
1197 3300031344 Ga0265316_10005704 Ga0265316_100057048 154
1198 3300031344 Ga0265316_10006899 Ga0265316_100068993 154
1199 3300031344 Ga0265316_10093360 Ga0265316_100933602 154
1200 3300031344 Ga0265316_10261810 Ga0265316_102618102 154
1201 3300031595 Ga0265313_10017597 Ga0265313_100175972 154
1202 3300031595 Ga0265313_10076357 Ga0265313_100763572 154
1203 3300031711 Ga0265314_10005119 Ga0265314_100051196 154
1204 3300031711 Ga0265314_10102489 Ga0265314_101024892 154
1205 3300031711 Ga0265314_10108971 Ga0265314_101089712 154
1206 3300031712 Ga0265342_10012427 Ga0265342_100124275 154
1207 3300031712 Ga0265342_10016563 Ga0265342_100165632 154
1208 3300031995 Ga0307409_100702210 Ga0307409_1007022102 154
1209 3300032002 Ga0307416_100935322 Ga0307416_1009353222 154
1210 3300032133 Ga0316583_10032926 Ga0316583_100329264 154
1211 3300035111 Ga0373923_0113379 Ga0373923_0113379_505_975 154
1212 3300035112 Ga0373932_0218421 Ga0373932_0218421_119_604 154
1213 3300035410 Ga0373924_0119663 Ga0373924_0119663_236_706 154
1214 3300035692 Ga0373935_0038598 Ga0373935_0038598_2287_2751 154
1215 3300035692 Ga0373935_0771687 Ga0373935_0771687_36_512 154
1216 3300035724 Ga0373933_0040393 Ga0373933_0040393_1820_2290 154
1217 3300036401 Ga0373937_0279812 Ga0373937_0279812_410_880 154
1218 3300037068 Ga0373925_0132914 Ga0373925_0132914_1187_1657 154
1219 3300037312 Ga0395899_0003213 Ga0395899_0003213_950_1414 154
1220 3300037312 Ga0395899_0007467 Ga0395899_0007467_4671_5147 154
1221 3300037312 Ga0395899_0037790 Ga0395899_0037790_2997_3467 154
1222 3300037312 Ga0395899_0118909 Ga0395899_0118909_432_896 154
1223 3300037312 Ga0395899_0456122 Ga0395899_0456122_77_547 154
1224 3300037418 Ga0395900_0004199 Ga0395900_0004199_7965_8429 154
1225 3300037418 Ga0395900_0036662 Ga0395900_0036662_1000_1476 154
1226 3300037418 Ga0395900_0130827 Ga0395900_0130827_2090_2554 154
1227 3300037418 Ga0395900_0139602 Ga0395900_0139602_1748_2218 154
1228 3300037418 Ga0395900_0177119 Ga0395900_0177119_1680_2150 154
1229 3300037418 Ga0395900_0425658 Ga0395900_0425658_93_563 154
1230 3300037418 Ga0395900_0737116 Ga0395900_0737116_31_516 154
1231 3300037466 Ga0395898_0002942 Ga0395898_0002942_7783_8247 154
1232 3300037466 Ga0395898_0048454 Ga0395898_0048454_2676_3152 154
1233 3300037466 Ga0395898_0122096 Ga0395898_0122096_1399_1869 154
1234 3300037466 Ga0395898_0188871 Ga0395898_0188871_1308_1781 154
1235 3300037466 Ga0395898_0249371 Ga0395898_0249371_635_1105 154
1236 3300037466 Ga0395898_0349709 Ga0395898_0349709_571_1056 154
1237 3300037466 Ga0395898_0391041 Ga0395898_0391041_705_1175 154
1238 3300037466 Ga0395898_0692861 Ga0395898_0692861_225_695 154
1239 3300037466 Ga0395898_1066842 Ga0395898_1066842_233_703 154
1240 3300037466 Ga0395898_1284158 Ga0395898_1284158_165_629 154
1241 3300037471 Ga0395905_0000960 Ga0395905_0000960_22668_23132 154
1242 3300037471 Ga0395905_0007613 Ga0395905_0007613_3400_3876 154
1243 3300037471 Ga0395905_0118194 Ga0395905_0118194_747_1217 154
1244 3300037471 Ga0395905_0365069 Ga0395905_0365069_477_947 154
1245 3300038443 Ga0395901_0003508 Ga0395901_0003508_1031_1495 154
1246 3300038443 Ga0395901_0143043 Ga0395901_0143043_1099_1563 154
1247 3300038443 Ga0395901_0266311 Ga0395901_0266311_513_983 154
1248 3300038443 Ga0395901_0382849 Ga0395901_0382849_31_516 154
1249 3300038443 Ga0395901_0496573 Ga0395901_0496573_80_547 154
