F493806

General Info

Members Datasets Scaffolds Average Seq Length
1418 383 1418 119

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100478445|Ga0068858_1004784451
Length 131
Sequence MSCVYAVDCLRHMSKNPDDRRLDLLQGTLDMLILRTLQWGPQHGHGIGQAIRAQSDDLLKVETGSLYPALHRLEKRAWLKAEWGQSEANQRAKYYRLTAAGKAQLLREQDRWSQLVMAIGRIMNPAPAGED

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
120 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
223 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
247 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
253 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
256 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
257 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
258 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
259 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
260 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
261 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
262 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
263 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
277 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
329 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
351 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
352 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 3.6
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c028613 3300000041 Unclassified 519
2 JGI24751J29686_10008866 3300002459 Bacteria 2063
3 JGI24751J29686_10067055 3300002459 Unclassified 739
4 Ga0065714_10237464 3300005288 Bacteria 802
5 Ga0065712_10000261 3300005290 Bacteria 18174
6 Ga0065712_10007697 3300005290 Bacteria 3233
7 Ga0065712_10072631 3300005290 Bacteria 4673
8 Ga0065712_10117680 3300005290 Bacteria 1717
9 Ga0065712_10510675 3300005290 Bacteria 642
10 Ga0065715_10000251 3300005293 Bacteria 29530
11 Ga0065715_10095529 3300005293 Bacteria 4066
12 Ga0065715_10114170 3300005293 Bacteria 2460
13 Ga0065715_10160573 3300005293 Bacteria 1633
14 Ga0065715_10416155 3300005293 Bacteria 810
15 Ga0065715_10516821 3300005293 Bacteria 762
16 Ga0065715_10618242 3300005293 Unclassified 697
17 Ga0065707_10089470 3300005295 Bacteria 4360
18 Ga0065707_10227589 3300005295 Bacteria 1201
19 Ga0065707_10248989 3300005295 Bacteria 1131
20 Ga0065707_10548712 3300005295 Unclassified 716
21 Ga0065707_10565670 3300005295 Bacteria 711
22 Ga0070658_10098188 3300005327 Bacteria 2419
23 Ga0070676_10014126 3300005328 Bacteria 4384
24 Ga0070676_11230938 3300005328 Unclassified 570
25 Ga0070690_100013923 3300005330 Bacteria 4768
26 Ga0070670_100008131 3300005331 Bacteria 8929
27 Ga0070670_100015511 3300005331 Bacteria 6543
28 Ga0070670_100046942 3300005331 Bacteria 3716
29 Ga0070670_100088676 3300005331 Unclassified 2659
30 Ga0070670_100660785 3300005331 Bacteria 938
31 Ga0070670_100712674 3300005331 Bacteria 903
32 Ga0070677_10098207 3300005333 Bacteria 1286
33 Ga0070677_10118080 3300005333 Bacteria 1194
34 Ga0070677_10166188 3300005333 Unclassified 1039
35 Ga0070677_10400842 3300005333 Bacteria 723
36 Ga0068869_100058302 3300005334 Bacteria 2823
37 Ga0070666_10048887 3300005335 Bacteria 2842
38 Ga0070666_10136296 3300005335 Bacteria 1708
39 Ga0070680_100036963 3300005336 Bacteria 3946
40 Ga0070680_100390921 3300005336 Bacteria 1185
41 Ga0070680_100768471 3300005336 Bacteria 830
42 Ga0068868_100083627 3300005338 Unclassified 2563
43 Ga0068868_100166543 3300005338 Bacteria 1823
44 Ga0068868_101913606 3300005338 Unclassified 562
45 Ga0070660_100009760 3300005339 Bacteria 6765
46 Ga0070660_100249584 3300005339 Bacteria 1447
47 Ga0070689_100156391 3300005340 Bacteria 1841
48 Ga0070689_100160313 3300005340 Bacteria 1818
49 Ga0070689_101206770 3300005340 Bacteria 679
50 Ga0070691_10016048 3300005341 Bacteria 3442
51 Ga0070687_100378175 3300005343 Bacteria 922
52 Ga0070687_100424554 3300005343 Bacteria 878
53 Ga0070687_100808544 3300005343 Bacteria 665
54 Ga0070687_100812995 3300005343 Unclassified 663
55 Ga0070661_100408754 3300005344 Bacteria 1074
56 Ga0070661_100438020 3300005344 Unclassified 1038
57 Ga0070661_101304614 3300005344 Bacteria 609
58 Ga0070661_101336254 3300005344 Unclassified 602
59 Ga0070692_10056486 3300005345 Bacteria 2056
60 Ga0070692_10583161 3300005345 Unclassified 737
61 Ga0070692_10591783 3300005345 Bacteria 733
62 Ga0070668_100020058 3300005347 Bacteria 5040
63 Ga0070668_100590300 3300005347 Bacteria 971
64 Ga0070669_100004180 3300005353 Bacteria 10461
65 Ga0070669_100029543 3300005353 Bacteria 3952
66 Ga0070669_100036392 3300005353 Bacteria 3567
67 Ga0070669_100185858 3300005353 Bacteria 1628
68 Ga0070669_100186217 3300005353 Bacteria 1626
69 Ga0070669_100278463 3300005353 Unclassified 1340
70 Ga0070669_100364298 3300005353 Bacteria 1176
71 Ga0070669_100492567 3300005353 Bacteria 1016
72 Ga0070669_101125425 3300005353 Unclassified 677
73 Ga0070675_100000263 3300005354 Bacteria 34450
74 Ga0070675_100005779 3300005354 Bacteria 9464
75 Ga0070675_100032497 3300005354 Bacteria 4224
76 Ga0070675_100038879 3300005354 Bacteria 3880
77 Ga0070675_100195158 3300005354 Bacteria 1756
78 Ga0070675_100199772 3300005354 Bacteria 1735
79 Ga0070675_100450560 3300005354 Bacteria 1154
80 Ga0070675_100464244 3300005354 Bacteria 1137
81 Ga0070675_100526730 3300005354 Bacteria 1067
82 Ga0070675_100698294 3300005354 Bacteria 924
83 Ga0070675_101159563 3300005354 Bacteria 711
84 Ga0070671_100093414 3300005355 Bacteria 2521
85 Ga0070674_100004715 3300005356 Bacteria 7800
86 Ga0070674_100013234 3300005356 Bacteria 5093
87 Ga0070674_100038015 3300005356 Unclassified 3240
88 Ga0070674_100214611 3300005356 Bacteria 1494
89 Ga0070674_100380861 3300005356 Bacteria 1148
90 Ga0070674_100826126 3300005356 Bacteria 802
91 Ga0070674_101031945 3300005356 Bacteria 723
92 Ga0070674_101187006 3300005356 Unclassified 677
93 Ga0070674_101260923 3300005356 Bacteria 658
94 Ga0070674_101700710 3300005356 Bacteria 570
95 Ga0070673_100036388 3300005364 Bacteria 3741
96 Ga0070673_100075355 3300005364 Bacteria 2721
97 Ga0070673_100102739 3300005364 Bacteria 2357
98 Ga0070673_100193991 3300005364 Bacteria 1746
99 Ga0070673_100538071 3300005364 Bacteria 1060
100 Ga0070673_100877957 3300005364 Unclassified 831
101 Ga0070673_101695677 3300005364 Unclassified 598
102 Ga0070688_100079089 3300005365 Bacteria 2123
103 Ga0070688_100637717 3300005365 Unclassified 819
104 Ga0070688_100723341 3300005365 Unclassified 773
105 Ga0070688_100850066 3300005365 Unclassified 717
106 Ga0070659_100087517 3300005366 Unclassified 2494
107 Ga0070667_100054603 3300005367 Bacteria 3373
108 Ga0070667_100068794 3300005367 Bacteria 3013
109 Ga0070667_101178617 3300005367 Bacteria 717
110 Ga0070703_10624090 3300005406 Bacteria 500
111 Ga0070709_10173612 3300005434 Bacteria 1508
112 Ga0070709_10554034 3300005434 Unclassified 880
113 Ga0070709_11186304 3300005434 Bacteria 613
114 Ga0070714_100005079 3300005435 Bacteria 10012
115 Ga0070710_10233543 3300005437 Unclassified 1175
116 Ga0070701_10027299 3300005438 Bacteria 2794
117 Ga0070711_100209442 3300005439 Unclassified 1509
118 Ga0070711_100252838 3300005439 Unclassified 1383
119 Ga0070711_100532606 3300005439 Bacteria 972
120 Ga0070705_100003440 3300005440 Bacteria 7763
121 Ga0070705_100079567 3300005440 Bacteria 2008
122 Ga0070705_100424439 3300005440 Unclassified 991
123 Ga0070700_100022249 3300005441 Bacteria 3694
124 Ga0070700_100029344 3300005441 Bacteria 3279
125 Ga0070700_100114917 3300005441 Bacteria 1795
126 Ga0070700_100320247 3300005441 Bacteria 1139
127 Ga0070700_100504777 3300005441 Bacteria 931
128 Ga0070700_100592085 3300005441 Bacteria 868
129 Ga0070700_100719299 3300005441 Unclassified 796
130 Ga0070700_100915036 3300005441 Bacteria 715
131 Ga0070694_100231845 3300005444 Bacteria 1389
132 Ga0070694_100338638 3300005444 Unclassified 1162
133 Ga0070694_100383610 3300005444 Bacteria 1096
134 Ga0070694_100531954 3300005444 Bacteria 939
135 Ga0070708_100890556 3300005445 Bacteria 836
136 Ga0070663_100809119 3300005455 Bacteria 804
137 Ga0070663_101240837 3300005455 Bacteria 656
138 Ga0070663_102004271 3300005455 Bacteria 521
139 Ga0070678_100055031 3300005456 Bacteria 2903
140 Ga0070678_100172781 3300005456 Bacteria 1762
141 Ga0070678_100328190 3300005456 Bacteria 1309
142 Ga0070678_101765676 3300005456 Bacteria 583
143 Ga0070662_100029984 3300005457 Bacteria 3802
144 Ga0070662_100420794 3300005457 Unclassified 1105
145 Ga0070681_10000782 3300005458 Bacteria 26491
146 Ga0070681_10051671 3300005458 Bacteria 4100
147 Ga0070681_10083353 3300005458 Bacteria 3151
148 Ga0070681_10211377 3300005458 Bacteria 1856
149 Ga0070681_11384876 3300005458 Unclassified 627
150 Ga0068867_100186937 3300005459 Bacteria 1651
151 Ga0068867_100225292 3300005459 Bacteria 1513
152 Ga0068867_100245237 3300005459 Bacteria 1454
153 Ga0068867_100641739 3300005459 Unclassified 930
154 Ga0068867_101178085 3300005459 Bacteria 703
155 Ga0068867_102058541 3300005459 Bacteria 540
156 Ga0070685_10007059 3300005466 Bacteria 5735
157 Ga0070685_10176490 3300005466 Bacteria 1372
158 Ga0070685_10452236 3300005466 Bacteria 900
159 Ga0070685_10614421 3300005466 Bacteria 784
160 Ga0070706_100234597 3300005467 Bacteria 1713
161 Ga0070706_100766602 3300005467 Bacteria 894
162 Ga0070706_101322290 3300005467 Bacteria 661
163 Ga0070707_100105604 3300005468 Bacteria 2731
164 Ga0070707_100461168 3300005468 Bacteria 1232
165 Ga0070707_100464821 3300005468 Bacteria 1226
166 Ga0070707_100815876 3300005468 Bacteria 897
167 Ga0070707_100891641 3300005468 Bacteria 854
168 Ga0070707_101820917 3300005468 Bacteria 576
169 Ga0070707_101900463 3300005468 Unclassified 563
170 Ga0070698_100081682 3300005471 Bacteria 3226
171 Ga0070698_100341131 3300005471 Bacteria 1430
172 Ga0070698_100437529 3300005471 Bacteria 1243
173 Ga0070698_100507008 3300005471 Unclassified 1145
174 Ga0070699_100098836 3300005518 Bacteria 2557
175 Ga0070699_100651999 3300005518 Bacteria 961
176 Ga0070699_100653420 3300005518 Bacteria 960
177 Ga0070699_101589618 3300005518 Unclassified 599
178 Ga0070699_101993021 3300005518 Unclassified 531
179 Ga0070679_100043801 3300005530 Bacteria 4457
180 Ga0070679_100097367 3300005530 Bacteria 2930
181 Ga0070679_101715518 3300005530 Unclassified 576
182 Ga0070684_100162562 3300005535 Bacteria 2026
183 Ga0070684_100453868 3300005535 Bacteria 1185
184 Ga0070684_100504122 3300005535 Unclassified 1121
185 Ga0070684_101869587 3300005535 Bacteria 566
186 Ga0070697_100025752 3300005536 Bacteria 4692
187 Ga0070697_100131184 3300005536 Bacteria 2102
188 Ga0070697_100970599 3300005536 Bacteria 755
189 Ga0070697_101167418 3300005536 Unclassified 686
190 Ga0068853_100384142 3300005539 Bacteria 1312
191 Ga0068853_100866124 3300005539 Bacteria 867
192 Ga0068853_101150651 3300005539 Bacteria 749
193 Ga0068853_101600232 3300005539 Bacteria 631
194 Ga0070672_100006193 3300005543 Bacteria 8013
195 Ga0070672_100113621 3300005543 Bacteria 2210
196 Ga0070672_100231730 3300005543 Unclassified 1552
197 Ga0070672_100248761 3300005543 Bacteria 1497
198 Ga0070672_100374073 3300005543 Bacteria 1218
199 Ga0070672_100549111 3300005543 Bacteria 1003
200 Ga0070672_100704769 3300005543 Bacteria 884
201 Ga0070672_101358823 3300005543 Bacteria 635
202 Ga0070672_101918994 3300005543 Unclassified 533
203 Ga0070686_100011242 3300005544 Bacteria 5072
204 Ga0070686_100015118 3300005544 Bacteria 4463
205 Ga0070686_100252521 3300005544 Bacteria 1289
206 Ga0070686_100762355 3300005544 Bacteria 777
207 Ga0070695_100051838 3300005545 Bacteria 2634
208 Ga0070695_100295488 3300005545 Bacteria 1196
209 Ga0070695_100484690 3300005545 Bacteria 954
210 Ga0070695_100700554 3300005545 Bacteria 804
211 Ga0070696_100006942 3300005546 Bacteria 7559
212 Ga0070696_101768150 3300005546 Unclassified 534
213 Ga0070693_100754947 3300005547 Unclassified 717
214 Ga0070665_100009673 3300005548 Bacteria 9746
215 Ga0070665_100010784 3300005548 Bacteria 9241
216 Ga0070665_100336432 3300005548 Bacteria 1514
217 Ga0070665_101110679 3300005548 Bacteria 802
218 Ga0070665_101216807 3300005548 Bacteria 764
219 Ga0070665_101443081 3300005548 Bacteria 697
220 Ga0070704_100005455 3300005549 Bacteria 7410
221 Ga0070704_100027621 3300005549 Bacteria 3767
222 Ga0070704_100342321 3300005549 Bacteria 1260
223 Ga0070704_100378046 3300005549 Bacteria 1203
224 Ga0070704_100785310 3300005549 Bacteria 850
225 Ga0070704_101865880 3300005549 Bacteria 557
226 Ga0070704_101904288 3300005549 Bacteria 551
227 Ga0068855_100006730 3300005563 Bacteria 13945
228 Ga0068855_100078218 3300005563 Bacteria 3837
229 Ga0068855_100450789 3300005563 Unclassified 1404
230 Ga0068855_100607357 3300005563 Bacteria 1179
231 Ga0068855_101390594 3300005563 Bacteria 724
232 Ga0070664_100042065 3300005564 Bacteria 3858
233 Ga0070664_102212294 3300005564 Bacteria 522
234 Ga0068857_100076213 3300005577 Bacteria 2991
235 Ga0068857_100130772 3300005577 Unclassified 2264
236 Ga0068854_100006513 3300005578 Bacteria 7431
237 Ga0068854_100172947 3300005578 Bacteria 1682
238 Ga0068856_101263594 3300005614 Unclassified 754
239 Ga0068856_102052920 3300005614 Unclassified 582
240 Ga0070702_100014267 3300005615 Bacteria 4029
241 Ga0070702_100617939 3300005615 Bacteria 815
242 Ga0070702_101277818 3300005615 Bacteria 595
243 Ga0070702_101749689 3300005615 Bacteria 518
244 Ga0068852_100494432 3300005616 Bacteria 1217
245 Ga0068852_101038209 3300005616 Bacteria 839
246 Ga0068852_102091960 3300005616 Bacteria 588
247 Ga0068852_102267282 3300005616 Bacteria 564
248 Ga0068859_100034539 3300005617 Bacteria 5075
249 Ga0068859_100124888 3300005617 Bacteria 2642
250 Ga0068859_100161431 3300005617 Bacteria 2320
251 Ga0068859_100271587 3300005617 Bacteria 1788
252 Ga0068859_100428074 3300005617 Bacteria 1420
253 Ga0068859_100793627 3300005617 Bacteria 1035
254 Ga0068859_101000724 3300005617 Bacteria 918
255 Ga0068859_101066605 3300005617 Unclassified 888
256 Ga0068859_101470818 3300005617 Bacteria 752
257 Ga0068859_102495541 3300005617 Bacteria 569
258 Ga0068864_100004878 3300005618 Bacteria 10982
259 Ga0068864_100011781 3300005618 Bacteria 7223
260 Ga0068864_100131310 3300005618 Bacteria 2250
261 Ga0068864_100436837 3300005618 Bacteria 1250
262 Ga0068864_100829409 3300005618 Bacteria 910
263 Ga0068864_101077561 3300005618 Bacteria 799
264 Ga0068864_101902919 3300005618 Unclassified 601
265 Ga0068866_10199737 3300005718 Bacteria 1194
266 Ga0068866_10489349 3300005718 Bacteria 812
267 Ga0068866_10921711 3300005718 Unclassified 616
268 Ga0068861_100052201 3300005719 Bacteria 3107
269 Ga0068861_100062989 3300005719 Bacteria 2850
270 Ga0068861_100136974 3300005719 Bacteria 1993
271 Ga0068861_100233003 3300005719 Bacteria 1563
272 Ga0068861_100390075 3300005719 Bacteria 1233
273 Ga0068861_101188066 3300005719 Unclassified 737
274 Ga0068870_10449789 3300005840 Bacteria 849
275 Ga0068870_10504745 3300005840 Unclassified 807
276 Ga0068870_10632440 3300005840 Bacteria 731
277 Ga0068863_100032588 3300005841 Bacteria 4966
278 Ga0068863_100234500 3300005841 Bacteria 1771
279 Ga0068863_100515578 3300005841 Bacteria 1178
280 Ga0068863_101061306 3300005841 Unclassified 814
281 Ga0068863_101065099 3300005841 Bacteria 812
282 Ga0068863_102006524 3300005841 Unclassified 588
283 Ga0068863_102496448 3300005841 Unclassified 526
284 Ga0068858_100012933 3300005842 Bacteria 7869
285 Ga0068858_100104020 3300005842 Bacteria 2650
286 Ga0068858_100158166 3300005842 Bacteria 2133
287 Ga0068858_100175178 3300005842 Bacteria 2024
288 Ga0068858_100478445 3300005842 Bacteria 1202
289 Ga0068858_100739476 3300005842 Bacteria 958
290 Ga0068858_101341489 3300005842 Bacteria 704
291 Ga0068860_100031017 3300005843 Bacteria 5139
292 Ga0068860_100369821 3300005843 Bacteria 1414
293 Ga0068860_100372149 3300005843 Bacteria 1409
294 Ga0068860_100619072 3300005843 Unclassified 1089
295 Ga0068860_100649456 3300005843 Bacteria 1063
296 Ga0068860_101895028 3300005843 Unclassified 618
297 Ga0068860_102040477 3300005843 Bacteria 595
298 Ga0068862_100025690 3300005844 Unclassified 4946
299 Ga0068862_100040059 3300005844 Bacteria 3982
300 Ga0068862_100098005 3300005844 Bacteria 2560
301 Ga0068862_100498796 3300005844 Bacteria 1155
302 Ga0068862_100599666 3300005844 Unclassified 1057
303 Ga0068862_100972564 3300005844 Unclassified 838
304 Ga0068862_101198571 3300005844 Bacteria 758
305 Ga0068862_101258093 3300005844 Bacteria 740
306 Ga0068862_102272539 3300005844 Bacteria 554
307 Ga0081455_10088091 3300005937 Bacteria 2524
308 Ga0081455_10428229 3300005937 Bacteria 910
309 Ga0081455_10450650 3300005937 Bacteria 879
310 Ga0081539_10014244 3300005985 Bacteria 5902
311 Ga0070717_10749092 3300006028 Bacteria 888
312 Ga0075365_10211371 3300006038 Unclassified 1360
313 Ga0075365_11055682 3300006038 Unclassified 572
314 Ga0075368_10004146 3300006042 Bacteria 4882
315 Ga0075368_10022443 3300006042 Bacteria 2403
316 Ga0075368_10046216 3300006042 Bacteria 1722
317 Ga0075364_10007212 3300006051 Bacteria 6585
318 Ga0075364_10019158 3300006051 Bacteria 4292
319 Ga0075364_10030281 3300006051 Bacteria 3473
320 Ga0075364_10110526 3300006051 Bacteria 1834
321 Ga0075432_10013119 3300006058 Bacteria 2816
322 Ga0075432_10168821 3300006058 Unclassified 850
323 Ga0070715_10691666 3300006163 Unclassified 608
324 Ga0070716_100197736 3300006173 Bacteria 1333
325 Ga0075362_10000612 3300006177 Bacteria 10445
326 Ga0075362_10005422 3300006177 Bacteria 4664
327 Ga0075367_10016516 3300006178 Bacteria 4031
328 Ga0075367_10021644 3300006178 Bacteria 3596
329 Ga0075367_10043715 3300006178 Unclassified 2624
330 Ga0075369_10472080 3300006186 Unclassified 595
331 Ga0075366_10005604 3300006195 Bacteria 6811
332 Ga0075366_10031509 3300006195 Bacteria 3121
333 Ga0075366_10093834 3300006195 Bacteria 1799
334 Ga0075366_10560787 3300006195 Bacteria 707
335 Ga0097621_100009812 3300006237 Bacteria 6970
336 Ga0097621_100042330 3300006237 Bacteria 3668
337 Ga0097621_100502104 3300006237 Bacteria 1099
338 Ga0097621_101163859 3300006237 Unclassified 726
339 Ga0075370_10073026 3300006353 Unclassified 1964
340 Ga0075370_10124251 3300006353 Bacteria 1504
341 Ga0068871_100020951 3300006358 Bacteria 5016
342 Ga0068871_100895743 3300006358 Unclassified 822
343 Ga0068871_101323190 3300006358 Bacteria 678
344 Ga0068871_101486101 3300006358 Unclassified 640
345 Ga0075428_100057445 3300006844 Bacteria 4259
346 Ga0075428_100131541 3300006844 Bacteria 2721
347 Ga0075428_100189265 3300006844 Bacteria 2226
348 Ga0075428_100456639 3300006844 Bacteria 1368
349 Ga0075428_100479873 3300006844 Unclassified 1331
350 Ga0075428_100698175 3300006844 Bacteria 1081
351 Ga0075428_100797293 3300006844 Bacteria 1004
352 Ga0075428_101299967 3300006844 Unclassified 765
353 Ga0075428_101362912 3300006844 Bacteria 745
354 Ga0075430_100004264 3300006846 Bacteria 12074
355 Ga0075430_100048754 3300006846 Bacteria 3576
356 Ga0075430_100094266 3300006846 Bacteria 2503
357 Ga0075430_100389260 3300006846 Bacteria 1150
358 Ga0075430_100546638 3300006846 Bacteria 955
359 Ga0075430_100712766 3300006846 Bacteria 827
360 Ga0075431_100052235 3300006847 Bacteria 4214
361 Ga0075431_100094687 3300006847 Unclassified 3082
362 Ga0075431_100098924 3300006847 Bacteria 3011
363 Ga0075431_100218693 3300006847 Bacteria 1944
364 Ga0075431_100305028 3300006847 Unclassified 1608
365 Ga0075431_100509425 3300006847 Bacteria 1194
366 Ga0075431_100690784 3300006847 Bacteria 999
367 Ga0075431_101015630 3300006847 Bacteria 796
368 Ga0075431_101330355 3300006847 Bacteria 679
369 Ga0075431_101925836 3300006847 Bacteria 547
370 Ga0075433_10001180 3300006852 Bacteria 18992
371 Ga0075433_10003835 3300006852 Bacteria 11638
372 Ga0075433_10011494 3300006852 Bacteria 7129
373 Ga0075433_10165387 3300006852 Bacteria 1969
374 Ga0075433_10193567 3300006852 Bacteria 1809
375 Ga0075433_10448011 3300006852 Bacteria 1138
376 Ga0075433_10580021 3300006852 Bacteria 985
377 Ga0075433_10688028 3300006852 Unclassified 896
378 Ga0075433_10711268 3300006852 Bacteria 880
379 Ga0075433_10712501 3300006852 Bacteria 879
380 Ga0075433_10902581 3300006852 Unclassified 771
381 Ga0075433_11346120 3300006852 Bacteria 618
