F493806
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1418 | 383 | 1418 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100478445|Ga0068858_1004784451 |
| Length | 131 |
| Sequence | MSCVYAVDCLRHMSKNPDDRRLDLLQGTLDMLILRTLQWGPQHGHGIGQAIRAQSDDLLKVETGSLYPALHRLEKRAWLKAEWGQSEANQRAKYYRLTAAGKAQLLREQDRWSQLVMAIGRIMNPAPAGED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 120 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 252 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 253 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 256 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 257 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 258 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 259 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 260 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 261 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 262 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 263 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 329 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 351 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.74 |
| Nodule | 0 |
| Rhizoplane | 3.6 |
| Rhizosphere | 92.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c028613 | 3300000041 | Unclassified | 519 |
| 2 | JGI24751J29686_10008866 | 3300002459 | Bacteria | 2063 |
| 3 | JGI24751J29686_10067055 | 3300002459 | Unclassified | 739 |
| 4 | Ga0065714_10237464 | 3300005288 | Bacteria | 802 |
| 5 | Ga0065712_10000261 | 3300005290 | Bacteria | 18174 |
| 6 | Ga0065712_10007697 | 3300005290 | Bacteria | 3233 |
| 7 | Ga0065712_10072631 | 3300005290 | Bacteria | 4673 |
| 8 | Ga0065712_10117680 | 3300005290 | Bacteria | 1717 |
| 9 | Ga0065712_10510675 | 3300005290 | Bacteria | 642 |
| 10 | Ga0065715_10000251 | 3300005293 | Bacteria | 29530 |
| 11 | Ga0065715_10095529 | 3300005293 | Bacteria | 4066 |
| 12 | Ga0065715_10114170 | 3300005293 | Bacteria | 2460 |
| 13 | Ga0065715_10160573 | 3300005293 | Bacteria | 1633 |
| 14 | Ga0065715_10416155 | 3300005293 | Bacteria | 810 |
| 15 | Ga0065715_10516821 | 3300005293 | Bacteria | 762 |
| 16 | Ga0065715_10618242 | 3300005293 | Unclassified | 697 |
| 17 | Ga0065707_10089470 | 3300005295 | Bacteria | 4360 |
| 18 | Ga0065707_10227589 | 3300005295 | Bacteria | 1201 |
| 19 | Ga0065707_10248989 | 3300005295 | Bacteria | 1131 |
| 20 | Ga0065707_10548712 | 3300005295 | Unclassified | 716 |
| 21 | Ga0065707_10565670 | 3300005295 | Bacteria | 711 |
| 22 | Ga0070658_10098188 | 3300005327 | Bacteria | 2419 |
| 23 | Ga0070676_10014126 | 3300005328 | Bacteria | 4384 |
| 24 | Ga0070676_11230938 | 3300005328 | Unclassified | 570 |
| 25 | Ga0070690_100013923 | 3300005330 | Bacteria | 4768 |
| 26 | Ga0070670_100008131 | 3300005331 | Bacteria | 8929 |
| 27 | Ga0070670_100015511 | 3300005331 | Bacteria | 6543 |
| 28 | Ga0070670_100046942 | 3300005331 | Bacteria | 3716 |
| 29 | Ga0070670_100088676 | 3300005331 | Unclassified | 2659 |
| 30 | Ga0070670_100660785 | 3300005331 | Bacteria | 938 |
| 31 | Ga0070670_100712674 | 3300005331 | Bacteria | 903 |
| 32 | Ga0070677_10098207 | 3300005333 | Bacteria | 1286 |
| 33 | Ga0070677_10118080 | 3300005333 | Bacteria | 1194 |
| 34 | Ga0070677_10166188 | 3300005333 | Unclassified | 1039 |
| 35 | Ga0070677_10400842 | 3300005333 | Bacteria | 723 |
| 36 | Ga0068869_100058302 | 3300005334 | Bacteria | 2823 |
| 37 | Ga0070666_10048887 | 3300005335 | Bacteria | 2842 |
| 38 | Ga0070666_10136296 | 3300005335 | Bacteria | 1708 |
| 39 | Ga0070680_100036963 | 3300005336 | Bacteria | 3946 |
| 40 | Ga0070680_100390921 | 3300005336 | Bacteria | 1185 |
| 41 | Ga0070680_100768471 | 3300005336 | Bacteria | 830 |
| 42 | Ga0068868_100083627 | 3300005338 | Unclassified | 2563 |
| 43 | Ga0068868_100166543 | 3300005338 | Bacteria | 1823 |
| 44 | Ga0068868_101913606 | 3300005338 | Unclassified | 562 |
| 45 | Ga0070660_100009760 | 3300005339 | Bacteria | 6765 |
| 46 | Ga0070660_100249584 | 3300005339 | Bacteria | 1447 |
| 47 | Ga0070689_100156391 | 3300005340 | Bacteria | 1841 |
| 48 | Ga0070689_100160313 | 3300005340 | Bacteria | 1818 |
| 49 | Ga0070689_101206770 | 3300005340 | Bacteria | 679 |
| 50 | Ga0070691_10016048 | 3300005341 | Bacteria | 3442 |
| 51 | Ga0070687_100378175 | 3300005343 | Bacteria | 922 |
| 52 | Ga0070687_100424554 | 3300005343 | Bacteria | 878 |
| 53 | Ga0070687_100808544 | 3300005343 | Bacteria | 665 |
| 54 | Ga0070687_100812995 | 3300005343 | Unclassified | 663 |
| 55 | Ga0070661_100408754 | 3300005344 | Bacteria | 1074 |
| 56 | Ga0070661_100438020 | 3300005344 | Unclassified | 1038 |
| 57 | Ga0070661_101304614 | 3300005344 | Bacteria | 609 |
| 58 | Ga0070661_101336254 | 3300005344 | Unclassified | 602 |
| 59 | Ga0070692_10056486 | 3300005345 | Bacteria | 2056 |
| 60 | Ga0070692_10583161 | 3300005345 | Unclassified | 737 |
| 61 | Ga0070692_10591783 | 3300005345 | Bacteria | 733 |
| 62 | Ga0070668_100020058 | 3300005347 | Bacteria | 5040 |
| 63 | Ga0070668_100590300 | 3300005347 | Bacteria | 971 |
| 64 | Ga0070669_100004180 | 3300005353 | Bacteria | 10461 |
| 65 | Ga0070669_100029543 | 3300005353 | Bacteria | 3952 |
| 66 | Ga0070669_100036392 | 3300005353 | Bacteria | 3567 |
| 67 | Ga0070669_100185858 | 3300005353 | Bacteria | 1628 |
| 68 | Ga0070669_100186217 | 3300005353 | Bacteria | 1626 |
| 69 | Ga0070669_100278463 | 3300005353 | Unclassified | 1340 |
| 70 | Ga0070669_100364298 | 3300005353 | Bacteria | 1176 |
| 71 | Ga0070669_100492567 | 3300005353 | Bacteria | 1016 |
| 72 | Ga0070669_101125425 | 3300005353 | Unclassified | 677 |
| 73 | Ga0070675_100000263 | 3300005354 | Bacteria | 34450 |
| 74 | Ga0070675_100005779 | 3300005354 | Bacteria | 9464 |
| 75 | Ga0070675_100032497 | 3300005354 | Bacteria | 4224 |
| 76 | Ga0070675_100038879 | 3300005354 | Bacteria | 3880 |
| 77 | Ga0070675_100195158 | 3300005354 | Bacteria | 1756 |
| 78 | Ga0070675_100199772 | 3300005354 | Bacteria | 1735 |
| 79 | Ga0070675_100450560 | 3300005354 | Bacteria | 1154 |
| 80 | Ga0070675_100464244 | 3300005354 | Bacteria | 1137 |
| 81 | Ga0070675_100526730 | 3300005354 | Bacteria | 1067 |
| 82 | Ga0070675_100698294 | 3300005354 | Bacteria | 924 |
| 83 | Ga0070675_101159563 | 3300005354 | Bacteria | 711 |
| 84 | Ga0070671_100093414 | 3300005355 | Bacteria | 2521 |
| 85 | Ga0070674_100004715 | 3300005356 | Bacteria | 7800 |
| 86 | Ga0070674_100013234 | 3300005356 | Bacteria | 5093 |
| 87 | Ga0070674_100038015 | 3300005356 | Unclassified | 3240 |
| 88 | Ga0070674_100214611 | 3300005356 | Bacteria | 1494 |
| 89 | Ga0070674_100380861 | 3300005356 | Bacteria | 1148 |
| 90 | Ga0070674_100826126 | 3300005356 | Bacteria | 802 |
| 91 | Ga0070674_101031945 | 3300005356 | Bacteria | 723 |
| 92 | Ga0070674_101187006 | 3300005356 | Unclassified | 677 |
| 93 | Ga0070674_101260923 | 3300005356 | Bacteria | 658 |
| 94 | Ga0070674_101700710 | 3300005356 | Bacteria | 570 |
| 95 | Ga0070673_100036388 | 3300005364 | Bacteria | 3741 |
| 96 | Ga0070673_100075355 | 3300005364 | Bacteria | 2721 |
| 97 | Ga0070673_100102739 | 3300005364 | Bacteria | 2357 |
| 98 | Ga0070673_100193991 | 3300005364 | Bacteria | 1746 |
| 99 | Ga0070673_100538071 | 3300005364 | Bacteria | 1060 |
| 100 | Ga0070673_100877957 | 3300005364 | Unclassified | 831 |
| 101 | Ga0070673_101695677 | 3300005364 | Unclassified | 598 |
| 102 | Ga0070688_100079089 | 3300005365 | Bacteria | 2123 |
| 103 | Ga0070688_100637717 | 3300005365 | Unclassified | 819 |
| 104 | Ga0070688_100723341 | 3300005365 | Unclassified | 773 |
| 105 | Ga0070688_100850066 | 3300005365 | Unclassified | 717 |
| 106 | Ga0070659_100087517 | 3300005366 | Unclassified | 2494 |
| 107 | Ga0070667_100054603 | 3300005367 | Bacteria | 3373 |
| 108 | Ga0070667_100068794 | 3300005367 | Bacteria | 3013 |
| 109 | Ga0070667_101178617 | 3300005367 | Bacteria | 717 |
| 110 | Ga0070703_10624090 | 3300005406 | Bacteria | 500 |
| 111 | Ga0070709_10173612 | 3300005434 | Bacteria | 1508 |
| 112 | Ga0070709_10554034 | 3300005434 | Unclassified | 880 |
| 113 | Ga0070709_11186304 | 3300005434 | Bacteria | 613 |
| 114 | Ga0070714_100005079 | 3300005435 | Bacteria | 10012 |
| 115 | Ga0070710_10233543 | 3300005437 | Unclassified | 1175 |
| 116 | Ga0070701_10027299 | 3300005438 | Bacteria | 2794 |
| 117 | Ga0070711_100209442 | 3300005439 | Unclassified | 1509 |
| 118 | Ga0070711_100252838 | 3300005439 | Unclassified | 1383 |
| 119 | Ga0070711_100532606 | 3300005439 | Bacteria | 972 |
| 120 | Ga0070705_100003440 | 3300005440 | Bacteria | 7763 |
| 121 | Ga0070705_100079567 | 3300005440 | Bacteria | 2008 |
| 122 | Ga0070705_100424439 | 3300005440 | Unclassified | 991 |
| 123 | Ga0070700_100022249 | 3300005441 | Bacteria | 3694 |
| 124 | Ga0070700_100029344 | 3300005441 | Bacteria | 3279 |
| 125 | Ga0070700_100114917 | 3300005441 | Bacteria | 1795 |
| 126 | Ga0070700_100320247 | 3300005441 | Bacteria | 1139 |
| 127 | Ga0070700_100504777 | 3300005441 | Bacteria | 931 |
| 128 | Ga0070700_100592085 | 3300005441 | Bacteria | 868 |
| 129 | Ga0070700_100719299 | 3300005441 | Unclassified | 796 |
| 130 | Ga0070700_100915036 | 3300005441 | Bacteria | 715 |
| 131 | Ga0070694_100231845 | 3300005444 | Bacteria | 1389 |
| 132 | Ga0070694_100338638 | 3300005444 | Unclassified | 1162 |
| 133 | Ga0070694_100383610 | 3300005444 | Bacteria | 1096 |
| 134 | Ga0070694_100531954 | 3300005444 | Bacteria | 939 |
| 135 | Ga0070708_100890556 | 3300005445 | Bacteria | 836 |
| 136 | Ga0070663_100809119 | 3300005455 | Bacteria | 804 |
| 137 | Ga0070663_101240837 | 3300005455 | Bacteria | 656 |
| 138 | Ga0070663_102004271 | 3300005455 | Bacteria | 521 |
| 139 | Ga0070678_100055031 | 3300005456 | Bacteria | 2903 |
| 140 | Ga0070678_100172781 | 3300005456 | Bacteria | 1762 |
| 141 | Ga0070678_100328190 | 3300005456 | Bacteria | 1309 |
| 142 | Ga0070678_101765676 | 3300005456 | Bacteria | 583 |
| 143 | Ga0070662_100029984 | 3300005457 | Bacteria | 3802 |
| 144 | Ga0070662_100420794 | 3300005457 | Unclassified | 1105 |
| 145 | Ga0070681_10000782 | 3300005458 | Bacteria | 26491 |
| 146 | Ga0070681_10051671 | 3300005458 | Bacteria | 4100 |
| 147 | Ga0070681_10083353 | 3300005458 | Bacteria | 3151 |
| 148 | Ga0070681_10211377 | 3300005458 | Bacteria | 1856 |
| 149 | Ga0070681_11384876 | 3300005458 | Unclassified | 627 |
| 150 | Ga0068867_100186937 | 3300005459 | Bacteria | 1651 |
| 151 | Ga0068867_100225292 | 3300005459 | Bacteria | 1513 |
| 152 | Ga0068867_100245237 | 3300005459 | Bacteria | 1454 |
| 153 | Ga0068867_100641739 | 3300005459 | Unclassified | 930 |
| 154 | Ga0068867_101178085 | 3300005459 | Bacteria | 703 |
| 155 | Ga0068867_102058541 | 3300005459 | Bacteria | 540 |
| 156 | Ga0070685_10007059 | 3300005466 | Bacteria | 5735 |
| 157 | Ga0070685_10176490 | 3300005466 | Bacteria | 1372 |
| 158 | Ga0070685_10452236 | 3300005466 | Bacteria | 900 |
| 159 | Ga0070685_10614421 | 3300005466 | Bacteria | 784 |
| 160 | Ga0070706_100234597 | 3300005467 | Bacteria | 1713 |
| 161 | Ga0070706_100766602 | 3300005467 | Bacteria | 894 |
| 162 | Ga0070706_101322290 | 3300005467 | Bacteria | 661 |
| 163 | Ga0070707_100105604 | 3300005468 | Bacteria | 2731 |
| 164 | Ga0070707_100461168 | 3300005468 | Bacteria | 1232 |
| 165 | Ga0070707_100464821 | 3300005468 | Bacteria | 1226 |
| 166 | Ga0070707_100815876 | 3300005468 | Bacteria | 897 |
| 167 | Ga0070707_100891641 | 3300005468 | Bacteria | 854 |
| 168 | Ga0070707_101820917 | 3300005468 | Bacteria | 576 |
| 169 | Ga0070707_101900463 | 3300005468 | Unclassified | 563 |
| 170 | Ga0070698_100081682 | 3300005471 | Bacteria | 3226 |
| 171 | Ga0070698_100341131 | 3300005471 | Bacteria | 1430 |
| 172 | Ga0070698_100437529 | 3300005471 | Bacteria | 1243 |
| 173 | Ga0070698_100507008 | 3300005471 | Unclassified | 1145 |
| 174 | Ga0070699_100098836 | 3300005518 | Bacteria | 2557 |
| 175 | Ga0070699_100651999 | 3300005518 | Bacteria | 961 |
| 176 | Ga0070699_100653420 | 3300005518 | Bacteria | 960 |
| 177 | Ga0070699_101589618 | 3300005518 | Unclassified | 599 |
| 178 | Ga0070699_101993021 | 3300005518 | Unclassified | 531 |
| 179 | Ga0070679_100043801 | 3300005530 | Bacteria | 4457 |
| 180 | Ga0070679_100097367 | 3300005530 | Bacteria | 2930 |
| 181 | Ga0070679_101715518 | 3300005530 | Unclassified | 576 |
| 182 | Ga0070684_100162562 | 3300005535 | Bacteria | 2026 |
| 183 | Ga0070684_100453868 | 3300005535 | Bacteria | 1185 |
| 184 | Ga0070684_100504122 | 3300005535 | Unclassified | 1121 |
| 185 | Ga0070684_101869587 | 3300005535 | Bacteria | 566 |
| 186 | Ga0070697_100025752 | 3300005536 | Bacteria | 4692 |
| 187 | Ga0070697_100131184 | 3300005536 | Bacteria | 2102 |
| 188 | Ga0070697_100970599 | 3300005536 | Bacteria | 755 |
| 189 | Ga0070697_101167418 | 3300005536 | Unclassified | 686 |
| 190 | Ga0068853_100384142 | 3300005539 | Bacteria | 1312 |
| 191 | Ga0068853_100866124 | 3300005539 | Bacteria | 867 |
| 192 | Ga0068853_101150651 | 3300005539 | Bacteria | 749 |
| 193 | Ga0068853_101600232 | 3300005539 | Bacteria | 631 |
| 194 | Ga0070672_100006193 | 3300005543 | Bacteria | 8013 |
| 195 | Ga0070672_100113621 | 3300005543 | Bacteria | 2210 |
| 196 | Ga0070672_100231730 | 3300005543 | Unclassified | 1552 |
| 197 | Ga0070672_100248761 | 3300005543 | Bacteria | 1497 |
| 198 | Ga0070672_100374073 | 3300005543 | Bacteria | 1218 |
| 199 | Ga0070672_100549111 | 3300005543 | Bacteria | 1003 |
| 200 | Ga0070672_100704769 | 3300005543 | Bacteria | 884 |
| 201 | Ga0070672_101358823 | 3300005543 | Bacteria | 635 |
| 202 | Ga0070672_101918994 | 3300005543 | Unclassified | 533 |
| 203 | Ga0070686_100011242 | 3300005544 | Bacteria | 5072 |
| 204 | Ga0070686_100015118 | 3300005544 | Bacteria | 4463 |
| 205 | Ga0070686_100252521 | 3300005544 | Bacteria | 1289 |
| 206 | Ga0070686_100762355 | 3300005544 | Bacteria | 777 |
| 207 | Ga0070695_100051838 | 3300005545 | Bacteria | 2634 |
| 208 | Ga0070695_100295488 | 3300005545 | Bacteria | 1196 |
| 209 | Ga0070695_100484690 | 3300005545 | Bacteria | 954 |
| 210 | Ga0070695_100700554 | 3300005545 | Bacteria | 804 |
| 211 | Ga0070696_100006942 | 3300005546 | Bacteria | 7559 |
| 212 | Ga0070696_101768150 | 3300005546 | Unclassified | 534 |
| 213 | Ga0070693_100754947 | 3300005547 | Unclassified | 717 |
| 214 | Ga0070665_100009673 | 3300005548 | Bacteria | 9746 |
| 215 | Ga0070665_100010784 | 3300005548 | Bacteria | 9241 |
| 216 | Ga0070665_100336432 | 3300005548 | Bacteria | 1514 |
| 217 | Ga0070665_101110679 | 3300005548 | Bacteria | 802 |
| 218 | Ga0070665_101216807 | 3300005548 | Bacteria | 764 |
| 219 | Ga0070665_101443081 | 3300005548 | Bacteria | 697 |
| 220 | Ga0070704_100005455 | 3300005549 | Bacteria | 7410 |
| 221 | Ga0070704_100027621 | 3300005549 | Bacteria | 3767 |
| 222 | Ga0070704_100342321 | 3300005549 | Bacteria | 1260 |
| 223 | Ga0070704_100378046 | 3300005549 | Bacteria | 1203 |
| 224 | Ga0070704_100785310 | 3300005549 | Bacteria | 850 |
| 225 | Ga0070704_101865880 | 3300005549 | Bacteria | 557 |
| 226 | Ga0070704_101904288 | 3300005549 | Bacteria | 551 |
| 227 | Ga0068855_100006730 | 3300005563 | Bacteria | 13945 |
| 228 | Ga0068855_100078218 | 3300005563 | Bacteria | 3837 |
| 229 | Ga0068855_100450789 | 3300005563 | Unclassified | 1404 |
| 230 | Ga0068855_100607357 | 3300005563 | Bacteria | 1179 |
| 231 | Ga0068855_101390594 | 3300005563 | Bacteria | 724 |
| 232 | Ga0070664_100042065 | 3300005564 | Bacteria | 3858 |
| 233 | Ga0070664_102212294 | 3300005564 | Bacteria | 522 |
| 234 | Ga0068857_100076213 | 3300005577 | Bacteria | 2991 |
| 235 | Ga0068857_100130772 | 3300005577 | Unclassified | 2264 |
| 236 | Ga0068854_100006513 | 3300005578 | Bacteria | 7431 |
| 237 | Ga0068854_100172947 | 3300005578 | Bacteria | 1682 |
| 238 | Ga0068856_101263594 | 3300005614 | Unclassified | 754 |
| 239 | Ga0068856_102052920 | 3300005614 | Unclassified | 582 |
| 240 | Ga0070702_100014267 | 3300005615 | Bacteria | 4029 |
| 241 | Ga0070702_100617939 | 3300005615 | Bacteria | 815 |
| 242 | Ga0070702_101277818 | 3300005615 | Bacteria | 595 |
| 243 | Ga0070702_101749689 | 3300005615 | Bacteria | 518 |
| 244 | Ga0068852_100494432 | 3300005616 | Bacteria | 1217 |
| 245 | Ga0068852_101038209 | 3300005616 | Bacteria | 839 |
| 246 | Ga0068852_102091960 | 3300005616 | Bacteria | 588 |
| 247 | Ga0068852_102267282 | 3300005616 | Bacteria | 564 |
| 248 | Ga0068859_100034539 | 3300005617 | Bacteria | 5075 |
| 249 | Ga0068859_100124888 | 3300005617 | Bacteria | 2642 |
| 250 | Ga0068859_100161431 | 3300005617 | Bacteria | 2320 |
| 251 | Ga0068859_100271587 | 3300005617 | Bacteria | 1788 |
| 252 | Ga0068859_100428074 | 3300005617 | Bacteria | 1420 |
| 253 | Ga0068859_100793627 | 3300005617 | Bacteria | 1035 |
| 254 | Ga0068859_101000724 | 3300005617 | Bacteria | 918 |
| 255 | Ga0068859_101066605 | 3300005617 | Unclassified | 888 |
| 256 | Ga0068859_101470818 | 3300005617 | Bacteria | 752 |
| 257 | Ga0068859_102495541 | 3300005617 | Bacteria | 569 |
| 258 | Ga0068864_100004878 | 3300005618 | Bacteria | 10982 |
| 259 | Ga0068864_100011781 | 3300005618 | Bacteria | 7223 |
| 260 | Ga0068864_100131310 | 3300005618 | Bacteria | 2250 |
| 261 | Ga0068864_100436837 | 3300005618 | Bacteria | 1250 |
| 262 | Ga0068864_100829409 | 3300005618 | Bacteria | 910 |
| 263 | Ga0068864_101077561 | 3300005618 | Bacteria | 799 |
| 264 | Ga0068864_101902919 | 3300005618 | Unclassified | 601 |
| 265 | Ga0068866_10199737 | 3300005718 | Bacteria | 1194 |
| 266 | Ga0068866_10489349 | 3300005718 | Bacteria | 812 |
| 267 | Ga0068866_10921711 | 3300005718 | Unclassified | 616 |
| 268 | Ga0068861_100052201 | 3300005719 | Bacteria | 3107 |
| 269 | Ga0068861_100062989 | 3300005719 | Bacteria | 2850 |
| 270 | Ga0068861_100136974 | 3300005719 | Bacteria | 1993 |
| 271 | Ga0068861_100233003 | 3300005719 | Bacteria | 1563 |
| 272 | Ga0068861_100390075 | 3300005719 | Bacteria | 1233 |
| 273 | Ga0068861_101188066 | 3300005719 | Unclassified | 737 |
| 274 | Ga0068870_10449789 | 3300005840 | Bacteria | 849 |
| 275 | Ga0068870_10504745 | 3300005840 | Unclassified | 807 |
| 276 | Ga0068870_10632440 | 3300005840 | Bacteria | 731 |
| 277 | Ga0068863_100032588 | 3300005841 | Bacteria | 4966 |
| 278 | Ga0068863_100234500 | 3300005841 | Bacteria | 1771 |
| 279 | Ga0068863_100515578 | 3300005841 | Bacteria | 1178 |
| 280 | Ga0068863_101061306 | 3300005841 | Unclassified | 814 |
| 281 | Ga0068863_101065099 | 3300005841 | Bacteria | 812 |
| 282 | Ga0068863_102006524 | 3300005841 | Unclassified | 588 |
| 283 | Ga0068863_102496448 | 3300005841 | Unclassified | 526 |
| 284 | Ga0068858_100012933 | 3300005842 | Bacteria | 7869 |
| 285 | Ga0068858_100104020 | 3300005842 | Bacteria | 2650 |
| 286 | Ga0068858_100158166 | 3300005842 | Bacteria | 2133 |
| 287 | Ga0068858_100175178 | 3300005842 | Bacteria | 2024 |
| 288 | Ga0068858_100478445 | 3300005842 | Bacteria | 1202 |
| 289 | Ga0068858_100739476 | 3300005842 | Bacteria | 958 |
| 290 | Ga0068858_101341489 | 3300005842 | Bacteria | 704 |
| 291 | Ga0068860_100031017 | 3300005843 | Bacteria | 5139 |
| 292 | Ga0068860_100369821 | 3300005843 | Bacteria | 1414 |
| 293 | Ga0068860_100372149 | 3300005843 | Bacteria | 1409 |
| 294 | Ga0068860_100619072 | 3300005843 | Unclassified | 1089 |
| 295 | Ga0068860_100649456 | 3300005843 | Bacteria | 1063 |
| 296 | Ga0068860_101895028 | 3300005843 | Unclassified | 618 |
| 297 | Ga0068860_102040477 | 3300005843 | Bacteria | 595 |
| 298 | Ga0068862_100025690 | 3300005844 | Unclassified | 4946 |
| 299 | Ga0068862_100040059 | 3300005844 | Bacteria | 3982 |
| 300 | Ga0068862_100098005 | 3300005844 | Bacteria | 2560 |
| 301 | Ga0068862_100498796 | 3300005844 | Bacteria | 1155 |
| 302 | Ga0068862_100599666 | 3300005844 | Unclassified | 1057 |
| 303 | Ga0068862_100972564 | 3300005844 | Unclassified | 838 |
| 304 | Ga0068862_101198571 | 3300005844 | Bacteria | 758 |
| 305 | Ga0068862_101258093 | 3300005844 | Bacteria | 740 |
| 306 | Ga0068862_102272539 | 3300005844 | Bacteria | 554 |
| 307 | Ga0081455_10088091 | 3300005937 | Bacteria | 2524 |
| 308 | Ga0081455_10428229 | 3300005937 | Bacteria | 910 |
| 309 | Ga0081455_10450650 | 3300005937 | Bacteria | 879 |
| 310 | Ga0081539_10014244 | 3300005985 | Bacteria | 5902 |
| 311 | Ga0070717_10749092 | 3300006028 | Bacteria | 888 |
| 312 | Ga0075365_10211371 | 3300006038 | Unclassified | 1360 |
| 313 | Ga0075365_11055682 | 3300006038 | Unclassified | 572 |
| 314 | Ga0075368_10004146 | 3300006042 | Bacteria | 4882 |
| 315 | Ga0075368_10022443 | 3300006042 | Bacteria | 2403 |
| 316 | Ga0075368_10046216 | 3300006042 | Bacteria | 1722 |
| 317 | Ga0075364_10007212 | 3300006051 | Bacteria | 6585 |
| 318 | Ga0075364_10019158 | 3300006051 | Bacteria | 4292 |
| 319 | Ga0075364_10030281 | 3300006051 | Bacteria | 3473 |
| 320 | Ga0075364_10110526 | 3300006051 | Bacteria | 1834 |
| 321 | Ga0075432_10013119 | 3300006058 | Bacteria | 2816 |
| 322 | Ga0075432_10168821 | 3300006058 | Unclassified | 850 |
| 323 | Ga0070715_10691666 | 3300006163 | Unclassified | 608 |
| 324 | Ga0070716_100197736 | 3300006173 | Bacteria | 1333 |
| 325 | Ga0075362_10000612 | 3300006177 | Bacteria | 10445 |
| 326 | Ga0075362_10005422 | 3300006177 | Bacteria | 4664 |
| 327 | Ga0075367_10016516 | 3300006178 | Bacteria | 4031 |
| 328 | Ga0075367_10021644 | 3300006178 | Bacteria | 3596 |
| 329 | Ga0075367_10043715 | 3300006178 | Unclassified | 2624 |
| 330 | Ga0075369_10472080 | 3300006186 | Unclassified | 595 |
| 331 | Ga0075366_10005604 | 3300006195 | Bacteria | 6811 |
| 332 | Ga0075366_10031509 | 3300006195 | Bacteria | 3121 |
| 333 | Ga0075366_10093834 | 3300006195 | Bacteria | 1799 |
| 334 | Ga0075366_10560787 | 3300006195 | Bacteria | 707 |
| 335 | Ga0097621_100009812 | 3300006237 | Bacteria | 6970 |
| 336 | Ga0097621_100042330 | 3300006237 | Bacteria | 3668 |
| 337 | Ga0097621_100502104 | 3300006237 | Bacteria | 1099 |
| 338 | Ga0097621_101163859 | 3300006237 | Unclassified | 726 |
| 339 | Ga0075370_10073026 | 3300006353 | Unclassified | 1964 |
| 340 | Ga0075370_10124251 | 3300006353 | Bacteria | 1504 |
| 341 | Ga0068871_100020951 | 3300006358 | Bacteria | 5016 |
| 342 | Ga0068871_100895743 | 3300006358 | Unclassified | 822 |
| 343 | Ga0068871_101323190 | 3300006358 | Bacteria | 678 |
| 344 | Ga0068871_101486101 | 3300006358 | Unclassified | 640 |
| 345 | Ga0075428_100057445 | 3300006844 | Bacteria | 4259 |
| 346 | Ga0075428_100131541 | 3300006844 | Bacteria | 2721 |
| 347 | Ga0075428_100189265 | 3300006844 | Bacteria | 2226 |
| 348 | Ga0075428_100456639 | 3300006844 | Bacteria | 1368 |
| 349 | Ga0075428_100479873 | 3300006844 | Unclassified | 1331 |
| 350 | Ga0075428_100698175 | 3300006844 | Bacteria | 1081 |
| 351 | Ga0075428_100797293 | 3300006844 | Bacteria | 1004 |
| 352 | Ga0075428_101299967 | 3300006844 | Unclassified | 765 |
| 353 | Ga0075428_101362912 | 3300006844 | Bacteria | 745 |
| 354 | Ga0075430_100004264 | 3300006846 | Bacteria | 12074 |
| 355 | Ga0075430_100048754 | 3300006846 | Bacteria | 3576 |
| 356 | Ga0075430_100094266 | 3300006846 | Bacteria | 2503 |
| 357 | Ga0075430_100389260 | 3300006846 | Bacteria | 1150 |
| 358 | Ga0075430_100546638 | 3300006846 | Bacteria | 955 |
| 359 | Ga0075430_100712766 | 3300006846 | Bacteria | 827 |
| 360 | Ga0075431_100052235 | 3300006847 | Bacteria | 4214 |
| 361 | Ga0075431_100094687 | 3300006847 | Unclassified | 3082 |
| 362 | Ga0075431_100098924 | 3300006847 | Bacteria | 3011 |
| 363 | Ga0075431_100218693 | 3300006847 | Bacteria | 1944 |
| 364 | Ga0075431_100305028 | 3300006847 | Unclassified | 1608 |
| 365 | Ga0075431_100509425 | 3300006847 | Bacteria | 1194 |
| 366 | Ga0075431_100690784 | 3300006847 | Bacteria | 999 |
| 367 | Ga0075431_101015630 | 3300006847 | Bacteria | 796 |
| 368 | Ga0075431_101330355 | 3300006847 | Bacteria | 679 |
| 369 | Ga0075431_101925836 | 3300006847 | Bacteria | 547 |
| 370 | Ga0075433_10001180 | 3300006852 | Bacteria | 18992 |
| 371 | Ga0075433_10003835 | 3300006852 | Bacteria | 11638 |
| 372 | Ga0075433_10011494 | 3300006852 | Bacteria | 7129 |
| 373 | Ga0075433_10165387 | 3300006852 | Bacteria | 1969 |
| 374 | Ga0075433_10193567 | 3300006852 | Bacteria | 1809 |