1250 3300038443 Ga0395901_0639407 Ga0395901_0639407_155_625 154
1251 3300038443 Ga0395901_0999216 Ga0395901_0999216_141_617 154
1252 3300038443 Ga0395901_1054848 Ga0395901_1054848_239_715 154
1253 3300038443 Ga0395901_1158285 Ga0395901_1158285_117_581 154
1254 3300039450 Ga0436363_1249881 Ga0436363_1249881_370_843 154
1255 3300041511 Ga0451855_1429443 Ga0451855_1429443_185_655 154
1256 3300041512 Ga0451853_2062307 Ga0451853_2062307_399_869 154
1257 3300044658 Ga0466972_0158720 Ga0466972_0158720_210_680 154
1258 3300044683 Ga0466965_0504426 Ga0466965_0504426_11_481 154
1259 3300044684 Ga0466966_0001610 Ga0466966_0001610_854_1324 154
1260 3300044694 Ga0466963_0002415 Ga0466963_0002415_831_1301 154
1261 3300044694 Ga0466963_0003590 Ga0466963_0003590_6076_6546 154
1262 3300044694 Ga0466963_0029254 Ga0466963_0029254_2395_2865 154
1263 3300044694 Ga0466963_0036255 Ga0466963_0036255_867_1337 154
1264 3300044694 Ga0466963_0124507 Ga0466963_0124507_508_978 154
1265 3300044694 Ga0466963_0188387 Ga0466963_0188387_259_729 154
1266 3300044694 Ga0466963_0845998 Ga0466963_0845998_142_612 154
1267 3300044706 Ga0466964_0209689 Ga0466964_0209689_307_777 154
1268 3300044706 Ga0466964_0317276 Ga0466964_0317276_36_506 154
1269 3300044735 Ga0466968_0036487 Ga0466968_0036487_71_541 154
1270 3300044842 Ga0466957_0254250 Ga0466957_0254250_489_959 154
1271 3300044842 Ga0466957_0257397 Ga0466957_0257397_651_1121 154
1272 3300044842 Ga0466957_0375257 Ga0466957_0375257_155_625 154
1273 3300045049 Ga0466959_0013332 Ga0466959_0013332_1927_2397 154
1274 3300045051 Ga0451576_0061634 Ga0451576_0061634_837_1310 154
1275 3300045836 Ga0466958_0015520 Ga0466958_0015520_285_755 154
1276 3300045836 Ga0466958_0031868 Ga0466958_0031868_776_1246 154
1277 3300045836 Ga0466958_0069160 Ga0466958_0069160_29_499 154
1278 3300045836 Ga0466958_0245650 Ga0466958_0245650_481_951 154
1279 3300045976 Ga0466967_0000086 Ga0466967_0000086_31815_32285 154
1280 3300045976 Ga0466967_0018967 Ga0466967_0018967_4623_5093 154
1281 3300045976 Ga0466967_0048869 Ga0466967_0048869_2125_2595 154
1282 3300045976 Ga0466967_0050867 Ga0466967_0050867_1118_1588 154
1283 3300045976 Ga0466967_0078386 Ga0466967_0078386_1937_2407 154
1284 3300045976 Ga0466967_0102976 Ga0466967_0102976_1910_2380 154
1285 3300045976 Ga0466967_0182085 Ga0466967_0182085_1048_1533 154
1286 3300045976 Ga0466967_0194467 Ga0466967_0194467_379_849 154
1287 3300045976 Ga0466967_0198837 Ga0466967_0198837_1096_1566 154
1288 3300045976 Ga0466967_0243480 Ga0466967_0243480_525_995 154
1289 3300045976 Ga0466967_0370756 Ga0466967_0370756_310_780 154
1290 3300045976 Ga0466967_0388945 Ga0466967_0388945_319_789 154
1291 3300045976 Ga0466967_0427196 Ga0466967_0427196_362_901 154
1292 3300045976 Ga0466967_0470619 Ga0466967_0470619_261_731 154
1293 3300045976 Ga0466967_0793379 Ga0466967_0793379_341_811 154
1294 3300045976 Ga0466967_1179105 Ga0466967_1179105_241_711 154
1295 3300046454 Ga0495592_0199585 Ga0495592_0199585_689_1159 154
1296 3300046455 Ga0495603_0026884 Ga0495603_0026884_2876_3346 154
1297 3300046459 Ga0495629_0168066 Ga0495629_0168066_35_505 154
1298 3300046461 Ga0495641_0281457 Ga0495641_0281457_129_611 154
1299 3300046463 Ga0495653_0054781 Ga0495653_0054781_1141_1611 154
1300 3300046463 Ga0495653_0074790 Ga0495653_0074790_1612_2106 154
1301 3300046473 Ga0495582_0052700 Ga0495582_0052700_1253_1717 154