382 Ga0075434_100074174 3300006871 Bacteria 3396
383 Ga0075434_100177127 3300006871 Bacteria 2152
384 Ga0075434_100201853 3300006871 Bacteria 2008
385 Ga0075434_100385280 3300006871 Bacteria 1423
386 Ga0075434_100690033 3300006871 Bacteria 1039
387 Ga0075434_100725767 3300006871 Bacteria 1011
388 Ga0075434_101032830 3300006871 Bacteria 836
389 Ga0075434_102211105 3300006871 Unclassified 554
390 Ga0075429_100038356 3300006880 Bacteria 4170
391 Ga0075429_100082406 3300006880 Bacteria 2804
392 Ga0075429_100096187 3300006880 Bacteria 2583
393 Ga0075429_100212267 3300006880 Bacteria 1696
394 Ga0075429_100343820 3300006880 Unclassified 1306
395 Ga0075429_101207551 3300006880 Bacteria 660
396 Ga0075429_101976773 3300006880 Bacteria 505
397 Ga0068865_100013820 3300006881 Bacteria 5118
398 Ga0068865_100091282 3300006881 Bacteria 2210
399 Ga0068865_100123574 3300006881 Bacteria 1928
400 Ga0068865_100424070 3300006881 Bacteria 1094
401 Ga0068865_100510223 3300006881 Bacteria 1004
402 Ga0068865_102113716 3300006881 Bacteria 512
403 Ga0075436_100647231 3300006914 Unclassified 781
404 Ga0075436_101550399 3300006914 Bacteria 503
405 Ga0097620_100034539 3300006931 Bacteria 5075
406 Ga0097620_100124891 3300006931 Bacteria 2642
407 Ga0097620_100161430 3300006931 Bacteria 2320
408 Ga0097620_100271596 3300006931 Bacteria 1788
409 Ga0097620_100428071 3300006931 Bacteria 1420
410 Ga0097620_100793424 3300006931 Bacteria 1035
411 Ga0097620_101000915 3300006931 Bacteria 918
412 Ga0097620_101066602 3300006931 Unclassified 888
413 Ga0097620_101470858 3300006931 Bacteria 752
414 Ga0097620_102494893 3300006931 Bacteria 569
415 Ga0075435_100003425 3300007076 Bacteria 10756
416 Ga0075435_100107383 3300007076 Bacteria 2318
417 Ga0075435_100200359 3300007076 Bacteria 1691
418 Ga0075435_100278589 3300007076 Bacteria 1427
419 Ga0075435_100632854 3300007076 Bacteria 928
420 Ga0075435_100856356 3300007076 Unclassified 792
421 Ga0075435_100972992 3300007076 Bacteria 741
422 Ga0099794_10666159 3300007265 Unclassified 553
423 Ga0099795_10350812 3300007788 Bacteria 660
424 Ga0105240_10013366 3300009093 Bacteria 11278
425 Ga0105240_10168722 3300009093 Bacteria 2594
426 Ga0105240_10263269 3300009093 Bacteria 1988
427 Ga0105240_10590873 3300009093 Bacteria 1223
428 Ga0105240_10857001 3300009093 Bacteria 980
429 Ga0105240_11806519 3300009093 Unclassified 637
430 Ga0111539_10002910 3300009094 Bacteria 22714
431 Ga0111539_10003741 3300009094 Bacteria 20019
432 Ga0111539_10006263 3300009094 Bacteria 15360
433 Ga0111539_10019405 3300009094 Bacteria 8392
434 Ga0111539_10078058 3300009094 Bacteria 3897
435 Ga0111539_10149077 3300009094 Bacteria 2738
436 Ga0111539_10162240 3300009094 Bacteria 2614
437 Ga0111539_10310304 3300009094 Bacteria 1836
438 Ga0111539_10556952 3300009094 Bacteria 1335
439 Ga0105245_10055485 3300009098 Bacteria 3559
440 Ga0105245_10134307 3300009098 Bacteria 2324
441 Ga0105245_10143827 3300009098 Bacteria 2249
442 Ga0105245_10382519 3300009098 Bacteria 1402
443 Ga0105245_10536367 3300009098 Unclassified 1191
444 Ga0105245_10572521 3300009098 Bacteria 1153
445 Ga0105245_10783725 3300009098 Bacteria 991
446 Ga0105245_11005872 3300009098 Bacteria 878
447 Ga0105247_10014516 3300009101 Bacteria 4725
448 Ga0105247_10183334 3300009101 Bacteria 1398
449 Ga0105247_10421459 3300009101 Unclassified 956
450 Ga0114129_10001210 3300009147 Bacteria 34271
451 Ga0114129_10007043 3300009147 Bacteria 16009
452 Ga0114129_10007586 3300009147 Bacteria 15446
453 Ga0114129_10013890 3300009147 Bacteria 11474
454 Ga0114129_10014560 3300009147 Bacteria 11208
455 Ga0114129_10029746 3300009147 Bacteria 7735
456 Ga0114129_10037660 3300009147 Bacteria 6827
457 Ga0114129_10054867 3300009147 Bacteria 5585
458 Ga0114129_10107125 3300009147 Bacteria 3861
459 Ga0114129_10230970 3300009147 Bacteria 2492
460 Ga0114129_10335225 3300009147 Bacteria 2007
461 Ga0114129_10339713 3300009147 Unclassified 1992
462 Ga0114129_10504386 3300009147 Bacteria 1580
463 Ga0114129_10506899 3300009147 Bacteria 1575
464 Ga0114129_10607523 3300009147 Unclassified 1416
465 Ga0114129_10821864 3300009147 Bacteria 1184
466 Ga0114129_10982018 3300009147 Bacteria 1065
467 Ga0114129_11257469 3300009147 Bacteria 919
468 Ga0114129_11291873 3300009147 Bacteria 905
469 Ga0114129_11462435 3300009147 Bacteria 841
470 Ga0114129_11494525 3300009147 Bacteria 830
471 Ga0114129_11603241 3300009147 Bacteria 797
472 Ga0114129_11765492 3300009147 Bacteria 753
473 Ga0114129_11885200 3300009147 Unclassified 725
474 Ga0114129_12209444 3300009147 Bacteria 662
475 Ga0114129_12297577 3300009147 Bacteria 647
476 Ga0114129_12505978 3300009147 Bacteria 617
477 Ga0114129_12638583 3300009147 Unclassified 599
478 Ga0114129_12895361 3300009147 Bacteria 568
479 Ga0105243_10036845 3300009148 Bacteria 3799
480 Ga0105243_10234734 3300009148 Bacteria 1629
481 Ga0105243_10505644 3300009148 Unclassified 1146
482 Ga0105243_12168724 3300009148 Unclassified 592
483 Ga0105243_12629952 3300009148 Bacteria 543
484 Ga0105241_10078448 3300009174 Unclassified 2580
485 Ga0105241_10134751 3300009174 Bacteria 2004
486 Ga0105241_10173273 3300009174 Bacteria 1784
487 Ga0105241_12574325 3300009174 Unclassified 511
488 Ga0105242_10004376 3300009176 Bacteria 10987
489 Ga0105242_10022073 3300009176 Bacteria 5002
490 Ga0105242_10207341 3300009176 Bacteria 1744
491 Ga0105242_10255142 3300009176 Bacteria 1582
492 Ga0105242_10354094 3300009176 Bacteria 1357
493 Ga0105242_10809110 3300009176 Bacteria 928
494 Ga0105242_11285571 3300009176 Unclassified 755
495 Ga0105248_10001854 3300009177 Bacteria 23431
496 Ga0105248_10006073 3300009177 Bacteria 13255
497 Ga0105248_10018606 3300009177 Bacteria 7679
498 Ga0105248_10163520 3300009177 Bacteria 2510
499 Ga0105248_10197614 3300009177 Bacteria 2266
500 Ga0105248_10342163 3300009177 Bacteria 1684
501 Ga0105248_10379135 3300009177 Bacteria 1592
502 Ga0105248_11059300 3300009177 Bacteria 916
503 Ga0105248_11324105 3300009177 Unclassified 815
504 Ga0105248_13445956 3300009177 Unclassified 502
505 Ga0105238_10469453 3300009551 Unclassified 1257
506 Ga0105238_10522449 3300009551 Bacteria 1190
507 Ga0105238_11723206 3300009551 Unclassified 658
508 Ga0105238_11962004 3300009551 Bacteria 619
509 Ga0105238_12226418 3300009551 Bacteria 583
510 Ga0105249_10000759 3300009553 Bacteria 28990
511 Ga0105249_10015676 3300009553 Bacteria 6711
512 Ga0105249_10113961 3300009553 Bacteria 2559
513 Ga0105249_10116987 3300009553 Bacteria 2528
514 Ga0105249_10205001 3300009553 Unclassified 1932
515 Ga0105249_10256237 3300009553 Unclassified 1736
516 Ga0105249_10341462 3300009553 Bacteria 1514
517 Ga0105249_10357664 3300009553 Bacteria 1481
518 Ga0105249_10474338 3300009553 Bacteria 1293
519 Ga0105249_10618751 3300009553 Bacteria 1139
520 Ga0105249_11383934 3300009553 Unclassified 775
521 Ga0105249_12283063 3300009553 Bacteria 614
522 Ga0105249_13071043 3300009553 Bacteria 536
523 Ga0105239_10246058 3300010375 Bacteria 2008
524 Ga0105239_10410807 3300010375 Bacteria 1533
525 Ga0105239_12802094 3300010375 Bacteria 569
526 Ga0105239_12852507 3300010375 Bacteria 564
527 Ga0105246_10152096 3300011119 Unclassified 1753
528 Ga0105246_10243072 3300011119 Bacteria 1424
529 Ga0105246_10726285 3300011119 Unclassified 873
530 Ga0105246_11593631 3300011119 Bacteria 617
531 Ga0105246_11812800 3300011119 Bacteria 583
532 Ga0157325_1003348 3300012485 Bacteria 878
533 Ga0157315_1032378 3300012508 Bacteria 621
534 Ga0157369_10567572 3300013105 Unclassified 1172
535 Ga0157369_11556625 3300013105 Unclassified 672
536 Ga0157374_10049175 3300013296 Bacteria 3916
537 Ga0157374_10468686 3300013296 Bacteria 1262
538 Ga0157374_11121399 3300013296 Bacteria 807
539 Ga0157374_11376441 3300013296 Unclassified 728
540 Ga0157378_10062396 3300013297 Bacteria 3328
541 Ga0157378_10142479 3300013297 Bacteria 2227
542 Ga0157378_10982844 3300013297 Bacteria 878
543 Ga0157378_11527118 3300013297 Bacteria 713
544 Ga0163162_10028446 3300013306 Bacteria 5531
545 Ga0163162_10031594 3300013306 Bacteria 5252
546 Ga0163162_11004808 3300013306 Unclassified 943
547 Ga0163162_12481914 3300013306 Unclassified 596
548 Ga0157375_10124732 3300013308 Bacteria 2689
549 Ga0157375_10155119 3300013308 Bacteria 2428
550 Ga0157375_10157353 3300013308 Bacteria 2412
551 Ga0157375_10160971 3300013308 Unclassified 2386
552 Ga0157375_10473695 3300013308 Bacteria 1417
553 Ga0157375_10972641 3300013308 Bacteria 990
554 Ga0157375_12577862 3300013308 Unclassified 607
555 Ga0157375_12849071 3300013308 Unclassified 578
556 Ga0163163_10000001 3300014325 Bacteria 622185
557 Ga0163163_10013923 3300014325 Bacteria 7379
558 Ga0163163_10037866 3300014325 Bacteria 4694
559 Ga0163163_10050509 3300014325 Unclassified 4095
560 Ga0163163_10285013 3300014325 Bacteria 1704
561 Ga0163163_10760706 3300014325 Bacteria 1032
562 Ga0163163_11152154 3300014325 Bacteria 838
563 Ga0157380_10038923 3300014326 Bacteria 3695
564 Ga0157380_10049197 3300014326 Bacteria 3324
565 Ga0157380_10199940 3300014326 Bacteria 1772
566 Ga0157380_10522119 3300014326 Bacteria 1158
567 Ga0157380_10585523 3300014326 Bacteria 1101
568 Ga0157380_10678962 3300014326 Bacteria 1032
569 Ga0157380_10722508 3300014326 Unclassified 1004
570 Ga0157380_11890567 3300014326 Unclassified 657
571 Ga0157380_11890717 3300014326 Bacteria 657
572 Ga0157377_10169534 3300014745 Bacteria 1364
573 Ga0157377_10279296 3300014745 Bacteria 1094
574 Ga0157377_10823664 3300014745 Bacteria 686
575 Ga0157377_11036333 3300014745 Bacteria 624
576 Ga0157379_10058271 3300014968 Bacteria 3453
577 Ga0157379_10268217 3300014968 Bacteria 1552
578 Ga0157379_10339214 3300014968 Bacteria 1374
579 Ga0157379_10611574 3300014968 Bacteria 1018
580 Ga0157379_10882223 3300014968 Bacteria 848
581 Ga0157379_11225589 3300014968 Unclassified 722
582 Ga0157379_11285734 3300014968 Bacteria 706
583 Ga0157379_11870104 3300014968 Bacteria 591
584 Ga0157376_10000975 3300014969 Bacteria 18667
585 Ga0157376_10018993 3300014969 Bacteria 5286
586 Ga0157376_10033418 3300014969 Bacteria 4141
587 Ga0157376_10107811 3300014969 Bacteria 2446
588 Ga0157376_10207193 3300014969 Bacteria 1808
589 Ga0157376_10846099 3300014969 Bacteria 930
590 Ga0157376_10941038 3300014969 Bacteria 884
591 Ga0157376_12051121 3300014969 Unclassified 610
592 Ga0163161_10581157 3300017792 Unclassified 921
593 Ga0163161_11883711 3300017792 Unclassified 532
594 Ga0207697_10021594 3300025315 Bacteria 2635
595 Ga0207697_10093293 3300025315 Bacteria 1277
596 Ga0207697_10288768 3300025315 Unclassified 727
597 Ga0207697_10434919 3300025315 Unclassified 582
598 Ga0207656_10206753 3300025321 Bacteria 950
599 Ga0207682_10173375 3300025893 Bacteria 982
600 Ga0207682_10354109 3300025893 Bacteria 692
601 Ga0207682_10424402 3300025893 Unclassified 629
602 Ga0207692_10103471 3300025898 Unclassified 1568
603 Ga0207642_10045161 3300025899 Bacteria 1954
604 Ga0207642_10048782 3300025899 Bacteria 1900
605 Ga0207642_10615902 3300025899 Unclassified 677
606 Ga0207642_10900037 3300025899 Unclassified 567
607 Ga0207710_10173438 3300025900 Bacteria 1055
608 Ga0207688_10051437 3300025901 Bacteria 2308
609 Ga0207688_10066646 3300025901 Bacteria 2037
610 Ga0207688_10362029 3300025901 Bacteria 895
611 Ga0207680_10110962 3300025903 Bacteria 1779
612 Ga0207680_10121829 3300025903 Bacteria 1707
613 Ga0207680_10132869 3300025903 Bacteria 1642
614 Ga0207685_10059226 3300025905 Bacteria 1509
615 Ga0207699_10527210 3300025906 Bacteria 855
616 Ga0207645_10014763 3300025907 Bacteria 5216
617 Ga0207645_10033074 3300025907 Bacteria 3324
618 Ga0207645_10328202 3300025907 Bacteria 1021
619 Ga0207643_10578401 3300025908 Unclassified 722
620 Ga0207643_10627092 3300025908 Bacteria 693
621 Ga0207705_10284554 3300025909 Bacteria 1266
622 Ga0207684_10261399 3300025910 Bacteria 1494
623 Ga0207707_10068249 3300025912 Bacteria 3098
624 Ga0207707_10154287 3300025912 Bacteria 2008
625 Ga0207707_10351315 3300025912 Unclassified 1270
626 Ga0207695_10035373 3300025913 Bacteria 5418
627 Ga0207695_10089434 3300025913 Bacteria 3096
628 Ga0207695_10327086 3300025913 Unclassified 1422
629 Ga0207695_10592111 3300025913 Bacteria 990
630 Ga0207671_11521237 3300025914 Unclassified 516
631 Ga0207663_10623223 3300025916 Unclassified 849
632 Ga0207663_10976093 3300025916 Unclassified 679
633 Ga0207660_10133638 3300025917 Bacteria 1891
634 Ga0207660_10266641 3300025917 Bacteria 1356
635 Ga0207660_10491267 3300025917 Bacteria 995
636 Ga0207657_10005651 3300025919 Bacteria 13051
637 Ga0207657_10037224 3300025919 Bacteria 4347
638 Ga0207657_10856897 3300025919 Bacteria 701
639 Ga0207657_11310633 3300025919 Unclassified 547
640 Ga0207649_10969505 3300025920 Unclassified 668
641 Ga0207649_11462772 3300025920 Bacteria 541
642 Ga0207652_10019576 3300025921 Bacteria 5569
643 Ga0207652_10742537 3300025921 Bacteria 874
644 Ga0207652_10878524 3300025921 Bacteria 793
645 Ga0207652_11018784 3300025921 Bacteria 727
646 Ga0207646_10204636 3300025922 Bacteria 1783
647 Ga0207646_10274494 3300025922 Bacteria 1524
648 Ga0207646_10906412 3300025922 Bacteria 782
649 Ga0207646_11387178 3300025922 Bacteria 611
650 Ga0207646_11441343 3300025922 Bacteria 598
651 Ga0207646_11453198 3300025922 Unclassified 595
652 Ga0207646_11522900 3300025922 Bacteria 579
653 Ga0207646_11759896 3300025922 Unclassified 531
654 Ga0207646_11849867 3300025922 Unclassified 515
655 Ga0207681_10020072 3300025923 Bacteria 4231
656 Ga0207681_10024846 3300025923 Bacteria 3847
657 Ga0207681_10082786 3300025923 Bacteria 2269
658 Ga0207681_10087669 3300025923 Bacteria 2215
659 Ga0207681_10127047 3300025923 Bacteria 1879
660 Ga0207681_10218074 3300025923 Bacteria 1474
661 Ga0207681_10614112 3300025923 Unclassified 899
662 Ga0207681_10802699 3300025923 Bacteria 786
663 Ga0207681_10809420 3300025923 Unclassified 783
664 Ga0207681_11197134 3300025923 Bacteria 638
665 Ga0207694_10331346 3300025924 Unclassified 1258
666 Ga0207694_10845045 3300025924 Unclassified 774
667 Ga0207650_10037631 3300025925 Bacteria 3527
668 Ga0207650_10118528 3300025925 Unclassified 2058
669 Ga0207650_10200894 3300025925 Bacteria 1597
670 Ga0207650_10691293 3300025925 Bacteria 861
671 Ga0207650_11060496 3300025925 Bacteria 690
672 Ga0207650_11460745 3300025925 Unclassified 581
673 Ga0207650_11754857 3300025925 Unclassified 525
674 Ga0207659_10000369 3300025926 Bacteria 27027
675 Ga0207659_10007963 3300025926 Bacteria 6550
676 Ga0207659_10082095 3300025926 Bacteria 2385
677 Ga0207659_10216193 3300025926 Bacteria 1539
678 Ga0207659_10389365 3300025926 Bacteria 1164
679 Ga0207659_10643330 3300025926 Bacteria 906
680 Ga0207659_10660293 3300025926 Bacteria 894
681 Ga0207687_10070843 3300025927 Bacteria 2490
682 Ga0207687_10084042 3300025927 Bacteria 2306
683 Ga0207687_10477791 3300025927 Bacteria 1037
684 Ga0207687_10569671 3300025927 Bacteria 952
685 Ga0207687_10574190 3300025927 Bacteria 948
686 Ga0207687_10695478 3300025927 Bacteria 863
687 Ga0207700_10057909 3300025928 Bacteria 2924
688 Ga0207664_10039362 3300025929 Bacteria 3671
689 Ga0207644_10136083 3300025931 Bacteria 1886
690 Ga0207644_10499348 3300025931 Bacteria 1003
691 Ga0207644_10618614 3300025931 Bacteria 900
692 Ga0207690_10015495 3300025932 Bacteria 4621
693 Ga0207690_10222786 3300025932 Bacteria 1444
694 Ga0207690_10332461 3300025932 Unclassified 1197
695 Ga0207690_10710921 3300025932 Bacteria 826
696 Ga0207706_10052948 3300025933 Bacteria 3583
697 Ga0207706_10322587 3300025933 Bacteria 1344
698 Ga0207706_10469337 3300025933 Unclassified 1088
699 Ga0207706_11236496 3300025933 Unclassified 619
700 Ga0207686_10084333 3300025934 Bacteria 2081
701 Ga0207686_10222307 3300025934 Bacteria 1364
702 Ga0207686_10309817 3300025934 Bacteria 1175
703 Ga0207686_11372945 3300025934 Unclassified 581
704 Ga0207709_10393880 3300025935 Unclassified 1057
705 Ga0207709_10448524 3300025935 Bacteria 997
706 Ga0207709_10688957 3300025935 Bacteria 817
707 Ga0207709_11475678 3300025935 Bacteria 564
708 Ga0207670_10125373 3300025936 Bacteria 1873
709 Ga0207670_10182180 3300025936 Bacteria 1583
710 Ga0207670_10221525 3300025936 Bacteria 1448
711 Ga0207669_10003394 3300025937 Bacteria 6885
712 Ga0207669_10078225 3300025937 Bacteria 2107
713 Ga0207669_10163169 3300025937 Bacteria 1577
714 Ga0207669_10188026 3300025937 Unclassified 1487
715 Ga0207669_10349188 3300025937 Bacteria 1142
716 Ga0207669_10384681 3300025937 Unclassified 1094
717 Ga0207669_10392314 3300025937 Bacteria 1085
718 Ga0207669_10395694 3300025937 Bacteria 1081
719 Ga0207669_10536152 3300025937 Bacteria 942
720 Ga0207669_10546436 3300025937 Bacteria 934
721 Ga0207704_10030711 3300025938 Bacteria 3016
722 Ga0207704_10065142 3300025938 Bacteria 2280
723 Ga0207704_10180091 3300025938 Bacteria 1526
724 Ga0207665_11204934 3300025939 Unclassified 604
725 Ga0207665_11639778 3300025939 Unclassified 510
726 Ga0207691_10012143 3300025940 Bacteria 8257
727 Ga0207691_10017213 3300025940 Bacteria 6857
728 Ga0207691_10206823 3300025940 Bacteria 1706
729 Ga0207691_10339895 3300025940 Bacteria 1285
730 Ga0207691_10350895 3300025940 Bacteria 1262
731 Ga0207691_10789642 3300025940 Unclassified 798
732 Ga0207691_11370236 3300025940 Unclassified 582
733 Ga0207711_10061302 3300025941 Bacteria 3244
734 Ga0207711_10074486 3300025941 Bacteria 2952
735 Ga0207711_10094765 3300025941 Bacteria 2631
736 Ga0207711_10282514 3300025941 Bacteria 1529
737 Ga0207711_10519466 3300025941 Archaea 1110
738 Ga0207711_10555776 3300025941 Bacteria 1070
739 Ga0207711_10623057 3300025941 Bacteria 1007
740 Ga0207711_10642110 3300025941 Bacteria 990
741 Ga0207711_10670017 3300025941 Bacteria 968
742 Ga0207711_11978046 3300025941 Unclassified 526
743 Ga0207689_10078629 3300025942 Bacteria 2711
744 Ga0207689_10388063 3300025942 Bacteria 1163
745 Ga0207689_10874715 3300025942 Bacteria 758
746 Ga0207689_11491632 3300025942 Bacteria 565
747 Ga0207689_11500395 3300025942 Unclassified 563
748 Ga0207661_10008224 3300025944 Bacteria 7449
749 Ga0207661_11274144 3300025944 Bacteria 676
750 Ga0207679_11239940 3300025945 Bacteria 684
751 Ga0207667_10092976 3300025949 Bacteria 3115
752 Ga0207667_10094336 3300025949 Bacteria 3089
753 Ga0207667_10124226 3300025949 Bacteria 2659
754 Ga0207667_10319060 3300025949 Bacteria 1587
755 Ga0207651_10086539 3300025960 Bacteria 2278
756 Ga0207651_10105108 3300025960 Bacteria 2105
757 Ga0207651_10201501 3300025960 Bacteria 1595
758 Ga0207651_10224690 3300025960 Bacteria 1520
759 Ga0207651_10323551 3300025960 Bacteria 1290
760 Ga0207651_10622969 3300025960 Bacteria 945
761 Ga0207712_10010859 3300025961 Bacteria 5793
762 Ga0207712_10016070 3300025961 Bacteria 4839
763 Ga0207712_10177181 3300025961 Bacteria 1671
764 Ga0207712_10417505 3300025961 Bacteria 1131
765 Ga0207712_10506733 3300025961 Bacteria 1032
766 Ga0207712_11215676 3300025961 Unclassified 672
767 Ga0207668_10304233 3300025972 Bacteria 1317
768 Ga0207668_10351114 3300025972 Bacteria 1233
769 Ga0207668_10363917 3300025972 Bacteria 1213
770 Ga0207640_10235018 3300025981 Bacteria 1413
771 Ga0207640_10609991 3300025981 Bacteria 925
772 Ga0207640_10943704 3300025981 Unclassified 756
773 Ga0207640_11735587 3300025981 Unclassified 564
774 Ga0207658_10028089 3300025986 Bacteria 3960
775 Ga0207658_10039016 3300025986 Bacteria 3425
776 Ga0207658_10578996 3300025986 Bacteria 1007
777 Ga0207658_10688700 3300025986 Bacteria 923
778 Ga0207658_10889535 3300025986 Bacteria 811
779 Ga0207677_10025212 3300026023 Bacteria 3706
780 Ga0207677_10042274 3300026023 Bacteria 3021
781 Ga0207677_10066933 3300026023 Bacteria 2514
782 Ga0207677_10089593 3300026023 Bacteria 2234
783 Ga0207677_11888230 3300026023 Bacteria 555
784 Ga0207703_10030316 3300026035 Bacteria 4274
785 Ga0207703_10041243 3300026035 Bacteria 3696
786 Ga0207703_10112437 3300026035 Bacteria 2326
787 Ga0207703_10112933 3300026035 Bacteria 2322
788 Ga0207703_10147524 3300026035 Bacteria 2048
789 Ga0207703_10185001 3300026035 Bacteria 1841
790 Ga0207703_10316335 3300026035 Bacteria 1428
791 Ga0207703_10476287 3300026035 Bacteria 1169
792 Ga0207703_10618217 3300026035 Unclassified 1026