| 375 | Ga0075433_10448011 | 3300006852 | Bacteria | 1138 |
| 376 | Ga0075433_10580021 | 3300006852 | Bacteria | 985 |
| 377 | Ga0075433_10688028 | 3300006852 | Unclassified | 896 |
| 378 | Ga0075433_10711268 | 3300006852 | Bacteria | 880 |
| 379 | Ga0075433_10712501 | 3300006852 | Bacteria | 879 |
| 380 | Ga0075433_10902581 | 3300006852 | Unclassified | 771 |
| 381 | Ga0075433_11346120 | 3300006852 | Bacteria | 618 |
| 382 | Ga0075434_100074174 | 3300006871 | Bacteria | 3396 |
| 383 | Ga0075434_100177127 | 3300006871 | Bacteria | 2152 |
| 384 | Ga0075434_100201853 | 3300006871 | Bacteria | 2008 |
| 385 | Ga0075434_100385280 | 3300006871 | Bacteria | 1423 |
| 386 | Ga0075434_100690033 | 3300006871 | Bacteria | 1039 |
| 387 | Ga0075434_100725767 | 3300006871 | Bacteria | 1011 |
| 388 | Ga0075434_101032830 | 3300006871 | Bacteria | 836 |
| 389 | Ga0075434_102211105 | 3300006871 | Unclassified | 554 |
| 390 | Ga0075429_100038356 | 3300006880 | Bacteria | 4170 |
| 391 | Ga0075429_100082406 | 3300006880 | Bacteria | 2804 |
| 392 | Ga0075429_100096187 | 3300006880 | Bacteria | 2583 |
| 393 | Ga0075429_100212267 | 3300006880 | Bacteria | 1696 |
| 394 | Ga0075429_100343820 | 3300006880 | Unclassified | 1306 |
| 395 | Ga0075429_101207551 | 3300006880 | Bacteria | 660 |
| 396 | Ga0075429_101976773 | 3300006880 | Bacteria | 505 |
| 397 | Ga0068865_100013820 | 3300006881 | Bacteria | 5118 |
| 398 | Ga0068865_100091282 | 3300006881 | Bacteria | 2210 |
| 399 | Ga0068865_100123574 | 3300006881 | Bacteria | 1928 |
| 400 | Ga0068865_100424070 | 3300006881 | Bacteria | 1094 |
| 401 | Ga0068865_100510223 | 3300006881 | Bacteria | 1004 |
| 402 | Ga0068865_102113716 | 3300006881 | Bacteria | 512 |
| 403 | Ga0075436_100647231 | 3300006914 | Unclassified | 781 |
| 404 | Ga0075436_101550399 | 3300006914 | Bacteria | 503 |
| 405 | Ga0097620_100034539 | 3300006931 | Bacteria | 5075 |
| 406 | Ga0097620_100124891 | 3300006931 | Bacteria | 2642 |
| 407 | Ga0097620_100161430 | 3300006931 | Bacteria | 2320 |
| 408 | Ga0097620_100271596 | 3300006931 | Bacteria | 1788 |
| 409 | Ga0097620_100428071 | 3300006931 | Bacteria | 1420 |
| 410 | Ga0097620_100793424 | 3300006931 | Bacteria | 1035 |
| 411 | Ga0097620_101000915 | 3300006931 | Bacteria | 918 |
| 412 | Ga0097620_101066602 | 3300006931 | Unclassified | 888 |
| 413 | Ga0097620_101470858 | 3300006931 | Bacteria | 752 |
| 414 | Ga0097620_102494893 | 3300006931 | Bacteria | 569 |
| 415 | Ga0075435_100003425 | 3300007076 | Bacteria | 10756 |
| 416 | Ga0075435_100107383 | 3300007076 | Bacteria | 2318 |
| 417 | Ga0075435_100200359 | 3300007076 | Bacteria | 1691 |
| 418 | Ga0075435_100278589 | 3300007076 | Bacteria | 1427 |
| 419 | Ga0075435_100632854 | 3300007076 | Bacteria | 928 |
| 420 | Ga0075435_100856356 | 3300007076 | Unclassified | 792 |
| 421 | Ga0075435_100972992 | 3300007076 | Bacteria | 741 |
| 422 | Ga0099794_10666159 | 3300007265 | Unclassified | 553 |
| 423 | Ga0099795_10350812 | 3300007788 | Bacteria | 660 |
| 424 | Ga0105240_10013366 | 3300009093 | Bacteria | 11278 |
| 425 | Ga0105240_10168722 | 3300009093 | Bacteria | 2594 |
| 426 | Ga0105240_10263269 | 3300009093 | Bacteria | 1988 |
| 427 | Ga0105240_10590873 | 3300009093 | Bacteria | 1223 |
| 428 | Ga0105240_10857001 | 3300009093 | Bacteria | 980 |
| 429 | Ga0105240_11806519 | 3300009093 | Unclassified | 637 |
| 430 | Ga0111539_10002910 | 3300009094 | Bacteria | 22714 |
| 431 | Ga0111539_10003741 | 3300009094 | Bacteria | 20019 |
| 432 | Ga0111539_10006263 | 3300009094 | Bacteria | 15360 |
| 433 | Ga0111539_10019405 | 3300009094 | Bacteria | 8392 |
| 434 | Ga0111539_10078058 | 3300009094 | Bacteria | 3897 |
| 435 | Ga0111539_10149077 | 3300009094 | Bacteria | 2738 |
| 436 | Ga0111539_10162240 | 3300009094 | Bacteria | 2614 |
| 437 | Ga0111539_10310304 | 3300009094 | Bacteria | 1836 |
| 438 | Ga0111539_10556952 | 3300009094 | Bacteria | 1335 |
| 439 | Ga0105245_10055485 | 3300009098 | Bacteria | 3559 |
| 440 | Ga0105245_10134307 | 3300009098 | Bacteria | 2324 |
| 441 | Ga0105245_10143827 | 3300009098 | Bacteria | 2249 |
| 442 | Ga0105245_10382519 | 3300009098 | Bacteria | 1402 |
| 443 | Ga0105245_10536367 | 3300009098 | Unclassified | 1191 |
| 444 | Ga0105245_10572521 | 3300009098 | Bacteria | 1153 |
| 445 | Ga0105245_10783725 | 3300009098 | Bacteria | 991 |
| 446 | Ga0105245_11005872 | 3300009098 | Bacteria | 878 |
| 447 | Ga0105247_10014516 | 3300009101 | Bacteria | 4725 |
| 448 | Ga0105247_10183334 | 3300009101 | Bacteria | 1398 |
| 449 | Ga0105247_10421459 | 3300009101 | Unclassified | 956 |
| 450 | Ga0114129_10001210 | 3300009147 | Bacteria | 34271 |
| 451 | Ga0114129_10007043 | 3300009147 | Bacteria | 16009 |
| 452 | Ga0114129_10007586 | 3300009147 | Bacteria | 15446 |
| 453 | Ga0114129_10013890 | 3300009147 | Bacteria | 11474 |
| 454 | Ga0114129_10014560 | 3300009147 | Bacteria | 11208 |
| 455 | Ga0114129_10029746 | 3300009147 | Bacteria | 7735 |
| 456 | Ga0114129_10037660 | 3300009147 | Bacteria | 6827 |
| 457 | Ga0114129_10054867 | 3300009147 | Bacteria | 5585 |
| 458 | Ga0114129_10107125 | 3300009147 | Bacteria | 3861 |
| 459 | Ga0114129_10230970 | 3300009147 | Bacteria | 2492 |
| 460 | Ga0114129_10335225 | 3300009147 | Bacteria | 2007 |
| 461 | Ga0114129_10339713 | 3300009147 | Unclassified | 1992 |
| 462 | Ga0114129_10504386 | 3300009147 | Bacteria | 1580 |
| 463 | Ga0114129_10506899 | 3300009147 | Bacteria | 1575 |
| 464 | Ga0114129_10607523 | 3300009147 | Unclassified | 1416 |
| 465 | Ga0114129_10821864 | 3300009147 | Bacteria | 1184 |
| 466 | Ga0114129_10982018 | 3300009147 | Bacteria | 1065 |
| 467 | Ga0114129_11257469 | 3300009147 | Bacteria | 919 |
| 468 | Ga0114129_11291873 | 3300009147 | Bacteria | 905 |
| 469 | Ga0114129_11462435 | 3300009147 | Bacteria | 841 |
| 470 | Ga0114129_11494525 | 3300009147 | Bacteria | 830 |
| 471 | Ga0114129_11603241 | 3300009147 | Bacteria | 797 |
| 472 | Ga0114129_11765492 | 3300009147 | Bacteria | 753 |
| 473 | Ga0114129_11885200 | 3300009147 | Unclassified | 725 |
| 474 | Ga0114129_12209444 | 3300009147 | Bacteria | 662 |
| 475 | Ga0114129_12297577 | 3300009147 | Bacteria | 647 |
| 476 | Ga0114129_12505978 | 3300009147 | Bacteria | 617 |
| 477 | Ga0114129_12638583 | 3300009147 | Unclassified | 599 |
| 478 | Ga0114129_12895361 | 3300009147 | Bacteria | 568 |
| 479 | Ga0105243_10036845 | 3300009148 | Bacteria | 3799 |
| 480 | Ga0105243_10234734 | 3300009148 | Bacteria | 1629 |
| 481 | Ga0105243_10505644 | 3300009148 | Unclassified | 1146 |
| 482 | Ga0105243_12168724 | 3300009148 | Unclassified | 592 |
| 483 | Ga0105243_12629952 | 3300009148 | Bacteria | 543 |
| 484 | Ga0105241_10078448 | 3300009174 | Unclassified | 2580 |
| 485 | Ga0105241_10134751 | 3300009174 | Bacteria | 2004 |
| 486 | Ga0105241_10173273 | 3300009174 | Bacteria | 1784 |
| 487 | Ga0105241_12574325 | 3300009174 | Unclassified | 511 |
| 488 | Ga0105242_10004376 | 3300009176 | Bacteria | 10987 |
| 489 | Ga0105242_10022073 | 3300009176 | Bacteria | 5002 |
| 490 | Ga0105242_10207341 | 3300009176 | Bacteria | 1744 |
| 491 | Ga0105242_10255142 | 3300009176 | Bacteria | 1582 |
| 492 | Ga0105242_10354094 | 3300009176 | Bacteria | 1357 |
| 493 | Ga0105242_10809110 | 3300009176 | Bacteria | 928 |
| 494 | Ga0105242_11285571 | 3300009176 | Unclassified | 755 |
| 495 | Ga0105248_10001854 | 3300009177 | Bacteria | 23431 |
| 496 | Ga0105248_10006073 | 3300009177 | Bacteria | 13255 |
| 497 | Ga0105248_10018606 | 3300009177 | Bacteria | 7679 |
| 498 | Ga0105248_10163520 | 3300009177 | Bacteria | 2510 |
| 499 | Ga0105248_10197614 | 3300009177 | Bacteria | 2266 |
| 500 | Ga0105248_10342163 | 3300009177 | Bacteria | 1684 |
| 501 | Ga0105248_10379135 | 3300009177 | Bacteria | 1592 |
| 502 | Ga0105248_11059300 | 3300009177 | Bacteria | 916 |
| 503 | Ga0105248_11324105 | 3300009177 | Unclassified | 815 |
| 504 | Ga0105248_13445956 | 3300009177 | Unclassified | 502 |
| 505 | Ga0105238_10469453 | 3300009551 | Unclassified | 1257 |
| 506 | Ga0105238_10522449 | 3300009551 | Bacteria | 1190 |
| 507 | Ga0105238_11723206 | 3300009551 | Unclassified | 658 |
| 508 | Ga0105238_11962004 | 3300009551 | Bacteria | 619 |
| 509 | Ga0105238_12226418 | 3300009551 | Bacteria | 583 |
| 510 | Ga0105249_10000759 | 3300009553 | Bacteria | 28990 |
| 511 | Ga0105249_10015676 | 3300009553 | Bacteria | 6711 |
| 512 | Ga0105249_10113961 | 3300009553 | Bacteria | 2559 |
| 513 | Ga0105249_10116987 | 3300009553 | Bacteria | 2528 |
| 514 | Ga0105249_10205001 | 3300009553 | Unclassified | 1932 |
| 515 | Ga0105249_10256237 | 3300009553 | Unclassified | 1736 |
| 516 | Ga0105249_10341462 | 3300009553 | Bacteria | 1514 |
| 517 | Ga0105249_10357664 | 3300009553 | Bacteria | 1481 |
| 518 | Ga0105249_10474338 | 3300009553 | Bacteria | 1293 |
| 519 | Ga0105249_10618751 | 3300009553 | Bacteria | 1139 |
| 520 | Ga0105249_11383934 | 3300009553 | Unclassified | 775 |
| 521 | Ga0105249_12283063 | 3300009553 | Bacteria | 614 |
| 522 | Ga0105249_13071043 | 3300009553 | Bacteria | 536 |
| 523 | Ga0105239_10246058 | 3300010375 | Bacteria | 2008 |
| 524 | Ga0105239_10410807 | 3300010375 | Bacteria | 1533 |
| 525 | Ga0105239_12802094 | 3300010375 | Bacteria | 569 |
| 526 | Ga0105239_12852507 | 3300010375 | Bacteria | 564 |
| 527 | Ga0105246_10152096 | 3300011119 | Unclassified | 1753 |
| 528 | Ga0105246_10243072 | 3300011119 | Bacteria | 1424 |
| 529 | Ga0105246_10726285 | 3300011119 | Unclassified | 873 |
| 530 | Ga0105246_11593631 | 3300011119 | Bacteria | 617 |
| 531 | Ga0105246_11812800 | 3300011119 | Bacteria | 583 |
| 532 | Ga0157325_1003348 | 3300012485 | Bacteria | 878 |
| 533 | Ga0157315_1032378 | 3300012508 | Bacteria | 621 |
| 534 | Ga0157369_10567572 | 3300013105 | Unclassified | 1172 |
| 535 | Ga0157369_11556625 | 3300013105 | Unclassified | 672 |
| 536 | Ga0157374_10049175 | 3300013296 | Bacteria | 3916 |
| 537 | Ga0157374_10468686 | 3300013296 | Bacteria | 1262 |
| 538 | Ga0157374_11121399 | 3300013296 | Bacteria | 807 |
| 539 | Ga0157374_11376441 | 3300013296 | Unclassified | 728 |
| 540 | Ga0157378_10062396 | 3300013297 | Bacteria | 3328 |
| 541 | Ga0157378_10142479 | 3300013297 | Bacteria | 2227 |
| 542 | Ga0157378_10982844 | 3300013297 | Bacteria | 878 |
| 543 | Ga0157378_11527118 | 3300013297 | Bacteria | 713 |
| 544 | Ga0163162_10028446 | 3300013306 | Bacteria | 5531 |
| 545 | Ga0163162_10031594 | 3300013306 | Bacteria | 5252 |
| 546 | Ga0163162_11004808 | 3300013306 | Unclassified | 943 |
| 547 | Ga0163162_12481914 | 3300013306 | Unclassified | 596 |
| 548 | Ga0157375_10124732 | 3300013308 | Bacteria | 2689 |
| 549 | Ga0157375_10155119 | 3300013308 | Bacteria | 2428 |
| 550 | Ga0157375_10157353 | 3300013308 | Bacteria | 2412 |
| 551 | Ga0157375_10160971 | 3300013308 | Unclassified | 2386 |
| 552 | Ga0157375_10473695 | 3300013308 | Bacteria | 1417 |
| 553 | Ga0157375_10972641 | 3300013308 | Bacteria | 990 |
| 554 | Ga0157375_12577862 | 3300013308 | Unclassified | 607 |
| 555 | Ga0157375_12849071 | 3300013308 | Unclassified | 578 |
| 556 | Ga0163163_10000001 | 3300014325 | Bacteria | 622185 |
| 557 | Ga0163163_10013923 | 3300014325 | Bacteria | 7379 |
| 558 | Ga0163163_10037866 | 3300014325 | Bacteria | 4694 |
| 559 | Ga0163163_10050509 | 3300014325 | Unclassified | 4095 |
| 560 | Ga0163163_10285013 | 3300014325 | Bacteria | 1704 |
| 561 | Ga0163163_10760706 | 3300014325 | Bacteria | 1032 |
| 562 | Ga0163163_11152154 | 3300014325 | Bacteria | 838 |
| 563 | Ga0157380_10038923 | 3300014326 | Bacteria | 3695 |
| 564 | Ga0157380_10049197 | 3300014326 | Bacteria | 3324 |
| 565 | Ga0157380_10199940 | 3300014326 | Bacteria | 1772 |
| 566 | Ga0157380_10522119 | 3300014326 | Bacteria | 1158 |
| 567 | Ga0157380_10585523 | 3300014326 | Bacteria | 1101 |
| 568 | Ga0157380_10678962 | 3300014326 | Bacteria | 1032 |
| 569 | Ga0157380_10722508 | 3300014326 | Unclassified | 1004 |
| 570 | Ga0157380_11890567 | 3300014326 | Unclassified | 657 |
| 571 | Ga0157380_11890717 | 3300014326 | Bacteria | 657 |
| 572 | Ga0157377_10169534 | 3300014745 | Bacteria | 1364 |
| 573 | Ga0157377_10279296 | 3300014745 | Bacteria | 1094 |
| 574 | Ga0157377_10823664 | 3300014745 | Bacteria | 686 |
| 575 | Ga0157377_11036333 | 3300014745 | Bacteria | 624 |
| 576 | Ga0157379_10058271 | 3300014968 | Bacteria | 3453 |
| 577 | Ga0157379_10268217 | 3300014968 | Bacteria | 1552 |
| 578 | Ga0157379_10339214 | 3300014968 | Bacteria | 1374 |
| 579 | Ga0157379_10611574 | 3300014968 | Bacteria | 1018 |
| 580 | Ga0157379_10882223 | 3300014968 | Bacteria | 848 |
| 581 | Ga0157379_11225589 | 3300014968 | Unclassified | 722 |
| 582 | Ga0157379_11285734 | 3300014968 | Bacteria | 706 |
| 583 | Ga0157379_11870104 | 3300014968 | Bacteria | 591 |
| 584 | Ga0157376_10000975 | 3300014969 | Bacteria | 18667 |
| 585 | Ga0157376_10018993 | 3300014969 | Bacteria | 5286 |
| 586 | Ga0157376_10033418 | 3300014969 | Bacteria | 4141 |
| 587 | Ga0157376_10107811 | 3300014969 | Bacteria | 2446 |
| 588 | Ga0157376_10207193 | 3300014969 | Bacteria | 1808 |
| 589 | Ga0157376_10846099 | 3300014969 | Bacteria | 930 |
| 590 | Ga0157376_10941038 | 3300014969 | Bacteria | 884 |
| 591 | Ga0157376_12051121 | 3300014969 | Unclassified | 610 |
| 592 | Ga0163161_10581157 | 3300017792 | Unclassified | 921 |
| 593 | Ga0163161_11883711 | 3300017792 | Unclassified | 532 |
| 594 | Ga0207697_10021594 | 3300025315 | Bacteria | 2635 |
| 595 | Ga0207697_10093293 | 3300025315 | Bacteria | 1277 |
| 596 | Ga0207697_10288768 | 3300025315 | Unclassified | 727 |
| 597 | Ga0207697_10434919 | 3300025315 | Unclassified | 582 |
| 598 | Ga0207656_10206753 | 3300025321 | Bacteria | 950 |
| 599 | Ga0207682_10173375 | 3300025893 | Bacteria | 982 |
| 600 | Ga0207682_10354109 | 3300025893 | Bacteria | 692 |
| 601 | Ga0207682_10424402 | 3300025893 | Unclassified | 629 |
| 602 | Ga0207692_10103471 | 3300025898 | Unclassified | 1568 |
| 603 | Ga0207642_10045161 | 3300025899 | Bacteria | 1954 |
| 604 | Ga0207642_10048782 | 3300025899 | Bacteria | 1900 |
| 605 | Ga0207642_10615902 | 3300025899 | Unclassified | 677 |
| 606 | Ga0207642_10900037 | 3300025899 | Unclassified | 567 |
| 607 | Ga0207710_10173438 | 3300025900 | Bacteria | 1055 |
| 608 | Ga0207688_10051437 | 3300025901 | Bacteria | 2308 |
| 609 | Ga0207688_10066646 | 3300025901 | Bacteria | 2037 |
| 610 | Ga0207688_10362029 | 3300025901 | Bacteria | 895 |
| 611 | Ga0207680_10110962 | 3300025903 | Bacteria | 1779 |
| 612 | Ga0207680_10121829 | 3300025903 | Bacteria | 1707 |
| 613 | Ga0207680_10132869 | 3300025903 | Bacteria | 1642 |
| 614 | Ga0207685_10059226 | 3300025905 | Bacteria | 1509 |
| 615 | Ga0207699_10527210 | 3300025906 | Bacteria | 855 |
| 616 | Ga0207645_10014763 | 3300025907 | Bacteria | 5216 |
| 617 | Ga0207645_10033074 | 3300025907 | Bacteria | 3324 |
| 618 | Ga0207645_10328202 | 3300025907 | Bacteria | 1021 |
| 619 | Ga0207643_10578401 | 3300025908 | Unclassified | 722 |
| 620 | Ga0207643_10627092 | 3300025908 | Bacteria | 693 |
| 621 | Ga0207705_10284554 | 3300025909 | Bacteria | 1266 |
| 622 | Ga0207684_10261399 | 3300025910 | Bacteria | 1494 |
| 623 | Ga0207707_10068249 | 3300025912 | Bacteria | 3098 |
| 624 | Ga0207707_10154287 | 3300025912 | Bacteria | 2008 |
| 625 | Ga0207707_10351315 | 3300025912 | Unclassified | 1270 |
| 626 | Ga0207695_10035373 | 3300025913 | Bacteria | 5418 |
| 627 | Ga0207695_10089434 | 3300025913 | Bacteria | 3096 |
| 628 | Ga0207695_10327086 | 3300025913 | Unclassified | 1422 |
| 629 | Ga0207695_10592111 | 3300025913 | Bacteria | 990 |
| 630 | Ga0207671_11521237 | 3300025914 | Unclassified | 516 |
| 631 | Ga0207663_10623223 | 3300025916 | Unclassified | 849 |
| 632 | Ga0207663_10976093 | 3300025916 | Unclassified | 679 |
| 633 | Ga0207660_10133638 | 3300025917 | Bacteria | 1891 |
| 634 | Ga0207660_10266641 | 3300025917 | Bacteria | 1356 |
| 635 | Ga0207660_10491267 | 3300025917 | Bacteria | 995 |
| 636 | Ga0207657_10005651 | 3300025919 | Bacteria | 13051 |
| 637 | Ga0207657_10037224 | 3300025919 | Bacteria | 4347 |
| 638 | Ga0207657_10856897 | 3300025919 | Bacteria | 701 |
| 639 | Ga0207657_11310633 | 3300025919 | Unclassified | 547 |
| 640 | Ga0207649_10969505 | 3300025920 | Unclassified | 668 |
| 641 | Ga0207649_11462772 | 3300025920 | Bacteria | 541 |
| 642 | Ga0207652_10019576 | 3300025921 | Bacteria | 5569 |
| 643 | Ga0207652_10742537 | 3300025921 | Bacteria | 874 |
| 644 | Ga0207652_10878524 | 3300025921 | Bacteria | 793 |
| 645 | Ga0207652_11018784 | 3300025921 | Bacteria | 727 |
| 646 | Ga0207646_10204636 | 3300025922 | Bacteria | 1783 |
| 647 | Ga0207646_10274494 | 3300025922 | Bacteria | 1524 |
| 648 | Ga0207646_10906412 | 3300025922 | Bacteria | 782 |
| 649 | Ga0207646_11387178 | 3300025922 | Bacteria | 611 |
| 650 | Ga0207646_11441343 | 3300025922 | Bacteria | 598 |
| 651 | Ga0207646_11453198 | 3300025922 | Unclassified | 595 |
| 652 | Ga0207646_11522900 | 3300025922 | Bacteria | 579 |
| 653 | Ga0207646_11759896 | 3300025922 | Unclassified | 531 |
| 654 | Ga0207646_11849867 | 3300025922 | Unclassified | 515 |
| 655 | Ga0207681_10020072 | 3300025923 | Bacteria | 4231 |
| 656 | Ga0207681_10024846 | 3300025923 | Bacteria | 3847 |
| 657 | Ga0207681_10082786 | 3300025923 | Bacteria | 2269 |
| 658 | Ga0207681_10087669 | 3300025923 | Bacteria | 2215 |
| 659 | Ga0207681_10127047 | 3300025923 | Bacteria | 1879 |
| 660 | Ga0207681_10218074 | 3300025923 | Bacteria | 1474 |
| 661 | Ga0207681_10614112 | 3300025923 | Unclassified | 899 |
| 662 | Ga0207681_10802699 | 3300025923 | Bacteria | 786 |
| 663 | Ga0207681_10809420 | 3300025923 | Unclassified | 783 |
| 664 | Ga0207681_11197134 | 3300025923 | Bacteria | 638 |
| 665 | Ga0207694_10331346 | 3300025924 | Unclassified | 1258 |
| 666 | Ga0207694_10845045 | 3300025924 | Unclassified | 774 |
| 667 | Ga0207650_10037631 | 3300025925 | Bacteria | 3527 |
| 668 | Ga0207650_10118528 | 3300025925 | Unclassified | 2058 |
| 669 | Ga0207650_10200894 | 3300025925 | Bacteria | 1597 |
| 670 | Ga0207650_10691293 | 3300025925 | Bacteria | 861 |
| 671 | Ga0207650_11060496 | 3300025925 | Bacteria | 690 |
| 672 | Ga0207650_11460745 | 3300025925 | Unclassified | 581 |
| 673 | Ga0207650_11754857 | 3300025925 | Unclassified | 525 |
| 674 | Ga0207659_10000369 | 3300025926 | Bacteria | 27027 |
| 675 | Ga0207659_10007963 | 3300025926 | Bacteria | 6550 |
| 676 | Ga0207659_10082095 | 3300025926 | Bacteria | 2385 |
| 677 | Ga0207659_10216193 | 3300025926 | Bacteria | 1539 |
| 678 | Ga0207659_10389365 | 3300025926 | Bacteria | 1164 |
| 679 | Ga0207659_10643330 | 3300025926 | Bacteria | 906 |
| 680 | Ga0207659_10660293 | 3300025926 | Bacteria | 894 |
| 681 | Ga0207687_10070843 | 3300025927 | Bacteria | 2490 |
| 682 | Ga0207687_10084042 | 3300025927 | Bacteria | 2306 |
| 683 | Ga0207687_10477791 | 3300025927 | Bacteria | 1037 |
| 684 | Ga0207687_10569671 | 3300025927 | Bacteria | 952 |
| 685 | Ga0207687_10574190 | 3300025927 | Bacteria | 948 |
| 686 | Ga0207687_10695478 | 3300025927 | Bacteria | 863 |
| 687 | Ga0207700_10057909 | 3300025928 | Bacteria | 2924 |
| 688 | Ga0207664_10039362 | 3300025929 | Bacteria | 3671 |
| 689 | Ga0207644_10136083 | 3300025931 | Bacteria | 1886 |
| 690 | Ga0207644_10499348 | 3300025931 | Bacteria | 1003 |
| 691 | Ga0207644_10618614 | 3300025931 | Bacteria | 900 |
| 692 | Ga0207690_10015495 | 3300025932 | Bacteria | 4621 |
| 693 | Ga0207690_10222786 | 3300025932 | Bacteria | 1444 |
| 694 | Ga0207690_10332461 | 3300025932 | Unclassified | 1197 |
| 695 | Ga0207690_10710921 | 3300025932 | Bacteria | 826 |
| 696 | Ga0207706_10052948 | 3300025933 | Bacteria | 3583 |
| 697 | Ga0207706_10322587 | 3300025933 | Bacteria | 1344 |
| 698 | Ga0207706_10469337 | 3300025933 | Unclassified | 1088 |
| 699 | Ga0207706_11236496 | 3300025933 | Unclassified | 619 |
| 700 | Ga0207686_10084333 | 3300025934 | Bacteria | 2081 |
| 701 | Ga0207686_10222307 | 3300025934 | Bacteria | 1364 |
| 702 | Ga0207686_10309817 | 3300025934 | Bacteria | 1175 |
| 703 | Ga0207686_11372945 | 3300025934 | Unclassified | 581 |
| 704 | Ga0207709_10393880 | 3300025935 | Unclassified | 1057 |
| 705 | Ga0207709_10448524 | 3300025935 | Bacteria | 997 |
| 706 | Ga0207709_10688957 | 3300025935 | Bacteria | 817 |
| 707 | Ga0207709_11475678 | 3300025935 | Bacteria | 564 |
| 708 | Ga0207670_10125373 | 3300025936 | Bacteria | 1873 |
| 709 | Ga0207670_10182180 | 3300025936 | Bacteria | 1583 |
| 710 | Ga0207670_10221525 | 3300025936 | Bacteria | 1448 |
| 711 | Ga0207669_10003394 | 3300025937 | Bacteria | 6885 |
| 712 | Ga0207669_10078225 | 3300025937 | Bacteria | 2107 |
| 713 | Ga0207669_10163169 | 3300025937 | Bacteria | 1577 |
| 714 | Ga0207669_10188026 | 3300025937 | Unclassified | 1487 |
| 715 | Ga0207669_10349188 | 3300025937 | Bacteria | 1142 |
| 716 | Ga0207669_10384681 | 3300025937 | Unclassified | 1094 |
| 717 | Ga0207669_10392314 | 3300025937 | Bacteria | 1085 |
| 718 | Ga0207669_10395694 | 3300025937 | Bacteria | 1081 |
| 719 | Ga0207669_10536152 | 3300025937 | Bacteria | 942 |
| 720 | Ga0207669_10546436 | 3300025937 | Bacteria | 934 |
| 721 | Ga0207704_10030711 | 3300025938 | Bacteria | 3016 |
| 722 | Ga0207704_10065142 | 3300025938 | Bacteria | 2280 |
| 723 | Ga0207704_10180091 | 3300025938 | Bacteria | 1526 |
| 724 | Ga0207665_11204934 | 3300025939 | Unclassified | 604 |
| 725 | Ga0207665_11639778 | 3300025939 | Unclassified | 510 |
| 726 | Ga0207691_10012143 | 3300025940 | Bacteria | 8257 |
| 727 | Ga0207691_10017213 | 3300025940 | Bacteria | 6857 |
| 728 | Ga0207691_10206823 | 3300025940 | Bacteria | 1706 |
| 729 | Ga0207691_10339895 | 3300025940 | Bacteria | 1285 |
| 730 | Ga0207691_10350895 | 3300025940 | Bacteria | 1262 |
| 731 | Ga0207691_10789642 | 3300025940 | Unclassified | 798 |
| 732 | Ga0207691_11370236 | 3300025940 | Unclassified | 582 |
| 733 | Ga0207711_10061302 | 3300025941 | Bacteria | 3244 |
| 734 | Ga0207711_10074486 | 3300025941 | Bacteria | 2952 |
| 735 | Ga0207711_10094765 | 3300025941 | Bacteria | 2631 |
| 736 | Ga0207711_10282514 | 3300025941 | Bacteria | 1529 |
| 737 | Ga0207711_10519466 | 3300025941 | Archaea | 1110 |
| 738 | Ga0207711_10555776 | 3300025941 | Bacteria | 1070 |
| 739 | Ga0207711_10623057 | 3300025941 | Bacteria | 1007 |
| 740 | Ga0207711_10642110 | 3300025941 | Bacteria | 990 |
| 741 | Ga0207711_10670017 | 3300025941 | Bacteria | 968 |
| 742 | Ga0207711_11978046 | 3300025941 | Unclassified | 526 |
| 743 | Ga0207689_10078629 | 3300025942 | Bacteria | 2711 |
| 744 | Ga0207689_10388063 | 3300025942 | Bacteria | 1163 |
| 745 | Ga0207689_10874715 | 3300025942 | Bacteria | 758 |
| 746 | Ga0207689_11491632 | 3300025942 | Bacteria | 565 |
| 747 | Ga0207689_11500395 | 3300025942 | Unclassified | 563 |
| 748 | Ga0207661_10008224 | 3300025944 | Bacteria | 7449 |
| 749 | Ga0207661_11274144 | 3300025944 | Bacteria | 676 |
| 750 | Ga0207679_11239940 | 3300025945 | Bacteria | 684 |
| 751 | Ga0207667_10092976 | 3300025949 | Bacteria | 3115 |
| 752 | Ga0207667_10094336 | 3300025949 | Bacteria | 3089 |
| 753 | Ga0207667_10124226 | 3300025949 | Bacteria | 2659 |
| 754 | Ga0207667_10319060 | 3300025949 | Bacteria | 1587 |
| 755 | Ga0207651_10086539 | 3300025960 | Bacteria | 2278 |
| 756 | Ga0207651_10105108 | 3300025960 | Bacteria | 2105 |
| 757 | Ga0207651_10201501 | 3300025960 | Bacteria | 1595 |
| 758 | Ga0207651_10224690 | 3300025960 | Bacteria | 1520 |
| 759 | Ga0207651_10323551 | 3300025960 | Bacteria | 1290 |
| 760 | Ga0207651_10622969 | 3300025960 | Bacteria | 945 |
| 761 | Ga0207712_10010859 | 3300025961 | Bacteria | 5793 |
| 762 | Ga0207712_10016070 | 3300025961 | Bacteria | 4839 |
| 763 | Ga0207712_10177181 | 3300025961 | Bacteria | 1671 |
| 764 | Ga0207712_10417505 | 3300025961 | Bacteria | 1131 |
| 765 | Ga0207712_10506733 | 3300025961 | Bacteria | 1032 |
| 766 | Ga0207712_11215676 | 3300025961 | Unclassified | 672 |
| 767 | Ga0207668_10304233 | 3300025972 | Bacteria | 1317 |
| 768 | Ga0207668_10351114 | 3300025972 | Bacteria | 1233 |
| 769 | Ga0207668_10363917 | 3300025972 | Bacteria | 1213 |
| 770 | Ga0207640_10235018 | 3300025981 | Bacteria | 1413 |