1302 3300046473 Ga0495582_0073683 Ga0495582_0073683_1039_1509 154
1303 3300046474 Ga0495605_0234245 Ga0495605_0234245_225_695 154
1304 3300046475 Ga0495639_0054652 Ga0495639_0054652_1080_1544 154
1305 3300046499 Ga0495594_0018912 Ga0495594_0018912_131_595 154
1306 3300046499 Ga0495594_0218653 Ga0495594_0218653_58_528 154
1307 3300046500 Ga0495596_0099177 Ga0495596_0099177_502_972 154
1308 3300046511 Ga0495608_0027170 Ga0495608_0027170_2984_3454 154
1309 3300046511 Ga0495608_0112900 Ga0495608_0112900_1219_1683 154
1310 3300046511 Ga0495608_0379057 Ga0495608_0379057_326_802 154
1311 3300046514 Ga0495618_0057495 Ga0495618_0057495_1931_2407 154
1312 3300046514 Ga0495618_0401390 Ga0495618_0401390_185_655 154
1313 3300046517 Ga0495630_1039954 Ga0495630_1039954_11_487 154
1314 3300046518 Ga0495631_0298010 Ga0495631_0298010_182_652 154
1315 3300046528 Ga0495642_0118157 Ga0495642_0118157_594_1064 154
1316 3300046529 Ga0495652_0108724 Ga0495652_0108724_720_1196 154
1317 3300046529 Ga0495652_0518399 Ga0495652_0518399_129_611 154
1318 3300046531 Ga0495665_0062568 Ga0495665_0062568_411_875 154
1319 3300046533 Ga0495640_0419325 Ga0495640_0419325_172_654 154
1320 3300046535 Ga0495586_0082234 Ga0495586_0082234_770_1246 154
1321 3300046536 Ga0495587_0282994 Ga0495587_0282994_140_610 154
1322 3300046559 Ga0495667_0201710 Ga0495667_0201710_710_1204 154
1323 3300046559 Ga0495667_0219690 Ga0495667_0219690_87_563 154
1324 3300046559 Ga0495667_0981557 Ga0495667_0981557_19_483 154
1325 3300046642 Ga0495634_0042072 Ga0495634_0042072_1562_2032 154
1326 3300046664 Ga0495659_0074257 Ga0495659_0074257_376_846 154
1327 3300046674 Ga0495588_0161041 Ga0495588_0161041_647_1111 154
1328 3300046675 Ga0495657_0040642 Ga0495657_0040642_2332_2802 154
1329 3300046675 Ga0495657_0087186 Ga0495657_0087186_64_558 154
1330 3300046679 Ga0495623_0145691 Ga0495623_0145691_397_861 154
1331 3300046681 Ga0495647_0034491 Ga0495647_0034491_1211_1675 154
1332 3300046681 Ga0495647_0199443 Ga0495647_0199443_377_847 154
1333 3300046689 Ga0495613_0086476 Ga0495613_0086476_1406_1876 154
1334 3300046689 Ga0495613_0222616 Ga0495613_0222616_402_866 154
1335 3300047315 Ga0495581_0005520 Ga0495581_0005520_5298_5768 154
1336 3300047315 Ga0495581_0008376 Ga0495581_0008376_1819_2283 154
1337 3300047319 Ga0495674_0200167 Ga0495674_0200167_369_839 154
1338 3300047319 Ga0495674_0458869 Ga0495674_0458869_27_503 154
1339 3300047321 Ga0495676_0062485 Ga0495676_0062485_1543_2007 154
1340 3300047322 Ga0495680_0021619 Ga0495680_0021619_2130_2600 154
1341 3300047322 Ga0495680_0149911 Ga0495680_0149911_534_1028 154
1342 3300047322 Ga0495680_0596748 Ga0495680_0596748_247_723 154
1343 3300047471 Ga0495684_0017745 Ga0495684_0017745_1565_2035 154
1344 3300047471 Ga0495684_0220784 Ga0495684_0220784_297_773 154
1345 3300048088 Ga0495602_0048531 Ga0495602_0048531_605_1069 154
1346 3300048088 Ga0495602_0142008 Ga0495602_0142008_311_781 154
1347 3300048088 Ga0495602_0310260 Ga0495602_0310260_317_793 154
1348 3300048088 Ga0495602_0865708 Ga0495602_0865708_44_511 154
1349 3300048903 Ga0496100_0011597 Ga0496100_0011597_3289_3753 154
1350 3300048903 Ga0496100_0418492 Ga0496100_0418492_320_805 154
1351 3300048904 Ga0496101_0012292 Ga0496101_0012292_2540_3004 154
1352 3300048905 Ga0496102_0038900 Ga0496102_0038900_701_1165 154
1353 3300048905 Ga0496102_0521426 Ga0496102_0521426_335_805 154