793 Ga0207703_10626199 3300026035 Bacteria 1019
794 Ga0207703_11411492 3300026035 Unclassified 670
795 Ga0207703_12247751 3300026035 Unclassified 521
796 Ga0207678_10893713 3300026067 Bacteria 785
797 Ga0207678_11151830 3300026067 Bacteria 687
798 Ga0207708_10017960 3300026075 Bacteria 5321
799 Ga0207708_10031124 3300026075 Bacteria 4049
800 Ga0207708_10043835 3300026075 Bacteria 3410
801 Ga0207708_10146881 3300026075 Bacteria 1853
802 Ga0207708_10342496 3300026075 Unclassified 1225
803 Ga0207708_10699232 3300026075 Unclassified 866
804 Ga0207708_10764201 3300026075 Bacteria 830
805 Ga0207708_10839177 3300026075 Bacteria 793
806 Ga0207708_11113690 3300026075 Bacteria 689
807 Ga0207702_10149816 3300026078 Unclassified 2121
808 Ga0207702_10225637 3300026078 Bacteria 1748
809 Ga0207702_11291656 3300026078 Unclassified 724
810 Ga0207641_10007212 3300026088 Bacteria 9265
811 Ga0207641_10039403 3300026088 Bacteria 3952
812 Ga0207641_10276475 3300026088 Bacteria 1578
813 Ga0207641_10513476 3300026088 Unclassified 1165
814 Ga0207641_10812096 3300026088 Unclassified 926
815 Ga0207641_10870103 3300026088 Unclassified 894
816 Ga0207641_11915020 3300026088 Unclassified 594
817 Ga0207648_10008247 3300026089 Bacteria 10112
818 Ga0207648_10057142 3300026089 Bacteria 3404
819 Ga0207648_10064974 3300026089 Bacteria 3181
820 Ga0207648_10105600 3300026089 Unclassified 2471
821 Ga0207648_10124554 3300026089 Bacteria 2267
822 Ga0207648_10512303 3300026089 Bacteria 1099
823 Ga0207648_10660207 3300026089 Bacteria 967
824 Ga0207648_11136248 3300026089 Unclassified 733
825 Ga0207648_11545971 3300026089 Unclassified 624
826 Ga0207676_10010212 3300026095 Bacteria 6679
827 Ga0207676_10022988 3300026095 Bacteria 4592
828 Ga0207676_10027803 3300026095 Bacteria 4217
829 Ga0207676_10306785 3300026095 Bacteria 1451
830 Ga0207676_10394300 3300026095 Bacteria 1292
831 Ga0207676_11324151 3300026095 Bacteria 715
832 Ga0207674_10035085 3300026116 Bacteria 5236
833 Ga0207674_10103314 3300026116 Unclassified 2829
834 Ga0207675_100003262 3300026118 Bacteria 15891
835 Ga0207675_100240452 3300026118 Unclassified 1749
836 Ga0207675_100358573 3300026118 Bacteria 1430
837 Ga0207675_100651815 3300026118 Bacteria 1059
838 Ga0207675_101202623 3300026118 Bacteria 778
839 Ga0207683_10141360 3300026121 Bacteria 2169
840 Ga0207683_10285343 3300026121 Bacteria 1509
841 Ga0207698_10389892 3300026142 Bacteria 1328
842 Ga0207698_10772378 3300026142 Bacteria 961
843 Ga0207698_11425557 3300026142 Bacteria 708
844 Ga0209971_1029609 3300027682 Bacteria 1311
845 Ga0209813_10018216 3300027866 Bacteria 1937
846 Ga0209813_10030413 3300027866 Bacteria 1587
847 Ga0209813_10176690 3300027866 Bacteria 779
848 Ga0207428_10002391 3300027907 Bacteria 18750
849 Ga0207428_10003247 3300027907 Bacteria 15845
850 Ga0207428_10032210 3300027907 Bacteria 4314
851 Ga0207428_10375974 3300027907 Bacteria 1043
852 Ga0207428_10898141 3300027907 Bacteria 626
853 Ga0268266_10135488 3300028379 Bacteria 2205
854 Ga0268266_10362223 3300028379 Bacteria 1364
855 Ga0268266_10651773 3300028379 Bacteria 1013
856 Ga0268266_11048943 3300028379 Bacteria 789
857 Ga0268266_11458153 3300028379 Bacteria 660
858 Ga0268265_10003607 3300028380 Bacteria 11058
859 Ga0268265_10015652 3300028380 Bacteria 5193
860 Ga0268265_10040186 3300028380 Bacteria 3453
861 Ga0268265_10046425 3300028380 Bacteria 3247
862 Ga0268265_10051494 3300028380 Bacteria 3108
863 Ga0268265_10114997 3300028380 Bacteria 2204
864 Ga0268265_10120559 3300028380 Bacteria 2160
865 Ga0268265_10187309 3300028380 Bacteria 1784
866 Ga0268265_10354849 3300028380 Unclassified 1340
867 Ga0268265_10695667 3300028380 Bacteria 982
868 Ga0268265_11920751 3300028380 Unclassified 599
869 Ga0268265_12241757 3300028380 Bacteria 553
870 Ga0268265_12360337 3300028380 Unclassified 538
871 Ga0268265_12471776 3300028380 Unclassified 526
872 Ga0268264_10004922 3300028381 Bacteria 11318
873 Ga0268264_10243636 3300028381 Bacteria 1666
874 Ga0268264_10381813 3300028381 Bacteria 1349
875 Ga0268264_10410468 3300028381 Bacteria 1304
876 Ga0268264_11951195 3300028381 Unclassified 596
877 Ga0268264_12240349 3300028381 Unclassified 554
878 Ga0307511_10250473 3300030521 Bacteria 852
879 Ga0265332_10254341 3300031238 Bacteria 726
880 Ga0265328_10036845 3300031239 Bacteria 1807
881 Ga0265325_10211375 3300031241 Bacteria 891
882 Ga0265339_10100403 3300031249 Bacteria 1507
883 Ga0265316_10044113 3300031344 Bacteria 3548
884 Ga0307408_100324684 3300031548 Unclassified 1298
885 Ga0307408_100392565 3300031548 Bacteria 1189
886 Ga0307408_100966632 3300031548 Unclassified 783
887 Ga0307408_101189041 3300031548 Bacteria 711
888 Ga0307408_101199525 3300031548 Bacteria 708
889 Ga0307408_101239770 3300031548 Bacteria 697
890 Ga0307408_101481337 3300031548 Bacteria 641
891 Ga0265314_10344605 3300031711 Bacteria 822
892 Ga0265342_10038270 3300031712 Bacteria 2922
893 Ga0307405_10205354 3300031731 Bacteria 1434
894 Ga0307405_11228519 3300031731 Bacteria 649
895 Ga0307413_10292918 3300031824 Bacteria 1230
896 Ga0307413_12031097 3300031824 Unclassified 519
897 Ga0307410_10052205 3300031852 Bacteria 2760
898 Ga0307410_10079571 3300031852 Unclassified 2297
899 Ga0307406_10360932 3300031901 Bacteria 1139
900 Ga0307406_11086012 3300031901 Unclassified 690
901 Ga0307406_11838811 3300031901 Unclassified 539
902 Ga0307407_10274800 3300031903 Bacteria 1164
903 Ga0307412_10431170 3300031911 Bacteria 1081
904 Ga0307412_11082123 3300031911 Unclassified 712
905 Ga0307412_11335117 3300031911 Bacteria 647
906 Ga0307409_100088819 3300031995 Bacteria 2524
907 Ga0307409_100243458 3300031995 Bacteria 1639
908 Ga0307409_100630369 3300031995 Unclassified 1063
909 Ga0307409_100881331 3300031995 Bacteria 907
910 Ga0307416_100006416 3300032002 Bacteria 7363
911 Ga0307416_100149210 3300032002 Unclassified 2141
912 Ga0307416_100774534 3300032002 Bacteria 1053
913 Ga0307416_101233158 3300032002 Unclassified 854
914 Ga0307416_101505040 3300032002 Unclassified 779
915 Ga0307416_103873736 3300032002 Unclassified 501
916 Ga0307414_10078781 3300032004 Unclassified 2403
917 Ga0307414_10942263 3300032004 Bacteria 793
918 Ga0307411_10027368 3300032005 Bacteria 3449
919 Ga0307411_10227592 3300032005 Unclassified 1451
920 Ga0307411_10554758 3300032005 Bacteria 981
921 Ga0307415_100320355 3300032126 Bacteria 1292
922 Ga0373934_0136435 3300035086 Bacteria 1002
923 Ga0373944_0067432 3300035089 Bacteria 1159
924 Ga0373952_0067810 3300035092 Bacteria 886
925 Ga0373932_0132278 3300035112 Bacteria 842
926 Ga0373939_0223877 3300035114 Bacteria 721
927 Ga0373941_0020831 3300035115 Bacteria 1843
928 Ga0373953_0095967 3300035117 Unclassified 1244
929 Ga0373954_0464738 3300035118 Unclassified 627
930 Ga0373956_0062577 3300035119 Bacteria 1687
931 Ga0373956_0550643 3300035119 Unclassified 551
932 Ga0373957_0243770 3300035120 Bacteria 755
933 Ga0373943_0396005 3300035170 Unclassified 797
934 Ga0373943_0409810 3300035170 Bacteria 783
935 Ga0373946_0187164 3300035171 Bacteria 985
936 Ga0373946_0206811 3300035171 Bacteria 942
937 Ga0373946_0489077 3300035171 Bacteria 630
938 Ga0373955_0182192 3300035172 Unclassified 1247
939 Ga0373942_0235875 3300035207 Bacteria 617
940 Ga0373961_0185002 3300035241 Bacteria 727
941 Ga0373962_0010098 3300035242 Bacteria 2348
942 Ga0373924_0417055 3300035410 Bacteria 601
943 Ga0373935_0141045 3300035692 Bacteria 1628
944 Ga0373935_0406277 3300035692 Bacteria 979
945 Ga0373935_1130831 3300035692 Unclassified 583
946 Ga0373927_0294309 3300035695 Bacteria 1068
947 Ga0373933_0314609 3300035724 Bacteria 1015
948 Ga0373933_0323342 3300035724 Bacteria 1000
949 Ga0373933_0442611 3300035724 Bacteria 850
950 Ga0373947_0045408 3300035725 Bacteria 2629
951 Ga0373947_0508393 3300035725 Unclassified 819
952 Ga0373937_0156997 3300036401 Bacteria 2133
953 Ga0373937_0390185 3300036401 Bacteria 1321
954 Ga0373937_0394018 3300036401 Unclassified 1314
955 Ga0373937_0553235 3300036401 Unclassified 1093
956 Ga0373937_0572791 3300036401 Bacteria 1072
957 Ga0373937_0589532 3300036401 Bacteria 1055
958 Ga0373937_0774386 3300036401 Bacteria 907
959 Ga0373937_0868381 3300036401 Bacteria 851
960 Ga0373925_0141686 3300037068 Bacteria 1882
961 Ga0373925_0502191 3300037068 Bacteria 996
962 Ga0395898_0657269 3300037466 Bacteria 991
963 Ga0395905_0126645 3300037471 Bacteria 2402
964 Ga0395901_0419786 3300038443 Bacteria 1372
965 Ga0395901_1199526 3300038443 Bacteria 725
966 Ga0439461_0041338 3300041410 Unclassified 997
967 Ga0439461_0210524 3300041410 Unclassified 526
968 Ga0451802_1678584 3300041460 Bacteria 753
969 Ga0451802_1910756 3300041460 Bacteria 1243
970 Ga0451807_0062462 3300041486 Unclassified 841
971 Ga0451851_1214807 3300041507 Unclassified 522
972 Ga0451853_1119114 3300041512 Bacteria 797
973 Ga0451853_3468293 3300041512 Unclassified 698
974 Ga0439431_0014634 3300041997 Bacteria 1820
975 Ga0439433_0010796 3300041999 Bacteria 1997
976 Ga0439445_0140531 3300042004 Bacteria 700
977 Ga0439449_0213054 3300042007 Bacteria 724
978 Ga0439454_024460 3300042011 Unclassified 912
979 Ga0439456_095693 3300042013 Bacteria 670
980 Ga0439457_109036 3300042014 Bacteria 649
981 Ga0439462_0132078 3300042015 Bacteria 697
982 Ga0450892_009984 3300042130 Bacteria 827
983 Ga0450889_005880 3300042144 Unclassified 1227
984 Ga0439446_0018109 3300042156 Bacteria 1970
985 Ga0439446_0246314 3300042156 Viruses 615
986 Ga0439446_0370131 3300042156 Unclassified 513
987 Ga0439435_0031586 3300042436 Unclassified 1441
988 Ga0439435_0081378 3300042436 Bacteria 972
989 Ga0439435_0092857 3300042436 Unclassified 919
990 Ga0439435_0205670 3300042436 Unclassified 651
991 Ga0439460_0029458 3300042461 Unclassified 1554
992 Ga0439460_0085754 3300042461 Bacteria 994
993 Ga0439460_0109076 3300042461 Bacteria 896
994 Ga0439460_0168790 3300042461 Bacteria 736
995 Ga0451576_0017400 3300045051 Bacteria 7904
996 Ga0451576_0355762 3300045051 Unclassified 1533
997 Ga0451576_0508735 3300045051 Bacteria 1265
998 Ga0451576_1519312 3300045051 Unclassified 695
999 Ga0466967_0326134 3300045976 Bacteria 1482
1000 Ga0466967_0514393 3300045976 Bacteria 1176
1001 Ga0466967_1051907 3300045976 Bacteria 811
1002 Ga0495592_0045114 3300046454 Bacteria 3290
1003 Ga0495592_0277687 3300046454 Bacteria 1097
1004 Ga0495603_0366880 3300046455 Bacteria 826
1005 Ga0495629_0048860 3300046459 Bacteria 2966
1006 Ga0495629_0195894 3300046459 Bacteria 1397
1007 Ga0495638_0008188 3300046460 Bacteria 7433
1008 Ga0495638_0159524 3300046460 Bacteria 1302
1009 Ga0495651_0734815 3300046462 Unclassified 613
1010 Ga0495651_0835005 3300046462 Bacteria 567
1011 Ga0495580_0203587 3300046472 Bacteria 1363
1012 Ga0495580_0650506 3300046472 Bacteria 693
1013 Ga0495580_0825510 3300046472 Unclassified 600
1014 Ga0495580_1051214 3300046472 Unclassified 517
1015 Ga0495582_0095929 3300046473 Bacteria 1657
1016 Ga0495582_0197190 3300046473 Bacteria 1149
1017 Ga0495582_0417583 3300046473 Bacteria 774
1018 Ga0495582_0744393 3300046473 Unclassified 567
1019 Ga0495582_0892158 3300046473 Unclassified 514
1020 Ga0495639_0074404 3300046475 Bacteria 1574
1021 Ga0495639_0350812 3300046475 Bacteria 741
1022 Ga0495662_0356181 3300046476 Unclassified 719
1023 Ga0495662_0411683 3300046476 Unclassified 664
1024 Ga0495664_0805455 3300046477 Unclassified 552
1025 Ga0495584_0176894 3300046491 Bacteria 1085
1026 Ga0495585_0407997 3300046492 Bacteria 654
1027 Ga0495594_0005857 3300046499 Bacteria 6316
1028 Ga0495608_0002617 3300046511 Bacteria 12929
1029 Ga0495608_0259263 3300046511 Bacteria 1083
1030 Ga0495628_0040510 3300046516 Bacteria 3722
1031 Ga0495628_0151710 3300046516 Bacteria 1765
1032 Ga0495628_0308217 3300046516 Bacteria 1171
1033 Ga0495630_0015118 3300046517 Bacteria 5632
1034 Ga0495630_0986396 3300046517 Unclassified 640
1035 Ga0495643_0114733 3300046522 Bacteria 1366
1036 Ga0495663_0117327 3300046525 Bacteria 889
1037 Ga0495652_0212949 3300046529 Bacteria 1457
1038 Ga0495652_0618131 3300046529 Bacteria 737
1039 Ga0495665_0053238 3300046531 Bacteria 2141
1040 Ga0495640_0241382 3300046533 Unclassified 1134
1041 Ga0495640_0531115 3300046533 Bacteria 714
1042 Ga0495586_0352909 3300046535 Unclassified 845
1043 Ga0495587_0015255 3300046536 Bacteria 4800
1044 Ga0495587_0465028 3300046536 Unclassified 700
1045 Ga0495587_0491462 3300046536 Unclassified 679
1046 Ga0495645_0001484 3300046543 Bacteria 15885
1047 Ga0495645_0006999 3300046543 Bacteria 7844
1048 Ga0495645_0088034 3300046543 Bacteria 2221
1049 Ga0495633_0505859 3300046558 Bacteria 545
1050 Ga0495667_0015027 3300046559 Bacteria 5227
1051 Ga0495667_0221803 3300046559 Bacteria 1206
1052 Ga0495667_0224475 3300046559 Bacteria 1198
1053 Ga0495667_0276447 3300046559 Bacteria 1066
1054 Ga0495667_0395679 3300046559 Bacteria 870
1055 Ga0495656_0463212 3300046615 Unclassified 669
1056 Ga0495668_0846099 3300046616 Bacteria 507
1057 Ga0495634_0048319 3300046642 Bacteria 2865
1058 Ga0495634_0336374 3300046642 Bacteria 906
1059 Ga0495634_0641132 3300046642 Bacteria 614
1060 Ga0495635_0241998 3300046663 Bacteria 1217
1061 Ga0495635_0332038 3300046663 Bacteria 1016
1062 Ga0495635_0685285 3300046663 Archaea 665
1063 Ga0495659_0447166 3300046664 Bacteria 562
1064 Ga0495659_0499212 3300046664 Unclassified 533
1065 Ga0495599_0091975 3300046678 Unclassified 1893
1066 Ga0495647_0053986 3300046681 Bacteria 1569
1067 Ga0495647_0099209 3300046681 Bacteria 1204
1068 Ga0495647_0164920 3300046681 Bacteria 956
1069 Ga0495658_0130434 3300046683 Unclassified 1529
1070 Ga0495658_0154332 3300046683 Bacteria 1412
1071 Ga0495658_0357296 3300046683 Bacteria 929
1072 Ga0495658_0801538 3300046683 Bacteria 603
1073 Ga0495669_0004290 3300046684 Bacteria 5883
1074 Ga0495669_0099320 3300046684 Bacteria 1351
1075 Ga0495669_0546106 3300046684 Bacteria 564
1076 Ga0495613_0000460 3300046689 Bacteria 34834
1077 Ga0495613_0060053 3300046689 Bacteria 2786
1078 Ga0495613_0140910 3300046689 Bacteria 1723
1079 Ga0495670_0401213 3300046691 Bacteria 741
1080 Ga0495649_0515104 3300046694 Unclassified 594
1081 Ga0495589_0503081 3300046794 Unclassified 553
1082 Ga0495600_0064883 3300046809 Bacteria 2387
1083 Ga0495600_0147941 3300046809 Bacteria 1522
1084 Ga0495581_0111288 3300047315 Unclassified 1593
1085 Ga0495581_0614559 3300047315 Unclassified 629
1086 Ga0495604_0022896 3300047317 Bacteria 4986
1087 Ga0495604_0134806 3300047317 Bacteria 1771
1088 Ga0495674_0204527 3300047319 Bacteria 1637
1089 Ga0495674_0258680 3300047319 Unclassified 1431
1090 Ga0495674_0313575 3300047319 Unclassified 1279
1091 Ga0495680_0558833 3300047322 Bacteria 770
1092 Ga0495675_0086686 3300047444 Bacteria 1968
1093 Ga0495684_0000011 3300047471 Bacteria 195144
1094 Ga0495684_0055859 3300047471 Bacteria 3011
1095 Ga0495684_0500086 3300047471 Unclassified 836
1096 Ga0495602_1163738 3300048088 Unclassified 504
1097 Ga0496100_0695619 3300048903 Unclassified 793
1098 Ga0496101_0405539 3300048904 Unclassified 1074
1099 Ga0496101_0535281 3300048904 Unclassified 926
1100 Ga0496101_0739857 3300048904 Bacteria 776
1101 Ga0496101_0806585 3300048904 Bacteria 740
1102 Ga0496101_1327019 3300048904 Unclassified 562
1103 Ga0496102_0263543 3300048905 Bacteria 1625
1104 Ga0496102_0503062 3300048905 Bacteria 1134
1105 Ga0496102_1892127 3300048905 Unclassified 513
1106 Ga0496104_0008562 3300048907 Bacteria 9097
1107 Ga0496104_0071068 3300048907 Unclassified 3309
1108 Ga0496104_0190219 3300048907 Bacteria 1964
1109 Ga0496104_0978782 3300048907 Bacteria 750
1110 Ga0496105_0083175 3300048908 Unclassified 2644
1111 Ga0496105_0118197 3300048908 Bacteria 2187
1112 Ga0496105_0324119 3300048908 Bacteria 1234
1113 Ga0496106_0040608 3300048909 Bacteria 3485
1114 Ga0496106_0159914 3300048909 Unclassified 1781
1115 Ga0496106_0324981 3300048909 Bacteria 1235
1116 Ga0496106_0730059 3300048909 Bacteria 788
1117 Ga0496106_1180855 3300048909 Bacteria 597
1118 Ga0496107_0076223 3300048910 Bacteria 2442
1119 Ga0496107_0620004 3300048910 Unclassified 799
1120 Ga0496108_0029035 3300048911 Bacteria 4577
1121 Ga0496109_0007883 3300048912 Bacteria 9025
1122 Ga0496109_0052940 3300048912 Bacteria 3701
1123 Ga0496109_0225536 3300048912 Unclassified 1763
1124 Ga0496109_1006808 3300048912 Unclassified 771
1125 Ga0496109_1988281 3300048912 Unclassified 513
1126 Ga0496110_0004692 3300048913 Bacteria 10630
1127 Ga0496110_0158049 3300048913 Bacteria 2054
1128 Ga0496110_0363689 3300048913 Bacteria 1318
1129 Ga0496110_0851591 3300048913 Bacteria 817
1130 Ga0496111_0018955 3300048914 Bacteria 4770
1131 Ga0496111_0440325 3300048914 Bacteria 962
1132 Ga0496112_0009593 3300048915 Bacteria 8730
1133 Ga0496112_0051911 3300048915 Unclassified 4023
1134 Ga0496112_0250188 3300048915 Bacteria 1723
1135 Ga0496112_1094059 3300048915 Unclassified 715
1136 Ga0496112_1183391 3300048915 Unclassified 681
1137 Ga0496113_0010835 3300048916 Bacteria 6050
1138 Ga0496113_0713246 3300048916 Unclassified 800
1139 Ga0496114_0020936 3300048917 Bacteria 5313
1140 Ga0496114_0207454 3300048917 Bacteria 1718
1141 Ga0496114_0446878 3300048917 Bacteria 1145
1142 Ga0496114_0459142 3300048917 Bacteria 1128
1143 Ga0496114_0499461 3300048917 Bacteria 1076
1144 Ga0496115_0111356 3300048918 Bacteria 2249
1145 Ga0501296_068390 3300049519 Unclassified 547
1146 Ga0501299_220721 3300049522 Unclassified 512
1147 Ga0501032_0405350 3300049569 Unclassified 876
1148 Ga0501036_0085962 3300049572 Bacteria 2659
1149 Ga0501036_0096073 3300049572 Unclassified 2505
1150 Ga0501036_0214944 3300049572 Unclassified 1615
1151 Ga0501036_0390320 3300049572 Bacteria 1161
1152 Ga0501036_1547782 3300049572 Unclassified 536
1153 Ga0501039_0042891 3300049575 Bacteria 3495
1154 Ga0501039_0081481 3300049575 Bacteria 2520
1155 Ga0501039_1024109 3300049575 Bacteria 641
1156 Ga0501040_0081902 3300049576 Bacteria 2237
1157 Ga0501040_0401635 3300049576 Bacteria 984
1158 Ga0501040_0808401 3300049576 Unclassified 678
1159 Ga0501040_1331680 3300049576 Bacteria 521
1160 Ga0501041_0050172 3300049577 Bacteria 2543
1161 Ga0501041_0065202 3300049577 Bacteria 2231
1162 Ga0501041_0077878 3300049577 Unclassified 2040
1163 Ga0501041_0178885 3300049577 Unclassified 1328
1164 Ga0501041_0208371 3300049577 Unclassified 1226
1165 Ga0501041_0216867 3300049577 Bacteria 1201
1166 Ga0501041_0558089 3300049577 Bacteria 730
1167 Ga0501041_0681295 3300049577 Bacteria 658
1168 Ga0501042_0044862 3300049578 Bacteria 3150
1169 Ga0501042_0091952 3300049578 Bacteria 2178
1170 Ga0501042_0140840 3300049578 Bacteria 1739
1171 Ga0501042_0245811 3300049578 Bacteria 1291
1172 Ga0501042_0556675 3300049578 Bacteria 833
1173 Ga0501042_0691570 3300049578 Unclassified 742
1174 Ga0501043_0654737 3300049579 Bacteria 771
1175 Ga0501043_1073480 3300049579 Bacteria 570
1176 Ga0501046_0456555 3300049580 Bacteria 918
1177 Ga0501046_0868996 3300049580 Unclassified 630
1178 Ga0501046_1014923 3300049580 Bacteria 575
1179 Ga0501047_0965959 3300049581 Bacteria 665
1180 Ga0501048_0126263 3300049582 Bacteria 1809
1181 Ga0501048_0682498 3300049582 Unclassified 737
1182 Ga0501048_0713459 3300049582 Unclassified 720
1183 Ga0501048_0822114 3300049582 Unclassified 668
1184 Ga0501067_0349988 3300049583 Bacteria 824
1185 Ga0501068_0413061 3300049584 Bacteria 871
1186 Ga0501068_0434109 3300049584 Bacteria 849
1187 Ga0501069_0179706 3300049585 Bacteria 1223
1188 Ga0501071_0031106 3300049587 Bacteria 3781
1189 Ga0501071_0098787 3300049587 Bacteria 2151
1190 Ga0501071_0227948 3300049587 Bacteria 1403
1191 Ga0501071_0231381 3300049587 Bacteria 1392
1192 Ga0501071_0695411 3300049587 Bacteria 783
1193 Ga0501071_0756575 3300049587 Unclassified 749
1194 Ga0501072_0016297 3300049588 Bacteria 5702
1195 Ga0501072_0042793 3300049588 Unclassified 3558
1196 Ga0501072_0139036 3300049588 Bacteria 1936
1197 Ga0501072_0236472 3300049588 Unclassified 1455
1198 Ga0501072_0248440 3300049588 Unclassified 1417
1199 Ga0501073_0249406 3300049589 Unclassified 1225
1200 Ga0501073_0395639 3300049589 Bacteria 955
1201 Ga0501074_0314297 3300049590 Unclassified 1113
1202 Ga0501074_0359698 3300049590 Bacteria 1033
1203 Ga0501075_0025120 3300049591 Bacteria 4376