| 771 | Ga0207640_10609991 | 3300025981 | Bacteria | 925 |
| 772 | Ga0207640_10943704 | 3300025981 | Unclassified | 756 |
| 773 | Ga0207640_11735587 | 3300025981 | Unclassified | 564 |
| 774 | Ga0207658_10028089 | 3300025986 | Bacteria | 3960 |
| 775 | Ga0207658_10039016 | 3300025986 | Bacteria | 3425 |
| 776 | Ga0207658_10578996 | 3300025986 | Bacteria | 1007 |
| 777 | Ga0207658_10688700 | 3300025986 | Bacteria | 923 |
| 778 | Ga0207658_10889535 | 3300025986 | Bacteria | 811 |
| 779 | Ga0207677_10025212 | 3300026023 | Bacteria | 3706 |
| 780 | Ga0207677_10042274 | 3300026023 | Bacteria | 3021 |
| 781 | Ga0207677_10066933 | 3300026023 | Bacteria | 2514 |
| 782 | Ga0207677_10089593 | 3300026023 | Bacteria | 2234 |
| 783 | Ga0207677_11888230 | 3300026023 | Bacteria | 555 |
| 784 | Ga0207703_10030316 | 3300026035 | Bacteria | 4274 |
| 785 | Ga0207703_10041243 | 3300026035 | Bacteria | 3696 |
| 786 | Ga0207703_10112437 | 3300026035 | Bacteria | 2326 |
| 787 | Ga0207703_10112933 | 3300026035 | Bacteria | 2322 |
| 788 | Ga0207703_10147524 | 3300026035 | Bacteria | 2048 |
| 789 | Ga0207703_10185001 | 3300026035 | Bacteria | 1841 |
| 790 | Ga0207703_10316335 | 3300026035 | Bacteria | 1428 |
| 791 | Ga0207703_10476287 | 3300026035 | Bacteria | 1169 |
| 792 | Ga0207703_10618217 | 3300026035 | Unclassified | 1026 |
| 793 | Ga0207703_10626199 | 3300026035 | Bacteria | 1019 |
| 794 | Ga0207703_11411492 | 3300026035 | Unclassified | 670 |
| 795 | Ga0207703_12247751 | 3300026035 | Unclassified | 521 |
| 796 | Ga0207678_10893713 | 3300026067 | Bacteria | 785 |
| 797 | Ga0207678_11151830 | 3300026067 | Bacteria | 687 |
| 798 | Ga0207708_10017960 | 3300026075 | Bacteria | 5321 |
| 799 | Ga0207708_10031124 | 3300026075 | Bacteria | 4049 |
| 800 | Ga0207708_10043835 | 3300026075 | Bacteria | 3410 |
| 801 | Ga0207708_10146881 | 3300026075 | Bacteria | 1853 |
| 802 | Ga0207708_10342496 | 3300026075 | Unclassified | 1225 |
| 803 | Ga0207708_10699232 | 3300026075 | Unclassified | 866 |
| 804 | Ga0207708_10764201 | 3300026075 | Bacteria | 830 |
| 805 | Ga0207708_10839177 | 3300026075 | Bacteria | 793 |
| 806 | Ga0207708_11113690 | 3300026075 | Bacteria | 689 |
| 807 | Ga0207702_10149816 | 3300026078 | Unclassified | 2121 |
| 808 | Ga0207702_10225637 | 3300026078 | Bacteria | 1748 |
| 809 | Ga0207702_11291656 | 3300026078 | Unclassified | 724 |
| 810 | Ga0207641_10007212 | 3300026088 | Bacteria | 9265 |
| 811 | Ga0207641_10039403 | 3300026088 | Bacteria | 3952 |
| 812 | Ga0207641_10276475 | 3300026088 | Bacteria | 1578 |
| 813 | Ga0207641_10513476 | 3300026088 | Unclassified | 1165 |
| 814 | Ga0207641_10812096 | 3300026088 | Unclassified | 926 |
| 815 | Ga0207641_10870103 | 3300026088 | Unclassified | 894 |
| 816 | Ga0207641_11915020 | 3300026088 | Unclassified | 594 |
| 817 | Ga0207648_10008247 | 3300026089 | Bacteria | 10112 |
| 818 | Ga0207648_10057142 | 3300026089 | Bacteria | 3404 |
| 819 | Ga0207648_10064974 | 3300026089 | Bacteria | 3181 |
| 820 | Ga0207648_10105600 | 3300026089 | Unclassified | 2471 |
| 821 | Ga0207648_10124554 | 3300026089 | Bacteria | 2267 |
| 822 | Ga0207648_10512303 | 3300026089 | Bacteria | 1099 |
| 823 | Ga0207648_10660207 | 3300026089 | Bacteria | 967 |
| 824 | Ga0207648_11136248 | 3300026089 | Unclassified | 733 |
| 825 | Ga0207648_11545971 | 3300026089 | Unclassified | 624 |
| 826 | Ga0207676_10010212 | 3300026095 | Bacteria | 6679 |
| 827 | Ga0207676_10022988 | 3300026095 | Bacteria | 4592 |
| 828 | Ga0207676_10027803 | 3300026095 | Bacteria | 4217 |
| 829 | Ga0207676_10306785 | 3300026095 | Bacteria | 1451 |
| 830 | Ga0207676_10394300 | 3300026095 | Bacteria | 1292 |
| 831 | Ga0207676_11324151 | 3300026095 | Bacteria | 715 |
| 832 | Ga0207674_10035085 | 3300026116 | Bacteria | 5236 |
| 833 | Ga0207674_10103314 | 3300026116 | Unclassified | 2829 |
| 834 | Ga0207675_100003262 | 3300026118 | Bacteria | 15891 |
| 835 | Ga0207675_100240452 | 3300026118 | Unclassified | 1749 |
| 836 | Ga0207675_100358573 | 3300026118 | Bacteria | 1430 |
| 837 | Ga0207675_100651815 | 3300026118 | Bacteria | 1059 |
| 838 | Ga0207675_101202623 | 3300026118 | Bacteria | 778 |
| 839 | Ga0207683_10141360 | 3300026121 | Bacteria | 2169 |
| 840 | Ga0207683_10285343 | 3300026121 | Bacteria | 1509 |
| 841 | Ga0207698_10389892 | 3300026142 | Bacteria | 1328 |
| 842 | Ga0207698_10772378 | 3300026142 | Bacteria | 961 |
| 843 | Ga0207698_11425557 | 3300026142 | Bacteria | 708 |
| 844 | Ga0209971_1029609 | 3300027682 | Bacteria | 1311 |
| 845 | Ga0209813_10018216 | 3300027866 | Bacteria | 1937 |
| 846 | Ga0209813_10030413 | 3300027866 | Bacteria | 1587 |
| 847 | Ga0209813_10176690 | 3300027866 | Bacteria | 779 |
| 848 | Ga0207428_10002391 | 3300027907 | Bacteria | 18750 |
| 849 | Ga0207428_10003247 | 3300027907 | Bacteria | 15845 |
| 850 | Ga0207428_10032210 | 3300027907 | Bacteria | 4314 |
| 851 | Ga0207428_10375974 | 3300027907 | Bacteria | 1043 |
| 852 | Ga0207428_10898141 | 3300027907 | Bacteria | 626 |
| 853 | Ga0268266_10135488 | 3300028379 | Bacteria | 2205 |
| 854 | Ga0268266_10362223 | 3300028379 | Bacteria | 1364 |
| 855 | Ga0268266_10651773 | 3300028379 | Bacteria | 1013 |
| 856 | Ga0268266_11048943 | 3300028379 | Bacteria | 789 |
| 857 | Ga0268266_11458153 | 3300028379 | Bacteria | 660 |
| 858 | Ga0268265_10003607 | 3300028380 | Bacteria | 11058 |
| 859 | Ga0268265_10015652 | 3300028380 | Bacteria | 5193 |
| 860 | Ga0268265_10040186 | 3300028380 | Bacteria | 3453 |
| 861 | Ga0268265_10046425 | 3300028380 | Bacteria | 3247 |
| 862 | Ga0268265_10051494 | 3300028380 | Bacteria | 3108 |
| 863 | Ga0268265_10114997 | 3300028380 | Bacteria | 2204 |
| 864 | Ga0268265_10120559 | 3300028380 | Bacteria | 2160 |
| 865 | Ga0268265_10187309 | 3300028380 | Bacteria | 1784 |
| 866 | Ga0268265_10354849 | 3300028380 | Unclassified | 1340 |
| 867 | Ga0268265_10695667 | 3300028380 | Bacteria | 982 |
| 868 | Ga0268265_11920751 | 3300028380 | Unclassified | 599 |
| 869 | Ga0268265_12241757 | 3300028380 | Bacteria | 553 |
| 870 | Ga0268265_12360337 | 3300028380 | Unclassified | 538 |
| 871 | Ga0268265_12471776 | 3300028380 | Unclassified | 526 |
| 872 | Ga0268264_10004922 | 3300028381 | Bacteria | 11318 |
| 873 | Ga0268264_10243636 | 3300028381 | Bacteria | 1666 |
| 874 | Ga0268264_10381813 | 3300028381 | Bacteria | 1349 |
| 875 | Ga0268264_10410468 | 3300028381 | Bacteria | 1304 |
| 876 | Ga0268264_11951195 | 3300028381 | Unclassified | 596 |
| 877 | Ga0268264_12240349 | 3300028381 | Unclassified | 554 |
| 878 | Ga0307511_10250473 | 3300030521 | Bacteria | 852 |
| 879 | Ga0265332_10254341 | 3300031238 | Bacteria | 726 |
| 880 | Ga0265328_10036845 | 3300031239 | Bacteria | 1807 |
| 881 | Ga0265325_10211375 | 3300031241 | Bacteria | 891 |
| 882 | Ga0265339_10100403 | 3300031249 | Bacteria | 1507 |
| 883 | Ga0265316_10044113 | 3300031344 | Bacteria | 3548 |
| 884 | Ga0307408_100324684 | 3300031548 | Unclassified | 1298 |
| 885 | Ga0307408_100392565 | 3300031548 | Bacteria | 1189 |
| 886 | Ga0307408_100966632 | 3300031548 | Unclassified | 783 |
| 887 | Ga0307408_101189041 | 3300031548 | Bacteria | 711 |
| 888 | Ga0307408_101199525 | 3300031548 | Bacteria | 708 |
| 889 | Ga0307408_101239770 | 3300031548 | Bacteria | 697 |
| 890 | Ga0307408_101481337 | 3300031548 | Bacteria | 641 |
| 891 | Ga0265314_10344605 | 3300031711 | Bacteria | 822 |
| 892 | Ga0265342_10038270 | 3300031712 | Bacteria | 2922 |
| 893 | Ga0307405_10205354 | 3300031731 | Bacteria | 1434 |
| 894 | Ga0307405_11228519 | 3300031731 | Bacteria | 649 |
| 895 | Ga0307413_10292918 | 3300031824 | Bacteria | 1230 |
| 896 | Ga0307413_12031097 | 3300031824 | Unclassified | 519 |
| 897 | Ga0307410_10052205 | 3300031852 | Bacteria | 2760 |
| 898 | Ga0307410_10079571 | 3300031852 | Unclassified | 2297 |
| 899 | Ga0307406_10360932 | 3300031901 | Bacteria | 1139 |
| 900 | Ga0307406_11086012 | 3300031901 | Unclassified | 690 |
| 901 | Ga0307406_11838811 | 3300031901 | Unclassified | 539 |
| 902 | Ga0307407_10274800 | 3300031903 | Bacteria | 1164 |
| 903 | Ga0307412_10431170 | 3300031911 | Bacteria | 1081 |
| 904 | Ga0307412_11082123 | 3300031911 | Unclassified | 712 |
| 905 | Ga0307412_11335117 | 3300031911 | Bacteria | 647 |
| 906 | Ga0307409_100088819 | 3300031995 | Bacteria | 2524 |
| 907 | Ga0307409_100243458 | 3300031995 | Bacteria | 1639 |
| 908 | Ga0307409_100630369 | 3300031995 | Unclassified | 1063 |
| 909 | Ga0307409_100881331 | 3300031995 | Bacteria | 907 |
| 910 | Ga0307416_100006416 | 3300032002 | Bacteria | 7363 |
| 911 | Ga0307416_100149210 | 3300032002 | Unclassified | 2141 |
| 912 | Ga0307416_100774534 | 3300032002 | Bacteria | 1053 |
| 913 | Ga0307416_101233158 | 3300032002 | Unclassified | 854 |
| 914 | Ga0307416_101505040 | 3300032002 | Unclassified | 779 |
| 915 | Ga0307416_103873736 | 3300032002 | Unclassified | 501 |
| 916 | Ga0307414_10078781 | 3300032004 | Unclassified | 2403 |
| 917 | Ga0307414_10942263 | 3300032004 | Bacteria | 793 |
| 918 | Ga0307411_10027368 | 3300032005 | Bacteria | 3449 |
| 919 | Ga0307411_10227592 | 3300032005 | Unclassified | 1451 |
| 920 | Ga0307411_10554758 | 3300032005 | Bacteria | 981 |
| 921 | Ga0307415_100320355 | 3300032126 | Bacteria | 1292 |
| 922 | Ga0373934_0136435 | 3300035086 | Bacteria | 1002 |
| 923 | Ga0373944_0067432 | 3300035089 | Bacteria | 1159 |
| 924 | Ga0373952_0067810 | 3300035092 | Bacteria | 886 |
| 925 | Ga0373932_0132278 | 3300035112 | Bacteria | 842 |
| 926 | Ga0373939_0223877 | 3300035114 | Bacteria | 721 |
| 927 | Ga0373941_0020831 | 3300035115 | Bacteria | 1843 |
| 928 | Ga0373953_0095967 | 3300035117 | Unclassified | 1244 |
| 929 | Ga0373954_0464738 | 3300035118 | Unclassified | 627 |
| 930 | Ga0373956_0062577 | 3300035119 | Bacteria | 1687 |
| 931 | Ga0373956_0550643 | 3300035119 | Unclassified | 551 |
| 932 | Ga0373957_0243770 | 3300035120 | Bacteria | 755 |
| 933 | Ga0373943_0396005 | 3300035170 | Unclassified | 797 |
| 934 | Ga0373943_0409810 | 3300035170 | Bacteria | 783 |
| 935 | Ga0373946_0187164 | 3300035171 | Bacteria | 985 |
| 936 | Ga0373946_0206811 | 3300035171 | Bacteria | 942 |
| 937 | Ga0373946_0489077 | 3300035171 | Bacteria | 630 |
| 938 | Ga0373955_0182192 | 3300035172 | Unclassified | 1247 |
| 939 | Ga0373942_0235875 | 3300035207 | Bacteria | 617 |
| 940 | Ga0373961_0185002 | 3300035241 | Bacteria | 727 |
| 941 | Ga0373962_0010098 | 3300035242 | Bacteria | 2348 |
| 942 | Ga0373924_0417055 | 3300035410 | Bacteria | 601 |
| 943 | Ga0373935_0141045 | 3300035692 | Bacteria | 1628 |
| 944 | Ga0373935_0406277 | 3300035692 | Bacteria | 979 |
| 945 | Ga0373935_1130831 | 3300035692 | Unclassified | 583 |
| 946 | Ga0373927_0294309 | 3300035695 | Bacteria | 1068 |
| 947 | Ga0373933_0314609 | 3300035724 | Bacteria | 1015 |
| 948 | Ga0373933_0323342 | 3300035724 | Bacteria | 1000 |
| 949 | Ga0373933_0442611 | 3300035724 | Bacteria | 850 |
| 950 | Ga0373947_0045408 | 3300035725 | Bacteria | 2629 |
| 951 | Ga0373947_0508393 | 3300035725 | Unclassified | 819 |
| 952 | Ga0373937_0156997 | 3300036401 | Bacteria | 2133 |
| 953 | Ga0373937_0390185 | 3300036401 | Bacteria | 1321 |
| 954 | Ga0373937_0394018 | 3300036401 | Unclassified | 1314 |
| 955 | Ga0373937_0553235 | 3300036401 | Unclassified | 1093 |
| 956 | Ga0373937_0572791 | 3300036401 | Bacteria | 1072 |
| 957 | Ga0373937_0589532 | 3300036401 | Bacteria | 1055 |
| 958 | Ga0373937_0774386 | 3300036401 | Bacteria | 907 |
| 959 | Ga0373937_0868381 | 3300036401 | Bacteria | 851 |
| 960 | Ga0373925_0141686 | 3300037068 | Bacteria | 1882 |
| 961 | Ga0373925_0502191 | 3300037068 | Bacteria | 996 |
| 962 | Ga0395898_0657269 | 3300037466 | Bacteria | 991 |
| 963 | Ga0395905_0126645 | 3300037471 | Bacteria | 2402 |
| 964 | Ga0395901_0419786 | 3300038443 | Bacteria | 1372 |
| 965 | Ga0395901_1199526 | 3300038443 | Bacteria | 725 |
| 966 | Ga0439461_0041338 | 3300041410 | Unclassified | 997 |
| 967 | Ga0439461_0210524 | 3300041410 | Unclassified | 526 |
| 968 | Ga0451802_1678584 | 3300041460 | Bacteria | 753 |
| 969 | Ga0451802_1910756 | 3300041460 | Bacteria | 1243 |
| 970 | Ga0451807_0062462 | 3300041486 | Unclassified | 841 |
| 971 | Ga0451851_1214807 | 3300041507 | Unclassified | 522 |
| 972 | Ga0451853_1119114 | 3300041512 | Bacteria | 797 |
| 973 | Ga0451853_3468293 | 3300041512 | Unclassified | 698 |
| 974 | Ga0439431_0014634 | 3300041997 | Bacteria | 1820 |
| 975 | Ga0439433_0010796 | 3300041999 | Bacteria | 1997 |
| 976 | Ga0439445_0140531 | 3300042004 | Bacteria | 700 |
| 977 | Ga0439449_0213054 | 3300042007 | Bacteria | 724 |
| 978 | Ga0439454_024460 | 3300042011 | Unclassified | 912 |
| 979 | Ga0439456_095693 | 3300042013 | Bacteria | 670 |
| 980 | Ga0439457_109036 | 3300042014 | Bacteria | 649 |
| 981 | Ga0439462_0132078 | 3300042015 | Bacteria | 697 |
| 982 | Ga0450892_009984 | 3300042130 | Bacteria | 827 |
| 983 | Ga0450889_005880 | 3300042144 | Unclassified | 1227 |
| 984 | Ga0439446_0018109 | 3300042156 | Bacteria | 1970 |
| 985 | Ga0439446_0246314 | 3300042156 | Viruses | 615 |
| 986 | Ga0439446_0370131 | 3300042156 | Unclassified | 513 |
| 987 | Ga0439435_0031586 | 3300042436 | Unclassified | 1441 |
| 988 | Ga0439435_0081378 | 3300042436 | Bacteria | 972 |
| 989 | Ga0439435_0092857 | 3300042436 | Unclassified | 919 |
| 990 | Ga0439435_0205670 | 3300042436 | Unclassified | 651 |
| 991 | Ga0439460_0029458 | 3300042461 | Unclassified | 1554 |
| 992 | Ga0439460_0085754 | 3300042461 | Bacteria | 994 |
| 993 | Ga0439460_0109076 | 3300042461 | Bacteria | 896 |
| 994 | Ga0439460_0168790 | 3300042461 | Bacteria | 736 |
| 995 | Ga0451576_0017400 | 3300045051 | Bacteria | 7904 |
| 996 | Ga0451576_0355762 | 3300045051 | Unclassified | 1533 |
| 997 | Ga0451576_0508735 | 3300045051 | Bacteria | 1265 |
| 998 | Ga0451576_1519312 | 3300045051 | Unclassified | 695 |
| 999 | Ga0466967_0326134 | 3300045976 | Bacteria | 1482 |
| 1000 | Ga0466967_0514393 | 3300045976 | Bacteria | 1176 |
| 1001 | Ga0466967_1051907 | 3300045976 | Bacteria | 811 |
| 1002 | Ga0495592_0045114 | 3300046454 | Bacteria | 3290 |
| 1003 | Ga0495592_0277687 | 3300046454 | Bacteria | 1097 |
| 1004 | Ga0495603_0366880 | 3300046455 | Bacteria | 826 |
| 1005 | Ga0495629_0048860 | 3300046459 | Bacteria | 2966 |
| 1006 | Ga0495629_0195894 | 3300046459 | Bacteria | 1397 |
| 1007 | Ga0495638_0008188 | 3300046460 | Bacteria | 7433 |
| 1008 | Ga0495638_0159524 | 3300046460 | Bacteria | 1302 |
| 1009 | Ga0495651_0734815 | 3300046462 | Unclassified | 613 |
| 1010 | Ga0495651_0835005 | 3300046462 | Bacteria | 567 |
| 1011 | Ga0495580_0203587 | 3300046472 | Bacteria | 1363 |
| 1012 | Ga0495580_0650506 | 3300046472 | Bacteria | 693 |
| 1013 | Ga0495580_0825510 | 3300046472 | Unclassified | 600 |
| 1014 | Ga0495580_1051214 | 3300046472 | Unclassified | 517 |
| 1015 | Ga0495582_0095929 | 3300046473 | Bacteria | 1657 |
| 1016 | Ga0495582_0197190 | 3300046473 | Bacteria | 1149 |
| 1017 | Ga0495582_0417583 | 3300046473 | Bacteria | 774 |
| 1018 | Ga0495582_0744393 | 3300046473 | Unclassified | 567 |
| 1019 | Ga0495582_0892158 | 3300046473 | Unclassified | 514 |
| 1020 | Ga0495639_0074404 | 3300046475 | Bacteria | 1574 |
| 1021 | Ga0495639_0350812 | 3300046475 | Bacteria | 741 |
| 1022 | Ga0495662_0356181 | 3300046476 | Unclassified | 719 |
| 1023 | Ga0495662_0411683 | 3300046476 | Unclassified | 664 |
| 1024 | Ga0495664_0805455 | 3300046477 | Unclassified | 552 |
| 1025 | Ga0495584_0176894 | 3300046491 | Bacteria | 1085 |
| 1026 | Ga0495585_0407997 | 3300046492 | Bacteria | 654 |
| 1027 | Ga0495594_0005857 | 3300046499 | Bacteria | 6316 |
| 1028 | Ga0495608_0002617 | 3300046511 | Bacteria | 12929 |
| 1029 | Ga0495608_0259263 | 3300046511 | Bacteria | 1083 |
| 1030 | Ga0495628_0040510 | 3300046516 | Bacteria | 3722 |
| 1031 | Ga0495628_0151710 | 3300046516 | Bacteria | 1765 |
| 1032 | Ga0495628_0308217 | 3300046516 | Bacteria | 1171 |
| 1033 | Ga0495630_0015118 | 3300046517 | Bacteria | 5632 |
| 1034 | Ga0495630_0986396 | 3300046517 | Unclassified | 640 |
| 1035 | Ga0495643_0114733 | 3300046522 | Bacteria | 1366 |
| 1036 | Ga0495663_0117327 | 3300046525 | Bacteria | 889 |
| 1037 | Ga0495652_0212949 | 3300046529 | Bacteria | 1457 |
| 1038 | Ga0495652_0618131 | 3300046529 | Bacteria | 737 |
| 1039 | Ga0495665_0053238 | 3300046531 | Bacteria | 2141 |
| 1040 | Ga0495640_0241382 | 3300046533 | Unclassified | 1134 |
| 1041 | Ga0495640_0531115 | 3300046533 | Bacteria | 714 |
| 1042 | Ga0495586_0352909 | 3300046535 | Unclassified | 845 |
| 1043 | Ga0495587_0015255 | 3300046536 | Bacteria | 4800 |
| 1044 | Ga0495587_0465028 | 3300046536 | Unclassified | 700 |
| 1045 | Ga0495587_0491462 | 3300046536 | Unclassified | 679 |
| 1046 | Ga0495645_0001484 | 3300046543 | Bacteria | 15885 |
| 1047 | Ga0495645_0006999 | 3300046543 | Bacteria | 7844 |
| 1048 | Ga0495645_0088034 | 3300046543 | Bacteria | 2221 |
| 1049 | Ga0495633_0505859 | 3300046558 | Bacteria | 545 |
| 1050 | Ga0495667_0015027 | 3300046559 | Bacteria | 5227 |
| 1051 | Ga0495667_0221803 | 3300046559 | Bacteria | 1206 |
| 1052 | Ga0495667_0224475 | 3300046559 | Bacteria | 1198 |
| 1053 | Ga0495667_0276447 | 3300046559 | Bacteria | 1066 |
| 1054 | Ga0495667_0395679 | 3300046559 | Bacteria | 870 |
| 1055 | Ga0495656_0463212 | 3300046615 | Unclassified | 669 |
| 1056 | Ga0495668_0846099 | 3300046616 | Bacteria | 507 |
| 1057 | Ga0495634_0048319 | 3300046642 | Bacteria | 2865 |
| 1058 | Ga0495634_0336374 | 3300046642 | Bacteria | 906 |
| 1059 | Ga0495634_0641132 | 3300046642 | Bacteria | 614 |
| 1060 | Ga0495635_0241998 | 3300046663 | Bacteria | 1217 |
| 1061 | Ga0495635_0332038 | 3300046663 | Bacteria | 1016 |
| 1062 | Ga0495635_0685285 | 3300046663 | Archaea | 665 |
| 1063 | Ga0495659_0447166 | 3300046664 | Bacteria | 562 |
| 1064 | Ga0495659_0499212 | 3300046664 | Unclassified | 533 |
| 1065 | Ga0495599_0091975 | 3300046678 | Unclassified | 1893 |
| 1066 | Ga0495647_0053986 | 3300046681 | Bacteria | 1569 |
| 1067 | Ga0495647_0099209 | 3300046681 | Bacteria | 1204 |
| 1068 | Ga0495647_0164920 | 3300046681 | Bacteria | 956 |
| 1069 | Ga0495658_0130434 | 3300046683 | Unclassified | 1529 |
| 1070 | Ga0495658_0154332 | 3300046683 | Bacteria | 1412 |
| 1071 | Ga0495658_0357296 | 3300046683 | Bacteria | 929 |
| 1072 | Ga0495658_0801538 | 3300046683 | Bacteria | 603 |
| 1073 | Ga0495669_0004290 | 3300046684 | Bacteria | 5883 |
| 1074 | Ga0495669_0099320 | 3300046684 | Bacteria | 1351 |
| 1075 | Ga0495669_0546106 | 3300046684 | Bacteria | 564 |
| 1076 | Ga0495613_0000460 | 3300046689 | Bacteria | 34834 |
| 1077 | Ga0495613_0060053 | 3300046689 | Bacteria | 2786 |
| 1078 | Ga0495613_0140910 | 3300046689 | Bacteria | 1723 |
| 1079 | Ga0495670_0401213 | 3300046691 | Bacteria | 741 |
| 1080 | Ga0495649_0515104 | 3300046694 | Unclassified | 594 |
| 1081 | Ga0495589_0503081 | 3300046794 | Unclassified | 553 |
| 1082 | Ga0495600_0064883 | 3300046809 | Bacteria | 2387 |
| 1083 | Ga0495600_0147941 | 3300046809 | Bacteria | 1522 |
| 1084 | Ga0495581_0111288 | 3300047315 | Unclassified | 1593 |
| 1085 | Ga0495581_0614559 | 3300047315 | Unclassified | 629 |
| 1086 | Ga0495604_0022896 | 3300047317 | Bacteria | 4986 |
| 1087 | Ga0495604_0134806 | 3300047317 | Bacteria | 1771 |
| 1088 | Ga0495674_0204527 | 3300047319 | Bacteria | 1637 |
| 1089 | Ga0495674_0258680 | 3300047319 | Unclassified | 1431 |
| 1090 | Ga0495674_0313575 | 3300047319 | Unclassified | 1279 |
| 1091 | Ga0495680_0558833 | 3300047322 | Bacteria | 770 |
| 1092 | Ga0495675_0086686 | 3300047444 | Bacteria | 1968 |
| 1093 | Ga0495684_0000011 | 3300047471 | Bacteria | 195144 |
| 1094 | Ga0495684_0055859 | 3300047471 | Bacteria | 3011 |
| 1095 | Ga0495684_0500086 | 3300047471 | Unclassified | 836 |
| 1096 | Ga0495602_1163738 | 3300048088 | Unclassified | 504 |
| 1097 | Ga0496100_0695619 | 3300048903 | Unclassified | 793 |
| 1098 | Ga0496101_0405539 | 3300048904 | Unclassified | 1074 |
| 1099 | Ga0496101_0535281 | 3300048904 | Unclassified | 926 |
| 1100 | Ga0496101_0739857 | 3300048904 | Bacteria | 776 |
| 1101 | Ga0496101_0806585 | 3300048904 | Bacteria | 740 |
| 1102 | Ga0496101_1327019 | 3300048904 | Unclassified | 562 |
| 1103 | Ga0496102_0263543 | 3300048905 | Bacteria | 1625 |
| 1104 | Ga0496102_0503062 | 3300048905 | Bacteria | 1134 |
| 1105 | Ga0496102_1892127 | 3300048905 | Unclassified | 513 |
| 1106 | Ga0496104_0008562 | 3300048907 | Bacteria | 9097 |
| 1107 | Ga0496104_0071068 | 3300048907 | Unclassified | 3309 |
| 1108 | Ga0496104_0190219 | 3300048907 | Bacteria | 1964 |
| 1109 | Ga0496104_0978782 | 3300048907 | Bacteria | 750 |
| 1110 | Ga0496105_0083175 | 3300048908 | Unclassified | 2644 |
| 1111 | Ga0496105_0118197 | 3300048908 | Bacteria | 2187 |
| 1112 | Ga0496105_0324119 | 3300048908 | Bacteria | 1234 |
| 1113 | Ga0496106_0040608 | 3300048909 | Bacteria | 3485 |
| 1114 | Ga0496106_0159914 | 3300048909 | Unclassified | 1781 |
| 1115 | Ga0496106_0324981 | 3300048909 | Bacteria | 1235 |
| 1116 | Ga0496106_0730059 | 3300048909 | Bacteria | 788 |
| 1117 | Ga0496106_1180855 | 3300048909 | Bacteria | 597 |
| 1118 | Ga0496107_0076223 | 3300048910 | Bacteria | 2442 |
| 1119 | Ga0496107_0620004 | 3300048910 | Unclassified | 799 |
| 1120 | Ga0496108_0029035 | 3300048911 | Bacteria | 4577 |
| 1121 | Ga0496109_0007883 | 3300048912 | Bacteria | 9025 |
| 1122 | Ga0496109_0052940 | 3300048912 | Bacteria | 3701 |
| 1123 | Ga0496109_0225536 | 3300048912 | Unclassified | 1763 |
| 1124 | Ga0496109_1006808 | 3300048912 | Unclassified | 771 |
| 1125 | Ga0496109_1988281 | 3300048912 | Unclassified | 513 |
| 1126 | Ga0496110_0004692 | 3300048913 | Bacteria | 10630 |
| 1127 | Ga0496110_0158049 | 3300048913 | Bacteria | 2054 |
| 1128 | Ga0496110_0363689 | 3300048913 | Bacteria | 1318 |
| 1129 | Ga0496110_0851591 | 3300048913 | Bacteria | 817 |
| 1130 | Ga0496111_0018955 | 3300048914 | Bacteria | 4770 |
| 1131 | Ga0496111_0440325 | 3300048914 | Bacteria | 962 |
| 1132 | Ga0496112_0009593 | 3300048915 | Bacteria | 8730 |
| 1133 | Ga0496112_0051911 | 3300048915 | Unclassified | 4023 |
| 1134 | Ga0496112_0250188 | 3300048915 | Bacteria | 1723 |
| 1135 | Ga0496112_1094059 | 3300048915 | Unclassified | 715 |
| 1136 | Ga0496112_1183391 | 3300048915 | Unclassified | 681 |
| 1137 | Ga0496113_0010835 | 3300048916 | Bacteria | 6050 |
| 1138 | Ga0496113_0713246 | 3300048916 | Unclassified | 800 |
| 1139 | Ga0496114_0020936 | 3300048917 | Bacteria | 5313 |
| 1140 | Ga0496114_0207454 | 3300048917 | Bacteria | 1718 |
| 1141 | Ga0496114_0446878 | 3300048917 | Bacteria | 1145 |
| 1142 | Ga0496114_0459142 | 3300048917 | Bacteria | 1128 |
| 1143 | Ga0496114_0499461 | 3300048917 | Bacteria | 1076 |
| 1144 | Ga0496115_0111356 | 3300048918 | Bacteria | 2249 |
| 1145 | Ga0501296_068390 | 3300049519 | Unclassified | 547 |
| 1146 | Ga0501299_220721 | 3300049522 | Unclassified | 512 |
| 1147 | Ga0501032_0405350 | 3300049569 | Unclassified | 876 |
| 1148 | Ga0501036_0085962 | 3300049572 | Bacteria | 2659 |
| 1149 | Ga0501036_0096073 | 3300049572 | Unclassified | 2505 |
| 1150 | Ga0501036_0214944 | 3300049572 | Unclassified | 1615 |
| 1151 | Ga0501036_0390320 | 3300049572 | Bacteria | 1161 |
| 1152 | Ga0501036_1547782 | 3300049572 | Unclassified | 536 |
| 1153 | Ga0501039_0042891 | 3300049575 | Bacteria | 3495 |
| 1154 | Ga0501039_0081481 | 3300049575 | Bacteria | 2520 |
| 1155 | Ga0501039_1024109 | 3300049575 | Bacteria | 641 |
| 1156 | Ga0501040_0081902 | 3300049576 | Bacteria | 2237 |
| 1157 | Ga0501040_0401635 | 3300049576 | Bacteria | 984 |
| 1158 | Ga0501040_0808401 | 3300049576 | Unclassified | 678 |
| 1159 | Ga0501040_1331680 | 3300049576 | Bacteria | 521 |
| 1160 | Ga0501041_0050172 | 3300049577 | Bacteria | 2543 |
| 1161 | Ga0501041_0065202 | 3300049577 | Bacteria | 2231 |
| 1162 | Ga0501041_0077878 | 3300049577 | Unclassified | 2040 |
| 1163 | Ga0501041_0178885 | 3300049577 | Unclassified | 1328 |
| 1164 | Ga0501041_0208371 | 3300049577 | Unclassified | 1226 |
| 1165 | Ga0501041_0216867 | 3300049577 | Bacteria | 1201 |
| 1166 | Ga0501041_0558089 | 3300049577 | Bacteria | 730 |