1354 3300048905 Ga0496102_0855650 Ga0496102_0855650_109_594 154
1355 3300048906 Ga0496103_0019370 Ga0496103_0019370_868_1332 154
1356 3300048907 Ga0496104_0068082 Ga0496104_0068082_1618_2088 154
1357 3300048908 Ga0496105_0221595 Ga0496105_0221595_71_535 154
1358 3300048908 Ga0496105_0221843 Ga0496105_0221843_590_1060 154
1359 3300048909 Ga0496106_0008805 Ga0496106_0008805_2162_2626 154
1360 3300048909 Ga0496106_0015307 Ga0496106_0015307_368_844 154
1361 3300048909 Ga0496106_0174851 Ga0496106_0174851_346_831 154
1362 3300048910 Ga0496107_0012150 Ga0496107_0012150_961_1425 154
1363 3300048910 Ga0496107_0327494 Ga0496107_0327494_304_786 154
1364 3300048910 Ga0496107_0408488 Ga0496107_0408488_497_967 154
1365 3300048911 Ga0496108_0080088 Ga0496108_0080088_1804_2274 154
1366 3300048911 Ga0496108_0211620 Ga0496108_0211620_123_587 154
1367 3300048912 Ga0496109_0035566 Ga0496109_0035566_1372_1842 154
1368 3300048912 Ga0496109_0044089 Ga0496109_0044089_949_1413 154
1369 3300048912 Ga0496109_0209778 Ga0496109_0209778_402_878 154
1370 3300048913 Ga0496110_0220344 Ga0496110_0220344_884_1354 154
1371 3300048913 Ga0496110_0987586 Ga0496110_0987586_36_521 154
1372 3300048914 Ga0496111_0055309 Ga0496111_0055309_831_1301 154
1373 3300048914 Ga0496111_0393917 Ga0496111_0393917_20_484 154
1374 3300048915 Ga0496112_0020478 Ga0496112_0020478_5052_5522 154
1375 3300048915 Ga0496112_0048093 Ga0496112_0048093_3013_3495 154
1376 3300048915 Ga0496112_0057209 Ga0496112_0057209_649_1119 154
1377 3300048915 Ga0496112_0086555 Ga0496112_0086555_1614_2084 154
1378 3300048915 Ga0496112_0090643 Ga0496112_0090643_1068_1550 154
1379 3300048915 Ga0496112_0177279 Ga0496112_0177279_418_894 154
1380 3300048915 Ga0496112_0216595 Ga0496112_0216595_983_1459 154
1381 3300048915 Ga0496112_0326854 Ga0496112_0326854_860_1324 154
1382 3300048915 Ga0496112_1010542 Ga0496112_1010542_73_549 154
1383 3300048916 Ga0496113_0080717 Ga0496113_0080717_1352_1822 154
1384 3300048916 Ga0496113_0293003 Ga0496113_0293003_260_736 154
1385 3300048916 Ga0496113_0429029 Ga0496113_0429029_128_592 154
1386 3300048917 Ga0496114_0047329 Ga0496114_0047329_2634_3098 154
1387 3300048918 Ga0496115_0041287 Ga0496115_0041287_701_1165 154
1388 3300049571 Ga0501034_0193712 Ga0501034_0193712_824_1294 154
1389 3300049574 Ga0501038_0439688 Ga0501038_0439688_128_604 154
1390 3300049583 Ga0501067_0052561 Ga0501067_0052561_1744_2214 154
1391 3300049583 Ga0501067_0419748 Ga0501067_0419748_265_735 154
1392 3300049585 Ga0501069_0011496 Ga0501069_0011496_3648_4118 154
1393 3300049585 Ga0501069_0489424 Ga0501069_0489424_45_515 154
1394 3300049586 Ga0501070_0005623 Ga0501070_0005623_6213_6752 154
1395 3300049586 Ga0501070_0025860 Ga0501070_0025860_3744_4214 154
1396 3300049588 Ga0501072_1024817 Ga0501072_1024817_108_572 154
1397 3300049589 Ga0501073_0041522 Ga0501073_0041522_325_864 154
1398 3300049589 Ga0501073_0480297 Ga0501073_0480297_22_492 154
1399 3300049590 Ga0501074_0053264 Ga0501074_0053264_273_812 154
1400 3300049590 Ga0501074_0282302 Ga0501074_0282302_41_511 154
1401 3300049592 Ga0501076_0726574 Ga0501076_0726574_79_549 154
1402 3300049741 Ga0501079_0172134 Ga0501079_0172134_785_1324 154
1403 3300049742 Ga0501080_0266540 Ga0501080_0266540_578_1117 154
1404 3300049742 Ga0501080_0301008 Ga0501080_0301008_529_999 154
1405 3300049742 Ga0501080_0757355 Ga0501080_0757355_108_578 154