1204 Ga0501075_0042269 3300049591 Bacteria 3417
1205 Ga0501075_0115421 3300049591 Bacteria 2042
1206 Ga0501075_0159458 3300049591 Bacteria 1721
1207 Ga0501075_0300054 3300049591 Bacteria 1224
1208 Ga0501075_0456567 3300049591 Bacteria 974
1209 Ga0501075_0616205 3300049591 Bacteria 828
1210 Ga0501075_0952764 3300049591 Bacteria 652
1211 Ga0501076_0029060 3300049592 Bacteria 4297
1212 Ga0501076_0033584 3300049592 Bacteria 4006
1213 Ga0501076_0046014 3300049592 Bacteria 3447
1214 Ga0501076_0055767 3300049592 Bacteria 3134
1215 Ga0501076_0140625 3300049592 Unclassified 1961
1216 Ga0501076_0171493 3300049592 Bacteria 1768
1217 Ga0501076_0225615 3300049592 Bacteria 1531
1218 Ga0501076_0476171 3300049592 Bacteria 1029
1219 Ga0501076_0540538 3300049592 Unclassified 961
1220 Ga0501076_0774979 3300049592 Bacteria 791
1221 Ga0501077_0358434 3300049593 Bacteria 931
1222 Ga0501077_0666823 3300049593 Bacteria 668
1223 Ga0501202_148057 3300049652 Bacteria 612
1224 Ga0501233_088484 3300049668 Unclassified 806
1225 Ga0501221_123152 3300049704 Bacteria 664
1226 Ga0501079_0053476 3300049741 Bacteria 3115
1227 Ga0501079_0087881 3300049741 Bacteria 2406
1228 Ga0501079_0094223 3300049741 Bacteria 2320
1229 Ga0501079_0140282 3300049741 Bacteria 1883
1230 Ga0501079_0190006 3300049741 Bacteria 1603
1231 Ga0501079_0464306 3300049741 Bacteria 994
1232 Ga0501079_1310383 3300049741 Unclassified 570
1233 Ga0501080_0349522 3300049742 Bacteria 1335
1234 Ga0501080_0947979 3300049742 Bacteria 748
1235 Ga0501080_1002540 3300049742 Bacteria 724
1236 Ga0501080_1373390 3300049742 Unclassified 603
1237 Ga0501081_0008315 3300049743 Bacteria 6733
1238 Ga0501081_0157769 3300049743 Unclassified 1633
1239 Ga0501081_0181421 3300049743 Bacteria 1523
1240 Ga0501081_0281554 3300049743 Unclassified 1217
1241 Ga0501081_0420790 3300049743 Unclassified 990
1242 Ga0501081_0421217 3300049743 Bacteria 990
1243 Ga0501081_0807818 3300049743 Bacteria 706
1244 Ga0501081_1183681 3300049743 Bacteria 579
1245 Ga0501045_0013441 3300049824 Bacteria 5783
1246 Ga0501045_0076993 3300049824 Bacteria 2458
1247 Ga0501045_0483206 3300049824 Bacteria 920
1248 Ga0501045_0599848 3300049824 Bacteria 815
1249 Ga0501045_1194561 3300049824 Bacteria 555
1250 Ga0501045_1301088 3300049824 Unclassified 529
1251 nmdc:mga03683_17494_c1 3300050489 Bacteria 2714
1252 nmdc:mga03683_62505_c1 3300050489 Bacteria 1577
1253 nmdc:mga00v17_1193_c1 3300050491 Bacteria 13648
1254 nmdc:mga00v17_17412_c1 3300050491 Bacteria 4068
1255 nmdc:mga00v17_179328_c1 3300050491 Bacteria 1367
1256 nmdc:mga00v17_181772_c1 3300050491 Bacteria 1357
1257 nmdc:mga00v17_87170_c1 3300050491 Bacteria 1957
1258 nmdc:mga0yw44_217631_c1 3300050492 Unclassified 1265
1259 nmdc:mga0yw44_296469_c1 3300050492 Bacteria 1083
1260 nmdc:mga0yw44_895760_c1 3300050492 Unclassified 602
1261 nmdc:mga0k408_291082_c1 3300050493 Bacteria 975
1262 nmdc:mga0k408_4489_c1 3300050493 Bacteria 7405
1263 nmdc:mga0k408_5002_c1 3300050493 Bacteria 7022
1264 nmdc:mga0k408_53704_c2 3300050493 Bacteria 1300
1265 nmdc:mga0k408_741485_c1 3300050493 Unclassified 574
1266 nmdc:mga06z11_118642_c1 3300050494 Bacteria 747
1267 nmdc:mga06z11_144648_c1 3300050494 Bacteria 1346
1268 nmdc:mga06z11_3134_c1 3300050494 Bacteria 6380
1269 nmdc:mga06z11_81981_c1 3300050494 Bacteria 1733
1270 nmdc:mga04h51_13562_c1 3300050495 Bacteria 2310
1271 nmdc:mga04h51_30179_c1 3300050495 Bacteria 1704
1272 nmdc:mga04h51_49263_c1 3300050495 Bacteria 1407
1273 nmdc:mga07m45_103918_c1 3300050496 Bacteria 1633
1274 nmdc:mga07m45_180842_c1 3300050496 Unclassified 1226
1275 nmdc:mga07m45_28294_c1 3300050496 Bacteria 3093
1276 nmdc:mga07m45_828324_c1 3300050496 Unclassified 530
1277 nmdc:mga05p37_1059743_c1 3300050507 Bacteria 854
1278 nmdc:mga05p37_1074_c1 3300050507 Bacteria 31305
1279 nmdc:mga05p37_1100493_c1 3300050507 Bacteria 832
1280 nmdc:mga05p37_1100630_c1 3300050507 Bacteria 832
1281 nmdc:mga05p37_119786_c1 3300050507 Bacteria 3234
1282 nmdc:mga05p37_1230740_c1 3300050507 Bacteria 770
1283 nmdc:mga05p37_142726_c1 3300050507 Unclassified 2933
1284 nmdc:mga05p37_1594891_c1 3300050507 Bacteria 643
1285 nmdc:mga05p37_1729831_c1 3300050507 Bacteria 608
1286 nmdc:mga05p37_1756659_c1 3300050507 Unclassified 601
1287 nmdc:mga05p37_20831_c1 3300050507 Bacteria 7936
1288 nmdc:mga05p37_209293_c1 3300050507 Unclassified 2358
1289 nmdc:mga05p37_2143596_c1 3300050507 Bacteria 522
1290 nmdc:mga05p37_226973_c1 3300050507 Bacteria 2251
1291 nmdc:mga05p37_27034_c1 3300050507 Bacteria 6983
1292 nmdc:mga05p37_2738_c2 3300050507 Bacteria 17718
1293 nmdc:mga05p37_29743_c1 3300050507 Bacteria 6666
1294 nmdc:mga05p37_38505_c1 3300050507 Bacteria 5865
1295 nmdc:mga05p37_410546_c1 3300050507 Bacteria 1578
1296 nmdc:mga05p37_6177_c1 3300050507 Bacteria 14102
1297 nmdc:mga05p37_71170_c1 3300050507 Bacteria 4278
1298 nmdc:mga05p37_768870_c1 3300050507 Bacteria 1059
1299 nmdc:mga05p37_789914_c1 3300050507 Unclassified 1040
1300 nmdc:mga05p37_83256_c1 3300050507 Bacteria 3941
1301 nmdc:mga09592_101467_c1 3300050508 Unclassified 2465
1302 nmdc:mga09592_1025445_c1 3300050508 Unclassified 689
1303 nmdc:mga09592_1162425_c1 3300050508 Unclassified 639
1304 nmdc:mga09592_1226319_c1 3300050508 Unclassified 619
1305 nmdc:mga09592_2928_c1 3300050508 Bacteria 13833
1306 nmdc:mga09592_459558_c1 3300050508 Bacteria 1098
1307 nmdc:mga09592_483498_c1 3300050508 Unclassified 1067
1308 nmdc:mga09592_66881_c1 3300050508 Bacteria 3047
1309 nmdc:mga0qj67_142930_c1 3300050509 Bacteria 1940
1310 nmdc:mga0qj67_297662_c1 3300050509 Bacteria 1307
1311 nmdc:mga0qj67_48323_c1 3300050509 Bacteria 3361
1312 nmdc:mga0qj67_667180_c1 3300050509 Bacteria 829
1313 nmdc:mga0qj67_72318_c1 3300050509 Bacteria 2753
1314 nmdc:mga0qj67_80907_c1 3300050509 Bacteria 2604
1315 nmdc:mga06r32_100925_c1 3300050510 Bacteria 2831
1316 nmdc:mga06r32_102168_c1 3300050510 Bacteria 2814
1317 nmdc:mga06r32_108864_c1 3300050510 Bacteria 2725
1318 nmdc:mga06r32_1507208_c1 3300050510 Unclassified 612
1319 nmdc:mga06r32_166141_c1 3300050510 Bacteria 2190
1320 nmdc:mga06r32_26338_c1 3300050510 Bacteria 5420
1321 nmdc:mga06r32_444497_c1 3300050510 Bacteria 1276
1322 nmdc:mga06r32_452999_c1 3300050510 Bacteria 1263
1323 nmdc:mga06r32_719294_c1 3300050510 Bacteria 963
1324 nmdc:mga06r32_732389_c1 3300050510 Bacteria 953
1325 nmdc:mga06r32_86599_c1 3300050510 Bacteria 3055
1326 nmdc:mga06r32_881906_c1 3300050510 Bacteria 852
1327 nmdc:mga06r32_98095_c1 3300050510 Unclassified 2872
1328 nmdc:mga08y16_134702_c1 3300050511 Bacteria 2567
1329 nmdc:mga08y16_1685044_c1 3300050511 Bacteria 590
1330 nmdc:mga08y16_392987_c1 3300050511 Bacteria 1420
1331 nmdc:mga08y16_520297_c1 3300050511 Bacteria 1207
1332 nmdc:mga08y16_653305_c1 3300050511 Bacteria 1056
1333 nmdc:mga08y16_7416_c1 3300050511 Bacteria 11491
1334 nmdc:mga08y16_8907_c1 3300050511 Bacteria 10537
1335 nmdc:mga08y16_929148_c1 3300050511 Bacteria 854
1336 nmdc:mga08y16_9369_c1 3300050511 Bacteria 10270
1337 nmdc:mga0n895_1313407_c1 3300050512 Unclassified 694
1338 nmdc:mga0n895_132139_c1 3300050512 Bacteria 2522
1339 nmdc:mga0n895_194829_c1 3300050512 Bacteria 2057
1340 nmdc:mga0n895_1997708_c1 3300050512 Unclassified 538
1341 nmdc:mga0n895_2024542_c1 3300050512 Bacteria 533
1342 nmdc:mga0n895_301955_c1 3300050512 Unclassified 1623
1343 nmdc:mga0n895_340336_c1 3300050512 Bacteria 1519
1344 nmdc:mga0n895_394318_c1 3300050512 Bacteria 1400
1345 nmdc:mga0n895_421558_c1 3300050512 Unclassified 1349
1346 nmdc:mga0n895_45046_c1 3300050512 Bacteria 4304
1347 nmdc:mga0n895_718682_c1 3300050512 Bacteria 994
1348 nmdc:mga0n895_721858_c1 3300050512 Unclassified 991
1349 nmdc:mga0n895_765886_c1 3300050512 Bacteria 957
1350 nmdc:mga0rr50_1314062_c1 3300050513 Unclassified 613
1351 nmdc:mga0rr50_137630_c1 3300050513 Bacteria 1962
1352 nmdc:mga0rr50_242591_c1 3300050513 Unclassified 1494
1353 nmdc:mga0rr50_248189_c1 3300050513 Bacteria 1477
1354 nmdc:mga0rr50_343943_c1 3300050513 Bacteria 1254
1355 nmdc:mga0rr50_47505_c1 3300050513 Bacteria 3167
1356 nmdc:mga0rr50_740511_c1 3300050513 Bacteria 839
1357 nmdc:mga0rr50_793989_c1 3300050513 Unclassified 808
1358 nmdc:mga08x19_229740_c1 3300050514 Bacteria 1277
1359 nmdc:mga08x19_6364_c1 3300050514 Bacteria 6990
1360 nmdc:mga08x19_900864_c1 3300050514 Bacteria 628
1361 nmdc:mga0a205_100557_c2 3300050515 Bacteria 2429
1362 nmdc:mga0a205_1686_c1 3300050515 Bacteria 19071
1363 nmdc:mga0a205_19164_c1 3300050515 Bacteria 6448
1364 nmdc:mga0a205_196988_c2 3300050515 Unclassified 1546
1365 nmdc:mga0a205_339228_c1 3300050515 Bacteria 1371
1366 nmdc:mga0a205_345110_c1 3300050515 Bacteria 1357
1367 nmdc:mga0a205_388379_c1 3300050515 Unclassified 1260
1368 nmdc:mga0a205_428895_c1 3300050515 Unclassified 1184
1369 nmdc:mga0a205_468679_c1 3300050515 Bacteria 1118
1370 nmdc:mga0a205_74905_c2 3300050515 Bacteria 2971
1371 nmdc:mga0a205_86326_c1 3300050515 Unclassified 3031
1372 nmdc:mga0sz30_281466_c1 3300050516 Bacteria 741
1373 nmdc:mga0sz30_51515_c1 3300050516 Bacteria 1746
1374 Ga0495601_0001021 3300053077 Bacteria 15304
1375 Ga0495601_0095336 3300053077 Bacteria 1918
1376 Ga0495601_0225021 3300053077 Bacteria 1226
1377 Ga0495601_0371243 3300053077 Bacteria 929
1378 Ga0495601_0691420 3300053077 Unclassified 651
1379 Ga0495612_0460664 3300053078 Unclassified 581
1380 Ga0495595_0528633 3300053084 Unclassified 602
1381 Ga0495619_0000905 3300053085 Bacteria 19424
1382 Ga0495619_0118877 3300053085 Bacteria 1811
1383 Ga0495619_0150602 3300053085 Bacteria 1605
1384 Ga0495619_0151616 3300053085 Bacteria 1599
1385 Ga0495619_0248557 3300053085 Bacteria 1232
1386 Ga0495619_0248654 3300053085 Bacteria 1232
1387 Ga0495619_0249327 3300053085 Bacteria 1230
1388 Ga0495619_0326669 3300053085 Bacteria 1062
1389 Ga0500555_060744 3300053103 Bacteria 1017
1390 Ga0501084_0089602 3300054114 Bacteria 2582
1391 Ga0501084_0194380 3300054114 Bacteria 1712
1392 Ga0501084_0241347 3300054114 Bacteria 1525
1393 Ga0501084_0277564 3300054114 Bacteria 1415
1394 Ga0501084_0369950 3300054114 Bacteria 1211
1395 Ga0501084_0576016 3300054114 Unclassified 951
1396 Ga0501084_0702670 3300054114 Unclassified 853
1397 Ga0501084_1209224 3300054114 Unclassified 634
1398 Ga0501084_1276824 3300054114 Unclassified 616
1399 Ga0501084_1429318 3300054114 Bacteria 579
1400 Ga0501084_1442607 3300054114 Unclassified 576
1401 Ga0501084_1815246 3300054114 Unclassified 509
1402 Ga0590071_007833 3300059421 Bacteria 2525
1403 Ga0590077_002299 3300059426 Bacteria 4128
1404 Ga0590077_041235 3300059426 Bacteria 1026
1405 Ga0501082_0111869 3300060353 Bacteria 2364
1406 Ga0501082_0182024 3300060353 Bacteria 1828
1407 Ga0501082_0384535 3300060353 Bacteria 1225
1408 Ga0501082_0553563 3300060353 Bacteria 1006
1409 Ga0501082_0801192 3300060353 Unclassified 824
1410 Ga0501082_0922188 3300060353 Unclassified 764
1411 Ga0530510_0035013 3300061734 Unclassified 3618
1412 Ga0530510_0065854 3300061734 Bacteria 2626
1413 Ga0530510_0128067 3300061734 Bacteria 1867
1414 Ga0530510_0148807 3300061734 Bacteria 1728
1415 Ga0530510_0175133 3300061734 Bacteria 1590
1416 Ga0530510_0610693 3300061734 Unclassified 830
1417 Ga0530510_1100764 3300061734 Unclassified 609
1418 Ga0530510_1343010 3300061734 Bacteria 548

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_3468293 Ga0451853_3468293_88_426 111
2 3300005616 Ga0068852_102091960 Ga0068852_1020919601 113
3 3300006881 Ga0068865_100424070 Ga0068865_1004240702 113
4 3300005354 Ga0070675_100199772 Ga0070675_1001997722 114
5 3300014326 Ga0157380_11890567 Ga0157380_118905672 114
6 3300025925 Ga0207650_11460745 Ga0207650_114607452 114
7 3300026075 Ga0207708_10839177 Ga0207708_108391771 114
8 3300026089 Ga0207648_10105600 Ga0207648_101056004 114
9 3300035692 Ga0373935_1130831 Ga0373935_1130831_125_484 114
10 3300046454 Ga0495592_0045114 Ga0495592_0045114_1842_2201 114
11 3300046472 Ga0495580_1051214 Ga0495580_1051214_124_471 114
12 3300046642 Ga0495634_0336374 Ga0495634_0336374_103_462 114
13 3300046678 Ga0495599_0091975 Ga0495599_0091975_1040_1399 114
14 3300047319 Ga0495674_0258680 Ga0495674_0258680_1022_1381 114
15 3300005354 Ga0070675_100000263 Ga0070675_10000026313 115
16 3300013296 Ga0157374_11376441 Ga0157374_113764412 115
17 3300013308 Ga0157375_12577862 Ga0157375_125778621 115
18 3300014745 Ga0157377_10279296 Ga0157377_102792962 115
19 3300025926 Ga0207659_10000369 Ga0207659_100003698 115
20 3300028380 Ga0268265_12471776 Ga0268265_124717762 115
21 3300032002 Ga0307416_101233158 Ga0307416_1012331582 115
22 3300005334 Ga0068869_100058302 Ga0068869_1000583024 116
23 3300005338 Ga0068868_100083627 Ga0068868_1000836274 116
24 3300005343 Ga0070687_100378175 Ga0070687_1003781752 116
25 3300005354 Ga0070675_100526730 Ga0070675_1005267301 116
26 3300005356 Ga0070674_101187006 Ga0070674_1011870061 116
27 3300005356 Ga0070674_101700710 Ga0070674_1017007101 116
28 3300005364 Ga0070673_100036388 Ga0070673_1000363882 116
29 3300005456 Ga0070678_100172781 Ga0070678_1001727812 116
30 3300005458 Ga0070681_10211377 Ga0070681_102113772 116
31 3300005459 Ga0068867_100641739 Ga0068867_1006417392 116
32 3300005466 Ga0070685_10614421 Ga0070685_106144211 116
33 3300005543 Ga0070672_100248761 Ga0070672_1002487612 116
34 3300005548 Ga0070665_100009673 Ga0070665_1000096732 116
35 3300005615 Ga0070702_101749689 Ga0070702_1017496891 116
36 3300005842 Ga0068858_100104020 Ga0068858_1001040202 116
37 3300005843 Ga0068860_100031017 Ga0068860_1000310175 116
38 3300005985 Ga0081539_10014244 Ga0081539_100142442 116
39 3300006237 Ga0097621_100009812 Ga0097621_1000098125 116
40 3300006881 Ga0068865_100091282 Ga0068865_1000912822 116
41 3300009098 Ga0105245_10055485 Ga0105245_100554852 116
42 3300009148 Ga0105243_12629952 Ga0105243_126299521 116
43 3300009551 Ga0105238_11723206 Ga0105238_117232062 116
44 3300009551 Ga0105238_12226418 Ga0105238_122264182 116
45 3300013296 Ga0157374_11121399 Ga0157374_111213992 116
46 3300013297 Ga0157378_10142479 Ga0157378_101424794 116
47 3300013306 Ga0163162_11004808 Ga0163162_110048082 116
48 3300013308 Ga0157375_10155119 Ga0157375_101551194 116
49 3300014968 Ga0157379_11225589 Ga0157379_112255892 116
50 3300014969 Ga0157376_10000975 Ga0157376_1000097523 116
51 3300025907 Ga0207645_10328202 Ga0207645_103282022 116
52 3300025926 Ga0207659_10643330 Ga0207659_106433302 116
53 3300025927 Ga0207687_10070843 Ga0207687_100708434 116
54 3300025937 Ga0207669_10384681 Ga0207669_103846812 116
55 3300025938 Ga0207704_10180091 Ga0207704_101800912 116
56 3300025940 Ga0207691_10789642 Ga0207691_107896421 116
57 3300025941 Ga0207711_10074486 Ga0207711_100744862 116
58 3300025942 Ga0207689_10078629 Ga0207689_100786294 116
59 3300025960 Ga0207651_10201501 Ga0207651_102015012 116
60 3300026023 Ga0207677_10025212 Ga0207677_100252125 116
61 3300026035 Ga0207703_10112437 Ga0207703_101124372 116
62 3300026088 Ga0207641_10513476 Ga0207641_105134762 116
63 3300026089 Ga0207648_10124554 Ga0207648_101245543 116
64 3300026121 Ga0207683_10141360 Ga0207683_101413602 116
65 3300028379 Ga0268266_10135488 Ga0268266_101354882 116
66 3300028381 Ga0268264_10243636 Ga0268264_102436362 116
67 3300048904 Ga0496101_0806585 Ga0496101_0806585_273_629 116
68 3300049572 Ga0501036_0214944 Ga0501036_0214944_779_1129 116
69 3300049575 Ga0501039_0042891 Ga0501039_0042891_1553_1903 116
70 3300049576 Ga0501040_0401635 Ga0501040_0401635_55_405 116
71 3300049577 Ga0501041_0065202 Ga0501041_0065202_154_504 116
72 3300049578 Ga0501042_0556675 Ga0501042_0556675_290_640 116
73 3300049579 Ga0501043_1073480 Ga0501043_1073480_54_404 116
74 3300049582 Ga0501048_0682498 Ga0501048_0682498_206_556 116
75 3300049582 Ga0501048_0713459 Ga0501048_0713459_290_643 116
76 3300049587 Ga0501071_0231381 Ga0501071_0231381_213_563 116
77 3300049588 Ga0501072_0016297 Ga0501072_0016297_4733_5083 116
78 3300049591 Ga0501075_0300054 Ga0501075_0300054_598_948 116
79 3300049592 Ga0501076_0029060 Ga0501076_0029060_3483_3833 116
80 3300049741 Ga0501079_0464306 Ga0501079_0464306_386_736 116
81 3300049742 Ga0501080_0349522 Ga0501080_0349522_735_1085 116
82 3300049743 Ga0501081_0807818 Ga0501081_0807818_294_644 116
83 3300049824 Ga0501045_0013441 Ga0501045_0013441_4514_4864 116
84 3300050493 nmdc:mga0k408_741485_c1 nmdc:mga0k408_741485_c1_55_426 116
85 3300054114 Ga0501084_1442607 Ga0501084_1442607_53_403 116
86 3300060353 Ga0501082_0111869 Ga0501082_0111869_908_1258 116
87 3300061734 Ga0530510_0148807 Ga0530510_0148807_916_1266 116
88 3300002459 JGI24751J29686_10008866 JGI24751J29686_100088663 117
89 3300005290 Ga0065712_10510675 Ga0065712_105106751 117
90 3300005293 Ga0065715_10516821 Ga0065715_105168211 117
91 3300005331 Ga0070670_100015511 Ga0070670_1000155113 117
92 3300005333 Ga0070677_10166188 Ga0070677_101661881 117
93 3300005333 Ga0070677_10400842 Ga0070677_104008422 117
94 3300005343 Ga0070687_100808544 Ga0070687_1008085442 117
95 3300005344 Ga0070661_101304614 Ga0070661_1013046142 117
96 3300005353 Ga0070669_100278463 Ga0070669_1002784631 117
97 3300005354 Ga0070675_100195158 Ga0070675_1001951583 117
98 3300005354 Ga0070675_101159563 Ga0070675_1011595632 117
99 3300005356 Ga0070674_100038015 Ga0070674_1000380153 117
100 3300005356 Ga0070674_101260923 Ga0070674_1012609231 117
101 3300005434 Ga0070709_11186304 Ga0070709_111863042 117
102 3300005444 Ga0070694_100338638 Ga0070694_1003386382 117
103 3300005455 Ga0070663_101240837 Ga0070663_1012408371 117
104 3300005471 Ga0070698_100341131 Ga0070698_1003411311 117
105 3300005543 Ga0070672_101358823 Ga0070672_1013588232 117
106 3300005549 Ga0070704_101865880 Ga0070704_1018658801 117
107 3300005841 Ga0068863_102496448 Ga0068863_1024964481 117
108 3300006173 Ga0070716_100197736 Ga0070716_1001977362 117
109 3300006852 Ga0075433_10001180 Ga0075433_100011806 117
110 3300006852 Ga0075433_10193567 Ga0075433_101935673 117
111 3300006871 Ga0075434_100074174 Ga0075434_1000741743 117
112 3300006871 Ga0075434_100385280 Ga0075434_1003852802 117
113 3300007076 Ga0075435_100200359 Ga0075435_1002003592 117
114 3300009147 Ga0114129_10014560 Ga0114129_1001456013 117
115 3300009147 Ga0114129_10029746 Ga0114129_100297464 117
116 3300009147 Ga0114129_10506899 Ga0114129_105068992 117
117 3300009553 Ga0105249_10113961 Ga0105249_101139612 117
118 3300009553 Ga0105249_13071043 Ga0105249_130710431 117
119 3300013308 Ga0157375_10160971 Ga0157375_101609712 117
120 3300014745 Ga0157377_11036333 Ga0157377_110363331 117
121 3300014969 Ga0157376_12051121 Ga0157376_120511211 117
122 3300025893 Ga0207682_10354109 Ga0207682_103541091 117
123 3300025922 Ga0207646_11849867 Ga0207646_118498672 117
124 3300025923 Ga0207681_10614112 Ga0207681_106141121 117
125 3300025939 Ga0207665_11639778 Ga0207665_116397781 117
126 3300028380 Ga0268265_10120559 Ga0268265_101205591 117
127 3300032002 Ga0307416_103873736 Ga0307416_1038737361 117
128 3300041460 Ga0451802_1910756 Ga0451802_1910756_242_601 117
129 3300042156 Ga0439446_0246314 Ga0439446_0246314_89_442 117
130 3300045976 Ga0466967_0514393 Ga0466967_0514393_134_487 117
131 3300046462 Ga0495651_0835005 Ga0495651_0835005_42_395 117
132 3300046543 Ga0495645_0006999 Ga0495645_0006999_3228_3581 117
133 3300046642 Ga0495634_0048319 Ga0495634_0048319_1860_2216 117
134 3300046694 Ga0495649_0515104 Ga0495649_0515104_65_445 117
135 3300047471 Ga0495684_0500086 Ga0495684_0500086_157_510 117
136 3300048917 Ga0496114_0207454 Ga0496114_0207454_1240_1593 117
137 3300049572 Ga0501036_0096073 Ga0501036_0096073_211_564 117
138 3300049577 Ga0501041_0077878 Ga0501041_0077878_626_979 117
139 3300049582 Ga0501048_0822114 Ga0501048_0822114_131_484 117
140 3300049587 Ga0501071_0756575 Ga0501071_0756575_224_577 117
141 3300049588 Ga0501072_0236472 Ga0501072_0236472_615_968 117
142 3300049591 Ga0501075_0025120 Ga0501075_0025120_3596_3949 117
143 3300049592 Ga0501076_0033584 Ga0501076_0033584_2716_3069 117
144 3300049742 Ga0501080_1002540 Ga0501080_1002540_50_409 117
145 3300049743 Ga0501081_0281554 Ga0501081_0281554_269_622 117
146 3300049743 Ga0501081_1183681 Ga0501081_1183681_25_387 117
147 3300050507 nmdc:mga05p37_768870_c1 nmdc:mga05p37_768870_c1_597_953 117