| 1167 | Ga0501041_0681295 | 3300049577 | Bacteria | 658 |
| 1168 | Ga0501042_0044862 | 3300049578 | Bacteria | 3150 |
| 1169 | Ga0501042_0091952 | 3300049578 | Bacteria | 2178 |
| 1170 | Ga0501042_0140840 | 3300049578 | Bacteria | 1739 |
| 1171 | Ga0501042_0245811 | 3300049578 | Bacteria | 1291 |
| 1172 | Ga0501042_0556675 | 3300049578 | Bacteria | 833 |
| 1173 | Ga0501042_0691570 | 3300049578 | Unclassified | 742 |
| 1174 | Ga0501043_0654737 | 3300049579 | Bacteria | 771 |
| 1175 | Ga0501043_1073480 | 3300049579 | Bacteria | 570 |
| 1176 | Ga0501046_0456555 | 3300049580 | Bacteria | 918 |
| 1177 | Ga0501046_0868996 | 3300049580 | Unclassified | 630 |
| 1178 | Ga0501046_1014923 | 3300049580 | Bacteria | 575 |
| 1179 | Ga0501047_0965959 | 3300049581 | Bacteria | 665 |
| 1180 | Ga0501048_0126263 | 3300049582 | Bacteria | 1809 |
| 1181 | Ga0501048_0682498 | 3300049582 | Unclassified | 737 |
| 1182 | Ga0501048_0713459 | 3300049582 | Unclassified | 720 |
| 1183 | Ga0501048_0822114 | 3300049582 | Unclassified | 668 |
| 1184 | Ga0501067_0349988 | 3300049583 | Bacteria | 824 |
| 1185 | Ga0501068_0413061 | 3300049584 | Bacteria | 871 |
| 1186 | Ga0501068_0434109 | 3300049584 | Bacteria | 849 |
| 1187 | Ga0501069_0179706 | 3300049585 | Bacteria | 1223 |
| 1188 | Ga0501071_0031106 | 3300049587 | Bacteria | 3781 |
| 1189 | Ga0501071_0098787 | 3300049587 | Bacteria | 2151 |
| 1190 | Ga0501071_0227948 | 3300049587 | Bacteria | 1403 |
| 1191 | Ga0501071_0231381 | 3300049587 | Bacteria | 1392 |
| 1192 | Ga0501071_0695411 | 3300049587 | Bacteria | 783 |
| 1193 | Ga0501071_0756575 | 3300049587 | Unclassified | 749 |
| 1194 | Ga0501072_0016297 | 3300049588 | Bacteria | 5702 |
| 1195 | Ga0501072_0042793 | 3300049588 | Unclassified | 3558 |
| 1196 | Ga0501072_0139036 | 3300049588 | Bacteria | 1936 |
| 1197 | Ga0501072_0236472 | 3300049588 | Unclassified | 1455 |
| 1198 | Ga0501072_0248440 | 3300049588 | Unclassified | 1417 |
| 1199 | Ga0501073_0249406 | 3300049589 | Unclassified | 1225 |
| 1200 | Ga0501073_0395639 | 3300049589 | Bacteria | 955 |
| 1201 | Ga0501074_0314297 | 3300049590 | Unclassified | 1113 |
| 1202 | Ga0501074_0359698 | 3300049590 | Bacteria | 1033 |
| 1203 | Ga0501075_0025120 | 3300049591 | Bacteria | 4376 |
| 1204 | Ga0501075_0042269 | 3300049591 | Bacteria | 3417 |
| 1205 | Ga0501075_0115421 | 3300049591 | Bacteria | 2042 |
| 1206 | Ga0501075_0159458 | 3300049591 | Bacteria | 1721 |
| 1207 | Ga0501075_0300054 | 3300049591 | Bacteria | 1224 |
| 1208 | Ga0501075_0456567 | 3300049591 | Bacteria | 974 |
| 1209 | Ga0501075_0616205 | 3300049591 | Bacteria | 828 |
| 1210 | Ga0501075_0952764 | 3300049591 | Bacteria | 652 |
| 1211 | Ga0501076_0029060 | 3300049592 | Bacteria | 4297 |
| 1212 | Ga0501076_0033584 | 3300049592 | Bacteria | 4006 |
| 1213 | Ga0501076_0046014 | 3300049592 | Bacteria | 3447 |
| 1214 | Ga0501076_0055767 | 3300049592 | Bacteria | 3134 |
| 1215 | Ga0501076_0140625 | 3300049592 | Unclassified | 1961 |
| 1216 | Ga0501076_0171493 | 3300049592 | Bacteria | 1768 |
| 1217 | Ga0501076_0225615 | 3300049592 | Bacteria | 1531 |
| 1218 | Ga0501076_0476171 | 3300049592 | Bacteria | 1029 |
| 1219 | Ga0501076_0540538 | 3300049592 | Unclassified | 961 |
| 1220 | Ga0501076_0774979 | 3300049592 | Bacteria | 791 |
| 1221 | Ga0501077_0358434 | 3300049593 | Bacteria | 931 |
| 1222 | Ga0501077_0666823 | 3300049593 | Bacteria | 668 |
| 1223 | Ga0501202_148057 | 3300049652 | Bacteria | 612 |
| 1224 | Ga0501233_088484 | 3300049668 | Unclassified | 806 |
| 1225 | Ga0501221_123152 | 3300049704 | Bacteria | 664 |
| 1226 | Ga0501079_0053476 | 3300049741 | Bacteria | 3115 |
| 1227 | Ga0501079_0087881 | 3300049741 | Bacteria | 2406 |
| 1228 | Ga0501079_0094223 | 3300049741 | Bacteria | 2320 |
| 1229 | Ga0501079_0140282 | 3300049741 | Bacteria | 1883 |
| 1230 | Ga0501079_0190006 | 3300049741 | Bacteria | 1603 |
| 1231 | Ga0501079_0464306 | 3300049741 | Bacteria | 994 |
| 1232 | Ga0501079_1310383 | 3300049741 | Unclassified | 570 |
| 1233 | Ga0501080_0349522 | 3300049742 | Bacteria | 1335 |
| 1234 | Ga0501080_0947979 | 3300049742 | Bacteria | 748 |
| 1235 | Ga0501080_1002540 | 3300049742 | Bacteria | 724 |
| 1236 | Ga0501080_1373390 | 3300049742 | Unclassified | 603 |
| 1237 | Ga0501081_0008315 | 3300049743 | Bacteria | 6733 |
| 1238 | Ga0501081_0157769 | 3300049743 | Unclassified | 1633 |
| 1239 | Ga0501081_0181421 | 3300049743 | Bacteria | 1523 |
| 1240 | Ga0501081_0281554 | 3300049743 | Unclassified | 1217 |
| 1241 | Ga0501081_0420790 | 3300049743 | Unclassified | 990 |
| 1242 | Ga0501081_0421217 | 3300049743 | Bacteria | 990 |
| 1243 | Ga0501081_0807818 | 3300049743 | Bacteria | 706 |
| 1244 | Ga0501081_1183681 | 3300049743 | Bacteria | 579 |
| 1245 | Ga0501045_0013441 | 3300049824 | Bacteria | 5783 |
| 1246 | Ga0501045_0076993 | 3300049824 | Bacteria | 2458 |
| 1247 | Ga0501045_0483206 | 3300049824 | Bacteria | 920 |
| 1248 | Ga0501045_0599848 | 3300049824 | Bacteria | 815 |
| 1249 | Ga0501045_1194561 | 3300049824 | Bacteria | 555 |
| 1250 | Ga0501045_1301088 | 3300049824 | Unclassified | 529 |
| 1251 | nmdc:mga03683_17494_c1 | 3300050489 | Bacteria | 2714 |
| 1252 | nmdc:mga03683_62505_c1 | 3300050489 | Bacteria | 1577 |
| 1253 | nmdc:mga00v17_1193_c1 | 3300050491 | Bacteria | 13648 |
| 1254 | nmdc:mga00v17_17412_c1 | 3300050491 | Bacteria | 4068 |
| 1255 | nmdc:mga00v17_179328_c1 | 3300050491 | Bacteria | 1367 |
| 1256 | nmdc:mga00v17_181772_c1 | 3300050491 | Bacteria | 1357 |
| 1257 | nmdc:mga00v17_87170_c1 | 3300050491 | Bacteria | 1957 |
| 1258 | nmdc:mga0yw44_217631_c1 | 3300050492 | Unclassified | 1265 |
| 1259 | nmdc:mga0yw44_296469_c1 | 3300050492 | Bacteria | 1083 |
| 1260 | nmdc:mga0yw44_895760_c1 | 3300050492 | Unclassified | 602 |
| 1261 | nmdc:mga0k408_291082_c1 | 3300050493 | Bacteria | 975 |
| 1262 | nmdc:mga0k408_4489_c1 | 3300050493 | Bacteria | 7405 |
| 1263 | nmdc:mga0k408_5002_c1 | 3300050493 | Bacteria | 7022 |
| 1264 | nmdc:mga0k408_53704_c2 | 3300050493 | Bacteria | 1300 |
| 1265 | nmdc:mga0k408_741485_c1 | 3300050493 | Unclassified | 574 |
| 1266 | nmdc:mga06z11_118642_c1 | 3300050494 | Bacteria | 747 |
| 1267 | nmdc:mga06z11_144648_c1 | 3300050494 | Bacteria | 1346 |
| 1268 | nmdc:mga06z11_3134_c1 | 3300050494 | Bacteria | 6380 |
| 1269 | nmdc:mga06z11_81981_c1 | 3300050494 | Bacteria | 1733 |
| 1270 | nmdc:mga04h51_13562_c1 | 3300050495 | Bacteria | 2310 |
| 1271 | nmdc:mga04h51_30179_c1 | 3300050495 | Bacteria | 1704 |
| 1272 | nmdc:mga04h51_49263_c1 | 3300050495 | Bacteria | 1407 |
| 1273 | nmdc:mga07m45_103918_c1 | 3300050496 | Bacteria | 1633 |
| 1274 | nmdc:mga07m45_180842_c1 | 3300050496 | Unclassified | 1226 |
| 1275 | nmdc:mga07m45_28294_c1 | 3300050496 | Bacteria | 3093 |
| 1276 | nmdc:mga07m45_828324_c1 | 3300050496 | Unclassified | 530 |
| 1277 | nmdc:mga05p37_1059743_c1 | 3300050507 | Bacteria | 854 |
| 1278 | nmdc:mga05p37_1074_c1 | 3300050507 | Bacteria | 31305 |
| 1279 | nmdc:mga05p37_1100493_c1 | 3300050507 | Bacteria | 832 |
| 1280 | nmdc:mga05p37_1100630_c1 | 3300050507 | Bacteria | 832 |
| 1281 | nmdc:mga05p37_119786_c1 | 3300050507 | Bacteria | 3234 |
| 1282 | nmdc:mga05p37_1230740_c1 | 3300050507 | Bacteria | 770 |
| 1283 | nmdc:mga05p37_142726_c1 | 3300050507 | Unclassified | 2933 |
| 1284 | nmdc:mga05p37_1594891_c1 | 3300050507 | Bacteria | 643 |
| 1285 | nmdc:mga05p37_1729831_c1 | 3300050507 | Bacteria | 608 |
| 1286 | nmdc:mga05p37_1756659_c1 | 3300050507 | Unclassified | 601 |
| 1287 | nmdc:mga05p37_20831_c1 | 3300050507 | Bacteria | 7936 |
| 1288 | nmdc:mga05p37_209293_c1 | 3300050507 | Unclassified | 2358 |
| 1289 | nmdc:mga05p37_2143596_c1 | 3300050507 | Bacteria | 522 |
| 1290 | nmdc:mga05p37_226973_c1 | 3300050507 | Bacteria | 2251 |
| 1291 | nmdc:mga05p37_27034_c1 | 3300050507 | Bacteria | 6983 |
| 1292 | nmdc:mga05p37_2738_c2 | 3300050507 | Bacteria | 17718 |
| 1293 | nmdc:mga05p37_29743_c1 | 3300050507 | Bacteria | 6666 |
| 1294 | nmdc:mga05p37_38505_c1 | 3300050507 | Bacteria | 5865 |
| 1295 | nmdc:mga05p37_410546_c1 | 3300050507 | Bacteria | 1578 |
| 1296 | nmdc:mga05p37_6177_c1 | 3300050507 | Bacteria | 14102 |
| 1297 | nmdc:mga05p37_71170_c1 | 3300050507 | Bacteria | 4278 |
| 1298 | nmdc:mga05p37_768870_c1 | 3300050507 | Bacteria | 1059 |
| 1299 | nmdc:mga05p37_789914_c1 | 3300050507 | Unclassified | 1040 |
| 1300 | nmdc:mga05p37_83256_c1 | 3300050507 | Bacteria | 3941 |
| 1301 | nmdc:mga09592_101467_c1 | 3300050508 | Unclassified | 2465 |
| 1302 | nmdc:mga09592_1025445_c1 | 3300050508 | Unclassified | 689 |
| 1303 | nmdc:mga09592_1162425_c1 | 3300050508 | Unclassified | 639 |
| 1304 | nmdc:mga09592_1226319_c1 | 3300050508 | Unclassified | 619 |
| 1305 | nmdc:mga09592_2928_c1 | 3300050508 | Bacteria | 13833 |
| 1306 | nmdc:mga09592_459558_c1 | 3300050508 | Bacteria | 1098 |
| 1307 | nmdc:mga09592_483498_c1 | 3300050508 | Unclassified | 1067 |
| 1308 | nmdc:mga09592_66881_c1 | 3300050508 | Bacteria | 3047 |
| 1309 | nmdc:mga0qj67_142930_c1 | 3300050509 | Bacteria | 1940 |
| 1310 | nmdc:mga0qj67_297662_c1 | 3300050509 | Bacteria | 1307 |
| 1311 | nmdc:mga0qj67_48323_c1 | 3300050509 | Bacteria | 3361 |
| 1312 | nmdc:mga0qj67_667180_c1 | 3300050509 | Bacteria | 829 |
| 1313 | nmdc:mga0qj67_72318_c1 | 3300050509 | Bacteria | 2753 |
| 1314 | nmdc:mga0qj67_80907_c1 | 3300050509 | Bacteria | 2604 |
| 1315 | nmdc:mga06r32_100925_c1 | 3300050510 | Bacteria | 2831 |
| 1316 | nmdc:mga06r32_102168_c1 | 3300050510 | Bacteria | 2814 |
| 1317 | nmdc:mga06r32_108864_c1 | 3300050510 | Bacteria | 2725 |
| 1318 | nmdc:mga06r32_1507208_c1 | 3300050510 | Unclassified | 612 |
| 1319 | nmdc:mga06r32_166141_c1 | 3300050510 | Bacteria | 2190 |
| 1320 | nmdc:mga06r32_26338_c1 | 3300050510 | Bacteria | 5420 |
| 1321 | nmdc:mga06r32_444497_c1 | 3300050510 | Bacteria | 1276 |
| 1322 | nmdc:mga06r32_452999_c1 | 3300050510 | Bacteria | 1263 |
| 1323 | nmdc:mga06r32_719294_c1 | 3300050510 | Bacteria | 963 |
| 1324 | nmdc:mga06r32_732389_c1 | 3300050510 | Bacteria | 953 |
| 1325 | nmdc:mga06r32_86599_c1 | 3300050510 | Bacteria | 3055 |
| 1326 | nmdc:mga06r32_881906_c1 | 3300050510 | Bacteria | 852 |
| 1327 | nmdc:mga06r32_98095_c1 | 3300050510 | Unclassified | 2872 |
| 1328 | nmdc:mga08y16_134702_c1 | 3300050511 | Bacteria | 2567 |
| 1329 | nmdc:mga08y16_1685044_c1 | 3300050511 | Bacteria | 590 |
| 1330 | nmdc:mga08y16_392987_c1 | 3300050511 | Bacteria | 1420 |
| 1331 | nmdc:mga08y16_520297_c1 | 3300050511 | Bacteria | 1207 |
| 1332 | nmdc:mga08y16_653305_c1 | 3300050511 | Bacteria | 1056 |
| 1333 | nmdc:mga08y16_7416_c1 | 3300050511 | Bacteria | 11491 |
| 1334 | nmdc:mga08y16_8907_c1 | 3300050511 | Bacteria | 10537 |
| 1335 | nmdc:mga08y16_929148_c1 | 3300050511 | Bacteria | 854 |
| 1336 | nmdc:mga08y16_9369_c1 | 3300050511 | Bacteria | 10270 |
| 1337 | nmdc:mga0n895_1313407_c1 | 3300050512 | Unclassified | 694 |
| 1338 | nmdc:mga0n895_132139_c1 | 3300050512 | Bacteria | 2522 |
| 1339 | nmdc:mga0n895_194829_c1 | 3300050512 | Bacteria | 2057 |
| 1340 | nmdc:mga0n895_1997708_c1 | 3300050512 | Unclassified | 538 |
| 1341 | nmdc:mga0n895_2024542_c1 | 3300050512 | Bacteria | 533 |
| 1342 | nmdc:mga0n895_301955_c1 | 3300050512 | Unclassified | 1623 |
| 1343 | nmdc:mga0n895_340336_c1 | 3300050512 | Bacteria | 1519 |
| 1344 | nmdc:mga0n895_394318_c1 | 3300050512 | Bacteria | 1400 |
| 1345 | nmdc:mga0n895_421558_c1 | 3300050512 | Unclassified | 1349 |
| 1346 | nmdc:mga0n895_45046_c1 | 3300050512 | Bacteria | 4304 |
| 1347 | nmdc:mga0n895_718682_c1 | 3300050512 | Bacteria | 994 |
| 1348 | nmdc:mga0n895_721858_c1 | 3300050512 | Unclassified | 991 |
| 1349 | nmdc:mga0n895_765886_c1 | 3300050512 | Bacteria | 957 |
| 1350 | nmdc:mga0rr50_1314062_c1 | 3300050513 | Unclassified | 613 |
| 1351 | nmdc:mga0rr50_137630_c1 | 3300050513 | Bacteria | 1962 |
| 1352 | nmdc:mga0rr50_242591_c1 | 3300050513 | Unclassified | 1494 |
| 1353 | nmdc:mga0rr50_248189_c1 | 3300050513 | Bacteria | 1477 |
| 1354 | nmdc:mga0rr50_343943_c1 | 3300050513 | Bacteria | 1254 |
| 1355 | nmdc:mga0rr50_47505_c1 | 3300050513 | Bacteria | 3167 |
| 1356 | nmdc:mga0rr50_740511_c1 | 3300050513 | Bacteria | 839 |
| 1357 | nmdc:mga0rr50_793989_c1 | 3300050513 | Unclassified | 808 |
| 1358 | nmdc:mga08x19_229740_c1 | 3300050514 | Bacteria | 1277 |
| 1359 | nmdc:mga08x19_6364_c1 | 3300050514 | Bacteria | 6990 |
| 1360 | nmdc:mga08x19_900864_c1 | 3300050514 | Bacteria | 628 |
| 1361 | nmdc:mga0a205_100557_c2 | 3300050515 | Bacteria | 2429 |
| 1362 | nmdc:mga0a205_1686_c1 | 3300050515 | Bacteria | 19071 |
| 1363 | nmdc:mga0a205_19164_c1 | 3300050515 | Bacteria | 6448 |
| 1364 | nmdc:mga0a205_196988_c2 | 3300050515 | Unclassified | 1546 |
| 1365 | nmdc:mga0a205_339228_c1 | 3300050515 | Bacteria | 1371 |
| 1366 | nmdc:mga0a205_345110_c1 | 3300050515 | Bacteria | 1357 |
| 1367 | nmdc:mga0a205_388379_c1 | 3300050515 | Unclassified | 1260 |
| 1368 | nmdc:mga0a205_428895_c1 | 3300050515 | Unclassified | 1184 |
| 1369 | nmdc:mga0a205_468679_c1 | 3300050515 | Bacteria | 1118 |
| 1370 | nmdc:mga0a205_74905_c2 | 3300050515 | Bacteria | 2971 |
| 1371 | nmdc:mga0a205_86326_c1 | 3300050515 | Unclassified | 3031 |
| 1372 | nmdc:mga0sz30_281466_c1 | 3300050516 | Bacteria | 741 |
| 1373 | nmdc:mga0sz30_51515_c1 | 3300050516 | Bacteria | 1746 |
| 1374 | Ga0495601_0001021 | 3300053077 | Bacteria | 15304 |
| 1375 | Ga0495601_0095336 | 3300053077 | Bacteria | 1918 |
| 1376 | Ga0495601_0225021 | 3300053077 | Bacteria | 1226 |
| 1377 | Ga0495601_0371243 | 3300053077 | Bacteria | 929 |
| 1378 | Ga0495601_0691420 | 3300053077 | Unclassified | 651 |
| 1379 | Ga0495612_0460664 | 3300053078 | Unclassified | 581 |
| 1380 | Ga0495595_0528633 | 3300053084 | Unclassified | 602 |
| 1381 | Ga0495619_0000905 | 3300053085 | Bacteria | 19424 |
| 1382 | Ga0495619_0118877 | 3300053085 | Bacteria | 1811 |
| 1383 | Ga0495619_0150602 | 3300053085 | Bacteria | 1605 |
| 1384 | Ga0495619_0151616 | 3300053085 | Bacteria | 1599 |
| 1385 | Ga0495619_0248557 | 3300053085 | Bacteria | 1232 |
| 1386 | Ga0495619_0248654 | 3300053085 | Bacteria | 1232 |
| 1387 | Ga0495619_0249327 | 3300053085 | Bacteria | 1230 |
| 1388 | Ga0495619_0326669 | 3300053085 | Bacteria | 1062 |
| 1389 | Ga0500555_060744 | 3300053103 | Bacteria | 1017 |
| 1390 | Ga0501084_0089602 | 3300054114 | Bacteria | 2582 |
| 1391 | Ga0501084_0194380 | 3300054114 | Bacteria | 1712 |
| 1392 | Ga0501084_0241347 | 3300054114 | Bacteria | 1525 |
| 1393 | Ga0501084_0277564 | 3300054114 | Bacteria | 1415 |
| 1394 | Ga0501084_0369950 | 3300054114 | Bacteria | 1211 |
| 1395 | Ga0501084_0576016 | 3300054114 | Unclassified | 951 |
| 1396 | Ga0501084_0702670 | 3300054114 | Unclassified | 853 |
| 1397 | Ga0501084_1209224 | 3300054114 | Unclassified | 634 |
| 1398 | Ga0501084_1276824 | 3300054114 | Unclassified | 616 |
| 1399 | Ga0501084_1429318 | 3300054114 | Bacteria | 579 |
| 1400 | Ga0501084_1442607 | 3300054114 | Unclassified | 576 |
| 1401 | Ga0501084_1815246 | 3300054114 | Unclassified | 509 |
| 1402 | Ga0590071_007833 | 3300059421 | Bacteria | 2525 |
| 1403 | Ga0590077_002299 | 3300059426 | Bacteria | 4128 |
| 1404 | Ga0590077_041235 | 3300059426 | Bacteria | 1026 |
| 1405 | Ga0501082_0111869 | 3300060353 | Bacteria | 2364 |
| 1406 | Ga0501082_0182024 | 3300060353 | Bacteria | 1828 |
| 1407 | Ga0501082_0384535 | 3300060353 | Bacteria | 1225 |
| 1408 | Ga0501082_0553563 | 3300060353 | Bacteria | 1006 |
| 1409 | Ga0501082_0801192 | 3300060353 | Unclassified | 824 |
| 1410 | Ga0501082_0922188 | 3300060353 | Unclassified | 764 |
| 1411 | Ga0530510_0035013 | 3300061734 | Unclassified | 3618 |
| 1412 | Ga0530510_0065854 | 3300061734 | Bacteria | 2626 |
| 1413 | Ga0530510_0128067 | 3300061734 | Bacteria | 1867 |
| 1414 | Ga0530510_0148807 | 3300061734 | Bacteria | 1728 |
| 1415 | Ga0530510_0175133 | 3300061734 | Bacteria | 1590 |
| 1416 | Ga0530510_0610693 | 3300061734 | Unclassified | 830 |
| 1417 | Ga0530510_1100764 | 3300061734 | Unclassified | 609 |
| 1418 | Ga0530510_1343010 | 3300061734 | Bacteria | 548 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041512 | Ga0451853_3468293 | Ga0451853_3468293_88_426 | 111 |
| 2 | 3300005616 | Ga0068852_102091960 | Ga0068852_1020919601 | 113 |
| 3 | 3300006881 | Ga0068865_100424070 | Ga0068865_1004240702 | 113 |
| 4 | 3300005354 | Ga0070675_100199772 | Ga0070675_1001997722 | 114 |
| 5 | 3300014326 | Ga0157380_11890567 | Ga0157380_118905672 | 114 |
| 6 | 3300025925 | Ga0207650_11460745 | Ga0207650_114607452 | 114 |
| 7 | 3300026075 | Ga0207708_10839177 | Ga0207708_108391771 | 114 |
| 8 | 3300026089 | Ga0207648_10105600 | Ga0207648_101056004 | 114 |
| 9 | 3300035692 | Ga0373935_1130831 | Ga0373935_1130831_125_484 | 114 |
| 10 | 3300046454 | Ga0495592_0045114 | Ga0495592_0045114_1842_2201 | 114 |
| 11 | 3300046472 | Ga0495580_1051214 | Ga0495580_1051214_124_471 | 114 |
| 12 | 3300046642 | Ga0495634_0336374 | Ga0495634_0336374_103_462 | 114 |
| 13 | 3300046678 | Ga0495599_0091975 | Ga0495599_0091975_1040_1399 | 114 |
| 14 | 3300047319 | Ga0495674_0258680 | Ga0495674_0258680_1022_1381 | 114 |
| 15 | 3300005354 | Ga0070675_100000263 | Ga0070675_10000026313 | 115 |
| 16 | 3300013296 | Ga0157374_11376441 | Ga0157374_113764412 | 115 |
| 17 | 3300013308 | Ga0157375_12577862 | Ga0157375_125778621 | 115 |
| 18 | 3300014745 | Ga0157377_10279296 | Ga0157377_102792962 | 115 |
| 19 | 3300025926 | Ga0207659_10000369 | Ga0207659_100003698 | 115 |
| 20 | 3300028380 | Ga0268265_12471776 | Ga0268265_124717762 | 115 |
| 21 | 3300032002 | Ga0307416_101233158 | Ga0307416_1012331582 | 115 |
| 22 | 3300005334 | Ga0068869_100058302 | Ga0068869_1000583024 | 116 |
| 23 | 3300005338 | Ga0068868_100083627 | Ga0068868_1000836274 | 116 |
| 24 | 3300005343 | Ga0070687_100378175 | Ga0070687_1003781752 | 116 |
| 25 | 3300005354 | Ga0070675_100526730 | Ga0070675_1005267301 | 116 |
| 26 | 3300005356 | Ga0070674_101187006 | Ga0070674_1011870061 | 116 |
| 27 | 3300005356 | Ga0070674_101700710 | Ga0070674_1017007101 | 116 |
| 28 | 3300005364 | Ga0070673_100036388 | Ga0070673_1000363882 | 116 |
| 29 | 3300005456 | Ga0070678_100172781 | Ga0070678_1001727812 | 116 |
| 30 | 3300005458 | Ga0070681_10211377 | Ga0070681_102113772 | 116 |
| 31 | 3300005459 | Ga0068867_100641739 | Ga0068867_1006417392 | 116 |
| 32 | 3300005466 | Ga0070685_10614421 | Ga0070685_106144211 | 116 |
| 33 | 3300005543 | Ga0070672_100248761 | Ga0070672_1002487612 | 116 |
| 34 | 3300005548 | Ga0070665_100009673 | Ga0070665_1000096732 | 116 |
| 35 | 3300005615 | Ga0070702_101749689 | Ga0070702_1017496891 | 116 |
| 36 | 3300005842 | Ga0068858_100104020 | Ga0068858_1001040202 | 116 |
| 37 | 3300005843 | Ga0068860_100031017 | Ga0068860_1000310175 | 116 |
| 38 | 3300005985 | Ga0081539_10014244 | Ga0081539_100142442 | 116 |
| 39 | 3300006237 | Ga0097621_100009812 | Ga0097621_1000098125 | 116 |
| 40 | 3300006881 | Ga0068865_100091282 | Ga0068865_1000912822 | 116 |
| 41 | 3300009098 | Ga0105245_10055485 | Ga0105245_100554852 | 116 |
| 42 | 3300009148 | Ga0105243_12629952 | Ga0105243_126299521 | 116 |
| 43 | 3300009551 | Ga0105238_11723206 | Ga0105238_117232062 | 116 |
| 44 | 3300009551 | Ga0105238_12226418 | Ga0105238_122264182 | 116 |
| 45 | 3300013296 | Ga0157374_11121399 | Ga0157374_111213992 | 116 |
| 46 | 3300013297 | Ga0157378_10142479 | Ga0157378_101424794 | 116 |
| 47 | 3300013306 | Ga0163162_11004808 | Ga0163162_110048082 | 116 |
| 48 | 3300013308 | Ga0157375_10155119 | Ga0157375_101551194 | 116 |
| 49 | 3300014968 | Ga0157379_11225589 | Ga0157379_112255892 | 116 |
| 50 | 3300014969 | Ga0157376_10000975 | Ga0157376_1000097523 | 116 |
| 51 | 3300025907 | Ga0207645_10328202 | Ga0207645_103282022 | 116 |
| 52 | 3300025926 | Ga0207659_10643330 | Ga0207659_106433302 | 116 |
| 53 | 3300025927 | Ga0207687_10070843 | Ga0207687_100708434 | 116 |
| 54 | 3300025937 | Ga0207669_10384681 | Ga0207669_103846812 | 116 |
| 55 | 3300025938 | Ga0207704_10180091 | Ga0207704_101800912 | 116 |
| 56 | 3300025940 | Ga0207691_10789642 | Ga0207691_107896421 | 116 |
| 57 | 3300025941 | Ga0207711_10074486 | Ga0207711_100744862 | 116 |
| 58 | 3300025942 | Ga0207689_10078629 | Ga0207689_100786294 | 116 |
| 59 | 3300025960 | Ga0207651_10201501 | Ga0207651_102015012 | 116 |
| 60 | 3300026023 | Ga0207677_10025212 | Ga0207677_100252125 | 116 |
| 61 | 3300026035 | Ga0207703_10112437 | Ga0207703_101124372 | 116 |
| 62 | 3300026088 | Ga0207641_10513476 | Ga0207641_105134762 | 116 |
| 63 | 3300026089 | Ga0207648_10124554 | Ga0207648_101245543 | 116 |
| 64 | 3300026121 | Ga0207683_10141360 | Ga0207683_101413602 | 116 |
| 65 | 3300028379 | Ga0268266_10135488 | Ga0268266_101354882 | 116 |
| 66 | 3300028381 | Ga0268264_10243636 | Ga0268264_102436362 | 116 |
| 67 | 3300048904 | Ga0496101_0806585 | Ga0496101_0806585_273_629 | 116 |
| 68 | 3300049572 | Ga0501036_0214944 | Ga0501036_0214944_779_1129 | 116 |
| 69 | 3300049575 | Ga0501039_0042891 | Ga0501039_0042891_1553_1903 | 116 |
| 70 | 3300049576 | Ga0501040_0401635 | Ga0501040_0401635_55_405 | 116 |
| 71 | 3300049577 | Ga0501041_0065202 | Ga0501041_0065202_154_504 | 116 |
| 72 | 3300049578 | Ga0501042_0556675 | Ga0501042_0556675_290_640 | 116 |
| 73 | 3300049579 | Ga0501043_1073480 | Ga0501043_1073480_54_404 | 116 |
| 74 | 3300049582 | Ga0501048_0682498 | Ga0501048_0682498_206_556 | 116 |
| 75 | 3300049582 | Ga0501048_0713459 | Ga0501048_0713459_290_643 | 116 |
| 76 | 3300049587 | Ga0501071_0231381 | Ga0501071_0231381_213_563 | 116 |
| 77 | 3300049588 | Ga0501072_0016297 | Ga0501072_0016297_4733_5083 | 116 |
| 78 | 3300049591 | Ga0501075_0300054 | Ga0501075_0300054_598_948 | 116 |
| 79 | 3300049592 | Ga0501076_0029060 | Ga0501076_0029060_3483_3833 | 116 |
| 80 | 3300049741 | Ga0501079_0464306 | Ga0501079_0464306_386_736 | 116 |
| 81 | 3300049742 | Ga0501080_0349522 | Ga0501080_0349522_735_1085 | 116 |
| 82 | 3300049743 | Ga0501081_0807818 | Ga0501081_0807818_294_644 | 116 |
| 83 | 3300049824 | Ga0501045_0013441 | Ga0501045_0013441_4514_4864 | 116 |
| 84 | 3300050493 | nmdc:mga0k408_741485_c1 | nmdc:mga0k408_741485_c1_55_426 | 116 |
| 85 | 3300054114 | Ga0501084_1442607 | Ga0501084_1442607_53_403 | 116 |
| 86 | 3300060353 | Ga0501082_0111869 | Ga0501082_0111869_908_1258 | 116 |
| 87 | 3300061734 | Ga0530510_0148807 | Ga0530510_0148807_916_1266 | 116 |
| 88 | 3300002459 | JGI24751J29686_10008866 | JGI24751J29686_100088663 | 117 |
| 89 | 3300005290 | Ga0065712_10510675 | Ga0065712_105106751 | 117 |
| 90 | 3300005293 | Ga0065715_10516821 | Ga0065715_105168211 | 117 |
| 91 | 3300005331 | Ga0070670_100015511 | Ga0070670_1000155113 | 117 |
| 92 | 3300005333 | Ga0070677_10166188 | Ga0070677_101661881 | 117 |
| 93 | 3300005333 | Ga0070677_10400842 | Ga0070677_104008422 | 117 |
| 94 | 3300005343 | Ga0070687_100808544 | Ga0070687_1008085442 | 117 |
| 95 | 3300005344 | Ga0070661_101304614 | Ga0070661_1013046142 | 117 |
| 96 | 3300005353 | Ga0070669_100278463 | Ga0070669_1002784631 | 117 |
| 97 | 3300005354 | Ga0070675_100195158 | Ga0070675_1001951583 | 117 |
| 98 | 3300005354 | Ga0070675_101159563 | Ga0070675_1011595632 | 117 |
| 99 | 3300005356 | Ga0070674_100038015 | Ga0070674_1000380153 | 117 |
| 100 | 3300005356 | Ga0070674_101260923 | Ga0070674_1012609231 | 117 |
| 101 | 3300005434 | Ga0070709_11186304 | Ga0070709_111863042 | 117 |
| 102 | 3300005444 | Ga0070694_100338638 | Ga0070694_1003386382 | 117 |
| 103 | 3300005455 | Ga0070663_101240837 | Ga0070663_1012408371 | 117 |
| 104 | 3300005471 | Ga0070698_100341131 | Ga0070698_1003411311 | 117 |
| 105 | 3300005543 | Ga0070672_101358823 | Ga0070672_1013588232 | 117 |
| 106 | 3300005549 | Ga0070704_101865880 | Ga0070704_1018658801 | 117 |
| 107 | 3300005841 | Ga0068863_102496448 | Ga0068863_1024964481 | 117 |
| 108 | 3300006173 | Ga0070716_100197736 | Ga0070716_1001977362 | 117 |
| 109 | 3300006852 | Ga0075433_10001180 | Ga0075433_100011806 | 117 |
| 110 | 3300006852 | Ga0075433_10193567 | Ga0075433_101935673 | 117 |
| 111 | 3300006871 | Ga0075434_100074174 | Ga0075434_1000741743 | 117 |
| 112 | 3300006871 | Ga0075434_100385280 | Ga0075434_1003852802 | 117 |