1406 3300050492 nmdc:mga0yw44_136359_c1 nmdc:mga0yw44_136359_c1_29_502 154
1407 3300050494 nmdc:mga06z11_490434_c1 nmdc:mga06z11_490434_c1_168_635 154
1408 3300050507 nmdc:mga05p37_1484394_c1 nmdc:mga05p37_1484394_c1_47_526 154
1409 3300050507 nmdc:mga05p37_8229_c1 nmdc:mga05p37_8229_c1_8658_9125 154
1410 3300050511 nmdc:mga08y16_1209559_c1 nmdc:mga08y16_1209559_c1_19_492 154
1411 3300050511 nmdc:mga08y16_426995_c1 nmdc:mga08y16_426995_c1_350_817 154
1412 3300050512 nmdc:mga0n895_14594_c1 nmdc:mga0n895_14594_c1_5941_6408 154
1413 3300050512 nmdc:mga0n895_438850_c1 nmdc:mga0n895_438850_c1_552_1028 154
1414 3300050513 nmdc:mga0rr50_2115_c1 nmdc:mga0rr50_2115_c1_6071_6538 154
1415 3300050514 nmdc:mga08x19_12265_c1 nmdc:mga08x19_12265_c1_3484_3951 154
1416 3300050515 nmdc:mga0a205_17014_c1 nmdc:mga0a205_17014_c1_3252_3719 154
1417 3300050515 nmdc:mga0a205_541128_c1 nmdc:mga0a205_541128_c1_108_584 154
1418 3300053077 Ga0495601_0241739 Ga0495601_0241739_336_809 154
1419 3300053077 Ga0495601_0257126 Ga0495601_0257126_299_775 154
1420 3300053084 Ga0495595_0289677 Ga0495595_0289677_188_664 154
1421 3300053084 Ga0495595_0610745 Ga0495595_0610745_76_540 154
1422 3300054114 Ga0501084_0128161 Ga0501084_0128161_1430_1900 154
1423 3300061719 Ga0466962_0229038 Ga0466962_0229038_148_618 154
1424 3300061719 Ga0466962_0367801 Ga0466962_0367801_211_681 154
1425 3300061719 Ga0466962_0384284 Ga0466962_0384284_64_534 154
1426 3300061734 Ga0530510_0167942 Ga0530510_0167942_583_1053 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

108

174

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i6d-assembly1.cif.gz_A crystal structure of ppo from bacillus subtilis with af 0.8877 106 128
3o0h-assembly1.cif.gz_B crystal structure of glutathione reductase from bartonella henselae 0.887 106 128
4bur-assembly1.cif.gz_A crystal structure of the reduced human apoptosis inducing factor complexed with nad 0.8599 107 128
4fdc-assembly1.cif.gz_B crystal structure of the e493v mutant of human apoptosis inducing factor (aif) 0.8476 105 128
8d3g-assembly1.cif.gz_B crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with 6-chloroquinolin-4-amine 0.8183 107 128
ID Description Score Start End Superfamily
af_Q2FZ44_92_167_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9495 81 149 2.30.30.240
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9445 82 148 2.30.30.240
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9416 81 146 2.30.30.240
3i6dB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8874 106 128 3.50.50.60
af_I1KSK3_174_274_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8762 81 149 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A7V8YT02-F1-model_v4 Ribosome maturation factor RimM 0.972 2 154 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A538M9A1-F1-model_v4 Ribosome maturation factor RimM 0.9697 4 150 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A3R8NDC9-F1-model_v4 16S rRNA processing protein RimM 0.961 73 149 GO:0005840
GO:0006364
GO:0043022
AF-A0A7V8YT02-F1-model_v4 Ribosome maturation factor RimM 0.9597 2 154 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7X5N2U9-F1-model_v4 Ribosome maturation factor RimM 0.9529 73 147 GO:0005737
GO:0005840
GO:0006364
GO:0043022

Feature Viewer

pLDDT pTM Quality
92.24 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map