148 3300050508 nmdc:mga09592_2928_c1 nmdc:mga09592_2928_c1_5426_5800 117
149 3300050512 nmdc:mga0n895_340336_c1 nmdc:mga0n895_340336_c1_746_1099 117
150 3300050512 nmdc:mga0n895_45046_c1 nmdc:mga0n895_45046_c1_790_1146 117
151 3300050512 nmdc:mga0n895_765886_c1 nmdc:mga0n895_765886_c1_534_887 117
152 3300050513 nmdc:mga0rr50_343943_c1 nmdc:mga0rr50_343943_c1_625_981 117
153 3300050515 nmdc:mga0a205_1686_c1 nmdc:mga0a205_1686_c1_4199_4552 117
154 3300053077 Ga0495601_0691420 Ga0495601_0691420_96_449 117
155 3300054114 Ga0501084_0194380 Ga0501084_0194380_1178_1531 117
156 3300054114 Ga0501084_1276824 Ga0501084_1276824_215_574 117
157 3300060353 Ga0501082_0922188 Ga0501082_0922188_176_529 117
158 3300061734 Ga0530510_0035013 Ga0530510_0035013_236_589 117
159 3300005290 Ga0065712_10007697 Ga0065712_100076974 118
160 3300005327 Ga0070658_10098188 Ga0070658_100981882 118
161 3300005333 Ga0070677_10098207 Ga0070677_100982071 118
162 3300005336 Ga0070680_100768471 Ga0070680_1007684712 118
163 3300005339 Ga0070660_100249584 Ga0070660_1002495842 118
164 3300005344 Ga0070661_100438020 Ga0070661_1004380202 118
165 3300005347 Ga0070668_100020058 Ga0070668_1000200581 118
166 3300005353 Ga0070669_100186217 Ga0070669_1001862172 118
167 3300005353 Ga0070669_100492567 Ga0070669_1004925672 118
168 3300005354 Ga0070675_100032497 Ga0070675_1000324972 118
169 3300005354 Ga0070675_100464244 Ga0070675_1004642441 118
170 3300005356 Ga0070674_100380861 Ga0070674_1003808612 118
171 3300005364 Ga0070673_100538071 Ga0070673_1005380712 118
172 3300005367 Ga0070667_101178617 Ga0070667_1011786171 118
173 3300005439 Ga0070711_100532606 Ga0070711_1005326062 118
174 3300005441 Ga0070700_100320247 Ga0070700_1003202471 118
175 3300005441 Ga0070700_100915036 Ga0070700_1009150361 118
176 3300005444 Ga0070694_100531954 Ga0070694_1005319542 118
177 3300005456 Ga0070678_101765676 Ga0070678_1017656761 118
178 3300005457 Ga0070662_100420794 Ga0070662_1004207942 118
179 3300005458 Ga0070681_10051671 Ga0070681_100516712 118
180 3300005458 Ga0070681_10083353 Ga0070681_100833532 118
181 3300005459 Ga0068867_102058541 Ga0068867_1020585412 118
182 3300005468 Ga0070707_100464821 Ga0070707_1004648212 118
183 3300005468 Ga0070707_100891641 Ga0070707_1008916412 118
184 3300005471 Ga0070698_100437529 Ga0070698_1004375292 118
185 3300005530 Ga0070679_100097367 Ga0070679_1000973674 118
186 3300005535 Ga0070684_100162562 Ga0070684_1001625622 118
187 3300005535 Ga0070684_101869587 Ga0070684_1018695871 118
188 3300005539 Ga0068853_100866124 Ga0068853_1008661241 118
189 3300005543 Ga0070672_100704769 Ga0070672_1007047692 118
190 3300005548 Ga0070665_100010784 Ga0070665_1000107849 118
191 3300005549 Ga0070704_101904288 Ga0070704_1019042881 118
192 3300005563 Ga0068855_100006730 Ga0068855_10000673013 118
193 3300005563 Ga0068855_100078218 Ga0068855_1000782186 118
194 3300005563 Ga0068855_100607357 Ga0068855_1006073572 118
195 3300005577 Ga0068857_100076213 Ga0068857_1000762132 118
196 3300005614 Ga0068856_101263594 Ga0068856_1012635942 118
197 3300005616 Ga0068852_101038209 Ga0068852_1010382092 118
198 3300005718 Ga0068866_10489349 Ga0068866_104893492 118
199 3300005719 Ga0068861_100390075 Ga0068861_1003900752 118
200 3300005844 Ga0068862_100972564 Ga0068862_1009725641 118
201 3300005937 Ga0081455_10450650 Ga0081455_104506502 118
202 3300006038 Ga0075365_10211371 Ga0075365_102113712 118
203 3300006038 Ga0075365_11055682 Ga0075365_110556822 118
204 3300006042 Ga0075368_10004146 Ga0075368_100041463 118
205 3300006042 Ga0075368_10022443 Ga0075368_100224432 118
206 3300006042 Ga0075368_10046216 Ga0075368_100462162 118
207 3300006051 Ga0075364_10007212 Ga0075364_100072126 118
208 3300006051 Ga0075364_10019158 Ga0075364_100191582 118
209 3300006051 Ga0075364_10030281 Ga0075364_100302812 118
210 3300006177 Ga0075362_10000612 Ga0075362_100006125 118
211 3300006177 Ga0075362_10005422 Ga0075362_100054223 118
212 3300006178 Ga0075367_10016516 Ga0075367_100165162 118
213 3300006178 Ga0075367_10021644 Ga0075367_100216443 118
214 3300006178 Ga0075367_10043715 Ga0075367_100437152 118
215 3300006186 Ga0075369_10472080 Ga0075369_104720802 118
216 3300006195 Ga0075366_10005604 Ga0075366_100056045 118
217 3300006195 Ga0075366_10031509 Ga0075366_100315092 118
218 3300006237 Ga0097621_100042330 Ga0097621_1000423302 118
219 3300006237 Ga0097621_101163859 Ga0097621_1011638592 118
220 3300006353 Ga0075370_10073026 Ga0075370_100730262 118
221 3300006353 Ga0075370_10124251 Ga0075370_101242512 118
222 3300006358 Ga0068871_100020951 Ga0068871_1000209512 118
223 3300006844 Ga0075428_100057445 Ga0075428_1000574453 118
224 3300006844 Ga0075428_100479873 Ga0075428_1004798732 118
225 3300006844 Ga0075428_100698175 Ga0075428_1006981752 118
226 3300006844 Ga0075428_100797293 Ga0075428_1007972931 118
227 3300006844 Ga0075428_101299967 Ga0075428_1012999672 118
228 3300006846 Ga0075430_100048754 Ga0075430_1000487544 118
229 3300006846 Ga0075430_100546638 Ga0075430_1005466382 118
230 3300006847 Ga0075431_100218693 Ga0075431_1002186932 118
231 3300006847 Ga0075431_100509425 Ga0075431_1005094252 118
232 3300006847 Ga0075431_101015630 Ga0075431_1010156301 118
233 3300006847 Ga0075431_101330355 Ga0075431_1013303552 118
234 3300006852 Ga0075433_10165387 Ga0075433_101653872 118
235 3300006871 Ga0075434_100201853 Ga0075434_1002018532 118
236 3300006880 Ga0075429_100038356 Ga0075429_1000383562 118
237 3300006880 Ga0075429_101976773 Ga0075429_1019767731 118
238 3300006881 Ga0068865_100013820 Ga0068865_1000138204 118
239 3300006881 Ga0068865_102113716 Ga0068865_1021137161 118
240 3300006914 Ga0075436_100647231 Ga0075436_1006472312 118
241 3300007076 Ga0075435_100107383 Ga0075435_1001073832 118
242 3300007788 Ga0099795_10350812 Ga0099795_103508121 118
243 3300009093 Ga0105240_10168722 Ga0105240_101687222 118
244 3300009094 Ga0111539_10002910 Ga0111539_100029109 118
245 3300009094 Ga0111539_10019405 Ga0111539_100194052 118
246 3300009094 Ga0111539_10149077 Ga0111539_101490771 118
247 3300009101 Ga0105247_10183334 Ga0105247_101833342 118
248 3300009147 Ga0114129_10013890 Ga0114129_100138902 118
249 3300009147 Ga0114129_10504386 Ga0114129_105043862 118
250 3300009147 Ga0114129_10821864 Ga0114129_108218642 118
251 3300009147 Ga0114129_11462435 Ga0114129_114624352 118
252 3300009147 Ga0114129_11603241 Ga0114129_116032412 118
253 3300009147 Ga0114129_11885200 Ga0114129_118852002 118
254 3300009147 Ga0114129_12297577 Ga0114129_122975771 118
255 3300009147 Ga0114129_12505978 Ga0114129_125059782 118
256 3300009147 Ga0114129_12638583 Ga0114129_126385831 118
257 3300009147 Ga0114129_12895361 Ga0114129_128953612 118
258 3300009176 Ga0105242_10022073 Ga0105242_100220734 118
259 3300009177 Ga0105248_10163520 Ga0105248_101635203 118
260 3300009177 Ga0105248_10197614 Ga0105248_101976142 118
261 3300009177 Ga0105248_11059300 Ga0105248_110593001 118
262 3300009551 Ga0105238_10469453 Ga0105238_104694531 118
263 3300009551 Ga0105238_11962004 Ga0105238_119620041 118
264 3300009553 Ga0105249_10474338 Ga0105249_104743382 118
265 3300009553 Ga0105249_10618751 Ga0105249_106187512 118
266 3300010375 Ga0105239_12802094 Ga0105239_128020941 118
267 3300011119 Ga0105246_11812800 Ga0105246_118128002 118
268 3300013105 Ga0157369_10567572 Ga0157369_105675722 118
269 3300013297 Ga0157378_11527118 Ga0157378_115271182 118
270 3300014326 Ga0157380_10585523 Ga0157380_105855231 118
271 3300014326 Ga0157380_11890717 Ga0157380_118907171 118
272 3300014968 Ga0157379_10611574 Ga0157379_106115742 118
273 3300014968 Ga0157379_11285734 Ga0157379_112857342 118
274 3300014969 Ga0157376_10107811 Ga0157376_101078112 118
275 3300025315 Ga0207697_10434919 Ga0207697_104349192 118
276 3300025893 Ga0207682_10424402 Ga0207682_104244021 118
277 3300025899 Ga0207642_10045161 Ga0207642_100451612 118
278 3300025899 Ga0207642_10900037 Ga0207642_109000372 118
279 3300025900 Ga0207710_10173438 Ga0207710_101734382 118
280 3300025907 Ga0207645_10033074 Ga0207645_100330742 118
281 3300025909 Ga0207705_10284554 Ga0207705_102845542 118
282 3300025912 Ga0207707_10068249 Ga0207707_100682492 118
283 3300025913 Ga0207695_10327086 Ga0207695_103270862 118
284 3300025914 Ga0207671_11521237 Ga0207671_115212371 118
285 3300025916 Ga0207663_10976093 Ga0207663_109760932 118
286 3300025917 Ga0207660_10491267 Ga0207660_104912672 118
287 3300025919 Ga0207657_10005651 Ga0207657_100056514 118
288 3300025921 Ga0207652_11018784 Ga0207652_110187841 118
289 3300025922 Ga0207646_10906412 Ga0207646_109064122 118
290 3300025922 Ga0207646_11387178 Ga0207646_113871781 118
291 3300025923 Ga0207681_10127047 Ga0207681_101270472 118
292 3300025923 Ga0207681_11197134 Ga0207681_111971342 118
293 3300025924 Ga0207694_10331346 Ga0207694_103313461 118
294 3300025926 Ga0207659_10007963 Ga0207659_100079633 118
295 3300025928 Ga0207700_10057909 Ga0207700_100579092 118
296 3300025932 Ga0207690_10222786 Ga0207690_102227863 118
297 3300025933 Ga0207706_10469337 Ga0207706_104693372 118
298 3300025934 Ga0207686_10084333 Ga0207686_100843332 118
299 3300025937 Ga0207669_10163169 Ga0207669_101631691 118
300 3300025937 Ga0207669_10392314 Ga0207669_103923142 118
301 3300025938 Ga0207704_10030711 Ga0207704_100307112 118
302 3300025941 Ga0207711_10519466 Ga0207711_105194661 118
303 3300025941 Ga0207711_10642110 Ga0207711_106421102 118
304 3300025944 Ga0207661_10008224 Ga0207661_100082243 118
305 3300025949 Ga0207667_10092976 Ga0207667_100929762 118
306 3300025949 Ga0207667_10094336 Ga0207667_100943362 118
307 3300025949 Ga0207667_10319060 Ga0207667_103190602 118
308 3300025961 Ga0207712_10417505 Ga0207712_104175052 118
309 3300025972 Ga0207668_10351114 Ga0207668_103511141 118
310 3300025981 Ga0207640_10609991 Ga0207640_106099912 118
311 3300025986 Ga0207658_10889535 Ga0207658_108895351 118
312 3300026075 Ga0207708_10031124 Ga0207708_100311242 118
313 3300026075 Ga0207708_10699232 Ga0207708_106992322 118
314 3300026075 Ga0207708_10764201 Ga0207708_107642011 118
315 3300026075 Ga0207708_11113690 Ga0207708_111136902 118
316 3300026078 Ga0207702_10149816 Ga0207702_101498161 118
317 3300026078 Ga0207702_10225637 Ga0207702_102256372 118
318 3300026118 Ga0207675_100358573 Ga0207675_1003585732 118
319 3300026142 Ga0207698_10772378 Ga0207698_107723782 118
320 3300027682 Ga0209971_1029609 Ga0209971_10296092 118
321 3300027866 Ga0209813_10018216 Ga0209813_100182162 118
322 3300027866 Ga0209813_10030413 Ga0209813_100304132 118
323 3300027866 Ga0209813_10176690 Ga0209813_101766901 118
324 3300027907 Ga0207428_10003247 Ga0207428_100032479 118
325 3300028380 Ga0268265_10051494 Ga0268265_100514941 118
326 3300031548 Ga0307408_100324684 Ga0307408_1003246842 118
327 3300031731 Ga0307405_10205354 Ga0307405_102053542 118
328 3300031852 Ga0307410_10052205 Ga0307410_100522053 118
329 3300031901 Ga0307406_11838811 Ga0307406_118388111 118
330 3300031903 Ga0307407_10274800 Ga0307407_102748002 118
331 3300031911 Ga0307412_11335117 Ga0307412_113351172 118
332 3300031995 Ga0307409_100088819 Ga0307409_1000888192 118
333 3300031995 Ga0307409_100630369 Ga0307409_1006303692 118
334 3300032002 Ga0307416_100006416 Ga0307416_1000064164 118
335 3300032005 Ga0307411_10027368 Ga0307411_100273682 118
336 3300035086 Ga0373934_0136435 Ga0373934_0136435_573_950 118
337 3300035089 Ga0373944_0067432 Ga0373944_0067432_621_980 118
338 3300035118 Ga0373954_0464738 Ga0373954_0464738_98_475 118
339 3300035119 Ga0373956_0550643 Ga0373956_0550643_134_493 118
340 3300035171 Ga0373946_0187164 Ga0373946_0187164_329_688 118
341 3300035410 Ga0373924_0417055 Ga0373924_0417055_23_382 118
342 3300035692 Ga0373935_0406277 Ga0373935_0406277_481_840 118
343 3300035724 Ga0373933_0314609 Ga0373933_0314609_457_834 118
344 3300035725 Ga0373947_0508393 Ga0373947_0508393_129_506 118
345 3300036401 Ga0373937_0553235 Ga0373937_0553235_350_709 118
346 3300036401 Ga0373937_0774386 Ga0373937_0774386_228_587 118
347 3300037068 Ga0373925_0141686 Ga0373925_0141686_203_559 118
348 3300037466 Ga0395898_0657269 Ga0395898_0657269_246_605 118
349 3300041410 Ga0439461_0210524 Ga0439461_0210524_113_469 118
350 3300042436 Ga0439435_0081378 Ga0439435_0081378_551_907 118
351 3300042461 Ga0439460_0085754 Ga0439460_0085754_346_705 118
352 3300042461 Ga0439460_0168790 Ga0439460_0168790_248_604 118
353 3300045051 Ga0451576_0508735 Ga0451576_0508735_219_578 118
354 3300045976 Ga0466967_0326134 Ga0466967_0326134_141_497 118
355 3300046459 Ga0495629_0048860 Ga0495629_0048860_133_492 118
356 3300046460 Ga0495638_0008188 Ga0495638_0008188_1914_2273 118
357 3300046460 Ga0495638_0159524 Ga0495638_0159524_793_1149 118
358 3300046462 Ga0495651_0734815 Ga0495651_0734815_109_486 118
359 3300046472 Ga0495580_0203587 Ga0495580_0203587_349_726 118
360 3300046473 Ga0495582_0197190 Ga0495582_0197190_149_526 118
361 3300046473 Ga0495582_0744393 Ga0495582_0744393_146_502 118
362 3300046511 Ga0495608_0002617 Ga0495608_0002617_132_509 118
363 3300046516 Ga0495628_0040510 Ga0495628_0040510_435_812 118
364 3300046516 Ga0495628_0151710 Ga0495628_0151710_90_446 118
365 3300046517 Ga0495630_0015118 Ga0495630_0015118_4823_5200 118
366 3300046517 Ga0495630_0986396 Ga0495630_0986396_53_430 118
367 3300046525 Ga0495663_0117327 Ga0495663_0117327_175_540 118
368 3300046529 Ga0495652_0212949 Ga0495652_0212949_308_685 118
369 3300046531 Ga0495665_0053238 Ga0495665_0053238_668_1045 118
370 3300046535 Ga0495586_0352909 Ga0495586_0352909_286_663 118
371 3300046536 Ga0495587_0015255 Ga0495587_0015255_1662_2039 118
372 3300046536 Ga0495587_0465028 Ga0495587_0465028_239_601 118
373 3300046543 Ga0495645_0088034 Ga0495645_0088034_1064_1441 118
374 3300046559 Ga0495667_0015027 Ga0495667_0015027_4694_5071 118
375 3300046559 Ga0495667_0276447 Ga0495667_0276447_558_917 118
376 3300046615 Ga0495656_0463212 Ga0495656_0463212_222_578 118
377 3300046663 Ga0495635_0685285 Ga0495635_0685285_188_547 118
378 3300046664 Ga0495659_0447166 Ga0495659_0447166_74_430 118
379 3300046681 Ga0495647_0053986 Ga0495647_0053986_526_903 118
380 3300046681 Ga0495647_0164920 Ga0495647_0164920_19_378 118
381 3300046684 Ga0495669_0004290 Ga0495669_0004290_513_890 118
382 3300046689 Ga0495613_0000460 Ga0495613_0000460_8569_8946 118
383 3300046809 Ga0495600_0064883 Ga0495600_0064883_523_900 118
384 3300046809 Ga0495600_0147941 Ga0495600_0147941_569_928 118
385 3300047315 Ga0495581_0614559 Ga0495581_0614559_21_398 118
386 3300047317 Ga0495604_0022896 Ga0495604_0022896_253_630 118
387 3300047319 Ga0495674_0204527 Ga0495674_0204527_1101_1460 118
388 3300047444 Ga0495675_0086686 Ga0495675_0086686_282_659 118
389 3300047471 Ga0495684_0000011 Ga0495684_0000011_173354_173731 118
390 3300048907 Ga0496104_0190219 Ga0496104_0190219_1391_1747 118
391 3300048913 Ga0496110_0851591 Ga0496110_0851591_177_533 118
392 3300048915 Ga0496112_0250188 Ga0496112_0250188_1166_1525 118
393 3300048917 Ga0496114_0020936 Ga0496114_0020936_1670_2047 118
394 3300048917 Ga0496114_0459142 Ga0496114_0459142_416_775 118
395 3300049572 Ga0501036_0085962 Ga0501036_0085962_1542_1898 118
396 3300049572 Ga0501036_1547782 Ga0501036_1547782_85_441 118
397 3300049575 Ga0501039_1024109 Ga0501039_1024109_231_587 118
398 3300049576 Ga0501040_0081902 Ga0501040_0081902_1525_1881 118
399 3300049577 Ga0501041_0558089 Ga0501041_0558089_127_483 118
400 3300049577 Ga0501041_0681295 Ga0501041_0681295_76_432 118
401 3300049578 Ga0501042_0245811 Ga0501042_0245811_627_983 118
402 3300049582 Ga0501048_0126263 Ga0501048_0126263_392_748 118
403 3300049587 Ga0501071_0227948 Ga0501071_0227948_1015_1371 118
404 3300049588 Ga0501072_0139036 Ga0501072_0139036_171_527 118
405 3300049588 Ga0501072_0248440 Ga0501072_0248440_953_1315 118
406 3300049591 Ga0501075_0115421 Ga0501075_0115421_137_493 118
407 3300049591 Ga0501075_0456567 Ga0501075_0456567_424_780 118
408 3300049591 Ga0501075_0616205 Ga0501075_0616205_373_729 118
409 3300049592 Ga0501076_0171493 Ga0501076_0171493_1127_1483 118
410 3300049592 Ga0501076_0476171 Ga0501076_0476171_148_504 118
411 3300049592 Ga0501076_0540538 Ga0501076_0540538_519_881 118
412 3300049592 Ga0501076_0774979 Ga0501076_0774979_412_777 118
413 3300049668 Ga0501233_088484 Ga0501233_088484_386_742 118
414 3300049704 Ga0501221_123152 Ga0501221_123152_92_448 118
415 3300049741 Ga0501079_0087881 Ga0501079_0087881_606_962 118
416 3300049741 Ga0501079_0190006 Ga0501079_0190006_356_712 118
417 3300049824 Ga0501045_0599848 Ga0501045_0599848_286_642 118
418 3300049824 Ga0501045_1194561 Ga0501045_1194561_174_530 118
419 3300049824 Ga0501045_1301088 Ga0501045_1301088_103_468 118
420 3300050489 nmdc:mga03683_17494_c1 nmdc:mga03683_17494_c1_1719_2075 118
421 3300050489 nmdc:mga03683_62505_c1 nmdc:mga03683_62505_c1_534_890 118
422 3300050491 nmdc:mga00v17_1193_c1 nmdc:mga00v17_1193_c1_6548_6904 118
423 3300050491 nmdc:mga00v17_17412_c1 nmdc:mga00v17_17412_c1_2217_2573 118
424 3300050491 nmdc:mga00v17_179328_c1 nmdc:mga00v17_179328_c1_353_709 118
425 3300050491 nmdc:mga00v17_87170_c1 nmdc:mga00v17_87170_c1_12_368 118
426 3300050492 nmdc:mga0yw44_217631_c1 nmdc:mga0yw44_217631_c1_137_493 118
427 3300050492 nmdc:mga0yw44_296469_c1 nmdc:mga0yw44_296469_c1_598_954 118
428 3300050492 nmdc:mga0yw44_895760_c1 nmdc:mga0yw44_895760_c1_41_397 118
429 3300050493 nmdc:mga0k408_4489_c1 nmdc:mga0k408_4489_c1_3563_3919 118
430 3300050493 nmdc:mga0k408_5002_c1 nmdc:mga0k408_5002_c1_475_831 118
431 3300050494 nmdc:mga06z11_144648_c1 nmdc:mga06z11_144648_c1_585_941 118
432 3300050494 nmdc:mga06z11_3134_c1 nmdc:mga06z11_3134_c1_3122_3478 118
433 3300050494 nmdc:mga06z11_81981_c1 nmdc:mga06z11_81981_c1_160_516 118
434 3300050495 nmdc:mga04h51_13562_c1 nmdc:mga04h51_13562_c1_1511_1867 118
435 3300050495 nmdc:mga04h51_30179_c1 nmdc:mga04h51_30179_c1_42_398 118
436 3300050495 nmdc:mga04h51_49263_c1 nmdc:mga04h51_49263_c1_328_684 118
437 3300050496 nmdc:mga07m45_103918_c1 nmdc:mga07m45_103918_c1_625_981 118
438 3300050496 nmdc:mga07m45_28294_c1 nmdc:mga07m45_28294_c1_1373_1729 118
439 3300050496 nmdc:mga07m45_828324_c1 nmdc:mga07m45_828324_c1_21_377 118
440 3300050507 nmdc:mga05p37_1059743_c1 nmdc:mga05p37_1059743_c1_94_450 118
441 3300050507 nmdc:mga05p37_1074_c1 nmdc:mga05p37_1074_c1_6890_7246 118
442 3300050507 nmdc:mga05p37_1100493_c1 nmdc:mga05p37_1100493_c1_70_426 118
443 3300050507 nmdc:mga05p37_142726_c1 nmdc:mga05p37_142726_c1_720_1076 118
444 3300050507 nmdc:mga05p37_1756659_c1 nmdc:mga05p37_1756659_c1_163_534 118
445 3300050507 nmdc:mga05p37_410546_c1 nmdc:mga05p37_410546_c1_821_1177 118
446 3300050508 nmdc:mga09592_1025445_c1 nmdc:mga09592_1025445_c1_24_380 118
447 3300050508 nmdc:mga09592_1162425_c1 nmdc:mga09592_1162425_c1_11_367 118
448 3300050508 nmdc:mga09592_1226319_c1 nmdc:mga09592_1226319_c1_236_592 118
449 3300050508 nmdc:mga09592_66881_c1 nmdc:mga09592_66881_c1_680_1036 118
450 3300050509 nmdc:mga0qj67_72318_c1 nmdc:mga0qj67_72318_c1_498_869 118
451 3300050510 nmdc:mga06r32_100925_c1 nmdc:mga06r32_100925_c1_2078_2434 118
452 3300050510 nmdc:mga06r32_102168_c1 nmdc:mga06r32_102168_c1_1142_1498 118
453 3300050510 nmdc:mga06r32_26338_c1 nmdc:mga06r32_26338_c1_5016_5372 118
454 3300050510 nmdc:mga06r32_444497_c1 nmdc:mga06r32_444497_c1_300_656 118
455 3300050510 nmdc:mga06r32_732389_c1 nmdc:mga06r32_732389_c1_251_610 118
456 3300050510 nmdc:mga06r32_881906_c1 nmdc:mga06r32_881906_c1_80_451 118
457 3300050511 nmdc:mga08y16_1685044_c1 nmdc:mga08y16_1685044_c1_147_503 118
458 3300050511 nmdc:mga08y16_7416_c1 nmdc:mga08y16_7416_c1_3638_3994 118
459 3300050511 nmdc:mga08y16_8907_c1 nmdc:mga08y16_8907_c1_1845_2201 118
460 3300050512 nmdc:mga0n895_1997708_c1 nmdc:mga0n895_1997708_c1_111_467 118
461 3300050512 nmdc:mga0n895_394318_c1 nmdc:mga0n895_394318_c1_570_926 118
462 3300050512 nmdc:mga0n895_421558_c1 nmdc:mga0n895_421558_c1_33_389 118
463 3300050513 nmdc:mga0rr50_793989_c1 nmdc:mga0rr50_793989_c1_355_711 118
464 3300050515 nmdc:mga0a205_196988_c2 nmdc:mga0a205_196988_c2_947_1303 118
465 3300050516 nmdc:mga0sz30_281466_c1 nmdc:mga0sz30_281466_c1_39_395 118
466 3300050516 nmdc:mga0sz30_51515_c1 nmdc:mga0sz30_51515_c1_27_383 118