| 113 | 3300007076 | Ga0075435_100200359 | Ga0075435_1002003592 | 117 |
| 114 | 3300009147 | Ga0114129_10014560 | Ga0114129_1001456013 | 117 |
| 115 | 3300009147 | Ga0114129_10029746 | Ga0114129_100297464 | 117 |
| 116 | 3300009147 | Ga0114129_10506899 | Ga0114129_105068992 | 117 |
| 117 | 3300009553 | Ga0105249_10113961 | Ga0105249_101139612 | 117 |
| 118 | 3300009553 | Ga0105249_13071043 | Ga0105249_130710431 | 117 |
| 119 | 3300013308 | Ga0157375_10160971 | Ga0157375_101609712 | 117 |
| 120 | 3300014745 | Ga0157377_11036333 | Ga0157377_110363331 | 117 |
| 121 | 3300014969 | Ga0157376_12051121 | Ga0157376_120511211 | 117 |
| 122 | 3300025893 | Ga0207682_10354109 | Ga0207682_103541091 | 117 |
| 123 | 3300025922 | Ga0207646_11849867 | Ga0207646_118498672 | 117 |
| 124 | 3300025923 | Ga0207681_10614112 | Ga0207681_106141121 | 117 |
| 125 | 3300025939 | Ga0207665_11639778 | Ga0207665_116397781 | 117 |
| 126 | 3300028380 | Ga0268265_10120559 | Ga0268265_101205591 | 117 |
| 127 | 3300032002 | Ga0307416_103873736 | Ga0307416_1038737361 | 117 |
| 128 | 3300041460 | Ga0451802_1910756 | Ga0451802_1910756_242_601 | 117 |
| 129 | 3300042156 | Ga0439446_0246314 | Ga0439446_0246314_89_442 | 117 |
| 130 | 3300045976 | Ga0466967_0514393 | Ga0466967_0514393_134_487 | 117 |
| 131 | 3300046462 | Ga0495651_0835005 | Ga0495651_0835005_42_395 | 117 |
| 132 | 3300046543 | Ga0495645_0006999 | Ga0495645_0006999_3228_3581 | 117 |
| 133 | 3300046642 | Ga0495634_0048319 | Ga0495634_0048319_1860_2216 | 117 |
| 134 | 3300046694 | Ga0495649_0515104 | Ga0495649_0515104_65_445 | 117 |
| 135 | 3300047471 | Ga0495684_0500086 | Ga0495684_0500086_157_510 | 117 |
| 136 | 3300048917 | Ga0496114_0207454 | Ga0496114_0207454_1240_1593 | 117 |
| 137 | 3300049572 | Ga0501036_0096073 | Ga0501036_0096073_211_564 | 117 |
| 138 | 3300049577 | Ga0501041_0077878 | Ga0501041_0077878_626_979 | 117 |
| 139 | 3300049582 | Ga0501048_0822114 | Ga0501048_0822114_131_484 | 117 |
| 140 | 3300049587 | Ga0501071_0756575 | Ga0501071_0756575_224_577 | 117 |
| 141 | 3300049588 | Ga0501072_0236472 | Ga0501072_0236472_615_968 | 117 |
| 142 | 3300049591 | Ga0501075_0025120 | Ga0501075_0025120_3596_3949 | 117 |
| 143 | 3300049592 | Ga0501076_0033584 | Ga0501076_0033584_2716_3069 | 117 |
| 144 | 3300049742 | Ga0501080_1002540 | Ga0501080_1002540_50_409 | 117 |
| 145 | 3300049743 | Ga0501081_0281554 | Ga0501081_0281554_269_622 | 117 |
| 146 | 3300049743 | Ga0501081_1183681 | Ga0501081_1183681_25_387 | 117 |
| 147 | 3300050507 | nmdc:mga05p37_768870_c1 | nmdc:mga05p37_768870_c1_597_953 | 117 |
| 148 | 3300050508 | nmdc:mga09592_2928_c1 | nmdc:mga09592_2928_c1_5426_5800 | 117 |
| 149 | 3300050512 | nmdc:mga0n895_340336_c1 | nmdc:mga0n895_340336_c1_746_1099 | 117 |
| 150 | 3300050512 | nmdc:mga0n895_45046_c1 | nmdc:mga0n895_45046_c1_790_1146 | 117 |
| 151 | 3300050512 | nmdc:mga0n895_765886_c1 | nmdc:mga0n895_765886_c1_534_887 | 117 |
| 152 | 3300050513 | nmdc:mga0rr50_343943_c1 | nmdc:mga0rr50_343943_c1_625_981 | 117 |
| 153 | 3300050515 | nmdc:mga0a205_1686_c1 | nmdc:mga0a205_1686_c1_4199_4552 | 117 |
| 154 | 3300053077 | Ga0495601_0691420 | Ga0495601_0691420_96_449 | 117 |
| 155 | 3300054114 | Ga0501084_0194380 | Ga0501084_0194380_1178_1531 | 117 |
| 156 | 3300054114 | Ga0501084_1276824 | Ga0501084_1276824_215_574 | 117 |
| 157 | 3300060353 | Ga0501082_0922188 | Ga0501082_0922188_176_529 | 117 |
| 158 | 3300061734 | Ga0530510_0035013 | Ga0530510_0035013_236_589 | 117 |
| 159 | 3300005290 | Ga0065712_10007697 | Ga0065712_100076974 | 118 |
| 160 | 3300005327 | Ga0070658_10098188 | Ga0070658_100981882 | 118 |
| 161 | 3300005333 | Ga0070677_10098207 | Ga0070677_100982071 | 118 |
| 162 | 3300005336 | Ga0070680_100768471 | Ga0070680_1007684712 | 118 |
| 163 | 3300005339 | Ga0070660_100249584 | Ga0070660_1002495842 | 118 |
| 164 | 3300005344 | Ga0070661_100438020 | Ga0070661_1004380202 | 118 |
| 165 | 3300005347 | Ga0070668_100020058 | Ga0070668_1000200581 | 118 |
| 166 | 3300005353 | Ga0070669_100186217 | Ga0070669_1001862172 | 118 |
| 167 | 3300005353 | Ga0070669_100492567 | Ga0070669_1004925672 | 118 |
| 168 | 3300005354 | Ga0070675_100032497 | Ga0070675_1000324972 | 118 |
| 169 | 3300005354 | Ga0070675_100464244 | Ga0070675_1004642441 | 118 |
| 170 | 3300005356 | Ga0070674_100380861 | Ga0070674_1003808612 | 118 |
| 171 | 3300005364 | Ga0070673_100538071 | Ga0070673_1005380712 | 118 |
| 172 | 3300005367 | Ga0070667_101178617 | Ga0070667_1011786171 | 118 |
| 173 | 3300005439 | Ga0070711_100532606 | Ga0070711_1005326062 | 118 |
| 174 | 3300005441 | Ga0070700_100320247 | Ga0070700_1003202471 | 118 |
| 175 | 3300005441 | Ga0070700_100915036 | Ga0070700_1009150361 | 118 |
| 176 | 3300005444 | Ga0070694_100531954 | Ga0070694_1005319542 | 118 |
| 177 | 3300005456 | Ga0070678_101765676 | Ga0070678_1017656761 | 118 |
| 178 | 3300005457 | Ga0070662_100420794 | Ga0070662_1004207942 | 118 |
| 179 | 3300005458 | Ga0070681_10051671 | Ga0070681_100516712 | 118 |
| 180 | 3300005458 | Ga0070681_10083353 | Ga0070681_100833532 | 118 |
| 181 | 3300005459 | Ga0068867_102058541 | Ga0068867_1020585412 | 118 |
| 182 | 3300005468 | Ga0070707_100464821 | Ga0070707_1004648212 | 118 |
| 183 | 3300005468 | Ga0070707_100891641 | Ga0070707_1008916412 | 118 |
| 184 | 3300005471 | Ga0070698_100437529 | Ga0070698_1004375292 | 118 |
| 185 | 3300005530 | Ga0070679_100097367 | Ga0070679_1000973674 | 118 |
| 186 | 3300005535 | Ga0070684_100162562 | Ga0070684_1001625622 | 118 |
| 187 | 3300005535 | Ga0070684_101869587 | Ga0070684_1018695871 | 118 |
| 188 | 3300005539 | Ga0068853_100866124 | Ga0068853_1008661241 | 118 |
| 189 | 3300005543 | Ga0070672_100704769 | Ga0070672_1007047692 | 118 |
| 190 | 3300005548 | Ga0070665_100010784 | Ga0070665_1000107849 | 118 |
| 191 | 3300005549 | Ga0070704_101904288 | Ga0070704_1019042881 | 118 |
| 192 | 3300005563 | Ga0068855_100006730 | Ga0068855_10000673013 | 118 |
| 193 | 3300005563 | Ga0068855_100078218 | Ga0068855_1000782186 | 118 |
| 194 | 3300005563 | Ga0068855_100607357 | Ga0068855_1006073572 | 118 |
| 195 | 3300005577 | Ga0068857_100076213 | Ga0068857_1000762132 | 118 |
| 196 | 3300005614 | Ga0068856_101263594 | Ga0068856_1012635942 | 118 |
| 197 | 3300005616 | Ga0068852_101038209 | Ga0068852_1010382092 | 118 |
| 198 | 3300005718 | Ga0068866_10489349 | Ga0068866_104893492 | 118 |
| 199 | 3300005719 | Ga0068861_100390075 | Ga0068861_1003900752 | 118 |
| 200 | 3300005844 | Ga0068862_100972564 | Ga0068862_1009725641 | 118 |
| 201 | 3300005937 | Ga0081455_10450650 | Ga0081455_104506502 | 118 |
| 202 | 3300006038 | Ga0075365_10211371 | Ga0075365_102113712 | 118 |
| 203 | 3300006038 | Ga0075365_11055682 | Ga0075365_110556822 | 118 |
| 204 | 3300006042 | Ga0075368_10004146 | Ga0075368_100041463 | 118 |
| 205 | 3300006042 | Ga0075368_10022443 | Ga0075368_100224432 | 118 |
| 206 | 3300006042 | Ga0075368_10046216 | Ga0075368_100462162 | 118 |
| 207 | 3300006051 | Ga0075364_10007212 | Ga0075364_100072126 | 118 |
| 208 | 3300006051 | Ga0075364_10019158 | Ga0075364_100191582 | 118 |
| 209 | 3300006051 | Ga0075364_10030281 | Ga0075364_100302812 | 118 |
| 210 | 3300006177 | Ga0075362_10000612 | Ga0075362_100006125 | 118 |
| 211 | 3300006177 | Ga0075362_10005422 | Ga0075362_100054223 | 118 |
| 212 | 3300006178 | Ga0075367_10016516 | Ga0075367_100165162 | 118 |
| 213 | 3300006178 | Ga0075367_10021644 | Ga0075367_100216443 | 118 |
| 214 | 3300006178 | Ga0075367_10043715 | Ga0075367_100437152 | 118 |
| 215 | 3300006186 | Ga0075369_10472080 | Ga0075369_104720802 | 118 |
| 216 | 3300006195 | Ga0075366_10005604 | Ga0075366_100056045 | 118 |
| 217 | 3300006195 | Ga0075366_10031509 | Ga0075366_100315092 | 118 |
| 218 | 3300006237 | Ga0097621_100042330 | Ga0097621_1000423302 | 118 |
| 219 | 3300006237 | Ga0097621_101163859 | Ga0097621_1011638592 | 118 |
| 220 | 3300006353 | Ga0075370_10073026 | Ga0075370_100730262 | 118 |
| 221 | 3300006353 | Ga0075370_10124251 | Ga0075370_101242512 | 118 |
| 222 | 3300006358 | Ga0068871_100020951 | Ga0068871_1000209512 | 118 |
| 223 | 3300006844 | Ga0075428_100057445 | Ga0075428_1000574453 | 118 |
| 224 | 3300006844 | Ga0075428_100479873 | Ga0075428_1004798732 | 118 |
| 225 | 3300006844 | Ga0075428_100698175 | Ga0075428_1006981752 | 118 |
| 226 | 3300006844 | Ga0075428_100797293 | Ga0075428_1007972931 | 118 |
| 227 | 3300006844 | Ga0075428_101299967 | Ga0075428_1012999672 | 118 |
| 228 | 3300006846 | Ga0075430_100048754 | Ga0075430_1000487544 | 118 |
| 229 | 3300006846 | Ga0075430_100546638 | Ga0075430_1005466382 | 118 |
| 230 | 3300006847 | Ga0075431_100218693 | Ga0075431_1002186932 | 118 |
| 231 | 3300006847 | Ga0075431_100509425 | Ga0075431_1005094252 | 118 |
| 232 | 3300006847 | Ga0075431_101015630 | Ga0075431_1010156301 | 118 |
| 233 | 3300006847 | Ga0075431_101330355 | Ga0075431_1013303552 | 118 |
| 234 | 3300006852 | Ga0075433_10165387 | Ga0075433_101653872 | 118 |
| 235 | 3300006871 | Ga0075434_100201853 | Ga0075434_1002018532 | 118 |
| 236 | 3300006880 | Ga0075429_100038356 | Ga0075429_1000383562 | 118 |
| 237 | 3300006880 | Ga0075429_101976773 | Ga0075429_1019767731 | 118 |
| 238 | 3300006881 | Ga0068865_100013820 | Ga0068865_1000138204 | 118 |
| 239 | 3300006881 | Ga0068865_102113716 | Ga0068865_1021137161 | 118 |
| 240 | 3300006914 | Ga0075436_100647231 | Ga0075436_1006472312 | 118 |
| 241 | 3300007076 | Ga0075435_100107383 | Ga0075435_1001073832 | 118 |
| 242 | 3300007788 | Ga0099795_10350812 | Ga0099795_103508121 | 118 |
| 243 | 3300009093 | Ga0105240_10168722 | Ga0105240_101687222 | 118 |
| 244 | 3300009094 | Ga0111539_10002910 | Ga0111539_100029109 | 118 |
| 245 | 3300009094 | Ga0111539_10019405 | Ga0111539_100194052 | 118 |
| 246 | 3300009094 | Ga0111539_10149077 | Ga0111539_101490771 | 118 |
| 247 | 3300009101 | Ga0105247_10183334 | Ga0105247_101833342 | 118 |
| 248 | 3300009147 | Ga0114129_10013890 | Ga0114129_100138902 | 118 |
| 249 | 3300009147 | Ga0114129_10504386 | Ga0114129_105043862 | 118 |
| 250 | 3300009147 | Ga0114129_10821864 | Ga0114129_108218642 | 118 |
| 251 | 3300009147 | Ga0114129_11462435 | Ga0114129_114624352 | 118 |
| 252 | 3300009147 | Ga0114129_11603241 | Ga0114129_116032412 | 118 |
| 253 | 3300009147 | Ga0114129_11885200 | Ga0114129_118852002 | 118 |
| 254 | 3300009147 | Ga0114129_12297577 | Ga0114129_122975771 | 118 |
| 255 | 3300009147 | Ga0114129_12505978 | Ga0114129_125059782 | 118 |
| 256 | 3300009147 | Ga0114129_12638583 | Ga0114129_126385831 | 118 |
| 257 | 3300009147 | Ga0114129_12895361 | Ga0114129_128953612 | 118 |
| 258 | 3300009176 | Ga0105242_10022073 | Ga0105242_100220734 | 118 |
| 259 | 3300009177 | Ga0105248_10163520 | Ga0105248_101635203 | 118 |
| 260 | 3300009177 | Ga0105248_10197614 | Ga0105248_101976142 | 118 |
| 261 | 3300009177 | Ga0105248_11059300 | Ga0105248_110593001 | 118 |
| 262 | 3300009551 | Ga0105238_10469453 | Ga0105238_104694531 | 118 |
| 263 | 3300009551 | Ga0105238_11962004 | Ga0105238_119620041 | 118 |
| 264 | 3300009553 | Ga0105249_10474338 | Ga0105249_104743382 | 118 |
| 265 | 3300009553 | Ga0105249_10618751 | Ga0105249_106187512 | 118 |
| 266 | 3300010375 | Ga0105239_12802094 | Ga0105239_128020941 | 118 |
| 267 | 3300011119 | Ga0105246_11812800 | Ga0105246_118128002 | 118 |
| 268 | 3300013105 | Ga0157369_10567572 | Ga0157369_105675722 | 118 |
| 269 | 3300013297 | Ga0157378_11527118 | Ga0157378_115271182 | 118 |
| 270 | 3300014326 | Ga0157380_10585523 | Ga0157380_105855231 | 118 |
| 271 | 3300014326 | Ga0157380_11890717 | Ga0157380_118907171 | 118 |
| 272 | 3300014968 | Ga0157379_10611574 | Ga0157379_106115742 | 118 |
| 273 | 3300014968 | Ga0157379_11285734 | Ga0157379_112857342 | 118 |
| 274 | 3300014969 | Ga0157376_10107811 | Ga0157376_101078112 | 118 |
| 275 | 3300025315 | Ga0207697_10434919 | Ga0207697_104349192 | 118 |
| 276 | 3300025893 | Ga0207682_10424402 | Ga0207682_104244021 | 118 |
| 277 | 3300025899 | Ga0207642_10045161 | Ga0207642_100451612 | 118 |
| 278 | 3300025899 | Ga0207642_10900037 | Ga0207642_109000372 | 118 |
| 279 | 3300025900 | Ga0207710_10173438 | Ga0207710_101734382 | 118 |
| 280 | 3300025907 | Ga0207645_10033074 | Ga0207645_100330742 | 118 |
| 281 | 3300025909 | Ga0207705_10284554 | Ga0207705_102845542 | 118 |
| 282 | 3300025912 | Ga0207707_10068249 | Ga0207707_100682492 | 118 |
| 283 | 3300025913 | Ga0207695_10327086 | Ga0207695_103270862 | 118 |
| 284 | 3300025914 | Ga0207671_11521237 | Ga0207671_115212371 | 118 |
| 285 | 3300025916 | Ga0207663_10976093 | Ga0207663_109760932 | 118 |
| 286 | 3300025917 | Ga0207660_10491267 | Ga0207660_104912672 | 118 |
| 287 | 3300025919 | Ga0207657_10005651 | Ga0207657_100056514 | 118 |
| 288 | 3300025921 | Ga0207652_11018784 | Ga0207652_110187841 | 118 |
| 289 | 3300025922 | Ga0207646_10906412 | Ga0207646_109064122 | 118 |
| 290 | 3300025922 | Ga0207646_11387178 | Ga0207646_113871781 | 118 |
| 291 | 3300025923 | Ga0207681_10127047 | Ga0207681_101270472 | 118 |
| 292 | 3300025923 | Ga0207681_11197134 | Ga0207681_111971342 | 118 |
| 293 | 3300025924 | Ga0207694_10331346 | Ga0207694_103313461 | 118 |
| 294 | 3300025926 | Ga0207659_10007963 | Ga0207659_100079633 | 118 |
| 295 | 3300025928 | Ga0207700_10057909 | Ga0207700_100579092 | 118 |
| 296 | 3300025932 | Ga0207690_10222786 | Ga0207690_102227863 | 118 |
| 297 | 3300025933 | Ga0207706_10469337 | Ga0207706_104693372 | 118 |
| 298 | 3300025934 | Ga0207686_10084333 | Ga0207686_100843332 | 118 |
| 299 | 3300025937 | Ga0207669_10163169 | Ga0207669_101631691 | 118 |
| 300 | 3300025937 | Ga0207669_10392314 | Ga0207669_103923142 | 118 |
| 301 | 3300025938 | Ga0207704_10030711 | Ga0207704_100307112 | 118 |
| 302 | 3300025941 | Ga0207711_10519466 | Ga0207711_105194661 | 118 |
| 303 | 3300025941 | Ga0207711_10642110 | Ga0207711_106421102 | 118 |
| 304 | 3300025944 | Ga0207661_10008224 | Ga0207661_100082243 | 118 |
| 305 | 3300025949 | Ga0207667_10092976 | Ga0207667_100929762 | 118 |
| 306 | 3300025949 | Ga0207667_10094336 | Ga0207667_100943362 | 118 |
| 307 | 3300025949 | Ga0207667_10319060 | Ga0207667_103190602 | 118 |
| 308 | 3300025961 | Ga0207712_10417505 | Ga0207712_104175052 | 118 |
| 309 | 3300025972 | Ga0207668_10351114 | Ga0207668_103511141 | 118 |
| 310 | 3300025981 | Ga0207640_10609991 | Ga0207640_106099912 | 118 |
| 311 | 3300025986 | Ga0207658_10889535 | Ga0207658_108895351 | 118 |
| 312 | 3300026075 | Ga0207708_10031124 | Ga0207708_100311242 | 118 |
| 313 | 3300026075 | Ga0207708_10699232 | Ga0207708_106992322 | 118 |
| 314 | 3300026075 | Ga0207708_10764201 | Ga0207708_107642011 | 118 |
| 315 | 3300026075 | Ga0207708_11113690 | Ga0207708_111136902 | 118 |
| 316 | 3300026078 | Ga0207702_10149816 | Ga0207702_101498161 | 118 |
| 317 | 3300026078 | Ga0207702_10225637 | Ga0207702_102256372 | 118 |
| 318 | 3300026118 | Ga0207675_100358573 | Ga0207675_1003585732 | 118 |
| 319 | 3300026142 | Ga0207698_10772378 | Ga0207698_107723782 | 118 |
| 320 | 3300027682 | Ga0209971_1029609 | Ga0209971_10296092 | 118 |
| 321 | 3300027866 | Ga0209813_10018216 | Ga0209813_100182162 | 118 |
| 322 | 3300027866 | Ga0209813_10030413 | Ga0209813_100304132 | 118 |
| 323 | 3300027866 | Ga0209813_10176690 | Ga0209813_101766901 | 118 |
| 324 | 3300027907 | Ga0207428_10003247 | Ga0207428_100032479 | 118 |
| 325 | 3300028380 | Ga0268265_10051494 | Ga0268265_100514941 | 118 |
| 326 | 3300031548 | Ga0307408_100324684 | Ga0307408_1003246842 | 118 |
| 327 | 3300031731 | Ga0307405_10205354 | Ga0307405_102053542 | 118 |
| 328 | 3300031852 | Ga0307410_10052205 | Ga0307410_100522053 | 118 |
| 329 | 3300031901 | Ga0307406_11838811 | Ga0307406_118388111 | 118 |
| 330 | 3300031903 | Ga0307407_10274800 | Ga0307407_102748002 | 118 |
| 331 | 3300031911 | Ga0307412_11335117 | Ga0307412_113351172 | 118 |
| 332 | 3300031995 | Ga0307409_100088819 | Ga0307409_1000888192 | 118 |
| 333 | 3300031995 | Ga0307409_100630369 | Ga0307409_1006303692 | 118 |
| 334 | 3300032002 | Ga0307416_100006416 | Ga0307416_1000064164 | 118 |
| 335 | 3300032005 | Ga0307411_10027368 | Ga0307411_100273682 | 118 |
| 336 | 3300035086 | Ga0373934_0136435 | Ga0373934_0136435_573_950 | 118 |
| 337 | 3300035089 | Ga0373944_0067432 | Ga0373944_0067432_621_980 | 118 |
| 338 | 3300035118 | Ga0373954_0464738 | Ga0373954_0464738_98_475 | 118 |
| 339 | 3300035119 | Ga0373956_0550643 | Ga0373956_0550643_134_493 | 118 |
| 340 | 3300035171 | Ga0373946_0187164 | Ga0373946_0187164_329_688 | 118 |
| 341 | 3300035410 | Ga0373924_0417055 | Ga0373924_0417055_23_382 | 118 |
| 342 | 3300035692 | Ga0373935_0406277 | Ga0373935_0406277_481_840 | 118 |
| 343 | 3300035724 | Ga0373933_0314609 | Ga0373933_0314609_457_834 | 118 |
| 344 | 3300035725 | Ga0373947_0508393 | Ga0373947_0508393_129_506 | 118 |
| 345 | 3300036401 | Ga0373937_0553235 | Ga0373937_0553235_350_709 | 118 |
| 346 | 3300036401 | Ga0373937_0774386 | Ga0373937_0774386_228_587 | 118 |
| 347 | 3300037068 | Ga0373925_0141686 | Ga0373925_0141686_203_559 | 118 |
| 348 | 3300037466 | Ga0395898_0657269 | Ga0395898_0657269_246_605 | 118 |
| 349 | 3300041410 | Ga0439461_0210524 | Ga0439461_0210524_113_469 | 118 |
| 350 | 3300042436 | Ga0439435_0081378 | Ga0439435_0081378_551_907 | 118 |
| 351 | 3300042461 | Ga0439460_0085754 | Ga0439460_0085754_346_705 | 118 |
| 352 | 3300042461 | Ga0439460_0168790 | Ga0439460_0168790_248_604 | 118 |
| 353 | 3300045051 | Ga0451576_0508735 | Ga0451576_0508735_219_578 | 118 |
| 354 | 3300045976 | Ga0466967_0326134 | Ga0466967_0326134_141_497 | 118 |
| 355 | 3300046459 | Ga0495629_0048860 | Ga0495629_0048860_133_492 | 118 |
| 356 | 3300046460 | Ga0495638_0008188 | Ga0495638_0008188_1914_2273 | 118 |
| 357 | 3300046460 | Ga0495638_0159524 | Ga0495638_0159524_793_1149 | 118 |
| 358 | 3300046462 | Ga0495651_0734815 | Ga0495651_0734815_109_486 | 118 |
| 359 | 3300046472 | Ga0495580_0203587 | Ga0495580_0203587_349_726 | 118 |
| 360 | 3300046473 | Ga0495582_0197190 | Ga0495582_0197190_149_526 | 118 |
| 361 | 3300046473 | Ga0495582_0744393 | Ga0495582_0744393_146_502 | 118 |
| 362 | 3300046511 | Ga0495608_0002617 | Ga0495608_0002617_132_509 | 118 |
| 363 | 3300046516 | Ga0495628_0040510 | Ga0495628_0040510_435_812 | 118 |
| 364 | 3300046516 | Ga0495628_0151710 | Ga0495628_0151710_90_446 | 118 |
| 365 | 3300046517 | Ga0495630_0015118 | Ga0495630_0015118_4823_5200 | 118 |
| 366 | 3300046517 | Ga0495630_0986396 | Ga0495630_0986396_53_430 | 118 |
| 367 | 3300046525 | Ga0495663_0117327 | Ga0495663_0117327_175_540 | 118 |
| 368 | 3300046529 | Ga0495652_0212949 | Ga0495652_0212949_308_685 | 118 |
| 369 | 3300046531 | Ga0495665_0053238 | Ga0495665_0053238_668_1045 | 118 |
| 370 | 3300046535 | Ga0495586_0352909 | Ga0495586_0352909_286_663 | 118 |
| 371 | 3300046536 | Ga0495587_0015255 | Ga0495587_0015255_1662_2039 | 118 |
| 372 | 3300046536 | Ga0495587_0465028 | Ga0495587_0465028_239_601 | 118 |
| 373 | 3300046543 | Ga0495645_0088034 | Ga0495645_0088034_1064_1441 | 118 |
| 374 | 3300046559 | Ga0495667_0015027 | Ga0495667_0015027_4694_5071 | 118 |
| 375 | 3300046559 | Ga0495667_0276447 | Ga0495667_0276447_558_917 | 118 |
| 376 | 3300046615 | Ga0495656_0463212 | Ga0495656_0463212_222_578 | 118 |
| 377 | 3300046663 | Ga0495635_0685285 | Ga0495635_0685285_188_547 | 118 |
| 378 | 3300046664 | Ga0495659_0447166 | Ga0495659_0447166_74_430 | 118 |
| 379 | 3300046681 | Ga0495647_0053986 | Ga0495647_0053986_526_903 | 118 |
| 380 | 3300046681 | Ga0495647_0164920 | Ga0495647_0164920_19_378 | 118 |
| 381 | 3300046684 | Ga0495669_0004290 | Ga0495669_0004290_513_890 | 118 |
| 382 | 3300046689 | Ga0495613_0000460 | Ga0495613_0000460_8569_8946 | 118 |
| 383 | 3300046809 | Ga0495600_0064883 | Ga0495600_0064883_523_900 | 118 |
| 384 | 3300046809 | Ga0495600_0147941 | Ga0495600_0147941_569_928 | 118 |
| 385 | 3300047315 | Ga0495581_0614559 | Ga0495581_0614559_21_398 | 118 |
| 386 | 3300047317 | Ga0495604_0022896 | Ga0495604_0022896_253_630 | 118 |
| 387 | 3300047319 | Ga0495674_0204527 | Ga0495674_0204527_1101_1460 | 118 |
| 388 | 3300047444 | Ga0495675_0086686 | Ga0495675_0086686_282_659 | 118 |
| 389 | 3300047471 | Ga0495684_0000011 | Ga0495684_0000011_173354_173731 | 118 |
| 390 | 3300048907 | Ga0496104_0190219 | Ga0496104_0190219_1391_1747 | 118 |
| 391 | 3300048913 | Ga0496110_0851591 | Ga0496110_0851591_177_533 | 118 |
| 392 | 3300048915 | Ga0496112_0250188 | Ga0496112_0250188_1166_1525 | 118 |
| 393 | 3300048917 | Ga0496114_0020936 | Ga0496114_0020936_1670_2047 | 118 |
| 394 | 3300048917 | Ga0496114_0459142 | Ga0496114_0459142_416_775 | 118 |
| 395 | 3300049572 | Ga0501036_0085962 | Ga0501036_0085962_1542_1898 | 118 |
| 396 | 3300049572 | Ga0501036_1547782 | Ga0501036_1547782_85_441 | 118 |
| 397 | 3300049575 | Ga0501039_1024109 | Ga0501039_1024109_231_587 | 118 |
| 398 | 3300049576 | Ga0501040_0081902 | Ga0501040_0081902_1525_1881 | 118 |
| 399 | 3300049577 | Ga0501041_0558089 | Ga0501041_0558089_127_483 | 118 |
| 400 | 3300049577 | Ga0501041_0681295 | Ga0501041_0681295_76_432 | 118 |
| 401 | 3300049578 | Ga0501042_0245811 | Ga0501042_0245811_627_983 | 118 |
| 402 | 3300049582 | Ga0501048_0126263 | Ga0501048_0126263_392_748 | 118 |
| 403 | 3300049587 | Ga0501071_0227948 | Ga0501071_0227948_1015_1371 | 118 |
| 404 | 3300049588 | Ga0501072_0139036 | Ga0501072_0139036_171_527 | 118 |
| 405 | 3300049588 | Ga0501072_0248440 | Ga0501072_0248440_953_1315 | 118 |
| 406 | 3300049591 | Ga0501075_0115421 | Ga0501075_0115421_137_493 | 118 |
| 407 | 3300049591 | Ga0501075_0456567 | Ga0501075_0456567_424_780 | 118 |
| 408 | 3300049591 | Ga0501075_0616205 | Ga0501075_0616205_373_729 | 118 |
| 409 | 3300049592 | Ga0501076_0171493 | Ga0501076_0171493_1127_1483 | 118 |
| 410 | 3300049592 | Ga0501076_0476171 | Ga0501076_0476171_148_504 | 118 |
| 411 | 3300049592 | Ga0501076_0540538 | Ga0501076_0540538_519_881 | 118 |
| 412 | 3300049592 | Ga0501076_0774979 | Ga0501076_0774979_412_777 | 118 |
| 413 | 3300049668 | Ga0501233_088484 | Ga0501233_088484_386_742 | 118 |
| 414 | 3300049704 | Ga0501221_123152 | Ga0501221_123152_92_448 | 118 |
| 415 | 3300049741 | Ga0501079_0087881 | Ga0501079_0087881_606_962 | 118 |
| 416 | 3300049741 | Ga0501079_0190006 | Ga0501079_0190006_356_712 | 118 |
| 417 | 3300049824 | Ga0501045_0599848 | Ga0501045_0599848_286_642 | 118 |
| 418 | 3300049824 | Ga0501045_1194561 | Ga0501045_1194561_174_530 | 118 |
| 419 | 3300049824 | Ga0501045_1301088 | Ga0501045_1301088_103_468 | 118 |
| 420 | 3300050489 | nmdc:mga03683_17494_c1 | nmdc:mga03683_17494_c1_1719_2075 | 118 |
| 421 | 3300050489 | nmdc:mga03683_62505_c1 | nmdc:mga03683_62505_c1_534_890 | 118 |
| 422 | 3300050491 | nmdc:mga00v17_1193_c1 | nmdc:mga00v17_1193_c1_6548_6904 | 118 |
| 423 | 3300050491 | nmdc:mga00v17_17412_c1 | nmdc:mga00v17_17412_c1_2217_2573 | 118 |
| 424 | 3300050491 | nmdc:mga00v17_179328_c1 | nmdc:mga00v17_179328_c1_353_709 | 118 |
| 425 | 3300050491 | nmdc:mga00v17_87170_c1 | nmdc:mga00v17_87170_c1_12_368 | 118 |
| 426 | 3300050492 | nmdc:mga0yw44_217631_c1 | nmdc:mga0yw44_217631_c1_137_493 | 118 |
| 427 | 3300050492 | nmdc:mga0yw44_296469_c1 | nmdc:mga0yw44_296469_c1_598_954 | 118 |
| 428 | 3300050492 | nmdc:mga0yw44_895760_c1 | nmdc:mga0yw44_895760_c1_41_397 | 118 |
| 429 | 3300050493 | nmdc:mga0k408_4489_c1 | nmdc:mga0k408_4489_c1_3563_3919 | 118 |
| 430 | 3300050493 | nmdc:mga0k408_5002_c1 | nmdc:mga0k408_5002_c1_475_831 | 118 |
| 431 | 3300050494 | nmdc:mga06z11_144648_c1 | nmdc:mga06z11_144648_c1_585_941 | 118 |
| 432 | 3300050494 | nmdc:mga06z11_3134_c1 | nmdc:mga06z11_3134_c1_3122_3478 | 118 |
| 433 | 3300050494 | nmdc:mga06z11_81981_c1 | nmdc:mga06z11_81981_c1_160_516 | 118 |
| 434 | 3300050495 | nmdc:mga04h51_13562_c1 | nmdc:mga04h51_13562_c1_1511_1867 | 118 |
| 435 | 3300050495 | nmdc:mga04h51_30179_c1 | nmdc:mga04h51_30179_c1_42_398 | 118 |
| 436 | 3300050495 | nmdc:mga04h51_49263_c1 | nmdc:mga04h51_49263_c1_328_684 | 118 |
| 437 | 3300050496 | nmdc:mga07m45_103918_c1 | nmdc:mga07m45_103918_c1_625_981 | 118 |
| 438 | 3300050496 | nmdc:mga07m45_28294_c1 | nmdc:mga07m45_28294_c1_1373_1729 | 118 |
| 439 | 3300050496 | nmdc:mga07m45_828324_c1 | nmdc:mga07m45_828324_c1_21_377 | 118 |