467 3300053077 Ga0495601_0001021 Ga0495601_0001021_8831_9208 118
468 3300053077 Ga0495601_0095336 Ga0495601_0095336_569_943 118
469 3300053085 Ga0495619_0000905 Ga0495619_0000905_17511_17888 118
470 3300053085 Ga0495619_0248557 Ga0495619_0248557_716_1075 118
471 3300053103 Ga0500555_060744 Ga0500555_060744_463_819 118
472 3300054114 Ga0501084_0576016 Ga0501084_0576016_412_768 118
473 3300054114 Ga0501084_1815246 Ga0501084_1815246_129_485 118
474 3300059426 Ga0590077_041235 Ga0590077_041235_393_755 118
475 3300000041 ARcpr5oldR_c028613 ARcpr5oldR_0286132 119
476 3300002459 JGI24751J29686_10067055 JGI24751J29686_100670552 119
477 3300005288 Ga0065714_10237464 Ga0065714_102374642 119
478 3300005290 Ga0065712_10000261 Ga0065712_100002617 119
479 3300005290 Ga0065712_10072631 Ga0065712_100726317 119
480 3300005290 Ga0065712_10117680 Ga0065712_101176802 119
481 3300005293 Ga0065715_10000251 Ga0065715_1000025119 119
482 3300005293 Ga0065715_10095529 Ga0065715_100955293 119
483 3300005293 Ga0065715_10114170 Ga0065715_101141702 119
484 3300005293 Ga0065715_10160573 Ga0065715_101605731 119
485 3300005293 Ga0065715_10416155 Ga0065715_104161552 119
486 3300005293 Ga0065715_10618242 Ga0065715_106182422 119
487 3300005295 Ga0065707_10089470 Ga0065707_100894702 119
488 3300005295 Ga0065707_10227589 Ga0065707_102275891 119
489 3300005295 Ga0065707_10248989 Ga0065707_102489891 119
490 3300005295 Ga0065707_10548712 Ga0065707_105487122 119
491 3300005295 Ga0065707_10565670 Ga0065707_105656702 119
492 3300005328 Ga0070676_10014126 Ga0070676_100141263 119
493 3300005328 Ga0070676_11230938 Ga0070676_112309381 119
494 3300005330 Ga0070690_100013923 Ga0070690_1000139232 119
495 3300005331 Ga0070670_100008131 Ga0070670_1000081315 119
496 3300005331 Ga0070670_100046942 Ga0070670_1000469421 119
497 3300005331 Ga0070670_100088676 Ga0070670_1000886762 119
498 3300005331 Ga0070670_100660785 Ga0070670_1006607851 119
499 3300005331 Ga0070670_100712674 Ga0070670_1007126742 119
500 3300005333 Ga0070677_10118080 Ga0070677_101180802 119
501 3300005335 Ga0070666_10048887 Ga0070666_100488872 119
502 3300005335 Ga0070666_10136296 Ga0070666_101362962 119
503 3300005336 Ga0070680_100036963 Ga0070680_1000369632 119
504 3300005336 Ga0070680_100390921 Ga0070680_1003909212 119
505 3300005338 Ga0068868_100166543 Ga0068868_1001665432 119
506 3300005338 Ga0068868_101913606 Ga0068868_1019136061 119
507 3300005339 Ga0070660_100009760 Ga0070660_1000097602 119
508 3300005340 Ga0070689_100156391 Ga0070689_1001563912 119
509 3300005340 Ga0070689_100160313 Ga0070689_1001603132 119
510 3300005340 Ga0070689_101206770 Ga0070689_1012067702 119
511 3300005341 Ga0070691_10016048 Ga0070691_100160482 119
512 3300005343 Ga0070687_100424554 Ga0070687_1004245542 119
513 3300005343 Ga0070687_100812995 Ga0070687_1008129952 119
514 3300005344 Ga0070661_100408754 Ga0070661_1004087542 119
515 3300005344 Ga0070661_101336254 Ga0070661_1013362541 119
516 3300005345 Ga0070692_10056486 Ga0070692_100564862 119
517 3300005345 Ga0070692_10583161 Ga0070692_105831612 119
518 3300005345 Ga0070692_10591783 Ga0070692_105917832 119
519 3300005347 Ga0070668_100590300 Ga0070668_1005903002 119
520 3300005353 Ga0070669_100004180 Ga0070669_1000041803 119
521 3300005353 Ga0070669_100029543 Ga0070669_1000295432 119
522 3300005353 Ga0070669_100036392 Ga0070669_1000363922 119
523 3300005353 Ga0070669_100185858 Ga0070669_1001858582 119
524 3300005353 Ga0070669_100364298 Ga0070669_1003642982 119
525 3300005353 Ga0070669_101125425 Ga0070669_1011254252 119
526 3300005354 Ga0070675_100005779 Ga0070675_1000057792 119
527 3300005354 Ga0070675_100038879 Ga0070675_1000388793 119
528 3300005354 Ga0070675_100450560 Ga0070675_1004505601 119
529 3300005354 Ga0070675_100698294 Ga0070675_1006982941 119
530 3300005355 Ga0070671_100093414 Ga0070671_1000934142 119
531 3300005356 Ga0070674_100004715 Ga0070674_1000047155 119
532 3300005356 Ga0070674_100013234 Ga0070674_1000132342 119
533 3300005356 Ga0070674_100214611 Ga0070674_1002146112 119
534 3300005356 Ga0070674_100826126 Ga0070674_1008261262 119
535 3300005356 Ga0070674_101031945 Ga0070674_1010319451 119
536 3300005364 Ga0070673_100075355 Ga0070673_1000753552 119
537 3300005364 Ga0070673_100102739 Ga0070673_1001027392 119
538 3300005364 Ga0070673_100193991 Ga0070673_1001939912 119
539 3300005364 Ga0070673_100877957 Ga0070673_1008779572 119
540 3300005364 Ga0070673_101695677 Ga0070673_1016956771 119
541 3300005365 Ga0070688_100079089 Ga0070688_1000790892 119
542 3300005365 Ga0070688_100637717 Ga0070688_1006377172 119
543 3300005365 Ga0070688_100723341 Ga0070688_1007233411 119
544 3300005365 Ga0070688_100850066 Ga0070688_1008500662 119
545 3300005366 Ga0070659_100087517 Ga0070659_1000875172 119
546 3300005367 Ga0070667_100054603 Ga0070667_1000546033 119
547 3300005367 Ga0070667_100068794 Ga0070667_1000687942 119
548 3300005406 Ga0070703_10624090 Ga0070703_106240901 119
549 3300005434 Ga0070709_10173612 Ga0070709_101736121 119
550 3300005434 Ga0070709_10554034 Ga0070709_105540342 119
551 3300005435 Ga0070714_100005079 Ga0070714_1000050795 119
552 3300005437 Ga0070710_10233543 Ga0070710_102335432 119
553 3300005438 Ga0070701_10027299 Ga0070701_100272992 119
554 3300005439 Ga0070711_100209442 Ga0070711_1002094421 119
555 3300005439 Ga0070711_100252838 Ga0070711_1002528381 119
556 3300005440 Ga0070705_100003440 Ga0070705_1000034404 119
557 3300005440 Ga0070705_100079567 Ga0070705_1000795672 119
558 3300005440 Ga0070705_100424439 Ga0070705_1004244392 119
559 3300005441 Ga0070700_100022249 Ga0070700_1000222492 119
560 3300005441 Ga0070700_100029344 Ga0070700_1000293442 119
561 3300005441 Ga0070700_100114917 Ga0070700_1001149172 119
562 3300005441 Ga0070700_100504777 Ga0070700_1005047772 119
563 3300005441 Ga0070700_100592085 Ga0070700_1005920851 119
564 3300005441 Ga0070700_100719299 Ga0070700_1007192991 119
565 3300005444 Ga0070694_100231845 Ga0070694_1002318452 119
566 3300005444 Ga0070694_100383610 Ga0070694_1003836102 119
567 3300005445 Ga0070708_100890556 Ga0070708_1008905562 119
568 3300005455 Ga0070663_100809119 Ga0070663_1008091192 119
569 3300005455 Ga0070663_102004271 Ga0070663_1020042711 119
570 3300005456 Ga0070678_100055031 Ga0070678_1000550312 119
571 3300005456 Ga0070678_100328190 Ga0070678_1003281902 119
572 3300005457 Ga0070662_100029984 Ga0070662_1000299842 119
573 3300005458 Ga0070681_10000782 Ga0070681_100007822 119
574 3300005458 Ga0070681_11384876 Ga0070681_113848761 119
575 3300005459 Ga0068867_100186937 Ga0068867_1001869372 119
576 3300005459 Ga0068867_100225292 Ga0068867_1002252922 119
577 3300005459 Ga0068867_100245237 Ga0068867_1002452372 119
578 3300005459 Ga0068867_101178085 Ga0068867_1011780851 119
579 3300005466 Ga0070685_10007059 Ga0070685_100070592 119
580 3300005466 Ga0070685_10176490 Ga0070685_101764902 119
581 3300005466 Ga0070685_10452236 Ga0070685_104522362 119
582 3300005467 Ga0070706_100234597 Ga0070706_1002345972 119
583 3300005467 Ga0070706_100766602 Ga0070706_1007666021 119
584 3300005467 Ga0070706_101322290 Ga0070706_1013222901 119
585 3300005468 Ga0070707_100105604 Ga0070707_1001056042 119
586 3300005468 Ga0070707_100461168 Ga0070707_1004611681 119
587 3300005468 Ga0070707_100815876 Ga0070707_1008158761 119
588 3300005468 Ga0070707_101820917 Ga0070707_1018209171 119
589 3300005468 Ga0070707_101900463 Ga0070707_1019004631 119
590 3300005471 Ga0070698_100081682 Ga0070698_1000816822 119
591 3300005471 Ga0070698_100507008 Ga0070698_1005070082 119
592 3300005518 Ga0070699_100098836 Ga0070699_1000988363 119
593 3300005518 Ga0070699_100651999 Ga0070699_1006519992 119
594 3300005518 Ga0070699_100653420 Ga0070699_1006534202 119
595 3300005518 Ga0070699_101589618 Ga0070699_1015896181 119
596 3300005518 Ga0070699_101993021 Ga0070699_1019930211 119
597 3300005530 Ga0070679_100043801 Ga0070679_1000438013 119
598 3300005530 Ga0070679_101715518 Ga0070679_1017155181 119
599 3300005535 Ga0070684_100453868 Ga0070684_1004538682 119
600 3300005535 Ga0070684_100504122 Ga0070684_1005041221 119
601 3300005536 Ga0070697_100025752 Ga0070697_1000257522 119
602 3300005536 Ga0070697_100131184 Ga0070697_1001311842 119
603 3300005536 Ga0070697_100970599 Ga0070697_1009705992 119
604 3300005536 Ga0070697_101167418 Ga0070697_1011674181 119
605 3300005539 Ga0068853_100384142 Ga0068853_1003841421 119
606 3300005539 Ga0068853_101150651 Ga0068853_1011506511 119
607 3300005539 Ga0068853_101600232 Ga0068853_1016002321 119
608 3300005543 Ga0070672_100006193 Ga0070672_1000061933 119
609 3300005543 Ga0070672_100113621 Ga0070672_1001136212 119
610 3300005543 Ga0070672_100231730 Ga0070672_1002317302 119
611 3300005543 Ga0070672_100374073 Ga0070672_1003740732 119
612 3300005543 Ga0070672_100549111 Ga0070672_1005491111 119
613 3300005543 Ga0070672_101918994 Ga0070672_1019189941 119
614 3300005544 Ga0070686_100011242 Ga0070686_1000112421 119
615 3300005544 Ga0070686_100015118 Ga0070686_1000151182 119
616 3300005544 Ga0070686_100252521 Ga0070686_1002525211 119
617 3300005544 Ga0070686_100762355 Ga0070686_1007623552 119
618 3300005545 Ga0070695_100051838 Ga0070695_1000518382 119
619 3300005545 Ga0070695_100295488 Ga0070695_1002954882 119
620 3300005545 Ga0070695_100484690 Ga0070695_1004846902 119
621 3300005545 Ga0070695_100700554 Ga0070695_1007005541 119
622 3300005546 Ga0070696_100006942 Ga0070696_1000069422 119
623 3300005546 Ga0070696_101768150 Ga0070696_1017681501 119
624 3300005547 Ga0070693_100754947 Ga0070693_1007549472 119
625 3300005548 Ga0070665_100336432 Ga0070665_1003364322 119
626 3300005548 Ga0070665_101110679 Ga0070665_1011106792 119
627 3300005548 Ga0070665_101216807 Ga0070665_1012168072 119
628 3300005548 Ga0070665_101443081 Ga0070665_1014430811 119
629 3300005549 Ga0070704_100005455 Ga0070704_1000054554 119
630 3300005549 Ga0070704_100027621 Ga0070704_1000276212 119
631 3300005549 Ga0070704_100342321 Ga0070704_1003423212 119
632 3300005549 Ga0070704_100378046 Ga0070704_1003780461 119
633 3300005549 Ga0070704_100785310 Ga0070704_1007853102 119
634 3300005563 Ga0068855_100450789 Ga0068855_1004507892 119
635 3300005563 Ga0068855_101390594 Ga0068855_1013905942 119
636 3300005564 Ga0070664_100042065 Ga0070664_1000420652 119
637 3300005564 Ga0070664_102212294 Ga0070664_1022122942 119
638 3300005577 Ga0068857_100130772 Ga0068857_1001307723 119
639 3300005578 Ga0068854_100006513 Ga0068854_1000065136 119
640 3300005578 Ga0068854_100172947 Ga0068854_1001729472 119
641 3300005614 Ga0068856_102052920 Ga0068856_1020529201 119
642 3300005615 Ga0070702_100014267 Ga0070702_1000142674 119
643 3300005615 Ga0070702_100617939 Ga0070702_1006179392 119
644 3300005615 Ga0070702_101277818 Ga0070702_1012778181 119
645 3300005616 Ga0068852_100494432 Ga0068852_1004944322 119
646 3300005616 Ga0068852_102267282 Ga0068852_1022672821 119
647 3300005617 Ga0068859_100034539 Ga0068859_1000345393 119
648 3300005617 Ga0068859_100124888 Ga0068859_1001248883 119
649 3300005617 Ga0068859_100161431 Ga0068859_1001614312 119
650 3300005617 Ga0068859_100271587 Ga0068859_1002715872 119
651 3300005617 Ga0068859_100428074 Ga0068859_1004280743 119
652 3300005617 Ga0068859_100793627 Ga0068859_1007936272 119
653 3300005617 Ga0068859_101000724 Ga0068859_1010007241 119
654 3300005617 Ga0068859_101066605 Ga0068859_1010666051 119
655 3300005617 Ga0068859_101470818 Ga0068859_1014708182 119
656 3300005617 Ga0068859_102495541 Ga0068859_1024955411 119
657 3300005618 Ga0068864_100004878 Ga0068864_1000048785 119
658 3300005618 Ga0068864_100011781 Ga0068864_1000117813 119
659 3300005618 Ga0068864_100131310 Ga0068864_1001313103 119
660 3300005618 Ga0068864_100436837 Ga0068864_1004368372 119
661 3300005618 Ga0068864_100829409 Ga0068864_1008294092 119
662 3300005618 Ga0068864_101077561 Ga0068864_1010775611 119
663 3300005618 Ga0068864_101902919 Ga0068864_1019029191 119
664 3300005718 Ga0068866_10199737 Ga0068866_101997372 119
665 3300005718 Ga0068866_10921711 Ga0068866_109217112 119
666 3300005719 Ga0068861_100052201 Ga0068861_1000522012 119
667 3300005719 Ga0068861_100062989 Ga0068861_1000629891 119
668 3300005719 Ga0068861_100136974 Ga0068861_1001369742 119
669 3300005719 Ga0068861_100233003 Ga0068861_1002330034 119
670 3300005719 Ga0068861_101188066 Ga0068861_1011880662 119
671 3300005840 Ga0068870_10449789 Ga0068870_104497892 119
672 3300005840 Ga0068870_10504745 Ga0068870_105047451 119
673 3300005840 Ga0068870_10632440 Ga0068870_106324402 119
674 3300005841 Ga0068863_100032588 Ga0068863_1000325883 119
675 3300005841 Ga0068863_100234500 Ga0068863_1002345003 119
676 3300005841 Ga0068863_100515578 Ga0068863_1005155782 119
677 3300005841 Ga0068863_101061306 Ga0068863_1010613061 119
678 3300005841 Ga0068863_101065099 Ga0068863_1010650992 119
679 3300005841 Ga0068863_102006524 Ga0068863_1020065242 119
680 3300005842 Ga0068858_100012933 Ga0068858_1000129332 119
681 3300005842 Ga0068858_100158166 Ga0068858_1001581662 119
682 3300005842 Ga0068858_100175178 Ga0068858_1001751782 119
683 3300005842 Ga0068858_100478445 Ga0068858_1004784451 119
684 3300005842 Ga0068858_100739476 Ga0068858_1007394762 119
685 3300005842 Ga0068858_101341489 Ga0068858_1013414891 119
686 3300005843 Ga0068860_100369821 Ga0068860_1003698212 119
687 3300005843 Ga0068860_100372149 Ga0068860_1003721492 119
688 3300005843 Ga0068860_100619072 Ga0068860_1006190722 119
689 3300005843 Ga0068860_100649456 Ga0068860_1006494562 119
690 3300005843 Ga0068860_101895028 Ga0068860_1018950281 119
691 3300005843 Ga0068860_102040477 Ga0068860_1020404771 119
692 3300005844 Ga0068862_100025690 Ga0068862_1000256903 119
693 3300005844 Ga0068862_100040059 Ga0068862_1000400592 119
694 3300005844 Ga0068862_100098005 Ga0068862_1000980053 119
695 3300005844 Ga0068862_100498796 Ga0068862_1004987962 119
696 3300005844 Ga0068862_100599666 Ga0068862_1005996662 119
697 3300005844 Ga0068862_101198571 Ga0068862_1011985712 119
698 3300005844 Ga0068862_101258093 Ga0068862_1012580932 119
699 3300005844 Ga0068862_102272539 Ga0068862_1022725391 119
700 3300005937 Ga0081455_10088091 Ga0081455_100880912 119
701 3300005937 Ga0081455_10428229 Ga0081455_104282292 119
702 3300006028 Ga0070717_10749092 Ga0070717_107490922 119
703 3300006051 Ga0075364_10110526 Ga0075364_101105262 119
704 3300006058 Ga0075432_10013119 Ga0075432_100131192 119
705 3300006058 Ga0075432_10168821 Ga0075432_101688212 119
706 3300006163 Ga0070715_10691666 Ga0070715_106916661 119
707 3300006195 Ga0075366_10093834 Ga0075366_100938342 119
708 3300006195 Ga0075366_10560787 Ga0075366_105607872 119
709 3300006237 Ga0097621_100502104 Ga0097621_1005021041 119
710 3300006358 Ga0068871_100895743 Ga0068871_1008957432 119
711 3300006358 Ga0068871_101323190 Ga0068871_1013231902 119
712 3300006358 Ga0068871_101486101 Ga0068871_1014861012 119
713 3300006844 Ga0075428_100131541 Ga0075428_1001315412 119
714 3300006844 Ga0075428_100189265 Ga0075428_1001892652 119
715 3300006844 Ga0075428_100456639 Ga0075428_1004566392 119
716 3300006844 Ga0075428_101362912 Ga0075428_1013629121 119
717 3300006846 Ga0075430_100004264 Ga0075430_10000426414 119
718 3300006846 Ga0075430_100094266 Ga0075430_1000942662 119
719 3300006846 Ga0075430_100389260 Ga0075430_1003892602 119
720 3300006846 Ga0075430_100712766 Ga0075430_1007127662 119
721 3300006847 Ga0075431_100052235 Ga0075431_1000522352 119
722 3300006847 Ga0075431_100094687 Ga0075431_1000946872 119
723 3300006847 Ga0075431_100098924 Ga0075431_1000989242 119
724 3300006847 Ga0075431_100305028 Ga0075431_1003050282 119
725 3300006847 Ga0075431_100690784 Ga0075431_1006907842 119
726 3300006847 Ga0075431_101925836 Ga0075431_1019258361 119
727 3300006852 Ga0075433_10003835 Ga0075433_100038358 119
728 3300006852 Ga0075433_10011494 Ga0075433_100114942 119
729 3300006852 Ga0075433_10448011 Ga0075433_104480112 119
730 3300006852 Ga0075433_10580021 Ga0075433_105800212 119
731 3300006852 Ga0075433_10688028 Ga0075433_106880282 119
732 3300006852 Ga0075433_10711268 Ga0075433_107112682 119
733 3300006852 Ga0075433_10712501 Ga0075433_107125012 119
734 3300006852 Ga0075433_10902581 Ga0075433_109025812 119
735 3300006852 Ga0075433_11346120 Ga0075433_113461202 119
736 3300006871 Ga0075434_100177127 Ga0075434_1001771272 119
737 3300006871 Ga0075434_100690033 Ga0075434_1006900332 119
738 3300006871 Ga0075434_100725767 Ga0075434_1007257672 119
739 3300006871 Ga0075434_101032830 Ga0075434_1010328302 119
740 3300006871 Ga0075434_102211105 Ga0075434_1022111052 119
741 3300006880 Ga0075429_100082406 Ga0075429_1000824062 119
742 3300006880 Ga0075429_100096187 Ga0075429_1000961872 119
743 3300006880 Ga0075429_100212267 Ga0075429_1002122672 119
744 3300006880 Ga0075429_100343820 Ga0075429_1003438202 119
745 3300006880 Ga0075429_101207551 Ga0075429_1012075512 119
746 3300006881 Ga0068865_100123574 Ga0068865_1001235742 119
747 3300006881 Ga0068865_100510223 Ga0068865_1005102231 119
748 3300006914 Ga0075436_101550399 Ga0075436_1015503991 119
749 3300006931 Ga0097620_100034539 Ga0097620_1000345393 119
750 3300006931 Ga0097620_100124891 Ga0097620_1001248912 119
751 3300006931 Ga0097620_100161430 Ga0097620_1001614302 119
752 3300006931 Ga0097620_100271596 Ga0097620_1002715962 119
753 3300006931 Ga0097620_100428071 Ga0097620_1004280713 119
754 3300006931 Ga0097620_100793424 Ga0097620_1007934242 119
755 3300006931 Ga0097620_101000915 Ga0097620_1010009151 119
756 3300006931 Ga0097620_101066602 Ga0097620_1010666021 119
757 3300006931 Ga0097620_101470858 Ga0097620_1014708582 119
758 3300006931 Ga0097620_102494893 Ga0097620_1024948931 119
759 3300007076 Ga0075435_100003425 Ga0075435_1000034251 119
760 3300007076 Ga0075435_100278589 Ga0075435_1002785892 119
761 3300007076 Ga0075435_100632854 Ga0075435_1006328542 119
762 3300007076 Ga0075435_100856356 Ga0075435_1008563562 119
763 3300007076 Ga0075435_100972992 Ga0075435_1009729922 119
764 3300007265 Ga0099794_10666159 Ga0099794_106661591 119
765 3300009093 Ga0105240_10013366 Ga0105240_100133665 119
766 3300009093 Ga0105240_10263269 Ga0105240_102632692 119
767 3300009093 Ga0105240_10590873 Ga0105240_105908732 119
768 3300009093 Ga0105240_10857001 Ga0105240_108570012 119
769 3300009093 Ga0105240_11806519 Ga0105240_118065192 119
770 3300009094 Ga0111539_10003741 Ga0111539_1000374114 119
771 3300009094 Ga0111539_10006263 Ga0111539_100062639 119
772 3300009094 Ga0111539_10078058 Ga0111539_100780582 119
773 3300009094 Ga0111539_10162240 Ga0111539_101622401 119
774 3300009094 Ga0111539_10310304 Ga0111539_103103042 119
775 3300009094 Ga0111539_10556952 Ga0111539_105569522 119
776 3300009098 Ga0105245_10134307 Ga0105245_101343072 119
777 3300009098 Ga0105245_10143827 Ga0105245_101438271 119
778 3300009098 Ga0105245_10382519 Ga0105245_103825192 119
779 3300009098 Ga0105245_10536367 Ga0105245_105363672 119
780 3300009098 Ga0105245_10572521 Ga0105245_105725212 119
781 3300009098 Ga0105245_10783725 Ga0105245_107837251 119
782 3300009098 Ga0105245_11005872 Ga0105245_110058721 119
783 3300009101 Ga0105247_10014516 Ga0105247_100145162 119
784 3300009101 Ga0105247_10421459 Ga0105247_104214592 119
785 3300009147 Ga0114129_10001210 Ga0114129_1000121025 119
786 3300009147 Ga0114129_10007043 Ga0114129_100070432 119
787 3300009147 Ga0114129_10007586 Ga0114129_1000758610 119
788 3300009147 Ga0114129_10037660 Ga0114129_100376609 119
789 3300009147 Ga0114129_10054867 Ga0114129_100548677 119
790 3300009147 Ga0114129_10107125 Ga0114129_101071252 119
791 3300009147 Ga0114129_10230970 Ga0114129_102309702 119
792 3300009147 Ga0114129_10335225 Ga0114129_103352252 119
793 3300009147 Ga0114129_10339713 Ga0114129_103397132 119
794 3300009147 Ga0114129_10607523 Ga0114129_106075232 119
795 3300009147 Ga0114129_10982018 Ga0114129_109820182 119
796 3300009147 Ga0114129_11257469 Ga0114129_112574692 119
797 3300009147 Ga0114129_11291873 Ga0114129_112918732 119
798 3300009147 Ga0114129_11494525 Ga0114129_114945252 119
799 3300009147 Ga0114129_11765492 Ga0114129_117654921 119
800 3300009147 Ga0114129_12209444 Ga0114129_122094442 119
801 3300009148 Ga0105243_10036845 Ga0105243_100368454 119
802 3300009148 Ga0105243_10234734 Ga0105243_102347343 119
803 3300009148 Ga0105243_10505644 Ga0105243_105056442 119
804 3300009148 Ga0105243_12168724 Ga0105243_121687242 119
805 3300009174 Ga0105241_10078448 Ga0105241_100784482 119
806 3300009174 Ga0105241_10134751 Ga0105241_101347512 119
807 3300009174 Ga0105241_10173273 Ga0105241_101732732 119
808 3300009174 Ga0105241_12574325 Ga0105241_125743251 119
809 3300009176 Ga0105242_10004376 Ga0105242_1000437610 119
810 3300009176 Ga0105242_10207341 Ga0105242_102073412 119
811 3300009176 Ga0105242_10255142 Ga0105242_102551422 119
812 3300009176 Ga0105242_10354094 Ga0105242_103540942 119
813 3300009176 Ga0105242_10809110 Ga0105242_108091102 119
814 3300009176 Ga0105242_11285571 Ga0105242_112855712 119
815 3300009177 Ga0105248_10001854 Ga0105248_1000185413 119
816 3300009177 Ga0105248_10006073 Ga0105248_100060738 119
817 3300009177 Ga0105248_10018606 Ga0105248_100186064 119
818 3300009177 Ga0105248_10342163 Ga0105248_103421632 119
819 3300009177 Ga0105248_10379135 Ga0105248_103791352 119
820 3300009177 Ga0105248_11324105 Ga0105248_113241052 119
821 3300009177 Ga0105248_13445956 Ga0105248_134459561 119
822 3300009551 Ga0105238_10522449 Ga0105238_105224493 119
823 3300009553 Ga0105249_10000759 Ga0105249_1000075914 119
824 3300009553 Ga0105249_10015676 Ga0105249_100156762 119
825 3300009553 Ga0105249_10116987 Ga0105249_101169872 119
826 3300009553 Ga0105249_10205001 Ga0105249_102050012 119
827 3300009553 Ga0105249_10256237 Ga0105249_102562373 119
828 3300009553 Ga0105249_10341462 Ga0105249_103414622 119
829 3300009553 Ga0105249_10357664 Ga0105249_103576642 119
830 3300009553 Ga0105249_11383934 Ga0105249_113839342 119
831 3300009553 Ga0105249_12283063 Ga0105249_122830632 119
832 3300010375 Ga0105239_10246058 Ga0105239_102460583 119
833 3300010375 Ga0105239_10410807 Ga0105239_104108072 119
834 3300010375 Ga0105239_12852507 Ga0105239_128525071 119
835 3300011119 Ga0105246_10152096 Ga0105246_101520962 119
836 3300011119 Ga0105246_10243072 Ga0105246_102430722 119
837 3300011119 Ga0105246_10726285 Ga0105246_107262852 119
838 3300011119 Ga0105246_11593631 Ga0105246_115936311 119
839 3300012485 Ga0157325_1003348 Ga0157325_10033482 119
840 3300012508 Ga0157315_1032378 Ga0157315_10323782 119
841 3300013105 Ga0157369_11556625 Ga0157369_115566252 119
842 3300013296 Ga0157374_10049175 Ga0157374_100491753 119
843 3300013296 Ga0157374_10468686 Ga0157374_104686862 119
844 3300013297 Ga0157378_10062396 Ga0157378_100623962 119
845 3300013297 Ga0157378_10982844 Ga0157378_109828442 119
846 3300013306 Ga0163162_10028446 Ga0163162_100284466 119
847 3300013306 Ga0163162_10031594 Ga0163162_100315942 119
848 3300013306 Ga0163162_12481914 Ga0163162_124819141 119
849 3300013308 Ga0157375_10124732 Ga0157375_101247322 119
850 3300013308 Ga0157375_10157353 Ga0157375_101573533 119
851 3300013308 Ga0157375_10473695 Ga0157375_104736952 119
852 3300013308 Ga0157375_10972641 Ga0157375_109726412 119
853 3300013308 Ga0157375_12849071 Ga0157375_128490712 119
854 3300014325 Ga0163163_10000001 Ga0163163_10000001117 119
855 3300014325 Ga0163163_10013923 Ga0163163_100139232 119
856 3300014325 Ga0163163_10037866 Ga0163163_100378663 119
857 3300014325 Ga0163163_10050509 Ga0163163_100505093 119
858 3300014325 Ga0163163_10285013 Ga0163163_102850132 119
859 3300014325 Ga0163163_10760706 Ga0163163_107607063 119
860 3300014325 Ga0163163_11152154 Ga0163163_111521541 119
861 3300014326 Ga0157380_10038923 Ga0157380_100389232 119
862 3300014326 Ga0157380_10049197 Ga0157380_100491973 119
863 3300014326 Ga0157380_10199940 Ga0157380_101999403 119
864 3300014326 Ga0157380_10522119 Ga0157380_105221192 119
865 3300014326 Ga0157380_10678962 Ga0157380_106789622 119
866 3300014326 Ga0157380_10722508 Ga0157380_107225082 119
867 3300014745 Ga0157377_10169534 Ga0157377_101695342 119
868 3300014745 Ga0157377_10823664 Ga0157377_108236641 119
869 3300014968 Ga0157379_10058271 Ga0157379_100582714 119
870 3300014968 Ga0157379_10268217 Ga0157379_102682172 119
871 3300014968 Ga0157379_10339214 Ga0157379_103392142 119
872 3300014968 Ga0157379_10882223 Ga0157379_108822232 119
873 3300014968 Ga0157379_11870104 Ga0157379_118701042 119
874 3300014969 Ga0157376_10018993 Ga0157376_100189934 119
875 3300014969 Ga0157376_10033418 Ga0157376_100334183 119
876 3300014969 Ga0157376_10207193 Ga0157376_102071932 119
877 3300014969 Ga0157376_10846099 Ga0157376_108460991 119
878 3300014969 Ga0157376_10941038 Ga0157376_109410382 119
879 3300017792 Ga0163161_10581157 Ga0163161_105811572 119
880 3300017792 Ga0163161_11883711 Ga0163161_118837111 119
881 3300025315 Ga0207697_10021594 Ga0207697_100215942 119
882 3300025315 Ga0207697_10093293 Ga0207697_100932932 119
883 3300025315 Ga0207697_10288768 Ga0207697_102887681 119
884 3300025321 Ga0207656_10206753 Ga0207656_102067532 119
885 3300025893 Ga0207682_10173375 Ga0207682_101733751 119
886 3300025898 Ga0207692_10103471 Ga0207692_101034712 119
887 3300025899 Ga0207642_10048782 Ga0207642_100487822 119
888 3300025899 Ga0207642_10615902 Ga0207642_106159022 119
889 3300025901 Ga0207688_10051437 Ga0207688_100514372 119
890 3300025901 Ga0207688_10066646 Ga0207688_100666462 119
891 3300025901 Ga0207688_10362029 Ga0207688_103620291 119
892 3300025903 Ga0207680_10110962 Ga0207680_101109622 119
893 3300025903 Ga0207680_10121829 Ga0207680_101218292 119
894 3300025903 Ga0207680_10132869 Ga0207680_101328692 119
895 3300025905 Ga0207685_10059226 Ga0207685_100592262 119
896 3300025906 Ga0207699_10527210 Ga0207699_105272102 119
897 3300025907 Ga0207645_10014763 Ga0207645_100147632 119
898 3300025908 Ga0207643_10578401 Ga0207643_105784011 119
899 3300025908 Ga0207643_10627092 Ga0207643_106270921 119
900 3300025910 Ga0207684_10261399 Ga0207684_102613991 119
901 3300025912 Ga0207707_10154287 Ga0207707_101542873 119
902 3300025912 Ga0207707_10351315 Ga0207707_103513152 119
903 3300025913 Ga0207695_10035373 Ga0207695_100353735 119
904 3300025913 Ga0207695_10089434 Ga0207695_100894342 119
905 3300025913 Ga0207695_10592111 Ga0207695_105921112 119
906 3300025916 Ga0207663_10623223 Ga0207663_106232231 119
907 3300025917 Ga0207660_10133638 Ga0207660_101336382 119
908 3300025917 Ga0207660_10266641 Ga0207660_102666411 119
909 3300025919 Ga0207657_10037224 Ga0207657_100372242 119
910 3300025919 Ga0207657_10856897 Ga0207657_108568971 119
911 3300025919 Ga0207657_11310633 Ga0207657_113106332 119
912 3300025920 Ga0207649_10969505 Ga0207649_109695052 119
913 3300025920 Ga0207649_11462772 Ga0207649_114627721 119
914 3300025921 Ga0207652_10019576 Ga0207652_100195764 119
915 3300025921 Ga0207652_10742537 Ga0207652_107425372 119
916 3300025921 Ga0207652_10878524 Ga0207652_108785242 119
917 3300025922 Ga0207646_10204636 Ga0207646_102046362 119
918 3300025922 Ga0207646_10274494 Ga0207646_102744941 119
919 3300025922 Ga0207646_11441343 Ga0207646_114413432 119
920 3300025922 Ga0207646_11453198 Ga0207646_114531982 119
921 3300025922 Ga0207646_11522900 Ga0207646_115229001 119
922 3300025922 Ga0207646_11759896 Ga0207646_117598961 119
923 3300025923 Ga0207681_10020072 Ga0207681_100200722 119
924 3300025923 Ga0207681_10024846 Ga0207681_100248462 119
925 3300025923 Ga0207681_10082786 Ga0207681_100827861 119
926 3300025923 Ga0207681_10087669 Ga0207681_100876692 119
927 3300025923 Ga0207681_10218074 Ga0207681_102180742 119
928 3300025923 Ga0207681_10802699 Ga0207681_108026992 119
929 3300025923 Ga0207681_10809420 Ga0207681_108094201 119
930 3300025924 Ga0207694_10845045 Ga0207694_108450452 119
931 3300025925 Ga0207650_10037631 Ga0207650_100376313 119
932 3300025925 Ga0207650_10118528 Ga0207650_101185282 119
933 3300025925 Ga0207650_10200894 Ga0207650_102008942 119
934 3300025925 Ga0207650_10691293 Ga0207650_106912931 119
935 3300025925 Ga0207650_11060496 Ga0207650_110604962 119
936 3300025925 Ga0207650_11754857 Ga0207650_117548571 119
937 3300025926 Ga0207659_10082095 Ga0207659_100820952 119
938 3300025926 Ga0207659_10216193 Ga0207659_102161932 119
939 3300025926 Ga0207659_10389365 Ga0207659_103893651 119
940 3300025926 Ga0207659_10660293 Ga0207659_106602931 119
941 3300025927 Ga0207687_10084042 Ga0207687_100840423 119
942 3300025927 Ga0207687_10477791 Ga0207687_104777912 119
943 3300025927 Ga0207687_10569671 Ga0207687_105696712 119
944 3300025927 Ga0207687_10574190 Ga0207687_105741902 119
945 3300025927 Ga0207687_10695478 Ga0207687_106954781 119
946 3300025929 Ga0207664_10039362 Ga0207664_100393622 119
947 3300025931 Ga0207644_10136083 Ga0207644_101360832 119
948 3300025931 Ga0207644_10499348 Ga0207644_104993482 119
949 3300025931 Ga0207644_10618614 Ga0207644_106186142 119
950 3300025932 Ga0207690_10015495 Ga0207690_100154952 119
951 3300025932 Ga0207690_10332461 Ga0207690_103324612 119
952 3300025932 Ga0207690_10710921 Ga0207690_107109212 119
953 3300025933 Ga0207706_10052948 Ga0207706_100529482 119
954 3300025933 Ga0207706_10322587 Ga0207706_103225872 119
955 3300025933 Ga0207706_11236496 Ga0207706_112364962 119
956 3300025934 Ga0207686_10222307 Ga0207686_102223072 119
957 3300025934 Ga0207686_10309817 Ga0207686_103098172 119
958 3300025934 Ga0207686_11372945 Ga0207686_113729452 119
959 3300025935 Ga0207709_10393880 Ga0207709_103938802 119
960 3300025935 Ga0207709_10448524 Ga0207709_104485241 119
961 3300025935 Ga0207709_10688957 Ga0207709_106889572 119
962 3300025935 Ga0207709_11475678 Ga0207709_114756781 119
963 3300025936 Ga0207670_10125373 Ga0207670_101253732 119
964 3300025936 Ga0207670_10182180 Ga0207670_101821801 119
965 3300025936 Ga0207670_10221525 Ga0207670_102215252 119
966 3300025937 Ga0207669_10003394 Ga0207669_100033947 119
967 3300025937 Ga0207669_10078225 Ga0207669_100782252 119
968 3300025937 Ga0207669_10188026 Ga0207669_101880263 119
969 3300025937 Ga0207669_10349188 Ga0207669_103491882 119
970 3300025937 Ga0207669_10395694 Ga0207669_103956942 119
971 3300025937 Ga0207669_10536152 Ga0207669_105361522 119
972 3300025937 Ga0207669_10546436 Ga0207669_105464362 119
973 3300025938 Ga0207704_10065142 Ga0207704_100651421 119
974 3300025939 Ga0207665_11204934 Ga0207665_112049341 119
975 3300025940 Ga0207691_10012143 Ga0207691_100121432 119
976 3300025940 Ga0207691_10017213 Ga0207691_100172133 119
977 3300025940 Ga0207691_10206823 Ga0207691_102068232 119
978 3300025940 Ga0207691_10339895 Ga0207691_103398951 119
979 3300025940 Ga0207691_10350895 Ga0207691_103508951 119
980 3300025940 Ga0207691_11370236 Ga0207691_113702362 119
981 3300025941 Ga0207711_10061302 Ga0207711_100613022 119
982 3300025941 Ga0207711_10094765 Ga0207711_100947651 119
983 3300025941 Ga0207711_10282514 Ga0207711_102825141 119
984 3300025941 Ga0207711_10555776 Ga0207711_105557762 119
985 3300025941 Ga0207711_10623057 Ga0207711_106230572 119
986 3300025941 Ga0207711_10670017 Ga0207711_106700172 119
987 3300025941 Ga0207711_11978046 Ga0207711_119780461 119
988 3300025942 Ga0207689_10388063 Ga0207689_103880632 119
989 3300025942 Ga0207689_10874715 Ga0207689_108747152 119
990 3300025942 Ga0207689_11491632 Ga0207689_114916322 119
991 3300025942 Ga0207689_11500395 Ga0207689_115003952 119
992 3300025944 Ga0207661_11274144 Ga0207661_112741442 119
993 3300025945 Ga0207679_11239940 Ga0207679_112399401 119
994 3300025949 Ga0207667_10124226 Ga0207667_101242264 119
995 3300025960 Ga0207651_10086539 Ga0207651_100865392 119
996 3300025960 Ga0207651_10105108 Ga0207651_101051082 119
997 3300025960 Ga0207651_10224690 Ga0207651_102246901 119
998 3300025960 Ga0207651_10323551 Ga0207651_103235512 119
999 3300025960 Ga0207651_10622969 Ga0207651_106229692 119
1000 3300025961 Ga0207712_10010859 Ga0207712_100108594 119
1001 3300025961 Ga0207712_10016070 Ga0207712_100160703 119
1002 3300025961 Ga0207712_10177181 Ga0207712_101771812 119
1003 3300025961 Ga0207712_10506733 Ga0207712_105067331 119
1004 3300025961 Ga0207712_11215676 Ga0207712_112156762 119
1005 3300025972 Ga0207668_10304233 Ga0207668_103042332 119
1006 3300025972 Ga0207668_10363917 Ga0207668_103639171 119
1007 3300025981 Ga0207640_10235018 Ga0207640_102350182 119
1008 3300025981 Ga0207640_10943704 Ga0207640_109437042 119
1009 3300025981 Ga0207640_11735587 Ga0207640_117355872 119
1010 3300025986 Ga0207658_10028089 Ga0207658_100280892 119
1011 3300025986 Ga0207658_10039016 Ga0207658_100390162 119
1012 3300025986 Ga0207658_10578996 Ga0207658_105789961 119
1013 3300025986 Ga0207658_10688700 Ga0207658_106887002 119
1014 3300026023 Ga0207677_10042274 Ga0207677_100422742 119
1015 3300026023 Ga0207677_10066933 Ga0207677_100669332 119
1016 3300026023 Ga0207677_10089593 Ga0207677_100895933 119
1017 3300026023 Ga0207677_11888230 Ga0207677_118882301 119
1018 3300026035 Ga0207703_10030316 Ga0207703_100303162 119
1019 3300026035 Ga0207703_10041243 Ga0207703_100412432 119
1020 3300026035 Ga0207703_10112933 Ga0207703_101129332 119
1021 3300026035 Ga0207703_10147524 Ga0207703_101475242 119
1022 3300026035 Ga0207703_10185001 Ga0207703_101850012 119
1023 3300026035 Ga0207703_10316335 Ga0207703_103163351 119
1024 3300026035 Ga0207703_10476287 Ga0207703_104762871 119
1025 3300026035 Ga0207703_10618217 Ga0207703_106182171 119
1026 3300026035 Ga0207703_10626199 Ga0207703_106261992 119
1027 3300026035 Ga0207703_11411492 Ga0207703_114114921 119
1028 3300026035 Ga0207703_12247751 Ga0207703_122477512 119
1029 3300026067 Ga0207678_10893713 Ga0207678_108937131 119
1030 3300026067 Ga0207678_11151830 Ga0207678_111518301 119
1031 3300026075 Ga0207708_10017960 Ga0207708_100179604 119
1032 3300026075 Ga0207708_10043835 Ga0207708_100438351 119
1033 3300026075 Ga0207708_10146881 Ga0207708_101468811 119
1034 3300026075 Ga0207708_10342496 Ga0207708_103424962 119
1035 3300026078 Ga0207702_11291656 Ga0207702_112916562 119
1036 3300026088 Ga0207641_10007212 Ga0207641_100072125 119
1037 3300026088 Ga0207641_10039403 Ga0207641_100394032 119
1038 3300026088 Ga0207641_10276475 Ga0207641_102764752 119
1039 3300026088 Ga0207641_10812096 Ga0207641_108120961 119
1040 3300026088 Ga0207641_10870103 Ga0207641_108701032 119
1041 3300026088 Ga0207641_11915020 Ga0207641_119150202 119
1042 3300026089 Ga0207648_10008247 Ga0207648_100082472 119
1043 3300026089 Ga0207648_10057142 Ga0207648_100571422 119
1044 3300026089 Ga0207648_10064974 Ga0207648_100649742 119
1045 3300026089 Ga0207648_10512303 Ga0207648_105123031 119
1046 3300026089 Ga0207648_10660207 Ga0207648_106602071 119
1047 3300026089 Ga0207648_11136248 Ga0207648_111362481 119
1048 3300026089 Ga0207648_11545971 Ga0207648_115459712 119
1049 3300026095 Ga0207676_10010212 Ga0207676_100102126 119
1050 3300026095 Ga0207676_10022988 Ga0207676_100229883 119
1051 3300026095 Ga0207676_10027803 Ga0207676_100278033 119
1052 3300026095 Ga0207676_10306785 Ga0207676_103067853 119
1053 3300026095 Ga0207676_10394300 Ga0207676_103943002 119
1054 3300026095 Ga0207676_11324151 Ga0207676_113241512 119
1055 3300026116 Ga0207674_10035085 Ga0207674_100350854 119
1056 3300026116 Ga0207674_10103314 Ga0207674_101033142 119
1057 3300026118 Ga0207675_100003262 Ga0207675_1000032624 119
1058 3300026118 Ga0207675_100240452 Ga0207675_1002404522 119
1059 3300026118 Ga0207675_100651815 Ga0207675_1006518152 119
1060 3300026118 Ga0207675_101202623 Ga0207675_1012026232 119
1061 3300026121 Ga0207683_10285343 Ga0207683_102853431 119
1062 3300026142 Ga0207698_10389892 Ga0207698_103898922 119
1063 3300026142 Ga0207698_11425557 Ga0207698_114255572 119
1064 3300027907 Ga0207428_10002391 Ga0207428_100023914 119
1065 3300027907 Ga0207428_10032210 Ga0207428_100322102 119
1066 3300027907 Ga0207428_10375974 Ga0207428_103759741 119
1067 3300027907 Ga0207428_10898141 Ga0207428_108981411 119
1068 3300028379 Ga0268266_10362223 Ga0268266_103622232 119
1069 3300028379 Ga0268266_10651773 Ga0268266_106517732 119
1070 3300028379 Ga0268266_11048943 Ga0268266_110489432 119
1071 3300028379 Ga0268266_11458153 Ga0268266_114581531 119
1072 3300028380 Ga0268265_10003607 Ga0268265_100036072 119
1073 3300028380 Ga0268265_10015652 Ga0268265_100156522 119
1074 3300028380 Ga0268265_10040186 Ga0268265_100401862 119
1075 3300028380 Ga0268265_10046425 Ga0268265_100464252 119
1076 3300028380 Ga0268265_10114997 Ga0268265_101149972 119
1077 3300028380 Ga0268265_10187309 Ga0268265_101873092 119
1078 3300028380 Ga0268265_10354849 Ga0268265_103548492 119
1079 3300028380 Ga0268265_10695667 Ga0268265_106956671 119
1080 3300028380 Ga0268265_11920751 Ga0268265_119207511 119
1081 3300028380 Ga0268265_12241757 Ga0268265_122417571 119
1082 3300028380 Ga0268265_12360337 Ga0268265_123603371 119
1083 3300028381 Ga0268264_10004922 Ga0268264_100049229 119
1084 3300028381 Ga0268264_10381813 Ga0268264_103818131 119
1085 3300028381 Ga0268264_10410468 Ga0268264_104104682 119
1086 3300028381 Ga0268264_11951195 Ga0268264_119511951 119
1087 3300028381 Ga0268264_12240349 Ga0268264_122403491 119
1088 3300030521 Ga0307511_10250473 Ga0307511_102504732 119
1089 3300031238 Ga0265332_10254341 Ga0265332_102543412 119
1090 3300031239 Ga0265328_10036845 Ga0265328_100368452 119
1091 3300031241 Ga0265325_10211375 Ga0265325_102113752 119
1092 3300031249 Ga0265339_10100403 Ga0265339_101004032 119
1093 3300031344 Ga0265316_10044113 Ga0265316_100441132 119
1094 3300031548 Ga0307408_100392565 Ga0307408_1003925651 119
1095 3300031548 Ga0307408_100966632 Ga0307408_1009666322 119
1096 3300031548 Ga0307408_101189041 Ga0307408_1011890412 119
1097 3300031548 Ga0307408_101199525 Ga0307408_1011995252 119
1098 3300031548 Ga0307408_101239770 Ga0307408_1012397702 119
1099 3300031548 Ga0307408_101481337 Ga0307408_1014813372 119
1100 3300031711 Ga0265314_10344605 Ga0265314_103446051 119
1101 3300031712 Ga0265342_10038270 Ga0265342_100382702 119
1102 3300031731 Ga0307405_11228519 Ga0307405_112285192 119
1103 3300031824 Ga0307413_10292918 Ga0307413_102929181 119
1104 3300031824 Ga0307413_12031097 Ga0307413_120310971 119
1105 3300031852 Ga0307410_10079571 Ga0307410_100795713 119
1106 3300031901 Ga0307406_10360932 Ga0307406_103609322 119
1107 3300031901 Ga0307406_11086012 Ga0307406_110860121 119
1108 3300031911 Ga0307412_10431170 Ga0307412_104311702 119
1109 3300031911 Ga0307412_11082123 Ga0307412_110821231 119
1110 3300031995 Ga0307409_100243458 Ga0307409_1002434582 119
1111 3300031995 Ga0307409_100881331 Ga0307409_1008813311 119
1112 3300032002 Ga0307416_100149210 Ga0307416_1001492102 119
1113 3300032002 Ga0307416_100774534 Ga0307416_1007745341 119
1114 3300032002 Ga0307416_101505040 Ga0307416_1015050402 119
1115 3300032004 Ga0307414_10078781 Ga0307414_100787811 119
1116 3300032004 Ga0307414_10942263 Ga0307414_109422632 119
1117 3300032005 Ga0307411_10227592 Ga0307411_102275922 119
1118 3300032005 Ga0307411_10554758 Ga0307411_105547582 119
1119 3300032126 Ga0307415_100320355 Ga0307415_1003203551 119
1120 3300035092 Ga0373952_0067810 Ga0373952_0067810_383_742 119
1121 3300035112 Ga0373932_0132278 Ga0373932_0132278_403_762 119
1122 3300035114 Ga0373939_0223877 Ga0373939_0223877_48_407 119
1123 3300035115 Ga0373941_0020831 Ga0373941_0020831_1353_1715 119
1124 3300035117 Ga0373953_0095967 Ga0373953_0095967_475_834 119
1125 3300035119 Ga0373956_0062577 Ga0373956_0062577_909_1268 119
1126 3300035120 Ga0373957_0243770 Ga0373957_0243770_319_678 119
1127 3300035170 Ga0373943_0396005 Ga0373943_0396005_247_606 119
1128 3300035170 Ga0373943_0409810 Ga0373943_0409810_290_649 119
1129 3300035171 Ga0373946_0206811 Ga0373946_0206811_485_844 119
1130 3300035171 Ga0373946_0489077 Ga0373946_0489077_244_603 119
1131 3300035172 Ga0373955_0182192 Ga0373955_0182192_228_587 119
1132 3300035207 Ga0373942_0235875 Ga0373942_0235875_13_372 119
1133 3300035241 Ga0373961_0185002 Ga0373961_0185002_38_397 119
1134 3300035242 Ga0373962_0010098 Ga0373962_0010098_1085_1444 119
1135 3300035692 Ga0373935_0141045 Ga0373935_0141045_795_1154 119
1136 3300035695 Ga0373927_0294309 Ga0373927_0294309_457_816 119
1137 3300035724 Ga0373933_0323342 Ga0373933_0323342_586_945 119
1138 3300035724 Ga0373933_0442611 Ga0373933_0442611_388_750 119
1139 3300035725 Ga0373947_0045408 Ga0373947_0045408_240_599 119
1140 3300036401 Ga0373937_0156997 Ga0373937_0156997_917_1276 119
1141 3300036401 Ga0373937_0390185 Ga0373937_0390185_202_561 119
1142 3300036401 Ga0373937_0394018 Ga0373937_0394018_876_1235 119