| 440 | 3300050507 | nmdc:mga05p37_1059743_c1 | nmdc:mga05p37_1059743_c1_94_450 | 118 |
| 441 | 3300050507 | nmdc:mga05p37_1074_c1 | nmdc:mga05p37_1074_c1_6890_7246 | 118 |
| 442 | 3300050507 | nmdc:mga05p37_1100493_c1 | nmdc:mga05p37_1100493_c1_70_426 | 118 |
| 443 | 3300050507 | nmdc:mga05p37_142726_c1 | nmdc:mga05p37_142726_c1_720_1076 | 118 |
| 444 | 3300050507 | nmdc:mga05p37_1756659_c1 | nmdc:mga05p37_1756659_c1_163_534 | 118 |
| 445 | 3300050507 | nmdc:mga05p37_410546_c1 | nmdc:mga05p37_410546_c1_821_1177 | 118 |
| 446 | 3300050508 | nmdc:mga09592_1025445_c1 | nmdc:mga09592_1025445_c1_24_380 | 118 |
| 447 | 3300050508 | nmdc:mga09592_1162425_c1 | nmdc:mga09592_1162425_c1_11_367 | 118 |
| 448 | 3300050508 | nmdc:mga09592_1226319_c1 | nmdc:mga09592_1226319_c1_236_592 | 118 |
| 449 | 3300050508 | nmdc:mga09592_66881_c1 | nmdc:mga09592_66881_c1_680_1036 | 118 |
| 450 | 3300050509 | nmdc:mga0qj67_72318_c1 | nmdc:mga0qj67_72318_c1_498_869 | 118 |
| 451 | 3300050510 | nmdc:mga06r32_100925_c1 | nmdc:mga06r32_100925_c1_2078_2434 | 118 |
| 452 | 3300050510 | nmdc:mga06r32_102168_c1 | nmdc:mga06r32_102168_c1_1142_1498 | 118 |
| 453 | 3300050510 | nmdc:mga06r32_26338_c1 | nmdc:mga06r32_26338_c1_5016_5372 | 118 |
| 454 | 3300050510 | nmdc:mga06r32_444497_c1 | nmdc:mga06r32_444497_c1_300_656 | 118 |
| 455 | 3300050510 | nmdc:mga06r32_732389_c1 | nmdc:mga06r32_732389_c1_251_610 | 118 |
| 456 | 3300050510 | nmdc:mga06r32_881906_c1 | nmdc:mga06r32_881906_c1_80_451 | 118 |
| 457 | 3300050511 | nmdc:mga08y16_1685044_c1 | nmdc:mga08y16_1685044_c1_147_503 | 118 |
| 458 | 3300050511 | nmdc:mga08y16_7416_c1 | nmdc:mga08y16_7416_c1_3638_3994 | 118 |
| 459 | 3300050511 | nmdc:mga08y16_8907_c1 | nmdc:mga08y16_8907_c1_1845_2201 | 118 |
| 460 | 3300050512 | nmdc:mga0n895_1997708_c1 | nmdc:mga0n895_1997708_c1_111_467 | 118 |
| 461 | 3300050512 | nmdc:mga0n895_394318_c1 | nmdc:mga0n895_394318_c1_570_926 | 118 |
| 462 | 3300050512 | nmdc:mga0n895_421558_c1 | nmdc:mga0n895_421558_c1_33_389 | 118 |
| 463 | 3300050513 | nmdc:mga0rr50_793989_c1 | nmdc:mga0rr50_793989_c1_355_711 | 118 |
| 464 | 3300050515 | nmdc:mga0a205_196988_c2 | nmdc:mga0a205_196988_c2_947_1303 | 118 |
| 465 | 3300050516 | nmdc:mga0sz30_281466_c1 | nmdc:mga0sz30_281466_c1_39_395 | 118 |
| 466 | 3300050516 | nmdc:mga0sz30_51515_c1 | nmdc:mga0sz30_51515_c1_27_383 | 118 |
| 467 | 3300053077 | Ga0495601_0001021 | Ga0495601_0001021_8831_9208 | 118 |
| 468 | 3300053077 | Ga0495601_0095336 | Ga0495601_0095336_569_943 | 118 |
| 469 | 3300053085 | Ga0495619_0000905 | Ga0495619_0000905_17511_17888 | 118 |
| 470 | 3300053085 | Ga0495619_0248557 | Ga0495619_0248557_716_1075 | 118 |
| 471 | 3300053103 | Ga0500555_060744 | Ga0500555_060744_463_819 | 118 |
| 472 | 3300054114 | Ga0501084_0576016 | Ga0501084_0576016_412_768 | 118 |
| 473 | 3300054114 | Ga0501084_1815246 | Ga0501084_1815246_129_485 | 118 |
| 474 | 3300059426 | Ga0590077_041235 | Ga0590077_041235_393_755 | 118 |
| 475 | 3300000041 | ARcpr5oldR_c028613 | ARcpr5oldR_0286132 | 119 |
| 476 | 3300002459 | JGI24751J29686_10067055 | JGI24751J29686_100670552 | 119 |
| 477 | 3300005288 | Ga0065714_10237464 | Ga0065714_102374642 | 119 |
| 478 | 3300005290 | Ga0065712_10000261 | Ga0065712_100002617 | 119 |
| 479 | 3300005290 | Ga0065712_10072631 | Ga0065712_100726317 | 119 |
| 480 | 3300005290 | Ga0065712_10117680 | Ga0065712_101176802 | 119 |
| 481 | 3300005293 | Ga0065715_10000251 | Ga0065715_1000025119 | 119 |
| 482 | 3300005293 | Ga0065715_10095529 | Ga0065715_100955293 | 119 |
| 483 | 3300005293 | Ga0065715_10114170 | Ga0065715_101141702 | 119 |
| 484 | 3300005293 | Ga0065715_10160573 | Ga0065715_101605731 | 119 |
| 485 | 3300005293 | Ga0065715_10416155 | Ga0065715_104161552 | 119 |
| 486 | 3300005293 | Ga0065715_10618242 | Ga0065715_106182422 | 119 |
| 487 | 3300005295 | Ga0065707_10089470 | Ga0065707_100894702 | 119 |
| 488 | 3300005295 | Ga0065707_10227589 | Ga0065707_102275891 | 119 |
| 489 | 3300005295 | Ga0065707_10248989 | Ga0065707_102489891 | 119 |
| 490 | 3300005295 | Ga0065707_10548712 | Ga0065707_105487122 | 119 |
| 491 | 3300005295 | Ga0065707_10565670 | Ga0065707_105656702 | 119 |
| 492 | 3300005328 | Ga0070676_10014126 | Ga0070676_100141263 | 119 |
| 493 | 3300005328 | Ga0070676_11230938 | Ga0070676_112309381 | 119 |
| 494 | 3300005330 | Ga0070690_100013923 | Ga0070690_1000139232 | 119 |
| 495 | 3300005331 | Ga0070670_100008131 | Ga0070670_1000081315 | 119 |
| 496 | 3300005331 | Ga0070670_100046942 | Ga0070670_1000469421 | 119 |
| 497 | 3300005331 | Ga0070670_100088676 | Ga0070670_1000886762 | 119 |
| 498 | 3300005331 | Ga0070670_100660785 | Ga0070670_1006607851 | 119 |
| 499 | 3300005331 | Ga0070670_100712674 | Ga0070670_1007126742 | 119 |
| 500 | 3300005333 | Ga0070677_10118080 | Ga0070677_101180802 | 119 |
| 501 | 3300005335 | Ga0070666_10048887 | Ga0070666_100488872 | 119 |
| 502 | 3300005335 | Ga0070666_10136296 | Ga0070666_101362962 | 119 |
| 503 | 3300005336 | Ga0070680_100036963 | Ga0070680_1000369632 | 119 |
| 504 | 3300005336 | Ga0070680_100390921 | Ga0070680_1003909212 | 119 |
| 505 | 3300005338 | Ga0068868_100166543 | Ga0068868_1001665432 | 119 |
| 506 | 3300005338 | Ga0068868_101913606 | Ga0068868_1019136061 | 119 |
| 507 | 3300005339 | Ga0070660_100009760 | Ga0070660_1000097602 | 119 |
| 508 | 3300005340 | Ga0070689_100156391 | Ga0070689_1001563912 | 119 |
| 509 | 3300005340 | Ga0070689_100160313 | Ga0070689_1001603132 | 119 |
| 510 | 3300005340 | Ga0070689_101206770 | Ga0070689_1012067702 | 119 |
| 511 | 3300005341 | Ga0070691_10016048 | Ga0070691_100160482 | 119 |
| 512 | 3300005343 | Ga0070687_100424554 | Ga0070687_1004245542 | 119 |
| 513 | 3300005343 | Ga0070687_100812995 | Ga0070687_1008129952 | 119 |
| 514 | 3300005344 | Ga0070661_100408754 | Ga0070661_1004087542 | 119 |
| 515 | 3300005344 | Ga0070661_101336254 | Ga0070661_1013362541 | 119 |
| 516 | 3300005345 | Ga0070692_10056486 | Ga0070692_100564862 | 119 |
| 517 | 3300005345 | Ga0070692_10583161 | Ga0070692_105831612 | 119 |
| 518 | 3300005345 | Ga0070692_10591783 | Ga0070692_105917832 | 119 |
| 519 | 3300005347 | Ga0070668_100590300 | Ga0070668_1005903002 | 119 |
| 520 | 3300005353 | Ga0070669_100004180 | Ga0070669_1000041803 | 119 |
| 521 | 3300005353 | Ga0070669_100029543 | Ga0070669_1000295432 | 119 |
| 522 | 3300005353 | Ga0070669_100036392 | Ga0070669_1000363922 | 119 |
| 523 | 3300005353 | Ga0070669_100185858 | Ga0070669_1001858582 | 119 |
| 524 | 3300005353 | Ga0070669_100364298 | Ga0070669_1003642982 | 119 |
| 525 | 3300005353 | Ga0070669_101125425 | Ga0070669_1011254252 | 119 |
| 526 | 3300005354 | Ga0070675_100005779 | Ga0070675_1000057792 | 119 |
| 527 | 3300005354 | Ga0070675_100038879 | Ga0070675_1000388793 | 119 |
| 528 | 3300005354 | Ga0070675_100450560 | Ga0070675_1004505601 | 119 |
| 529 | 3300005354 | Ga0070675_100698294 | Ga0070675_1006982941 | 119 |
| 530 | 3300005355 | Ga0070671_100093414 | Ga0070671_1000934142 | 119 |
| 531 | 3300005356 | Ga0070674_100004715 | Ga0070674_1000047155 | 119 |
| 532 | 3300005356 | Ga0070674_100013234 | Ga0070674_1000132342 | 119 |
| 533 | 3300005356 | Ga0070674_100214611 | Ga0070674_1002146112 | 119 |
| 534 | 3300005356 | Ga0070674_100826126 | Ga0070674_1008261262 | 119 |
| 535 | 3300005356 | Ga0070674_101031945 | Ga0070674_1010319451 | 119 |
| 536 | 3300005364 | Ga0070673_100075355 | Ga0070673_1000753552 | 119 |
| 537 | 3300005364 | Ga0070673_100102739 | Ga0070673_1001027392 | 119 |
| 538 | 3300005364 | Ga0070673_100193991 | Ga0070673_1001939912 | 119 |
| 539 | 3300005364 | Ga0070673_100877957 | Ga0070673_1008779572 | 119 |
| 540 | 3300005364 | Ga0070673_101695677 | Ga0070673_1016956771 | 119 |
| 541 | 3300005365 | Ga0070688_100079089 | Ga0070688_1000790892 | 119 |
| 542 | 3300005365 | Ga0070688_100637717 | Ga0070688_1006377172 | 119 |
| 543 | 3300005365 | Ga0070688_100723341 | Ga0070688_1007233411 | 119 |
| 544 | 3300005365 | Ga0070688_100850066 | Ga0070688_1008500662 | 119 |
| 545 | 3300005366 | Ga0070659_100087517 | Ga0070659_1000875172 | 119 |
| 546 | 3300005367 | Ga0070667_100054603 | Ga0070667_1000546033 | 119 |
| 547 | 3300005367 | Ga0070667_100068794 | Ga0070667_1000687942 | 119 |
| 548 | 3300005406 | Ga0070703_10624090 | Ga0070703_106240901 | 119 |
| 549 | 3300005434 | Ga0070709_10173612 | Ga0070709_101736121 | 119 |
| 550 | 3300005434 | Ga0070709_10554034 | Ga0070709_105540342 | 119 |
| 551 | 3300005435 | Ga0070714_100005079 | Ga0070714_1000050795 | 119 |
| 552 | 3300005437 | Ga0070710_10233543 | Ga0070710_102335432 | 119 |
| 553 | 3300005438 | Ga0070701_10027299 | Ga0070701_100272992 | 119 |
| 554 | 3300005439 | Ga0070711_100209442 | Ga0070711_1002094421 | 119 |
| 555 | 3300005439 | Ga0070711_100252838 | Ga0070711_1002528381 | 119 |
| 556 | 3300005440 | Ga0070705_100003440 | Ga0070705_1000034404 | 119 |
| 557 | 3300005440 | Ga0070705_100079567 | Ga0070705_1000795672 | 119 |
| 558 | 3300005440 | Ga0070705_100424439 | Ga0070705_1004244392 | 119 |
| 559 | 3300005441 | Ga0070700_100022249 | Ga0070700_1000222492 | 119 |
| 560 | 3300005441 | Ga0070700_100029344 | Ga0070700_1000293442 | 119 |
| 561 | 3300005441 | Ga0070700_100114917 | Ga0070700_1001149172 | 119 |
| 562 | 3300005441 | Ga0070700_100504777 | Ga0070700_1005047772 | 119 |
| 563 | 3300005441 | Ga0070700_100592085 | Ga0070700_1005920851 | 119 |
| 564 | 3300005441 | Ga0070700_100719299 | Ga0070700_1007192991 | 119 |
| 565 | 3300005444 | Ga0070694_100231845 | Ga0070694_1002318452 | 119 |
| 566 | 3300005444 | Ga0070694_100383610 | Ga0070694_1003836102 | 119 |
| 567 | 3300005445 | Ga0070708_100890556 | Ga0070708_1008905562 | 119 |
| 568 | 3300005455 | Ga0070663_100809119 | Ga0070663_1008091192 | 119 |
| 569 | 3300005455 | Ga0070663_102004271 | Ga0070663_1020042711 | 119 |
| 570 | 3300005456 | Ga0070678_100055031 | Ga0070678_1000550312 | 119 |
| 571 | 3300005456 | Ga0070678_100328190 | Ga0070678_1003281902 | 119 |
| 572 | 3300005457 | Ga0070662_100029984 | Ga0070662_1000299842 | 119 |
| 573 | 3300005458 | Ga0070681_10000782 | Ga0070681_100007822 | 119 |
| 574 | 3300005458 | Ga0070681_11384876 | Ga0070681_113848761 | 119 |
| 575 | 3300005459 | Ga0068867_100186937 | Ga0068867_1001869372 | 119 |
| 576 | 3300005459 | Ga0068867_100225292 | Ga0068867_1002252922 | 119 |
| 577 | 3300005459 | Ga0068867_100245237 | Ga0068867_1002452372 | 119 |
| 578 | 3300005459 | Ga0068867_101178085 | Ga0068867_1011780851 | 119 |
| 579 | 3300005466 | Ga0070685_10007059 | Ga0070685_100070592 | 119 |
| 580 | 3300005466 | Ga0070685_10176490 | Ga0070685_101764902 | 119 |
| 581 | 3300005466 | Ga0070685_10452236 | Ga0070685_104522362 | 119 |
| 582 | 3300005467 | Ga0070706_100234597 | Ga0070706_1002345972 | 119 |
| 583 | 3300005467 | Ga0070706_100766602 | Ga0070706_1007666021 | 119 |
| 584 | 3300005467 | Ga0070706_101322290 | Ga0070706_1013222901 | 119 |
| 585 | 3300005468 | Ga0070707_100105604 | Ga0070707_1001056042 | 119 |
| 586 | 3300005468 | Ga0070707_100461168 | Ga0070707_1004611681 | 119 |
| 587 | 3300005468 | Ga0070707_100815876 | Ga0070707_1008158761 | 119 |
| 588 | 3300005468 | Ga0070707_101820917 | Ga0070707_1018209171 | 119 |
| 589 | 3300005468 | Ga0070707_101900463 | Ga0070707_1019004631 | 119 |
| 590 | 3300005471 | Ga0070698_100081682 | Ga0070698_1000816822 | 119 |
| 591 | 3300005471 | Ga0070698_100507008 | Ga0070698_1005070082 | 119 |
| 592 | 3300005518 | Ga0070699_100098836 | Ga0070699_1000988363 | 119 |
| 593 | 3300005518 | Ga0070699_100651999 | Ga0070699_1006519992 | 119 |
| 594 | 3300005518 | Ga0070699_100653420 | Ga0070699_1006534202 | 119 |
| 595 | 3300005518 | Ga0070699_101589618 | Ga0070699_1015896181 | 119 |
| 596 | 3300005518 | Ga0070699_101993021 | Ga0070699_1019930211 | 119 |
| 597 | 3300005530 | Ga0070679_100043801 | Ga0070679_1000438013 | 119 |
| 598 | 3300005530 | Ga0070679_101715518 | Ga0070679_1017155181 | 119 |
| 599 | 3300005535 | Ga0070684_100453868 | Ga0070684_1004538682 | 119 |
| 600 | 3300005535 | Ga0070684_100504122 | Ga0070684_1005041221 | 119 |
| 601 | 3300005536 | Ga0070697_100025752 | Ga0070697_1000257522 | 119 |
| 602 | 3300005536 | Ga0070697_100131184 | Ga0070697_1001311842 | 119 |
| 603 | 3300005536 | Ga0070697_100970599 | Ga0070697_1009705992 | 119 |
| 604 | 3300005536 | Ga0070697_101167418 | Ga0070697_1011674181 | 119 |
| 605 | 3300005539 | Ga0068853_100384142 | Ga0068853_1003841421 | 119 |
| 606 | 3300005539 | Ga0068853_101150651 | Ga0068853_1011506511 | 119 |
| 607 | 3300005539 | Ga0068853_101600232 | Ga0068853_1016002321 | 119 |
| 608 | 3300005543 | Ga0070672_100006193 | Ga0070672_1000061933 | 119 |
| 609 | 3300005543 | Ga0070672_100113621 | Ga0070672_1001136212 | 119 |
| 610 | 3300005543 | Ga0070672_100231730 | Ga0070672_1002317302 | 119 |
| 611 | 3300005543 | Ga0070672_100374073 | Ga0070672_1003740732 | 119 |
| 612 | 3300005543 | Ga0070672_100549111 | Ga0070672_1005491111 | 119 |
| 613 | 3300005543 | Ga0070672_101918994 | Ga0070672_1019189941 | 119 |
| 614 | 3300005544 | Ga0070686_100011242 | Ga0070686_1000112421 | 119 |
| 615 | 3300005544 | Ga0070686_100015118 | Ga0070686_1000151182 | 119 |
| 616 | 3300005544 | Ga0070686_100252521 | Ga0070686_1002525211 | 119 |
| 617 | 3300005544 | Ga0070686_100762355 | Ga0070686_1007623552 | 119 |
| 618 | 3300005545 | Ga0070695_100051838 | Ga0070695_1000518382 | 119 |
| 619 | 3300005545 | Ga0070695_100295488 | Ga0070695_1002954882 | 119 |
| 620 | 3300005545 | Ga0070695_100484690 | Ga0070695_1004846902 | 119 |
| 621 | 3300005545 | Ga0070695_100700554 | Ga0070695_1007005541 | 119 |
| 622 | 3300005546 | Ga0070696_100006942 | Ga0070696_1000069422 | 119 |
| 623 | 3300005546 | Ga0070696_101768150 | Ga0070696_1017681501 | 119 |
| 624 | 3300005547 | Ga0070693_100754947 | Ga0070693_1007549472 | 119 |
| 625 | 3300005548 | Ga0070665_100336432 | Ga0070665_1003364322 | 119 |
| 626 | 3300005548 | Ga0070665_101110679 | Ga0070665_1011106792 | 119 |
| 627 | 3300005548 | Ga0070665_101216807 | Ga0070665_1012168072 | 119 |
| 628 | 3300005548 | Ga0070665_101443081 | Ga0070665_1014430811 | 119 |
| 629 | 3300005549 | Ga0070704_100005455 | Ga0070704_1000054554 | 119 |
| 630 | 3300005549 | Ga0070704_100027621 | Ga0070704_1000276212 | 119 |
| 631 | 3300005549 | Ga0070704_100342321 | Ga0070704_1003423212 | 119 |
| 632 | 3300005549 | Ga0070704_100378046 | Ga0070704_1003780461 | 119 |
| 633 | 3300005549 | Ga0070704_100785310 | Ga0070704_1007853102 | 119 |
| 634 | 3300005563 | Ga0068855_100450789 | Ga0068855_1004507892 | 119 |
| 635 | 3300005563 | Ga0068855_101390594 | Ga0068855_1013905942 | 119 |
| 636 | 3300005564 | Ga0070664_100042065 | Ga0070664_1000420652 | 119 |
| 637 | 3300005564 | Ga0070664_102212294 | Ga0070664_1022122942 | 119 |
| 638 | 3300005577 | Ga0068857_100130772 | Ga0068857_1001307723 | 119 |
| 639 | 3300005578 | Ga0068854_100006513 | Ga0068854_1000065136 | 119 |
| 640 | 3300005578 | Ga0068854_100172947 | Ga0068854_1001729472 | 119 |
| 641 | 3300005614 | Ga0068856_102052920 | Ga0068856_1020529201 | 119 |
| 642 | 3300005615 | Ga0070702_100014267 | Ga0070702_1000142674 | 119 |
| 643 | 3300005615 | Ga0070702_100617939 | Ga0070702_1006179392 | 119 |
| 644 | 3300005615 | Ga0070702_101277818 | Ga0070702_1012778181 | 119 |
| 645 | 3300005616 | Ga0068852_100494432 | Ga0068852_1004944322 | 119 |
| 646 | 3300005616 | Ga0068852_102267282 | Ga0068852_1022672821 | 119 |
| 647 | 3300005617 | Ga0068859_100034539 | Ga0068859_1000345393 | 119 |
| 648 | 3300005617 | Ga0068859_100124888 | Ga0068859_1001248883 | 119 |
| 649 | 3300005617 | Ga0068859_100161431 | Ga0068859_1001614312 | 119 |
| 650 | 3300005617 | Ga0068859_100271587 | Ga0068859_1002715872 | 119 |
| 651 | 3300005617 | Ga0068859_100428074 | Ga0068859_1004280743 | 119 |
| 652 | 3300005617 | Ga0068859_100793627 | Ga0068859_1007936272 | 119 |
| 653 | 3300005617 | Ga0068859_101000724 | Ga0068859_1010007241 | 119 |
| 654 | 3300005617 | Ga0068859_101066605 | Ga0068859_1010666051 | 119 |
| 655 | 3300005617 | Ga0068859_101470818 | Ga0068859_1014708182 | 119 |
| 656 | 3300005617 | Ga0068859_102495541 | Ga0068859_1024955411 | 119 |
| 657 | 3300005618 | Ga0068864_100004878 | Ga0068864_1000048785 | 119 |
| 658 | 3300005618 | Ga0068864_100011781 | Ga0068864_1000117813 | 119 |
| 659 | 3300005618 | Ga0068864_100131310 | Ga0068864_1001313103 | 119 |
| 660 | 3300005618 | Ga0068864_100436837 | Ga0068864_1004368372 | 119 |
| 661 | 3300005618 | Ga0068864_100829409 | Ga0068864_1008294092 | 119 |
| 662 | 3300005618 | Ga0068864_101077561 | Ga0068864_1010775611 | 119 |
| 663 | 3300005618 | Ga0068864_101902919 | Ga0068864_1019029191 | 119 |
| 664 | 3300005718 | Ga0068866_10199737 | Ga0068866_101997372 | 119 |
| 665 | 3300005718 | Ga0068866_10921711 | Ga0068866_109217112 | 119 |
| 666 | 3300005719 | Ga0068861_100052201 | Ga0068861_1000522012 | 119 |
| 667 | 3300005719 | Ga0068861_100062989 | Ga0068861_1000629891 | 119 |
| 668 | 3300005719 | Ga0068861_100136974 | Ga0068861_1001369742 | 119 |
| 669 | 3300005719 | Ga0068861_100233003 | Ga0068861_1002330034 | 119 |
| 670 | 3300005719 | Ga0068861_101188066 | Ga0068861_1011880662 | 119 |
| 671 | 3300005840 | Ga0068870_10449789 | Ga0068870_104497892 | 119 |
| 672 | 3300005840 | Ga0068870_10504745 | Ga0068870_105047451 | 119 |
| 673 | 3300005840 | Ga0068870_10632440 | Ga0068870_106324402 | 119 |
| 674 | 3300005841 | Ga0068863_100032588 | Ga0068863_1000325883 | 119 |
| 675 | 3300005841 | Ga0068863_100234500 | Ga0068863_1002345003 | 119 |
| 676 | 3300005841 | Ga0068863_100515578 | Ga0068863_1005155782 | 119 |
| 677 | 3300005841 | Ga0068863_101061306 | Ga0068863_1010613061 | 119 |
| 678 | 3300005841 | Ga0068863_101065099 | Ga0068863_1010650992 | 119 |
| 679 | 3300005841 | Ga0068863_102006524 | Ga0068863_1020065242 | 119 |
| 680 | 3300005842 | Ga0068858_100012933 | Ga0068858_1000129332 | 119 |
| 681 | 3300005842 | Ga0068858_100158166 | Ga0068858_1001581662 | 119 |
| 682 | 3300005842 | Ga0068858_100175178 | Ga0068858_1001751782 | 119 |
| 683 | 3300005842 | Ga0068858_100478445 | Ga0068858_1004784451 | 119 |
| 684 | 3300005842 | Ga0068858_100739476 | Ga0068858_1007394762 | 119 |
| 685 | 3300005842 | Ga0068858_101341489 | Ga0068858_1013414891 | 119 |
| 686 | 3300005843 | Ga0068860_100369821 | Ga0068860_1003698212 | 119 |
| 687 | 3300005843 | Ga0068860_100372149 | Ga0068860_1003721492 | 119 |
| 688 | 3300005843 | Ga0068860_100619072 | Ga0068860_1006190722 | 119 |
| 689 | 3300005843 | Ga0068860_100649456 | Ga0068860_1006494562 | 119 |
| 690 | 3300005843 | Ga0068860_101895028 | Ga0068860_1018950281 | 119 |
| 691 | 3300005843 | Ga0068860_102040477 | Ga0068860_1020404771 | 119 |
| 692 | 3300005844 | Ga0068862_100025690 | Ga0068862_1000256903 | 119 |
| 693 | 3300005844 | Ga0068862_100040059 | Ga0068862_1000400592 | 119 |
| 694 | 3300005844 | Ga0068862_100098005 | Ga0068862_1000980053 | 119 |
| 695 | 3300005844 | Ga0068862_100498796 | Ga0068862_1004987962 | 119 |
| 696 | 3300005844 | Ga0068862_100599666 | Ga0068862_1005996662 | 119 |
| 697 | 3300005844 | Ga0068862_101198571 | Ga0068862_1011985712 | 119 |
| 698 | 3300005844 | Ga0068862_101258093 | Ga0068862_1012580932 | 119 |
| 699 | 3300005844 | Ga0068862_102272539 | Ga0068862_1022725391 | 119 |
| 700 | 3300005937 | Ga0081455_10088091 | Ga0081455_100880912 | 119 |
| 701 | 3300005937 | Ga0081455_10428229 | Ga0081455_104282292 | 119 |
| 702 | 3300006028 | Ga0070717_10749092 | Ga0070717_107490922 | 119 |
| 703 | 3300006051 | Ga0075364_10110526 | Ga0075364_101105262 | 119 |
| 704 | 3300006058 | Ga0075432_10013119 | Ga0075432_100131192 | 119 |
| 705 | 3300006058 | Ga0075432_10168821 | Ga0075432_101688212 | 119 |
| 706 | 3300006163 | Ga0070715_10691666 | Ga0070715_106916661 | 119 |
| 707 | 3300006195 | Ga0075366_10093834 | Ga0075366_100938342 | 119 |
| 708 | 3300006195 | Ga0075366_10560787 | Ga0075366_105607872 | 119 |
| 709 | 3300006237 | Ga0097621_100502104 | Ga0097621_1005021041 | 119 |
| 710 | 3300006358 | Ga0068871_100895743 | Ga0068871_1008957432 | 119 |
| 711 | 3300006358 | Ga0068871_101323190 | Ga0068871_1013231902 | 119 |
| 712 | 3300006358 | Ga0068871_101486101 | Ga0068871_1014861012 | 119 |
| 713 | 3300006844 | Ga0075428_100131541 | Ga0075428_1001315412 | 119 |
| 714 | 3300006844 | Ga0075428_100189265 | Ga0075428_1001892652 | 119 |
| 715 | 3300006844 | Ga0075428_100456639 | Ga0075428_1004566392 | 119 |
| 716 | 3300006844 | Ga0075428_101362912 | Ga0075428_1013629121 | 119 |
| 717 | 3300006846 | Ga0075430_100004264 | Ga0075430_10000426414 | 119 |
| 718 | 3300006846 | Ga0075430_100094266 | Ga0075430_1000942662 | 119 |
| 719 | 3300006846 | Ga0075430_100389260 | Ga0075430_1003892602 | 119 |
| 720 | 3300006846 | Ga0075430_100712766 | Ga0075430_1007127662 | 119 |
| 721 | 3300006847 | Ga0075431_100052235 | Ga0075431_1000522352 | 119 |
| 722 | 3300006847 | Ga0075431_100094687 | Ga0075431_1000946872 | 119 |
| 723 | 3300006847 | Ga0075431_100098924 | Ga0075431_1000989242 | 119 |
| 724 | 3300006847 | Ga0075431_100305028 | Ga0075431_1003050282 | 119 |
| 725 | 3300006847 | Ga0075431_100690784 | Ga0075431_1006907842 | 119 |
| 726 | 3300006847 | Ga0075431_101925836 | Ga0075431_1019258361 | 119 |
| 727 | 3300006852 | Ga0075433_10003835 | Ga0075433_100038358 | 119 |
| 728 | 3300006852 | Ga0075433_10011494 | Ga0075433_100114942 | 119 |
| 729 | 3300006852 | Ga0075433_10448011 | Ga0075433_104480112 | 119 |
| 730 | 3300006852 | Ga0075433_10580021 | Ga0075433_105800212 | 119 |
| 731 | 3300006852 | Ga0075433_10688028 | Ga0075433_106880282 | 119 |
| 732 | 3300006852 | Ga0075433_10711268 | Ga0075433_107112682 | 119 |
| 733 | 3300006852 | Ga0075433_10712501 | Ga0075433_107125012 | 119 |
| 734 | 3300006852 | Ga0075433_10902581 | Ga0075433_109025812 | 119 |
| 735 | 3300006852 | Ga0075433_11346120 | Ga0075433_113461202 | 119 |
| 736 | 3300006871 | Ga0075434_100177127 | Ga0075434_1001771272 | 119 |
| 737 | 3300006871 | Ga0075434_100690033 | Ga0075434_1006900332 | 119 |
| 738 | 3300006871 | Ga0075434_100725767 | Ga0075434_1007257672 | 119 |
| 739 | 3300006871 | Ga0075434_101032830 | Ga0075434_1010328302 | 119 |
| 740 | 3300006871 | Ga0075434_102211105 | Ga0075434_1022111052 | 119 |
| 741 | 3300006880 | Ga0075429_100082406 | Ga0075429_1000824062 | 119 |
| 742 | 3300006880 | Ga0075429_100096187 | Ga0075429_1000961872 | 119 |
| 743 | 3300006880 | Ga0075429_100212267 | Ga0075429_1002122672 | 119 |
| 744 | 3300006880 | Ga0075429_100343820 | Ga0075429_1003438202 | 119 |
| 745 | 3300006880 | Ga0075429_101207551 | Ga0075429_1012075512 | 119 |
| 746 | 3300006881 | Ga0068865_100123574 | Ga0068865_1001235742 | 119 |
| 747 | 3300006881 | Ga0068865_100510223 | Ga0068865_1005102231 | 119 |
| 748 | 3300006914 | Ga0075436_101550399 | Ga0075436_1015503991 | 119 |
| 749 | 3300006931 | Ga0097620_100034539 | Ga0097620_1000345393 | 119 |
| 750 | 3300006931 | Ga0097620_100124891 | Ga0097620_1001248912 | 119 |
| 751 | 3300006931 | Ga0097620_100161430 | Ga0097620_1001614302 | 119 |
| 752 | 3300006931 | Ga0097620_100271596 | Ga0097620_1002715962 | 119 |
| 753 | 3300006931 | Ga0097620_100428071 | Ga0097620_1004280713 | 119 |
| 754 | 3300006931 | Ga0097620_100793424 | Ga0097620_1007934242 | 119 |
| 755 | 3300006931 | Ga0097620_101000915 | Ga0097620_1010009151 | 119 |
| 756 | 3300006931 | Ga0097620_101066602 | Ga0097620_1010666021 | 119 |
| 757 | 3300006931 | Ga0097620_101470858 | Ga0097620_1014708582 | 119 |
| 758 | 3300006931 | Ga0097620_102494893 | Ga0097620_1024948931 | 119 |
| 759 | 3300007076 | Ga0075435_100003425 | Ga0075435_1000034251 | 119 |
| 760 | 3300007076 | Ga0075435_100278589 | Ga0075435_1002785892 | 119 |
| 761 | 3300007076 | Ga0075435_100632854 | Ga0075435_1006328542 | 119 |
| 762 | 3300007076 | Ga0075435_100856356 | Ga0075435_1008563562 | 119 |
| 763 | 3300007076 | Ga0075435_100972992 | Ga0075435_1009729922 | 119 |
| 764 | 3300007265 | Ga0099794_10666159 | Ga0099794_106661591 | 119 |
| 765 | 3300009093 | Ga0105240_10013366 | Ga0105240_100133665 | 119 |
| 766 | 3300009093 | Ga0105240_10263269 | Ga0105240_102632692 | 119 |
| 767 | 3300009093 | Ga0105240_10590873 | Ga0105240_105908732 | 119 |
| 768 | 3300009093 | Ga0105240_10857001 | Ga0105240_108570012 | 119 |
| 769 | 3300009093 | Ga0105240_11806519 | Ga0105240_118065192 | 119 |
| 770 | 3300009094 | Ga0111539_10003741 | Ga0111539_1000374114 | 119 |
| 771 | 3300009094 | Ga0111539_10006263 | Ga0111539_100062639 | 119 |
| 772 | 3300009094 | Ga0111539_10078058 | Ga0111539_100780582 | 119 |
| 773 | 3300009094 | Ga0111539_10162240 | Ga0111539_101622401 | 119 |
| 774 | 3300009094 | Ga0111539_10310304 | Ga0111539_103103042 | 119 |
| 775 | 3300009094 | Ga0111539_10556952 | Ga0111539_105569522 | 119 |
| 776 | 3300009098 | Ga0105245_10134307 | Ga0105245_101343072 | 119 |
| 777 | 3300009098 | Ga0105245_10143827 | Ga0105245_101438271 | 119 |
| 778 | 3300009098 | Ga0105245_10382519 | Ga0105245_103825192 | 119 |
| 779 | 3300009098 | Ga0105245_10536367 | Ga0105245_105363672 | 119 |
| 780 | 3300009098 | Ga0105245_10572521 | Ga0105245_105725212 | 119 |
| 781 | 3300009098 | Ga0105245_10783725 | Ga0105245_107837251 | 119 |
| 782 | 3300009098 | Ga0105245_11005872 | Ga0105245_110058721 | 119 |
| 783 | 3300009101 | Ga0105247_10014516 | Ga0105247_100145162 | 119 |
| 784 | 3300009101 | Ga0105247_10421459 | Ga0105247_104214592 | 119 |
| 785 | 3300009147 | Ga0114129_10001210 | Ga0114129_1000121025 | 119 |
| 786 | 3300009147 | Ga0114129_10007043 | Ga0114129_100070432 | 119 |
| 787 | 3300009147 | Ga0114129_10007586 | Ga0114129_1000758610 | 119 |
| 788 | 3300009147 | Ga0114129_10037660 | Ga0114129_100376609 | 119 |
| 789 | 3300009147 | Ga0114129_10054867 | Ga0114129_100548677 | 119 |
| 790 | 3300009147 | Ga0114129_10107125 | Ga0114129_101071252 | 119 |
| 791 | 3300009147 | Ga0114129_10230970 | Ga0114129_102309702 | 119 |
| 792 | 3300009147 | Ga0114129_10335225 | Ga0114129_103352252 | 119 |
| 793 | 3300009147 | Ga0114129_10339713 | Ga0114129_103397132 | 119 |
| 794 | 3300009147 | Ga0114129_10607523 | Ga0114129_106075232 | 119 |
| 795 | 3300009147 | Ga0114129_10982018 | Ga0114129_109820182 | 119 |
| 796 | 3300009147 | Ga0114129_11257469 | Ga0114129_112574692 | 119 |
| 797 | 3300009147 | Ga0114129_11291873 | Ga0114129_112918732 | 119 |
| 798 | 3300009147 | Ga0114129_11494525 | Ga0114129_114945252 | 119 |
| 799 | 3300009147 | Ga0114129_11765492 | Ga0114129_117654921 | 119 |
| 800 | 3300009147 | Ga0114129_12209444 | Ga0114129_122094442 | 119 |
| 801 | 3300009148 | Ga0105243_10036845 | Ga0105243_100368454 | 119 |
| 802 | 3300009148 | Ga0105243_10234734 | Ga0105243_102347343 | 119 |
| 803 | 3300009148 | Ga0105243_10505644 | Ga0105243_105056442 | 119 |
| 804 | 3300009148 | Ga0105243_12168724 | Ga0105243_121687242 | 119 |
| 805 | 3300009174 | Ga0105241_10078448 | Ga0105241_100784482 | 119 |
| 806 | 3300009174 | Ga0105241_10134751 | Ga0105241_101347512 | 119 |
| 807 | 3300009174 | Ga0105241_10173273 | Ga0105241_101732732 | 119 |
| 808 | 3300009174 | Ga0105241_12574325 | Ga0105241_125743251 | 119 |
| 809 | 3300009176 | Ga0105242_10004376 | Ga0105242_1000437610 | 119 |
| 810 | 3300009176 | Ga0105242_10207341 | Ga0105242_102073412 | 119 |
| 811 | 3300009176 | Ga0105242_10255142 | Ga0105242_102551422 | 119 |
| 812 | 3300009176 | Ga0105242_10354094 | Ga0105242_103540942 | 119 |
| 813 | 3300009176 | Ga0105242_10809110 | Ga0105242_108091102 | 119 |
| 814 | 3300009176 | Ga0105242_11285571 | Ga0105242_112855712 | 119 |
| 815 | 3300009177 | Ga0105248_10001854 | Ga0105248_1000185413 | 119 |
| 816 | 3300009177 | Ga0105248_10006073 | Ga0105248_100060738 | 119 |
| 817 | 3300009177 | Ga0105248_10018606 | Ga0105248_100186064 | 119 |
| 818 | 3300009177 | Ga0105248_10342163 | Ga0105248_103421632 | 119 |
| 819 | 3300009177 | Ga0105248_10379135 | Ga0105248_103791352 | 119 |
| 820 | 3300009177 | Ga0105248_11324105 | Ga0105248_113241052 | 119 |
| 821 | 3300009177 | Ga0105248_13445956 | Ga0105248_134459561 | 119 |
| 822 | 3300009551 | Ga0105238_10522449 | Ga0105238_105224493 | 119 |
| 823 | 3300009553 | Ga0105249_10000759 | Ga0105249_1000075914 | 119 |
| 824 | 3300009553 | Ga0105249_10015676 | Ga0105249_100156762 | 119 |
| 825 | 3300009553 | Ga0105249_10116987 | Ga0105249_101169872 | 119 |
| 826 | 3300009553 | Ga0105249_10205001 | Ga0105249_102050012 | 119 |
| 827 | 3300009553 | Ga0105249_10256237 | Ga0105249_102562373 | 119 |
| 828 | 3300009553 | Ga0105249_10341462 | Ga0105249_103414622 | 119 |
| 829 | 3300009553 | Ga0105249_10357664 | Ga0105249_103576642 | 119 |
| 830 | 3300009553 | Ga0105249_11383934 | Ga0105249_113839342 | 119 |
| 831 | 3300009553 | Ga0105249_12283063 | Ga0105249_122830632 | 119 |
| 832 | 3300010375 | Ga0105239_10246058 | Ga0105239_102460583 | 119 |
| 833 | 3300010375 | Ga0105239_10410807 | Ga0105239_104108072 | 119 |
| 834 | 3300010375 | Ga0105239_12852507 | Ga0105239_128525071 | 119 |
| 835 | 3300011119 | Ga0105246_10152096 | Ga0105246_101520962 | 119 |
| 836 | 3300011119 | Ga0105246_10243072 | Ga0105246_102430722 | 119 |
| 837 | 3300011119 | Ga0105246_10726285 | Ga0105246_107262852 | 119 |
| 838 | 3300011119 | Ga0105246_11593631 | Ga0105246_115936311 | 119 |
| 839 | 3300012485 | Ga0157325_1003348 | Ga0157325_10033482 | 119 |
| 840 | 3300012508 | Ga0157315_1032378 | Ga0157315_10323782 | 119 |
| 841 | 3300013105 | Ga0157369_11556625 | Ga0157369_115566252 | 119 |
| 842 | 3300013296 | Ga0157374_10049175 | Ga0157374_100491753 | 119 |
| 843 | 3300013296 | Ga0157374_10468686 | Ga0157374_104686862 | 119 |
| 844 | 3300013297 | Ga0157378_10062396 | Ga0157378_100623962 | 119 |
| 845 | 3300013297 | Ga0157378_10982844 | Ga0157378_109828442 | 119 |
| 846 | 3300013306 | Ga0163162_10028446 | Ga0163162_100284466 | 119 |
| 847 | 3300013306 | Ga0163162_10031594 | Ga0163162_100315942 | 119 |
| 848 | 3300013306 | Ga0163162_12481914 | Ga0163162_124819141 | 119 |
| 849 | 3300013308 | Ga0157375_10124732 | Ga0157375_101247322 | 119 |
| 850 | 3300013308 | Ga0157375_10157353 | Ga0157375_101573533 | 119 |
| 851 | 3300013308 | Ga0157375_10473695 | Ga0157375_104736952 | 119 |
| 852 | 3300013308 | Ga0157375_10972641 | Ga0157375_109726412 | 119 |
| 853 | 3300013308 | Ga0157375_12849071 | Ga0157375_128490712 | 119 |
| 854 | 3300014325 | Ga0163163_10000001 | Ga0163163_10000001117 | 119 |
| 855 | 3300014325 | Ga0163163_10013923 | Ga0163163_100139232 | 119 |
| 856 | 3300014325 | Ga0163163_10037866 | Ga0163163_100378663 | 119 |
| 857 | 3300014325 | Ga0163163_10050509 | Ga0163163_100505093 | 119 |
| 858 | 3300014325 | Ga0163163_10285013 | Ga0163163_102850132 | 119 |
| 859 | 3300014325 | Ga0163163_10760706 | Ga0163163_107607063 | 119 |
| 860 | 3300014325 | Ga0163163_11152154 | Ga0163163_111521541 | 119 |
| 861 | 3300014326 | Ga0157380_10038923 | Ga0157380_100389232 | 119 |
| 862 | 3300014326 | Ga0157380_10049197 | Ga0157380_100491973 | 119 |
| 863 | 3300014326 | Ga0157380_10199940 | Ga0157380_101999403 | 119 |
| 864 | 3300014326 | Ga0157380_10522119 | Ga0157380_105221192 | 119 |
| 865 | 3300014326 | Ga0157380_10678962 | Ga0157380_106789622 | 119 |
| 866 | 3300014326 | Ga0157380_10722508 | Ga0157380_107225082 | 119 |
| 867 | 3300014745 | Ga0157377_10169534 | Ga0157377_101695342 | 119 |
| 868 | 3300014745 | Ga0157377_10823664 | Ga0157377_108236641 | 119 |
| 869 | 3300014968 | Ga0157379_10058271 | Ga0157379_100582714 | 119 |
| 870 | 3300014968 | Ga0157379_10268217 | Ga0157379_102682172 | 119 |
| 871 | 3300014968 | Ga0157379_10339214 | Ga0157379_103392142 | 119 |
| 872 | 3300014968 | Ga0157379_10882223 | Ga0157379_108822232 | 119 |
| 873 | 3300014968 | Ga0157379_11870104 | Ga0157379_118701042 | 119 |
| 874 | 3300014969 | Ga0157376_10018993 | Ga0157376_100189934 | 119 |
| 875 | 3300014969 | Ga0157376_10033418 | Ga0157376_100334183 | 119 |
| 876 | 3300014969 | Ga0157376_10207193 | Ga0157376_102071932 | 119 |
| 877 | 3300014969 | Ga0157376_10846099 | Ga0157376_108460991 | 119 |
| 878 | 3300014969 | Ga0157376_10941038 | Ga0157376_109410382 | 119 |
| 879 | 3300017792 | Ga0163161_10581157 | Ga0163161_105811572 | 119 |
| 880 | 3300017792 | Ga0163161_11883711 | Ga0163161_118837111 | 119 |
| 881 | 3300025315 | Ga0207697_10021594 | Ga0207697_100215942 | 119 |
| 882 | 3300025315 | Ga0207697_10093293 | Ga0207697_100932932 | 119 |
| 883 | 3300025315 | Ga0207697_10288768 | Ga0207697_102887681 | 119 |
| 884 | 3300025321 | Ga0207656_10206753 | Ga0207656_102067532 | 119 |
| 885 | 3300025893 | Ga0207682_10173375 | Ga0207682_101733751 | 119 |
| 886 | 3300025898 | Ga0207692_10103471 | Ga0207692_101034712 | 119 |
| 887 | 3300025899 | Ga0207642_10048782 | Ga0207642_100487822 | 119 |
| 888 | 3300025899 | Ga0207642_10615902 | Ga0207642_106159022 | 119 |
| 889 | 3300025901 | Ga0207688_10051437 | Ga0207688_100514372 | 119 |
| 890 | 3300025901 | Ga0207688_10066646 | Ga0207688_100666462 | 119 |
| 891 | 3300025901 | Ga0207688_10362029 | Ga0207688_103620291 | 119 |
| 892 | 3300025903 | Ga0207680_10110962 | Ga0207680_101109622 | 119 |
| 893 | 3300025903 | Ga0207680_10121829 | Ga0207680_101218292 | 119 |
| 894 | 3300025903 | Ga0207680_10132869 | Ga0207680_101328692 | 119 |
| 895 | 3300025905 | Ga0207685_10059226 | Ga0207685_100592262 | 119 |
| 896 | 3300025906 | Ga0207699_10527210 | Ga0207699_105272102 | 119 |
| 897 | 3300025907 | Ga0207645_10014763 | Ga0207645_100147632 | 119 |
| 898 | 3300025908 | Ga0207643_10578401 | Ga0207643_105784011 | 119 |
| 899 | 3300025908 | Ga0207643_10627092 | Ga0207643_106270921 | 119 |
| 900 | 3300025910 | Ga0207684_10261399 | Ga0207684_102613991 | 119 |
| 901 | 3300025912 | Ga0207707_10154287 | Ga0207707_101542873 | 119 |
| 902 | 3300025912 | Ga0207707_10351315 | Ga0207707_103513152 | 119 |
| 903 | 3300025913 | Ga0207695_10035373 | Ga0207695_100353735 | 119 |
| 904 | 3300025913 | Ga0207695_10089434 | Ga0207695_100894342 | 119 |
| 905 | 3300025913 | Ga0207695_10592111 | Ga0207695_105921112 | 119 |
| 906 | 3300025916 | Ga0207663_10623223 | Ga0207663_106232231 | 119 |
| 907 | 3300025917 | Ga0207660_10133638 | Ga0207660_101336382 | 119 |
| 908 | 3300025917 | Ga0207660_10266641 | Ga0207660_102666411 | 119 |
| 909 | 3300025919 | Ga0207657_10037224 | Ga0207657_100372242 | 119 |
| 910 | 3300025919 | Ga0207657_10856897 | Ga0207657_108568971 | 119 |
| 911 | 3300025919 | Ga0207657_11310633 | Ga0207657_113106332 | 119 |
| 912 | 3300025920 | Ga0207649_10969505 | Ga0207649_109695052 | 119 |
| 913 | 3300025920 | Ga0207649_11462772 | Ga0207649_114627721 | 119 |
| 914 | 3300025921 | Ga0207652_10019576 | Ga0207652_100195764 | 119 |
| 915 | 3300025921 | Ga0207652_10742537 | Ga0207652_107425372 | 119 |
| 916 | 3300025921 | Ga0207652_10878524 | Ga0207652_108785242 | 119 |
| 917 | 3300025922 | Ga0207646_10204636 | Ga0207646_102046362 | 119 |
| 918 | 3300025922 | Ga0207646_10274494 | Ga0207646_102744941 | 119 |
| 919 | 3300025922 | Ga0207646_11441343 | Ga0207646_114413432 | 119 |
| 920 | 3300025922 | Ga0207646_11453198 | Ga0207646_114531982 | 119 |
| 921 | 3300025922 | Ga0207646_11522900 | Ga0207646_115229001 | 119 |
| 922 | 3300025922 | Ga0207646_11759896 | Ga0207646_117598961 | 119 |
| 923 | 3300025923 | Ga0207681_10020072 | Ga0207681_100200722 | 119 |
| 924 | 3300025923 | Ga0207681_10024846 | Ga0207681_100248462 | 119 |
| 925 | 3300025923 | Ga0207681_10082786 | Ga0207681_100827861 | 119 |
| 926 | 3300025923 | Ga0207681_10087669 | Ga0207681_100876692 | 119 |
| 927 | 3300025923 | Ga0207681_10218074 | Ga0207681_102180742 | 119 |
| 928 | 3300025923 | Ga0207681_10802699 | Ga0207681_108026992 | 119 |
| 929 | 3300025923 | Ga0207681_10809420 | Ga0207681_108094201 | 119 |
| 930 | 3300025924 | Ga0207694_10845045 | Ga0207694_108450452 | 119 |
| 931 | 3300025925 | Ga0207650_10037631 | Ga0207650_100376313 | 119 |
| 932 | 3300025925 | Ga0207650_10118528 | Ga0207650_101185282 | 119 |
| 933 | 3300025925 | Ga0207650_10200894 | Ga0207650_102008942 | 119 |
| 934 | 3300025925 | Ga0207650_10691293 | Ga0207650_106912931 | 119 |
| 935 | 3300025925 | Ga0207650_11060496 | Ga0207650_110604962 | 119 |
| 936 | 3300025925 | Ga0207650_11754857 | Ga0207650_117548571 | 119 |
| 937 | 3300025926 | Ga0207659_10082095 | Ga0207659_100820952 | 119 |
| 938 | 3300025926 | Ga0207659_10216193 | Ga0207659_102161932 | 119 |
| 939 | 3300025926 | Ga0207659_10389365 | Ga0207659_103893651 | 119 |
| 940 | 3300025926 | Ga0207659_10660293 | Ga0207659_106602931 | 119 |
| 941 | 3300025927 | Ga0207687_10084042 | Ga0207687_100840423 | 119 |
| 942 | 3300025927 | Ga0207687_10477791 | Ga0207687_104777912 | 119 |
| 943 | 3300025927 | Ga0207687_10569671 | Ga0207687_105696712 | 119 |
| 944 | 3300025927 | Ga0207687_10574190 | Ga0207687_105741902 | 119 |
| 945 | 3300025927 | Ga0207687_10695478 | Ga0207687_106954781 | 119 |
| 946 | 3300025929 | Ga0207664_10039362 | Ga0207664_100393622 | 119 |
| 947 | 3300025931 | Ga0207644_10136083 | Ga0207644_101360832 | 119 |
| 948 | 3300025931 | Ga0207644_10499348 | Ga0207644_104993482 | 119 |
| 949 | 3300025931 | Ga0207644_10618614 | Ga0207644_106186142 | 119 |
| 950 | 3300025932 | Ga0207690_10015495 | Ga0207690_100154952 | 119 |
| 951 | 3300025932 | Ga0207690_10332461 | Ga0207690_103324612 | 119 |
| 952 | 3300025932 | Ga0207690_10710921 | Ga0207690_107109212 | 119 |
| 953 | 3300025933 | Ga0207706_10052948 | Ga0207706_100529482 | 119 |
| 954 | 3300025933 | Ga0207706_10322587 | Ga0207706_103225872 | 119 |
| 955 | 3300025933 | Ga0207706_11236496 | Ga0207706_112364962 | 119 |
| 956 | 3300025934 | Ga0207686_10222307 | Ga0207686_102223072 | 119 |
| 957 | 3300025934 | Ga0207686_10309817 | Ga0207686_103098172 | 119 |
| 958 | 3300025934 | Ga0207686_11372945 | Ga0207686_113729452 | 119 |
| 959 | 3300025935 | Ga0207709_10393880 | Ga0207709_103938802 | 119 |
| 960 | 3300025935 | Ga0207709_10448524 | Ga0207709_104485241 | 119 |
| 961 | 3300025935 | Ga0207709_10688957 | Ga0207709_106889572 | 119 |
| 962 | 3300025935 | Ga0207709_11475678 | Ga0207709_114756781 | 119 |
| 963 | 3300025936 | Ga0207670_10125373 | Ga0207670_101253732 | 119 |
| 964 | 3300025936 | Ga0207670_10182180 | Ga0207670_101821801 | 119 |
| 965 | 3300025936 | Ga0207670_10221525 | Ga0207670_102215252 | 119 |
| 966 | 3300025937 | Ga0207669_10003394 | Ga0207669_100033947 | 119 |
| 967 | 3300025937 | Ga0207669_10078225 | Ga0207669_100782252 | 119 |
| 968 | 3300025937 | Ga0207669_10188026 | Ga0207669_101880263 | 119 |
| 969 | 3300025937 | Ga0207669_10349188 | Ga0207669_103491882 | 119 |
| 970 | 3300025937 | Ga0207669_10395694 | Ga0207669_103956942 | 119 |
| 971 | 3300025937 | Ga0207669_10536152 | Ga0207669_105361522 | 119 |
| 972 | 3300025937 | Ga0207669_10546436 | Ga0207669_105464362 | 119 |
| 973 | 3300025938 | Ga0207704_10065142 | Ga0207704_100651421 | 119 |
| 974 | 3300025939 | Ga0207665_11204934 | Ga0207665_112049341 | 119 |
| 975 | 3300025940 | Ga0207691_10012143 | Ga0207691_100121432 | 119 |
| 976 | 3300025940 | Ga0207691_10017213 | Ga0207691_100172133 | 119 |
| 977 | 3300025940 | Ga0207691_10206823 | Ga0207691_102068232 | 119 |
| 978 | 3300025940 | Ga0207691_10339895 | Ga0207691_103398951 | 119 |
| 979 | 3300025940 | Ga0207691_10350895 | Ga0207691_103508951 | 119 |
| 980 | 3300025940 | Ga0207691_11370236 | Ga0207691_113702362 | 119 |
| 981 | 3300025941 | Ga0207711_10061302 | Ga0207711_100613022 | 119 |
| 982 | 3300025941 | Ga0207711_10094765 | Ga0207711_100947651 | 119 |
| 983 | 3300025941 | Ga0207711_10282514 | Ga0207711_102825141 | 119 |
| 984 | 3300025941 | Ga0207711_10555776 | Ga0207711_105557762 | 119 |
| 985 | 3300025941 | Ga0207711_10623057 | Ga0207711_106230572 | 119 |
| 986 | 3300025941 | Ga0207711_10670017 | Ga0207711_106700172 | 119 |
| 987 | 3300025941 | Ga0207711_11978046 | Ga0207711_119780461 | 119 |
| 988 | 3300025942 | Ga0207689_10388063 | Ga0207689_103880632 | 119 |
| 989 | 3300025942 | Ga0207689_10874715 | Ga0207689_108747152 | 119 |
| 990 | 3300025942 | Ga0207689_11491632 | Ga0207689_114916322 | 119 |
| 991 | 3300025942 | Ga0207689_11500395 | Ga0207689_115003952 | 119 |
| 992 | 3300025944 | Ga0207661_11274144 | Ga0207661_112741442 | 119 |
| 993 | 3300025945 | Ga0207679_11239940 | Ga0207679_112399401 | 119 |
| 994 | 3300025949 | Ga0207667_10124226 | Ga0207667_101242264 | 119 |
| 995 | 3300025960 | Ga0207651_10086539 | Ga0207651_100865392 | 119 |
| 996 | 3300025960 | Ga0207651_10105108 | Ga0207651_101051082 | 119 |
| 997 | 3300025960 | Ga0207651_10224690 | Ga0207651_102246901 | 119 |
| 998 | 3300025960 | Ga0207651_10323551 | Ga0207651_103235512 | 119 |
| 999 | 3300025960 | Ga0207651_10622969 | Ga0207651_106229692 | 119 |
| 1000 | 3300025961 | Ga0207712_10010859 | Ga0207712_100108594 | 119 |
| 1001 | 3300025961 | Ga0207712_10016070 | Ga0207712_100160703 | 119 |
| 1002 | 3300025961 | Ga0207712_10177181 | Ga0207712_101771812 | 119 |
| 1003 | 3300025961 | Ga0207712_10506733 | Ga0207712_105067331 | 119 |
| 1004 | 3300025961 | Ga0207712_11215676 | Ga0207712_112156762 | 119 |
| 1005 | 3300025972 | Ga0207668_10304233 | Ga0207668_103042332 | 119 |
| 1006 | 3300025972 | Ga0207668_10363917 | Ga0207668_103639171 | 119 |
| 1007 | 3300025981 | Ga0207640_10235018 | Ga0207640_102350182 | 119 |
| 1008 | 3300025981 | Ga0207640_10943704 | Ga0207640_109437042 | 119 |
| 1009 | 3300025981 | Ga0207640_11735587 | Ga0207640_117355872 | 119 |
| 1010 | 3300025986 | Ga0207658_10028089 | Ga0207658_100280892 | 119 |
| 1011 | 3300025986 | Ga0207658_10039016 | Ga0207658_100390162 | 119 |
| 1012 | 3300025986 | Ga0207658_10578996 | Ga0207658_105789961 | 119 |
| 1013 | 3300025986 | Ga0207658_10688700 | Ga0207658_106887002 | 119 |
| 1014 | 3300026023 | Ga0207677_10042274 | Ga0207677_100422742 | 119 |
| 1015 | 3300026023 | Ga0207677_10066933 | Ga0207677_100669332 | 119 |
| 1016 | 3300026023 | Ga0207677_10089593 | Ga0207677_100895933 | 119 |
| 1017 | 3300026023 | Ga0207677_11888230 | Ga0207677_118882301 | 119 |
| 1018 | 3300026035 | Ga0207703_10030316 | Ga0207703_100303162 | 119 |
| 1019 | 3300026035 | Ga0207703_10041243 | Ga0207703_100412432 | 119 |
| 1020 | 3300026035 | Ga0207703_10112933 | Ga0207703_101129332 | 119 |
| 1021 | 3300026035 | Ga0207703_10147524 | Ga0207703_101475242 | 119 |
| 1022 | 3300026035 | Ga0207703_10185001 | Ga0207703_101850012 | 119 |
| 1023 | 3300026035 | Ga0207703_10316335 | Ga0207703_103163351 | 119 |
| 1024 | 3300026035 | Ga0207703_10476287 | Ga0207703_104762871 | 119 |
| 1025 | 3300026035 | Ga0207703_10618217 | Ga0207703_106182171 | 119 |
| 1026 | 3300026035 | Ga0207703_10626199 | Ga0207703_106261992 | 119 |
| 1027 | 3300026035 | Ga0207703_11411492 | Ga0207703_114114921 | 119 |
| 1028 | 3300026035 | Ga0207703_12247751 | Ga0207703_122477512 | 119 |
| 1029 | 3300026067 | Ga0207678_10893713 | Ga0207678_108937131 | 119 |
| 1030 | 3300026067 | Ga0207678_11151830 | Ga0207678_111518301 | 119 |
| 1031 | 3300026075 | Ga0207708_10017960 | Ga0207708_100179604 | 119 |
| 1032 | 3300026075 | Ga0207708_10043835 | Ga0207708_100438351 | 119 |
| 1033 | 3300026075 | Ga0207708_10146881 | Ga0207708_101468811 | 119 |
| 1034 | 3300026075 | Ga0207708_10342496 | Ga0207708_103424962 | 119 |
| 1035 | 3300026078 | Ga0207702_11291656 | Ga0207702_112916562 | 119 |
| 1036 | 3300026088 | Ga0207641_10007212 | Ga0207641_100072125 | 119 |
| 1037 | 3300026088 | Ga0207641_10039403 | Ga0207641_100394032 | 119 |
| 1038 | 3300026088 | Ga0207641_10276475 | Ga0207641_102764752 | 119 |
| 1039 | 3300026088 | Ga0207641_10812096 | Ga0207641_108120961 | 119 |
| 1040 | 3300026088 | Ga0207641_10870103 | Ga0207641_108701032 | 119 |
| 1041 | 3300026088 | Ga0207641_11915020 | Ga0207641_119150202 | 119 |
| 1042 | 3300026089 | Ga0207648_10008247 | Ga0207648_100082472 | 119 |
| 1043 | 3300026089 | Ga0207648_10057142 | Ga0207648_100571422 | 119 |
| 1044 | 3300026089 | Ga0207648_10064974 | Ga0207648_100649742 | 119 |
| 1045 | 3300026089 | Ga0207648_10512303 | Ga0207648_105123031 | 119 |
| 1046 | 3300026089 | Ga0207648_10660207 | Ga0207648_106602071 | 119 |
| 1047 | 3300026089 | Ga0207648_11136248 | Ga0207648_111362481 | 119 |
| 1048 | 3300026089 | Ga0207648_11545971 | Ga0207648_115459712 | 119 |
| 1049 | 3300026095 | Ga0207676_10010212 | Ga0207676_100102126 | 119 |
| 1050 | 3300026095 | Ga0207676_10022988 | Ga0207676_100229883 | 119 |
| 1051 | 3300026095 | Ga0207676_10027803 | Ga0207676_100278033 | 119 |
| 1052 | 3300026095 | Ga0207676_10306785 | Ga0207676_103067853 | 119 |
| 1053 | 3300026095 | Ga0207676_10394300 | Ga0207676_103943002 | 119 |
| 1054 | 3300026095 | Ga0207676_11324151 | Ga0207676_113241512 | 119 |
| 1055 | 3300026116 | Ga0207674_10035085 | Ga0207674_100350854 | 119 |
| 1056 | 3300026116 | Ga0207674_10103314 | Ga0207674_101033142 | 119 |
| 1057 | 3300026118 | Ga0207675_100003262 | Ga0207675_1000032624 | 119 |
| 1058 | 3300026118 | Ga0207675_100240452 | Ga0207675_1002404522 | 119 |
| 1059 | 3300026118 | Ga0207675_100651815 | Ga0207675_1006518152 | 119 |
| 1060 | 3300026118 | Ga0207675_101202623 | Ga0207675_1012026232 | 119 |
| 1061 | 3300026121 | Ga0207683_10285343 | Ga0207683_102853431 | 119 |
| 1062 | 3300026142 | Ga0207698_10389892 | Ga0207698_103898922 | 119 |
| 1063 | 3300026142 | Ga0207698_11425557 | Ga0207698_114255572 | 119 |
| 1064 | 3300027907 | Ga0207428_10002391 | Ga0207428_100023914 | 119 |
| 1065 | 3300027907 | Ga0207428_10032210 | Ga0207428_100322102 | 119 |
| 1066 | 3300027907 | Ga0207428_10375974 | Ga0207428_103759741 | 119 |
| 1067 | 3300027907 | Ga0207428_10898141 | Ga0207428_108981411 | 119 |
| 1068 | 3300028379 | Ga0268266_10362223 | Ga0268266_103622232 | 119 |
| 1069 | 3300028379 | Ga0268266_10651773 | Ga0268266_106517732 | 119 |
| 1070 | 3300028379 | Ga0268266_11048943 | Ga0268266_110489432 | 119 |
| 1071 | 3300028379 | Ga0268266_11458153 | Ga0268266_114581531 | 119 |
| 1072 | 3300028380 | Ga0268265_10003607 | Ga0268265_100036072 | 119 |
| 1073 | 3300028380 | Ga0268265_10015652 | Ga0268265_100156522 | 119 |
| 1074 | 3300028380 | Ga0268265_10040186 | Ga0268265_100401862 | 119 |
| 1075 | 3300028380 | Ga0268265_10046425 | Ga0268265_100464252 | 119 |
| 1076 | 3300028380 | Ga0268265_10114997 | Ga0268265_101149972 | 119 |
| 1077 | 3300028380 | Ga0268265_10187309 | Ga0268265_101873092 | 119 |
| 1078 | 3300028380 | Ga0268265_10354849 | Ga0268265_103548492 | 119 |
| 1079 | 3300028380 | Ga0268265_10695667 | Ga0268265_106956671 | 119 |
| 1080 | 3300028380 | Ga0268265_11920751 | Ga0268265_119207511 | 119 |
| 1081 | 3300028380 | Ga0268265_12241757 | Ga0268265_122417571 | 119 |
| 1082 | 3300028380 | Ga0268265_12360337 | Ga0268265_123603371 | 119 |
| 1083 | 3300028381 | Ga0268264_10004922 | Ga0268264_100049229 | 119 |
| 1084 | 3300028381 | Ga0268264_10381813 | Ga0268264_103818131 | 119 |
| 1085 | 3300028381 | Ga0268264_10410468 | Ga0268264_104104682 | 119 |
| 1086 | 3300028381 | Ga0268264_11951195 | Ga0268264_119511951 | 119 |
| 1087 | 3300028381 | Ga0268264_12240349 | Ga0268264_122403491 | 119 |
| 1088 | 3300030521 | Ga0307511_10250473 | Ga0307511_102504732 | 119 |
| 1089 | 3300031238 | Ga0265332_10254341 | Ga0265332_102543412 | 119 |
| 1090 | 3300031239 | Ga0265328_10036845 | Ga0265328_100368452 | 119 |
| 1091 | 3300031241 | Ga0265325_10211375 | Ga0265325_102113752 | 119 |
| 1092 | 3300031249 | Ga0265339_10100403 | Ga0265339_101004032 | 119 |
| 1093 | 3300031344 | Ga0265316_10044113 | Ga0265316_100441132 | 119 |
| 1094 | 3300031548 | Ga0307408_100392565 | Ga0307408_1003925651 | 119 |
| 1095 | 3300031548 | Ga0307408_100966632 | Ga0307408_1009666322 | 119 |
| 1096 | 3300031548 | Ga0307408_101189041 | Ga0307408_1011890412 | 119 |
| 1097 | 3300031548 | Ga0307408_101199525 | Ga0307408_1011995252 | 119 |
| 1098 | 3300031548 | Ga0307408_101239770 | Ga0307408_1012397702 | 119 |
| 1099 | 3300031548 | Ga0307408_101481337 | Ga0307408_1014813372 | 119 |
| 1100 | 3300031711 | Ga0265314_10344605 | Ga0265314_103446051 | 119 |
| 1101 | 3300031712 | Ga0265342_10038270 | Ga0265342_100382702 | 119 |
| 1102 | 3300031731 | Ga0307405_11228519 | Ga0307405_112285192 | 119 |
| 1103 | 3300031824 | Ga0307413_10292918 | Ga0307413_102929181 | 119 |
| 1104 | 3300031824 | Ga0307413_12031097 | Ga0307413_120310971 | 119 |
| 1105 | 3300031852 | Ga0307410_10079571 | Ga0307410_100795713 | 119 |
| 1106 | 3300031901 | Ga0307406_10360932 | Ga0307406_103609322 | 119 |
| 1107 | 3300031901 | Ga0307406_11086012 | Ga0307406_110860121 | 119 |
| 1108 | 3300031911 | Ga0307412_10431170 | Ga0307412_104311702 | 119 |
| 1109 | 3300031911 | Ga0307412_11082123 | Ga0307412_110821231 | 119 |