1143 3300036401 Ga0373937_0572791 Ga0373937_0572791_73_432 119
1144 3300036401 Ga0373937_0589532 Ga0373937_0589532_68_427 119
1145 3300036401 Ga0373937_0868381 Ga0373937_0868381_477_836 119
1146 3300037068 Ga0373925_0502191 Ga0373925_0502191_501_860 119
1147 3300037471 Ga0395905_0126645 Ga0395905_0126645_1554_1913 119
1148 3300038443 Ga0395901_0419786 Ga0395901_0419786_58_417 119
1149 3300038443 Ga0395901_1199526 Ga0395901_1199526_318_677 119
1150 3300041410 Ga0439461_0041338 Ga0439461_0041338_577_936 119
1151 3300041460 Ga0451802_1678584 Ga0451802_1678584_101_460 119
1152 3300041486 Ga0451807_0062462 Ga0451807_0062462_202_567 119
1153 3300041507 Ga0451851_1214807 Ga0451851_1214807_23_394 119
1154 3300041512 Ga0451853_1119114 Ga0451853_1119114_69_428 119
1155 3300041997 Ga0439431_0014634 Ga0439431_0014634_830_1189 119
1156 3300041999 Ga0439433_0010796 Ga0439433_0010796_1163_1522 119
1157 3300042004 Ga0439445_0140531 Ga0439445_0140531_63_422 119
1158 3300042007 Ga0439449_0213054 Ga0439449_0213054_110_469 119
1159 3300042011 Ga0439454_024460 Ga0439454_024460_536_895 119
1160 3300042013 Ga0439456_095693 Ga0439456_095693_283_642 119
1161 3300042014 Ga0439457_109036 Ga0439457_109036_142_501 119
1162 3300042015 Ga0439462_0132078 Ga0439462_0132078_206_565 119
1163 3300042130 Ga0450892_009984 Ga0450892_009984_224_586 119
1164 3300042144 Ga0450889_005880 Ga0450889_005880_616_975 119
1165 3300042156 Ga0439446_0018109 Ga0439446_0018109_1371_1730 119
1166 3300042156 Ga0439446_0370131 Ga0439446_0370131_76_435 119
1167 3300042436 Ga0439435_0031586 Ga0439435_0031586_1032_1391 119
1168 3300042436 Ga0439435_0092857 Ga0439435_0092857_257_616 119
1169 3300042436 Ga0439435_0205670 Ga0439435_0205670_181_543 119
1170 3300042461 Ga0439460_0029458 Ga0439460_0029458_1051_1410 119
1171 3300042461 Ga0439460_0109076 Ga0439460_0109076_69_428 119
1172 3300045051 Ga0451576_0017400 Ga0451576_0017400_3641_4009 119
1173 3300045051 Ga0451576_0355762 Ga0451576_0355762_276_647 119
1174 3300045051 Ga0451576_1519312 Ga0451576_1519312_33_392 119
1175 3300045976 Ga0466967_1051907 Ga0466967_1051907_426_785 119
1176 3300046454 Ga0495592_0277687 Ga0495592_0277687_100_459 119
1177 3300046455 Ga0495603_0366880 Ga0495603_0366880_392_763 119
1178 3300046459 Ga0495629_0195894 Ga0495629_0195894_51_422 119
1179 3300046472 Ga0495580_0650506 Ga0495580_0650506_242_601 119
1180 3300046472 Ga0495580_0825510 Ga0495580_0825510_66_425 119
1181 3300046473 Ga0495582_0095929 Ga0495582_0095929_179_538 119
1182 3300046473 Ga0495582_0417583 Ga0495582_0417583_260_625 119
1183 3300046473 Ga0495582_0892158 Ga0495582_0892158_100_459 119
1184 3300046475 Ga0495639_0074404 Ga0495639_0074404_801_1160 119
1185 3300046475 Ga0495639_0350812 Ga0495639_0350812_293_664 119
1186 3300046476 Ga0495662_0356181 Ga0495662_0356181_90_455 119
1187 3300046476 Ga0495662_0411683 Ga0495662_0411683_81_440 119
1188 3300046477 Ga0495664_0805455 Ga0495664_0805455_140_499 119
1189 3300046491 Ga0495584_0176894 Ga0495584_0176894_324_683 119
1190 3300046492 Ga0495585_0407997 Ga0495585_0407997_117_476 119
1191 3300046499 Ga0495594_0005857 Ga0495594_0005857_318_677 119
1192 3300046511 Ga0495608_0259263 Ga0495608_0259263_423_782 119
1193 3300046516 Ga0495628_0308217 Ga0495628_0308217_527_886 119
1194 3300046522 Ga0495643_0114733 Ga0495643_0114733_482_841 119
1195 3300046529 Ga0495652_0618131 Ga0495652_0618131_210_569 119
1196 3300046533 Ga0495640_0241382 Ga0495640_0241382_267_626 119
1197 3300046533 Ga0495640_0531115 Ga0495640_0531115_135_494 119
1198 3300046536 Ga0495587_0491462 Ga0495587_0491462_286_645 119
1199 3300046543 Ga0495645_0001484 Ga0495645_0001484_12716_13075 119
1200 3300046558 Ga0495633_0505859 Ga0495633_0505859_52_411 119
1201 3300046559 Ga0495667_0221803 Ga0495667_0221803_809_1168 119
1202 3300046559 Ga0495667_0224475 Ga0495667_0224475_43_411 119
1203 3300046559 Ga0495667_0395679 Ga0495667_0395679_370_729 119
1204 3300046616 Ga0495668_0846099 Ga0495668_0846099_132_491 119
1205 3300046642 Ga0495634_0641132 Ga0495634_0641132_34_393 119
1206 3300046663 Ga0495635_0241998 Ga0495635_0241998_288_647 119
1207 3300046663 Ga0495635_0332038 Ga0495635_0332038_441_806 119
1208 3300046664 Ga0495659_0499212 Ga0495659_0499212_64_423 119
1209 3300046681 Ga0495647_0099209 Ga0495647_0099209_629_988 119
1210 3300046683 Ga0495658_0130434 Ga0495658_0130434_757_1116 119
1211 3300046683 Ga0495658_0154332 Ga0495658_0154332_268_633 119
1212 3300046683 Ga0495658_0357296 Ga0495658_0357296_173_532 119
1213 3300046683 Ga0495658_0801538 Ga0495658_0801538_109_468 119
1214 3300046684 Ga0495669_0099320 Ga0495669_0099320_29_388 119
1215 3300046684 Ga0495669_0546106 Ga0495669_0546106_18_377 119
1216 3300046689 Ga0495613_0060053 Ga0495613_0060053_2095_2460 119
1217 3300046689 Ga0495613_0140910 Ga0495613_0140910_907_1266 119
1218 3300046691 Ga0495670_0401213 Ga0495670_0401213_38_397 119
1219 3300046794 Ga0495589_0503081 Ga0495589_0503081_139_510 119
1220 3300047315 Ga0495581_0111288 Ga0495581_0111288_333_692 119
1221 3300047317 Ga0495604_0134806 Ga0495604_0134806_28_387 119
1222 3300047319 Ga0495674_0313575 Ga0495674_0313575_439_798 119
1223 3300047322 Ga0495680_0558833 Ga0495680_0558833_152_511 119
1224 3300047471 Ga0495684_0055859 Ga0495684_0055859_1388_1747 119
1225 3300048088 Ga0495602_1163738 Ga0495602_1163738_44_403 119
1226 3300048903 Ga0496100_0695619 Ga0496100_0695619_313_684 119
1227 3300048904 Ga0496101_0405539 Ga0496101_0405539_229_597 119
1228 3300048904 Ga0496101_0535281 Ga0496101_0535281_124_495 119
1229 3300048904 Ga0496101_0739857 Ga0496101_0739857_124_483 119
1230 3300048904 Ga0496101_1327019 Ga0496101_1327019_163_522 119
1231 3300048905 Ga0496102_0263543 Ga0496102_0263543_352_711 119
1232 3300048905 Ga0496102_0503062 Ga0496102_0503062_159_518 119
1233 3300048905 Ga0496102_1892127 Ga0496102_1892127_25_396 119
1234 3300048907 Ga0496104_0008562 Ga0496104_0008562_5184_5543 119
1235 3300048907 Ga0496104_0071068 Ga0496104_0071068_1881_2240 119
1236 3300048907 Ga0496104_0978782 Ga0496104_0978782_339_707 119
1237 3300048908 Ga0496105_0083175 Ga0496105_0083175_1749_2108 119
1238 3300048908 Ga0496105_0118197 Ga0496105_0118197_407_766 119
1239 3300048908 Ga0496105_0324119 Ga0496105_0324119_318_677 119
1240 3300048909 Ga0496106_0040608 Ga0496106_0040608_1715_2074 119
1241 3300048909 Ga0496106_0159914 Ga0496106_0159914_1202_1561 119
1242 3300048909 Ga0496106_0324981 Ga0496106_0324981_425_796 119
1243 3300048909 Ga0496106_0730059 Ga0496106_0730059_396_764 119
1244 3300048909 Ga0496106_1180855 Ga0496106_1180855_217_576 119
1245 3300048910 Ga0496107_0076223 Ga0496107_0076223_1844_2203 119
1246 3300048910 Ga0496107_0620004 Ga0496107_0620004_380_739 119
1247 3300048911 Ga0496108_0029035 Ga0496108_0029035_975_1334 119
1248 3300048912 Ga0496109_0007883 Ga0496109_0007883_341_700 119
1249 3300048912 Ga0496109_0052940 Ga0496109_0052940_2498_2857 119
1250 3300048912 Ga0496109_0225536 Ga0496109_0225536_903_1262 119
1251 3300048912 Ga0496109_1006808 Ga0496109_1006808_136_495 119
1252 3300048912 Ga0496109_1988281 Ga0496109_1988281_69_428 119
1253 3300048913 Ga0496110_0004692 Ga0496110_0004692_4246_4605 119
1254 3300048913 Ga0496110_0158049 Ga0496110_0158049_566_934 119
1255 3300048913 Ga0496110_0363689 Ga0496110_0363689_375_734 119
1256 3300048914 Ga0496111_0018955 Ga0496111_0018955_3453_3812 119
1257 3300048914 Ga0496111_0440325 Ga0496111_0440325_39_398 119
1258 3300048915 Ga0496112_0009593 Ga0496112_0009593_4765_5124 119
1259 3300048915 Ga0496112_0051911 Ga0496112_0051911_3237_3596 119
1260 3300048915 Ga0496112_1094059 Ga0496112_1094059_186_545 119
1261 3300048915 Ga0496112_1183391 Ga0496112_1183391_240_599 119
1262 3300048916 Ga0496113_0010835 Ga0496113_0010835_4474_4833 119
1263 3300048916 Ga0496113_0713246 Ga0496113_0713246_179_538 119
1264 3300048917 Ga0496114_0446878 Ga0496114_0446878_351_722 119
1265 3300048917 Ga0496114_0499461 Ga0496114_0499461_625_984 119
1266 3300048918 Ga0496115_0111356 Ga0496115_0111356_518_877 119
1267 3300049519 Ga0501296_068390 Ga0501296_068390_89_454 119
1268 3300049522 Ga0501299_220721 Ga0501299_220721_61_426 119
1269 3300049569 Ga0501032_0405350 Ga0501032_0405350_287_649 119
1270 3300049572 Ga0501036_0390320 Ga0501036_0390320_538_897 119
1271 3300049575 Ga0501039_0081481 Ga0501039_0081481_2129_2491 119
1272 3300049576 Ga0501040_0808401 Ga0501040_0808401_42_404 119
1273 3300049576 Ga0501040_1331680 Ga0501040_1331680_107_466 119
1274 3300049577 Ga0501041_0050172 Ga0501041_0050172_1741_2103 119
1275 3300049577 Ga0501041_0178885 Ga0501041_0178885_435_794 119
1276 3300049577 Ga0501041_0208371 Ga0501041_0208371_203_562 119
1277 3300049577 Ga0501041_0216867 Ga0501041_0216867_72_431 119
1278 3300049578 Ga0501042_0044862 Ga0501042_0044862_2332_2694 119
1279 3300049578 Ga0501042_0091952 Ga0501042_0091952_590_949 119
1280 3300049578 Ga0501042_0140840 Ga0501042_0140840_570_932 119
1281 3300049578 Ga0501042_0691570 Ga0501042_0691570_61_420 119
1282 3300049579 Ga0501043_0654737 Ga0501043_0654737_306_665 119
1283 3300049580 Ga0501046_0456555 Ga0501046_0456555_348_707 119
1284 3300049580 Ga0501046_0868996 Ga0501046_0868996_235_597 119
1285 3300049580 Ga0501046_1014923 Ga0501046_1014923_169_528 119
1286 3300049581 Ga0501047_0965959 Ga0501047_0965959_32_394 119
1287 3300049583 Ga0501067_0349988 Ga0501067_0349988_80_439 119
1288 3300049584 Ga0501068_0413061 Ga0501068_0413061_259_618 119
1289 3300049584 Ga0501068_0434109 Ga0501068_0434109_385_744 119
1290 3300049585 Ga0501069_0179706 Ga0501069_0179706_154_516 119
1291 3300049587 Ga0501071_0031106 Ga0501071_0031106_3225_3587 119
1292 3300049587 Ga0501071_0098787 Ga0501071_0098787_424_783 119
1293 3300049587 Ga0501071_0695411 Ga0501071_0695411_154_513 119
1294 3300049588 Ga0501072_0042793 Ga0501072_0042793_3131_3490 119
1295 3300049589 Ga0501073_0249406 Ga0501073_0249406_715_1092 119
1296 3300049589 Ga0501073_0395639 Ga0501073_0395639_41_403 119
1297 3300049590 Ga0501074_0314297 Ga0501074_0314297_488_847 119
1298 3300049590 Ga0501074_0359698 Ga0501074_0359698_329_691 119
1299 3300049591 Ga0501075_0042269 Ga0501075_0042269_1833_2192 119
1300 3300049591 Ga0501075_0159458 Ga0501075_0159458_631_993 119
1301 3300049591 Ga0501075_0952764 Ga0501075_0952764_11_370 119
1302 3300049592 Ga0501076_0046014 Ga0501076_0046014_2434_2796 119
1303 3300049592 Ga0501076_0055767 Ga0501076_0055767_2081_2440 119
1304 3300049592 Ga0501076_0140625 Ga0501076_0140625_380_739 119
1305 3300049592 Ga0501076_0225615 Ga0501076_0225615_229_588 119
1306 3300049593 Ga0501077_0358434 Ga0501077_0358434_239_598 119
1307 3300049593 Ga0501077_0666823 Ga0501077_0666823_204_581 119
1308 3300049652 Ga0501202_148057 Ga0501202_148057_69_434 119
1309 3300049741 Ga0501079_0053476 Ga0501079_0053476_819_1178 119
1310 3300049741 Ga0501079_0094223 Ga0501079_0094223_246_623 119
1311 3300049741 Ga0501079_0140282 Ga0501079_0140282_645_1004 119
1312 3300049741 Ga0501079_1310383 Ga0501079_1310383_116_475 119
1313 3300049742 Ga0501080_0947979 Ga0501080_0947979_378_737 119
1314 3300049742 Ga0501080_1373390 Ga0501080_1373390_83_460 119
1315 3300049743 Ga0501081_0008315 Ga0501081_0008315_3925_4284 119
1316 3300049743 Ga0501081_0157769 Ga0501081_0157769_1014_1373 119
1317 3300049743 Ga0501081_0181421 Ga0501081_0181421_95_457 119
1318 3300049743 Ga0501081_0420790 Ga0501081_0420790_351_713 119
1319 3300049743 Ga0501081_0421217 Ga0501081_0421217_603_965 119
1320 3300049824 Ga0501045_0076993 Ga0501045_0076993_573_935 119
1321 3300049824 Ga0501045_0483206 Ga0501045_0483206_433_795 119
1322 3300050491 nmdc:mga00v17_181772_c1 nmdc:mga00v17_181772_c1_95_457 119
1323 3300050493 nmdc:mga0k408_291082_c1 nmdc:mga0k408_291082_c1_74_436 119
1324 3300050493 nmdc:mga0k408_53704_c2 nmdc:mga0k408_53704_c2_336_704 119
1325 3300050494 nmdc:mga06z11_118642_c1 nmdc:mga06z11_118642_c1_136_504 119
1326 3300050496 nmdc:mga07m45_180842_c1 nmdc:mga07m45_180842_c1_165_524 119
1327 3300050507 nmdc:mga05p37_1100630_c1 nmdc:mga05p37_1100630_c1_337_705 119
1328 3300050507 nmdc:mga05p37_119786_c1 nmdc:mga05p37_119786_c1_143_502 119
1329 3300050507 nmdc:mga05p37_1230740_c1 nmdc:mga05p37_1230740_c1_383_742 119
1330 3300050507 nmdc:mga05p37_1594891_c1 nmdc:mga05p37_1594891_c1_124_483 119
1331 3300050507 nmdc:mga05p37_1729831_c1 nmdc:mga05p37_1729831_c1_166_552 119
1332 3300050507 nmdc:mga05p37_20831_c1 nmdc:mga05p37_20831_c1_838_1197 119
1333 3300050507 nmdc:mga05p37_209293_c1 nmdc:mga05p37_209293_c1_1005_1367 119
1334 3300050507 nmdc:mga05p37_2143596_c1 nmdc:mga05p37_2143596_c1_140_499 119
1335 3300050507 nmdc:mga05p37_226973_c1 nmdc:mga05p37_226973_c1_855_1214 119
1336 3300050507 nmdc:mga05p37_27034_c1 nmdc:mga05p37_27034_c1_3439_3798 119
1337 3300050507 nmdc:mga05p37_2738_c2 nmdc:mga05p37_2738_c2_2418_2777 119
1338 3300050507 nmdc:mga05p37_29743_c1 nmdc:mga05p37_29743_c1_6054_6413 119
1339 3300050507 nmdc:mga05p37_38505_c1 nmdc:mga05p37_38505_c1_4430_4789 119
1340 3300050507 nmdc:mga05p37_6177_c1 nmdc:mga05p37_6177_c1_9873_10232 119
1341 3300050507 nmdc:mga05p37_71170_c1 nmdc:mga05p37_71170_c1_2405_2764 119
1342 3300050507 nmdc:mga05p37_789914_c1 nmdc:mga05p37_789914_c1_457_819 119
1343 3300050507 nmdc:mga05p37_83256_c1 nmdc:mga05p37_83256_c1_2890_3249 119
1344 3300050508 nmdc:mga09592_101467_c1 nmdc:mga09592_101467_c1_1893_2252 119
1345 3300050508 nmdc:mga09592_459558_c1 nmdc:mga09592_459558_c1_365_730 119
1346 3300050508 nmdc:mga09592_483498_c1 nmdc:mga09592_483498_c1_384_743 119
1347 3300050509 nmdc:mga0qj67_142930_c1 nmdc:mga0qj67_142930_c1_449_808 119
1348 3300050509 nmdc:mga0qj67_297662_c1 nmdc:mga0qj67_297662_c1_242_604 119
1349 3300050509 nmdc:mga0qj67_48323_c1 nmdc:mga0qj67_48323_c1_2002_2361 119
1350 3300050509 nmdc:mga0qj67_667180_c1 nmdc:mga0qj67_667180_c1_446_811 119
1351 3300050509 nmdc:mga0qj67_80907_c1 nmdc:mga0qj67_80907_c1_2134_2496 119
1352 3300050510 nmdc:mga06r32_108864_c1 nmdc:mga06r32_108864_c1_1790_2149 119
1353 3300050510 nmdc:mga06r32_1507208_c1 nmdc:mga06r32_1507208_c1_205_570 119
1354 3300050510 nmdc:mga06r32_166141_c1 nmdc:mga06r32_166141_c1_834_1193 119
1355 3300050510 nmdc:mga06r32_452999_c1 nmdc:mga06r32_452999_c1_57_419 119
1356 3300050510 nmdc:mga06r32_719294_c1 nmdc:mga06r32_719294_c1_477_842 119
1357 3300050510 nmdc:mga06r32_86599_c1 nmdc:mga06r32_86599_c1_1310_1669 119
1358 3300050510 nmdc:mga06r32_98095_c1 nmdc:mga06r32_98095_c1_2341_2727 119
1359 3300050511 nmdc:mga08y16_134702_c1 nmdc:mga08y16_134702_c1_510_869 119
1360 3300050511 nmdc:mga08y16_392987_c1 nmdc:mga08y16_392987_c1_858_1226 119
1361 3300050511 nmdc:mga08y16_520297_c1 nmdc:mga08y16_520297_c1_454_813 119
1362 3300050511 nmdc:mga08y16_653305_c1 nmdc:mga08y16_653305_c1_499_864 119
1363 3300050511 nmdc:mga08y16_929148_c1 nmdc:mga08y16_929148_c1_333_704 119
1364 3300050511 nmdc:mga08y16_9369_c1 nmdc:mga08y16_9369_c1_6890_7249 119
1365 3300050512 nmdc:mga0n895_1313407_c1 nmdc:mga0n895_1313407_c1_137_496 119
1366 3300050512 nmdc:mga0n895_132139_c1 nmdc:mga0n895_132139_c1_839_1198 119
1367 3300050512 nmdc:mga0n895_194829_c1 nmdc:mga0n895_194829_c1_573_932 119
1368 3300050512 nmdc:mga0n895_2024542_c1 nmdc:mga0n895_2024542_c1_124_483 119
1369 3300050512 nmdc:mga0n895_301955_c1 nmdc:mga0n895_301955_c1_1220_1579 119
1370 3300050512 nmdc:mga0n895_718682_c1 nmdc:mga0n895_718682_c1_348_707 119
1371 3300050512 nmdc:mga0n895_721858_c1 nmdc:mga0n895_721858_c1_218_577 119
1372 3300050513 nmdc:mga0rr50_1314062_c1 nmdc:mga0rr50_1314062_c1_90_449 119
1373 3300050513 nmdc:mga0rr50_137630_c1 nmdc:mga0rr50_137630_c1_358_717 119
1374 3300050513 nmdc:mga0rr50_242591_c1 nmdc:mga0rr50_242591_c1_856_1215 119
1375 3300050513 nmdc:mga0rr50_248189_c1 nmdc:mga0rr50_248189_c1_510_869 119
1376 3300050513 nmdc:mga0rr50_47505_c1 nmdc:mga0rr50_47505_c1_97_459 119
1377 3300050513 nmdc:mga0rr50_740511_c1 nmdc:mga0rr50_740511_c1_378_746 119
1378 3300050514 nmdc:mga08x19_229740_c1 nmdc:mga08x19_229740_c1_548_907 119
1379 3300050514 nmdc:mga08x19_6364_c1 nmdc:mga08x19_6364_c1_2574_2933 119
1380 3300050514 nmdc:mga08x19_900864_c1 nmdc:mga08x19_900864_c1_67_426 119
1381 3300050515 nmdc:mga0a205_100557_c2 nmdc:mga0a205_100557_c2_1917_2276 119
1382 3300050515 nmdc:mga0a205_19164_c1 nmdc:mga0a205_19164_c1_1880_2239 119
1383 3300050515 nmdc:mga0a205_339228_c1 nmdc:mga0a205_339228_c1_744_1103 119
1384 3300050515 nmdc:mga0a205_345110_c1 nmdc:mga0a205_345110_c1_410_772 119
1385 3300050515 nmdc:mga0a205_388379_c1 nmdc:mga0a205_388379_c1_10_372 119
1386 3300050515 nmdc:mga0a205_428895_c1 nmdc:mga0a205_428895_c1_631_990 119
1387 3300050515 nmdc:mga0a205_468679_c1 nmdc:mga0a205_468679_c1_678_1037 119
1388 3300050515 nmdc:mga0a205_74905_c2 nmdc:mga0a205_74905_c2_2521_2880 119
1389 3300050515 nmdc:mga0a205_86326_c1 nmdc:mga0a205_86326_c1_2654_3013 119
1390 3300053077 Ga0495601_0225021 Ga0495601_0225021_455_814 119
1391 3300053077 Ga0495601_0371243 Ga0495601_0371243_29_388 119
1392 3300053078 Ga0495612_0460664 Ga0495612_0460664_115_474 119
1393 3300053084 Ga0495595_0528633 Ga0495595_0528633_23_382 119
1394 3300053085 Ga0495619_0118877 Ga0495619_0118877_987_1355 119
1395 3300053085 Ga0495619_0150602 Ga0495619_0150602_424_783 119
1396 3300053085 Ga0495619_0151616 Ga0495619_0151616_274_633 119
1397 3300053085 Ga0495619_0248654 Ga0495619_0248654_687_1046 119
1398 3300053085 Ga0495619_0249327 Ga0495619_0249327_788_1153 119
1399 3300053085 Ga0495619_0326669 Ga0495619_0326669_243_602 119
1400 3300054114 Ga0501084_0089602 Ga0501084_0089602_2044_2403 119
1401 3300054114 Ga0501084_0241347 Ga0501084_0241347_315_677 119
1402 3300054114 Ga0501084_0277564 Ga0501084_0277564_64_423 119
1403 3300054114 Ga0501084_0369950 Ga0501084_0369950_28_390 119
1404 3300054114 Ga0501084_0702670 Ga0501084_0702670_282_644 119
1405 3300054114 Ga0501084_1209224 Ga0501084_1209224_104_463 119
1406 3300054114 Ga0501084_1429318 Ga0501084_1429318_183_548 119
1407 3300059421 Ga0590071_007833 Ga0590071_007833_103_462 119
1408 3300059426 Ga0590077_002299 Ga0590077_002299_2803_3162 119
1409 3300060353 Ga0501082_0182024 Ga0501082_0182024_1057_1416 119
1410 3300060353 Ga0501082_0384535 Ga0501082_0384535_406_765 119
1411 3300060353 Ga0501082_0553563 Ga0501082_0553563_429_791 119
1412 3300060353 Ga0501082_0801192 Ga0501082_0801192_172_531 119
1413 3300061734 Ga0530510_0065854 Ga0530510_0065854_188_547 119
1414 3300061734 Ga0530510_0128067 Ga0530510_0128067_758_1120 119
1415 3300061734 Ga0530510_0175133 Ga0530510_0175133_563_922 119
1416 3300061734 Ga0530510_0610693 Ga0530510_0610693_122_481 119
1417 3300061734 Ga0530510_1100764 Ga0530510_1100764_145_504 119
1418 3300061734 Ga0530510_1343010 Ga0530510_1343010_133_495 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

33

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zzd-assembly1.cif.gz_A-2 crystal structure of multidrug resistance regulator lmrr bound to riboflavin 0.9245 15 111
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.9173 17 107
6fuu-assembly1.cif.gz_A transcriptional regulator lmrr with bound heme 0.9141 15 110
5h20-assembly1.cif.gz_A-2 x-ray structure of padr-like transcription factor from bacteroid fragilis 0.9031 14 110
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.902 15 109
ID Description Score Start End Superfamily
6fuuA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9141 15 110 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9035 17 95 1.10.10.10
5h20A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9031 14 110 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8982 10 107 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8909 15 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C7K7R8-F1-model_v4 deleted 0.9911 14 102
AF-A0A2V8EBD2-F1-model_v4 PadR family transcriptional regulator 0.9828 9 112
AF-A0A2V9A638-F1-model_v4 PadR family transcriptional regulator 0.9737 8 93
AF-A0A0K2GYX4-F1-model_v4 ParR family transcriptional regulator 0.9705 18 98
AF-A0A2V8UGP7-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9688 14 114

Feature Viewer

pLDDT pTM Quality
82.75 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map