| 1110 | 3300031995 | Ga0307409_100243458 | Ga0307409_1002434582 | 119 |
| 1111 | 3300031995 | Ga0307409_100881331 | Ga0307409_1008813311 | 119 |
| 1112 | 3300032002 | Ga0307416_100149210 | Ga0307416_1001492102 | 119 |
| 1113 | 3300032002 | Ga0307416_100774534 | Ga0307416_1007745341 | 119 |
| 1114 | 3300032002 | Ga0307416_101505040 | Ga0307416_1015050402 | 119 |
| 1115 | 3300032004 | Ga0307414_10078781 | Ga0307414_100787811 | 119 |
| 1116 | 3300032004 | Ga0307414_10942263 | Ga0307414_109422632 | 119 |
| 1117 | 3300032005 | Ga0307411_10227592 | Ga0307411_102275922 | 119 |
| 1118 | 3300032005 | Ga0307411_10554758 | Ga0307411_105547582 | 119 |
| 1119 | 3300032126 | Ga0307415_100320355 | Ga0307415_1003203551 | 119 |
| 1120 | 3300035092 | Ga0373952_0067810 | Ga0373952_0067810_383_742 | 119 |
| 1121 | 3300035112 | Ga0373932_0132278 | Ga0373932_0132278_403_762 | 119 |
| 1122 | 3300035114 | Ga0373939_0223877 | Ga0373939_0223877_48_407 | 119 |
| 1123 | 3300035115 | Ga0373941_0020831 | Ga0373941_0020831_1353_1715 | 119 |
| 1124 | 3300035117 | Ga0373953_0095967 | Ga0373953_0095967_475_834 | 119 |
| 1125 | 3300035119 | Ga0373956_0062577 | Ga0373956_0062577_909_1268 | 119 |
| 1126 | 3300035120 | Ga0373957_0243770 | Ga0373957_0243770_319_678 | 119 |
| 1127 | 3300035170 | Ga0373943_0396005 | Ga0373943_0396005_247_606 | 119 |
| 1128 | 3300035170 | Ga0373943_0409810 | Ga0373943_0409810_290_649 | 119 |
| 1129 | 3300035171 | Ga0373946_0206811 | Ga0373946_0206811_485_844 | 119 |
| 1130 | 3300035171 | Ga0373946_0489077 | Ga0373946_0489077_244_603 | 119 |
| 1131 | 3300035172 | Ga0373955_0182192 | Ga0373955_0182192_228_587 | 119 |
| 1132 | 3300035207 | Ga0373942_0235875 | Ga0373942_0235875_13_372 | 119 |
| 1133 | 3300035241 | Ga0373961_0185002 | Ga0373961_0185002_38_397 | 119 |
| 1134 | 3300035242 | Ga0373962_0010098 | Ga0373962_0010098_1085_1444 | 119 |
| 1135 | 3300035692 | Ga0373935_0141045 | Ga0373935_0141045_795_1154 | 119 |
| 1136 | 3300035695 | Ga0373927_0294309 | Ga0373927_0294309_457_816 | 119 |
| 1137 | 3300035724 | Ga0373933_0323342 | Ga0373933_0323342_586_945 | 119 |
| 1138 | 3300035724 | Ga0373933_0442611 | Ga0373933_0442611_388_750 | 119 |
| 1139 | 3300035725 | Ga0373947_0045408 | Ga0373947_0045408_240_599 | 119 |
| 1140 | 3300036401 | Ga0373937_0156997 | Ga0373937_0156997_917_1276 | 119 |
| 1141 | 3300036401 | Ga0373937_0390185 | Ga0373937_0390185_202_561 | 119 |
| 1142 | 3300036401 | Ga0373937_0394018 | Ga0373937_0394018_876_1235 | 119 |
| 1143 | 3300036401 | Ga0373937_0572791 | Ga0373937_0572791_73_432 | 119 |
| 1144 | 3300036401 | Ga0373937_0589532 | Ga0373937_0589532_68_427 | 119 |
| 1145 | 3300036401 | Ga0373937_0868381 | Ga0373937_0868381_477_836 | 119 |
| 1146 | 3300037068 | Ga0373925_0502191 | Ga0373925_0502191_501_860 | 119 |
| 1147 | 3300037471 | Ga0395905_0126645 | Ga0395905_0126645_1554_1913 | 119 |
| 1148 | 3300038443 | Ga0395901_0419786 | Ga0395901_0419786_58_417 | 119 |
| 1149 | 3300038443 | Ga0395901_1199526 | Ga0395901_1199526_318_677 | 119 |
| 1150 | 3300041410 | Ga0439461_0041338 | Ga0439461_0041338_577_936 | 119 |
| 1151 | 3300041460 | Ga0451802_1678584 | Ga0451802_1678584_101_460 | 119 |
| 1152 | 3300041486 | Ga0451807_0062462 | Ga0451807_0062462_202_567 | 119 |
| 1153 | 3300041507 | Ga0451851_1214807 | Ga0451851_1214807_23_394 | 119 |
| 1154 | 3300041512 | Ga0451853_1119114 | Ga0451853_1119114_69_428 | 119 |
| 1155 | 3300041997 | Ga0439431_0014634 | Ga0439431_0014634_830_1189 | 119 |
| 1156 | 3300041999 | Ga0439433_0010796 | Ga0439433_0010796_1163_1522 | 119 |
| 1157 | 3300042004 | Ga0439445_0140531 | Ga0439445_0140531_63_422 | 119 |
| 1158 | 3300042007 | Ga0439449_0213054 | Ga0439449_0213054_110_469 | 119 |
| 1159 | 3300042011 | Ga0439454_024460 | Ga0439454_024460_536_895 | 119 |
| 1160 | 3300042013 | Ga0439456_095693 | Ga0439456_095693_283_642 | 119 |
| 1161 | 3300042014 | Ga0439457_109036 | Ga0439457_109036_142_501 | 119 |
| 1162 | 3300042015 | Ga0439462_0132078 | Ga0439462_0132078_206_565 | 119 |
| 1163 | 3300042130 | Ga0450892_009984 | Ga0450892_009984_224_586 | 119 |
| 1164 | 3300042144 | Ga0450889_005880 | Ga0450889_005880_616_975 | 119 |
| 1165 | 3300042156 | Ga0439446_0018109 | Ga0439446_0018109_1371_1730 | 119 |
| 1166 | 3300042156 | Ga0439446_0370131 | Ga0439446_0370131_76_435 | 119 |
| 1167 | 3300042436 | Ga0439435_0031586 | Ga0439435_0031586_1032_1391 | 119 |
| 1168 | 3300042436 | Ga0439435_0092857 | Ga0439435_0092857_257_616 | 119 |
| 1169 | 3300042436 | Ga0439435_0205670 | Ga0439435_0205670_181_543 | 119 |
| 1170 | 3300042461 | Ga0439460_0029458 | Ga0439460_0029458_1051_1410 | 119 |
| 1171 | 3300042461 | Ga0439460_0109076 | Ga0439460_0109076_69_428 | 119 |
| 1172 | 3300045051 | Ga0451576_0017400 | Ga0451576_0017400_3641_4009 | 119 |
| 1173 | 3300045051 | Ga0451576_0355762 | Ga0451576_0355762_276_647 | 119 |
| 1174 | 3300045051 | Ga0451576_1519312 | Ga0451576_1519312_33_392 | 119 |
| 1175 | 3300045976 | Ga0466967_1051907 | Ga0466967_1051907_426_785 | 119 |
| 1176 | 3300046454 | Ga0495592_0277687 | Ga0495592_0277687_100_459 | 119 |
| 1177 | 3300046455 | Ga0495603_0366880 | Ga0495603_0366880_392_763 | 119 |
| 1178 | 3300046459 | Ga0495629_0195894 | Ga0495629_0195894_51_422 | 119 |
| 1179 | 3300046472 | Ga0495580_0650506 | Ga0495580_0650506_242_601 | 119 |
| 1180 | 3300046472 | Ga0495580_0825510 | Ga0495580_0825510_66_425 | 119 |
| 1181 | 3300046473 | Ga0495582_0095929 | Ga0495582_0095929_179_538 | 119 |
| 1182 | 3300046473 | Ga0495582_0417583 | Ga0495582_0417583_260_625 | 119 |
| 1183 | 3300046473 | Ga0495582_0892158 | Ga0495582_0892158_100_459 | 119 |
| 1184 | 3300046475 | Ga0495639_0074404 | Ga0495639_0074404_801_1160 | 119 |
| 1185 | 3300046475 | Ga0495639_0350812 | Ga0495639_0350812_293_664 | 119 |
| 1186 | 3300046476 | Ga0495662_0356181 | Ga0495662_0356181_90_455 | 119 |
| 1187 | 3300046476 | Ga0495662_0411683 | Ga0495662_0411683_81_440 | 119 |
| 1188 | 3300046477 | Ga0495664_0805455 | Ga0495664_0805455_140_499 | 119 |
| 1189 | 3300046491 | Ga0495584_0176894 | Ga0495584_0176894_324_683 | 119 |
| 1190 | 3300046492 | Ga0495585_0407997 | Ga0495585_0407997_117_476 | 119 |
| 1191 | 3300046499 | Ga0495594_0005857 | Ga0495594_0005857_318_677 | 119 |
| 1192 | 3300046511 | Ga0495608_0259263 | Ga0495608_0259263_423_782 | 119 |
| 1193 | 3300046516 | Ga0495628_0308217 | Ga0495628_0308217_527_886 | 119 |
| 1194 | 3300046522 | Ga0495643_0114733 | Ga0495643_0114733_482_841 | 119 |
| 1195 | 3300046529 | Ga0495652_0618131 | Ga0495652_0618131_210_569 | 119 |
| 1196 | 3300046533 | Ga0495640_0241382 | Ga0495640_0241382_267_626 | 119 |
| 1197 | 3300046533 | Ga0495640_0531115 | Ga0495640_0531115_135_494 | 119 |
| 1198 | 3300046536 | Ga0495587_0491462 | Ga0495587_0491462_286_645 | 119 |
| 1199 | 3300046543 | Ga0495645_0001484 | Ga0495645_0001484_12716_13075 | 119 |
| 1200 | 3300046558 | Ga0495633_0505859 | Ga0495633_0505859_52_411 | 119 |
| 1201 | 3300046559 | Ga0495667_0221803 | Ga0495667_0221803_809_1168 | 119 |
| 1202 | 3300046559 | Ga0495667_0224475 | Ga0495667_0224475_43_411 | 119 |
| 1203 | 3300046559 | Ga0495667_0395679 | Ga0495667_0395679_370_729 | 119 |
| 1204 | 3300046616 | Ga0495668_0846099 | Ga0495668_0846099_132_491 | 119 |
| 1205 | 3300046642 | Ga0495634_0641132 | Ga0495634_0641132_34_393 | 119 |
| 1206 | 3300046663 | Ga0495635_0241998 | Ga0495635_0241998_288_647 | 119 |
| 1207 | 3300046663 | Ga0495635_0332038 | Ga0495635_0332038_441_806 | 119 |
| 1208 | 3300046664 | Ga0495659_0499212 | Ga0495659_0499212_64_423 | 119 |
| 1209 | 3300046681 | Ga0495647_0099209 | Ga0495647_0099209_629_988 | 119 |
| 1210 | 3300046683 | Ga0495658_0130434 | Ga0495658_0130434_757_1116 | 119 |
| 1211 | 3300046683 | Ga0495658_0154332 | Ga0495658_0154332_268_633 | 119 |
| 1212 | 3300046683 | Ga0495658_0357296 | Ga0495658_0357296_173_532 | 119 |
| 1213 | 3300046683 | Ga0495658_0801538 | Ga0495658_0801538_109_468 | 119 |
| 1214 | 3300046684 | Ga0495669_0099320 | Ga0495669_0099320_29_388 | 119 |
| 1215 | 3300046684 | Ga0495669_0546106 | Ga0495669_0546106_18_377 | 119 |
| 1216 | 3300046689 | Ga0495613_0060053 | Ga0495613_0060053_2095_2460 | 119 |
| 1217 | 3300046689 | Ga0495613_0140910 | Ga0495613_0140910_907_1266 | 119 |
| 1218 | 3300046691 | Ga0495670_0401213 | Ga0495670_0401213_38_397 | 119 |
| 1219 | 3300046794 | Ga0495589_0503081 | Ga0495589_0503081_139_510 | 119 |
| 1220 | 3300047315 | Ga0495581_0111288 | Ga0495581_0111288_333_692 | 119 |
| 1221 | 3300047317 | Ga0495604_0134806 | Ga0495604_0134806_28_387 | 119 |
| 1222 | 3300047319 | Ga0495674_0313575 | Ga0495674_0313575_439_798 | 119 |
| 1223 | 3300047322 | Ga0495680_0558833 | Ga0495680_0558833_152_511 | 119 |
| 1224 | 3300047471 | Ga0495684_0055859 | Ga0495684_0055859_1388_1747 | 119 |
| 1225 | 3300048088 | Ga0495602_1163738 | Ga0495602_1163738_44_403 | 119 |
| 1226 | 3300048903 | Ga0496100_0695619 | Ga0496100_0695619_313_684 | 119 |
| 1227 | 3300048904 | Ga0496101_0405539 | Ga0496101_0405539_229_597 | 119 |
| 1228 | 3300048904 | Ga0496101_0535281 | Ga0496101_0535281_124_495 | 119 |
| 1229 | 3300048904 | Ga0496101_0739857 | Ga0496101_0739857_124_483 | 119 |
| 1230 | 3300048904 | Ga0496101_1327019 | Ga0496101_1327019_163_522 | 119 |
| 1231 | 3300048905 | Ga0496102_0263543 | Ga0496102_0263543_352_711 | 119 |
| 1232 | 3300048905 | Ga0496102_0503062 | Ga0496102_0503062_159_518 | 119 |
| 1233 | 3300048905 | Ga0496102_1892127 | Ga0496102_1892127_25_396 | 119 |
| 1234 | 3300048907 | Ga0496104_0008562 | Ga0496104_0008562_5184_5543 | 119 |
| 1235 | 3300048907 | Ga0496104_0071068 | Ga0496104_0071068_1881_2240 | 119 |
| 1236 | 3300048907 | Ga0496104_0978782 | Ga0496104_0978782_339_707 | 119 |
| 1237 | 3300048908 | Ga0496105_0083175 | Ga0496105_0083175_1749_2108 | 119 |
| 1238 | 3300048908 | Ga0496105_0118197 | Ga0496105_0118197_407_766 | 119 |
| 1239 | 3300048908 | Ga0496105_0324119 | Ga0496105_0324119_318_677 | 119 |
| 1240 | 3300048909 | Ga0496106_0040608 | Ga0496106_0040608_1715_2074 | 119 |
| 1241 | 3300048909 | Ga0496106_0159914 | Ga0496106_0159914_1202_1561 | 119 |
| 1242 | 3300048909 | Ga0496106_0324981 | Ga0496106_0324981_425_796 | 119 |
| 1243 | 3300048909 | Ga0496106_0730059 | Ga0496106_0730059_396_764 | 119 |
| 1244 | 3300048909 | Ga0496106_1180855 | Ga0496106_1180855_217_576 | 119 |
| 1245 | 3300048910 | Ga0496107_0076223 | Ga0496107_0076223_1844_2203 | 119 |
| 1246 | 3300048910 | Ga0496107_0620004 | Ga0496107_0620004_380_739 | 119 |
| 1247 | 3300048911 | Ga0496108_0029035 | Ga0496108_0029035_975_1334 | 119 |
| 1248 | 3300048912 | Ga0496109_0007883 | Ga0496109_0007883_341_700 | 119 |
| 1249 | 3300048912 | Ga0496109_0052940 | Ga0496109_0052940_2498_2857 | 119 |
| 1250 | 3300048912 | Ga0496109_0225536 | Ga0496109_0225536_903_1262 | 119 |
| 1251 | 3300048912 | Ga0496109_1006808 | Ga0496109_1006808_136_495 | 119 |
| 1252 | 3300048912 | Ga0496109_1988281 | Ga0496109_1988281_69_428 | 119 |
| 1253 | 3300048913 | Ga0496110_0004692 | Ga0496110_0004692_4246_4605 | 119 |
| 1254 | 3300048913 | Ga0496110_0158049 | Ga0496110_0158049_566_934 | 119 |
| 1255 | 3300048913 | Ga0496110_0363689 | Ga0496110_0363689_375_734 | 119 |
| 1256 | 3300048914 | Ga0496111_0018955 | Ga0496111_0018955_3453_3812 | 119 |
| 1257 | 3300048914 | Ga0496111_0440325 | Ga0496111_0440325_39_398 | 119 |
| 1258 | 3300048915 | Ga0496112_0009593 | Ga0496112_0009593_4765_5124 | 119 |
| 1259 | 3300048915 | Ga0496112_0051911 | Ga0496112_0051911_3237_3596 | 119 |
| 1260 | 3300048915 | Ga0496112_1094059 | Ga0496112_1094059_186_545 | 119 |
| 1261 | 3300048915 | Ga0496112_1183391 | Ga0496112_1183391_240_599 | 119 |
| 1262 | 3300048916 | Ga0496113_0010835 | Ga0496113_0010835_4474_4833 | 119 |
| 1263 | 3300048916 | Ga0496113_0713246 | Ga0496113_0713246_179_538 | 119 |
| 1264 | 3300048917 | Ga0496114_0446878 | Ga0496114_0446878_351_722 | 119 |
| 1265 | 3300048917 | Ga0496114_0499461 | Ga0496114_0499461_625_984 | 119 |
| 1266 | 3300048918 | Ga0496115_0111356 | Ga0496115_0111356_518_877 | 119 |
| 1267 | 3300049519 | Ga0501296_068390 | Ga0501296_068390_89_454 | 119 |
| 1268 | 3300049522 | Ga0501299_220721 | Ga0501299_220721_61_426 | 119 |
| 1269 | 3300049569 | Ga0501032_0405350 | Ga0501032_0405350_287_649 | 119 |
| 1270 | 3300049572 | Ga0501036_0390320 | Ga0501036_0390320_538_897 | 119 |
| 1271 | 3300049575 | Ga0501039_0081481 | Ga0501039_0081481_2129_2491 | 119 |
| 1272 | 3300049576 | Ga0501040_0808401 | Ga0501040_0808401_42_404 | 119 |
| 1273 | 3300049576 | Ga0501040_1331680 | Ga0501040_1331680_107_466 | 119 |
| 1274 | 3300049577 | Ga0501041_0050172 | Ga0501041_0050172_1741_2103 | 119 |
| 1275 | 3300049577 | Ga0501041_0178885 | Ga0501041_0178885_435_794 | 119 |
| 1276 | 3300049577 | Ga0501041_0208371 | Ga0501041_0208371_203_562 | 119 |
| 1277 | 3300049577 | Ga0501041_0216867 | Ga0501041_0216867_72_431 | 119 |
| 1278 | 3300049578 | Ga0501042_0044862 | Ga0501042_0044862_2332_2694 | 119 |
| 1279 | 3300049578 | Ga0501042_0091952 | Ga0501042_0091952_590_949 | 119 |
| 1280 | 3300049578 | Ga0501042_0140840 | Ga0501042_0140840_570_932 | 119 |
| 1281 | 3300049578 | Ga0501042_0691570 | Ga0501042_0691570_61_420 | 119 |
| 1282 | 3300049579 | Ga0501043_0654737 | Ga0501043_0654737_306_665 | 119 |
| 1283 | 3300049580 | Ga0501046_0456555 | Ga0501046_0456555_348_707 | 119 |
| 1284 | 3300049580 | Ga0501046_0868996 | Ga0501046_0868996_235_597 | 119 |
| 1285 | 3300049580 | Ga0501046_1014923 | Ga0501046_1014923_169_528 | 119 |
| 1286 | 3300049581 | Ga0501047_0965959 | Ga0501047_0965959_32_394 | 119 |
| 1287 | 3300049583 | Ga0501067_0349988 | Ga0501067_0349988_80_439 | 119 |
| 1288 | 3300049584 | Ga0501068_0413061 | Ga0501068_0413061_259_618 | 119 |
| 1289 | 3300049584 | Ga0501068_0434109 | Ga0501068_0434109_385_744 | 119 |
| 1290 | 3300049585 | Ga0501069_0179706 | Ga0501069_0179706_154_516 | 119 |
| 1291 | 3300049587 | Ga0501071_0031106 | Ga0501071_0031106_3225_3587 | 119 |
| 1292 | 3300049587 | Ga0501071_0098787 | Ga0501071_0098787_424_783 | 119 |
| 1293 | 3300049587 | Ga0501071_0695411 | Ga0501071_0695411_154_513 | 119 |
| 1294 | 3300049588 | Ga0501072_0042793 | Ga0501072_0042793_3131_3490 | 119 |
| 1295 | 3300049589 | Ga0501073_0249406 | Ga0501073_0249406_715_1092 | 119 |
| 1296 | 3300049589 | Ga0501073_0395639 | Ga0501073_0395639_41_403 | 119 |
| 1297 | 3300049590 | Ga0501074_0314297 | Ga0501074_0314297_488_847 | 119 |
| 1298 | 3300049590 | Ga0501074_0359698 | Ga0501074_0359698_329_691 | 119 |
| 1299 | 3300049591 | Ga0501075_0042269 | Ga0501075_0042269_1833_2192 | 119 |
| 1300 | 3300049591 | Ga0501075_0159458 | Ga0501075_0159458_631_993 | 119 |
| 1301 | 3300049591 | Ga0501075_0952764 | Ga0501075_0952764_11_370 | 119 |
| 1302 | 3300049592 | Ga0501076_0046014 | Ga0501076_0046014_2434_2796 | 119 |
| 1303 | 3300049592 | Ga0501076_0055767 | Ga0501076_0055767_2081_2440 | 119 |
| 1304 | 3300049592 | Ga0501076_0140625 | Ga0501076_0140625_380_739 | 119 |
| 1305 | 3300049592 | Ga0501076_0225615 | Ga0501076_0225615_229_588 | 119 |
| 1306 | 3300049593 | Ga0501077_0358434 | Ga0501077_0358434_239_598 | 119 |
| 1307 | 3300049593 | Ga0501077_0666823 | Ga0501077_0666823_204_581 | 119 |
| 1308 | 3300049652 | Ga0501202_148057 | Ga0501202_148057_69_434 | 119 |
| 1309 | 3300049741 | Ga0501079_0053476 | Ga0501079_0053476_819_1178 | 119 |
| 1310 | 3300049741 | Ga0501079_0094223 | Ga0501079_0094223_246_623 | 119 |
| 1311 | 3300049741 | Ga0501079_0140282 | Ga0501079_0140282_645_1004 | 119 |
| 1312 | 3300049741 | Ga0501079_1310383 | Ga0501079_1310383_116_475 | 119 |
| 1313 | 3300049742 | Ga0501080_0947979 | Ga0501080_0947979_378_737 | 119 |
| 1314 | 3300049742 | Ga0501080_1373390 | Ga0501080_1373390_83_460 | 119 |
| 1315 | 3300049743 | Ga0501081_0008315 | Ga0501081_0008315_3925_4284 | 119 |
| 1316 | 3300049743 | Ga0501081_0157769 | Ga0501081_0157769_1014_1373 | 119 |
| 1317 | 3300049743 | Ga0501081_0181421 | Ga0501081_0181421_95_457 | 119 |
| 1318 | 3300049743 | Ga0501081_0420790 | Ga0501081_0420790_351_713 | 119 |
| 1319 | 3300049743 | Ga0501081_0421217 | Ga0501081_0421217_603_965 | 119 |
| 1320 | 3300049824 | Ga0501045_0076993 | Ga0501045_0076993_573_935 | 119 |
| 1321 | 3300049824 | Ga0501045_0483206 | Ga0501045_0483206_433_795 | 119 |
| 1322 | 3300050491 | nmdc:mga00v17_181772_c1 | nmdc:mga00v17_181772_c1_95_457 | 119 |
| 1323 | 3300050493 | nmdc:mga0k408_291082_c1 | nmdc:mga0k408_291082_c1_74_436 | 119 |
| 1324 | 3300050493 | nmdc:mga0k408_53704_c2 | nmdc:mga0k408_53704_c2_336_704 | 119 |
| 1325 | 3300050494 | nmdc:mga06z11_118642_c1 | nmdc:mga06z11_118642_c1_136_504 | 119 |
| 1326 | 3300050496 | nmdc:mga07m45_180842_c1 | nmdc:mga07m45_180842_c1_165_524 | 119 |
| 1327 | 3300050507 | nmdc:mga05p37_1100630_c1 | nmdc:mga05p37_1100630_c1_337_705 | 119 |
| 1328 | 3300050507 | nmdc:mga05p37_119786_c1 | nmdc:mga05p37_119786_c1_143_502 | 119 |
| 1329 | 3300050507 | nmdc:mga05p37_1230740_c1 | nmdc:mga05p37_1230740_c1_383_742 | 119 |
| 1330 | 3300050507 | nmdc:mga05p37_1594891_c1 | nmdc:mga05p37_1594891_c1_124_483 | 119 |
| 1331 | 3300050507 | nmdc:mga05p37_1729831_c1 | nmdc:mga05p37_1729831_c1_166_552 | 119 |
| 1332 | 3300050507 | nmdc:mga05p37_20831_c1 | nmdc:mga05p37_20831_c1_838_1197 | 119 |
| 1333 | 3300050507 | nmdc:mga05p37_209293_c1 | nmdc:mga05p37_209293_c1_1005_1367 | 119 |
| 1334 | 3300050507 | nmdc:mga05p37_2143596_c1 | nmdc:mga05p37_2143596_c1_140_499 | 119 |
| 1335 | 3300050507 | nmdc:mga05p37_226973_c1 | nmdc:mga05p37_226973_c1_855_1214 | 119 |
| 1336 | 3300050507 | nmdc:mga05p37_27034_c1 | nmdc:mga05p37_27034_c1_3439_3798 | 119 |
| 1337 | 3300050507 | nmdc:mga05p37_2738_c2 | nmdc:mga05p37_2738_c2_2418_2777 | 119 |
| 1338 | 3300050507 | nmdc:mga05p37_29743_c1 | nmdc:mga05p37_29743_c1_6054_6413 | 119 |
| 1339 | 3300050507 | nmdc:mga05p37_38505_c1 | nmdc:mga05p37_38505_c1_4430_4789 | 119 |
| 1340 | 3300050507 | nmdc:mga05p37_6177_c1 | nmdc:mga05p37_6177_c1_9873_10232 | 119 |
| 1341 | 3300050507 | nmdc:mga05p37_71170_c1 | nmdc:mga05p37_71170_c1_2405_2764 | 119 |
| 1342 | 3300050507 | nmdc:mga05p37_789914_c1 | nmdc:mga05p37_789914_c1_457_819 | 119 |
| 1343 | 3300050507 | nmdc:mga05p37_83256_c1 | nmdc:mga05p37_83256_c1_2890_3249 | 119 |
| 1344 | 3300050508 | nmdc:mga09592_101467_c1 | nmdc:mga09592_101467_c1_1893_2252 | 119 |
| 1345 | 3300050508 | nmdc:mga09592_459558_c1 | nmdc:mga09592_459558_c1_365_730 | 119 |
| 1346 | 3300050508 | nmdc:mga09592_483498_c1 | nmdc:mga09592_483498_c1_384_743 | 119 |
| 1347 | 3300050509 | nmdc:mga0qj67_142930_c1 | nmdc:mga0qj67_142930_c1_449_808 | 119 |
| 1348 | 3300050509 | nmdc:mga0qj67_297662_c1 | nmdc:mga0qj67_297662_c1_242_604 | 119 |
| 1349 | 3300050509 | nmdc:mga0qj67_48323_c1 | nmdc:mga0qj67_48323_c1_2002_2361 | 119 |
| 1350 | 3300050509 | nmdc:mga0qj67_667180_c1 | nmdc:mga0qj67_667180_c1_446_811 | 119 |
| 1351 | 3300050509 | nmdc:mga0qj67_80907_c1 | nmdc:mga0qj67_80907_c1_2134_2496 | 119 |
| 1352 | 3300050510 | nmdc:mga06r32_108864_c1 | nmdc:mga06r32_108864_c1_1790_2149 | 119 |
| 1353 | 3300050510 | nmdc:mga06r32_1507208_c1 | nmdc:mga06r32_1507208_c1_205_570 | 119 |
| 1354 | 3300050510 | nmdc:mga06r32_166141_c1 | nmdc:mga06r32_166141_c1_834_1193 | 119 |
| 1355 | 3300050510 | nmdc:mga06r32_452999_c1 | nmdc:mga06r32_452999_c1_57_419 | 119 |
| 1356 | 3300050510 | nmdc:mga06r32_719294_c1 | nmdc:mga06r32_719294_c1_477_842 | 119 |
| 1357 | 3300050510 | nmdc:mga06r32_86599_c1 | nmdc:mga06r32_86599_c1_1310_1669 | 119 |
| 1358 | 3300050510 | nmdc:mga06r32_98095_c1 | nmdc:mga06r32_98095_c1_2341_2727 | 119 |
| 1359 | 3300050511 | nmdc:mga08y16_134702_c1 | nmdc:mga08y16_134702_c1_510_869 | 119 |
| 1360 | 3300050511 | nmdc:mga08y16_392987_c1 | nmdc:mga08y16_392987_c1_858_1226 | 119 |
| 1361 | 3300050511 | nmdc:mga08y16_520297_c1 | nmdc:mga08y16_520297_c1_454_813 | 119 |
| 1362 | 3300050511 | nmdc:mga08y16_653305_c1 | nmdc:mga08y16_653305_c1_499_864 | 119 |
| 1363 | 3300050511 | nmdc:mga08y16_929148_c1 | nmdc:mga08y16_929148_c1_333_704 | 119 |
| 1364 | 3300050511 | nmdc:mga08y16_9369_c1 | nmdc:mga08y16_9369_c1_6890_7249 | 119 |
| 1365 | 3300050512 | nmdc:mga0n895_1313407_c1 | nmdc:mga0n895_1313407_c1_137_496 | 119 |
| 1366 | 3300050512 | nmdc:mga0n895_132139_c1 | nmdc:mga0n895_132139_c1_839_1198 | 119 |
| 1367 | 3300050512 | nmdc:mga0n895_194829_c1 | nmdc:mga0n895_194829_c1_573_932 | 119 |
| 1368 | 3300050512 | nmdc:mga0n895_2024542_c1 | nmdc:mga0n895_2024542_c1_124_483 | 119 |
| 1369 | 3300050512 | nmdc:mga0n895_301955_c1 | nmdc:mga0n895_301955_c1_1220_1579 | 119 |
| 1370 | 3300050512 | nmdc:mga0n895_718682_c1 | nmdc:mga0n895_718682_c1_348_707 | 119 |
| 1371 | 3300050512 | nmdc:mga0n895_721858_c1 | nmdc:mga0n895_721858_c1_218_577 | 119 |
| 1372 | 3300050513 | nmdc:mga0rr50_1314062_c1 | nmdc:mga0rr50_1314062_c1_90_449 | 119 |
| 1373 | 3300050513 | nmdc:mga0rr50_137630_c1 | nmdc:mga0rr50_137630_c1_358_717 | 119 |
| 1374 | 3300050513 | nmdc:mga0rr50_242591_c1 | nmdc:mga0rr50_242591_c1_856_1215 | 119 |
| 1375 | 3300050513 | nmdc:mga0rr50_248189_c1 | nmdc:mga0rr50_248189_c1_510_869 | 119 |
| 1376 | 3300050513 | nmdc:mga0rr50_47505_c1 | nmdc:mga0rr50_47505_c1_97_459 | 119 |
| 1377 | 3300050513 | nmdc:mga0rr50_740511_c1 | nmdc:mga0rr50_740511_c1_378_746 | 119 |
| 1378 | 3300050514 | nmdc:mga08x19_229740_c1 | nmdc:mga08x19_229740_c1_548_907 | 119 |
| 1379 | 3300050514 | nmdc:mga08x19_6364_c1 | nmdc:mga08x19_6364_c1_2574_2933 | 119 |
| 1380 | 3300050514 | nmdc:mga08x19_900864_c1 | nmdc:mga08x19_900864_c1_67_426 | 119 |
| 1381 | 3300050515 | nmdc:mga0a205_100557_c2 | nmdc:mga0a205_100557_c2_1917_2276 | 119 |
| 1382 | 3300050515 | nmdc:mga0a205_19164_c1 | nmdc:mga0a205_19164_c1_1880_2239 | 119 |
| 1383 | 3300050515 | nmdc:mga0a205_339228_c1 | nmdc:mga0a205_339228_c1_744_1103 | 119 |
| 1384 | 3300050515 | nmdc:mga0a205_345110_c1 | nmdc:mga0a205_345110_c1_410_772 | 119 |
| 1385 | 3300050515 | nmdc:mga0a205_388379_c1 | nmdc:mga0a205_388379_c1_10_372 | 119 |
| 1386 | 3300050515 | nmdc:mga0a205_428895_c1 | nmdc:mga0a205_428895_c1_631_990 | 119 |
| 1387 | 3300050515 | nmdc:mga0a205_468679_c1 | nmdc:mga0a205_468679_c1_678_1037 | 119 |
| 1388 | 3300050515 | nmdc:mga0a205_74905_c2 | nmdc:mga0a205_74905_c2_2521_2880 | 119 |
| 1389 | 3300050515 | nmdc:mga0a205_86326_c1 | nmdc:mga0a205_86326_c1_2654_3013 | 119 |
| 1390 | 3300053077 | Ga0495601_0225021 | Ga0495601_0225021_455_814 | 119 |
| 1391 | 3300053077 | Ga0495601_0371243 | Ga0495601_0371243_29_388 | 119 |
| 1392 | 3300053078 | Ga0495612_0460664 | Ga0495612_0460664_115_474 | 119 |
| 1393 | 3300053084 | Ga0495595_0528633 | Ga0495595_0528633_23_382 | 119 |
| 1394 | 3300053085 | Ga0495619_0118877 | Ga0495619_0118877_987_1355 | 119 |
| 1395 | 3300053085 | Ga0495619_0150602 | Ga0495619_0150602_424_783 | 119 |
| 1396 | 3300053085 | Ga0495619_0151616 | Ga0495619_0151616_274_633 | 119 |
| 1397 | 3300053085 | Ga0495619_0248654 | Ga0495619_0248654_687_1046 | 119 |
| 1398 | 3300053085 | Ga0495619_0249327 | Ga0495619_0249327_788_1153 | 119 |
| 1399 | 3300053085 | Ga0495619_0326669 | Ga0495619_0326669_243_602 | 119 |
| 1400 | 3300054114 | Ga0501084_0089602 | Ga0501084_0089602_2044_2403 | 119 |
| 1401 | 3300054114 | Ga0501084_0241347 | Ga0501084_0241347_315_677 | 119 |
| 1402 | 3300054114 | Ga0501084_0277564 | Ga0501084_0277564_64_423 | 119 |
| 1403 | 3300054114 | Ga0501084_0369950 | Ga0501084_0369950_28_390 | 119 |
| 1404 | 3300054114 | Ga0501084_0702670 | Ga0501084_0702670_282_644 | 119 |
| 1405 | 3300054114 | Ga0501084_1209224 | Ga0501084_1209224_104_463 | 119 |
| 1406 | 3300054114 | Ga0501084_1429318 | Ga0501084_1429318_183_548 | 119 |
| 1407 | 3300059421 | Ga0590071_007833 | Ga0590071_007833_103_462 | 119 |
| 1408 | 3300059426 | Ga0590077_002299 | Ga0590077_002299_2803_3162 | 119 |
| 1409 | 3300060353 | Ga0501082_0182024 | Ga0501082_0182024_1057_1416 | 119 |
| 1410 | 3300060353 | Ga0501082_0384535 | Ga0501082_0384535_406_765 | 119 |
| 1411 | 3300060353 | Ga0501082_0553563 | Ga0501082_0553563_429_791 | 119 |
| 1412 | 3300060353 | Ga0501082_0801192 | Ga0501082_0801192_172_531 | 119 |
| 1413 | 3300061734 | Ga0530510_0065854 | Ga0530510_0065854_188_547 | 119 |
| 1414 | 3300061734 | Ga0530510_0128067 | Ga0530510_0128067_758_1120 | 119 |
| 1415 | 3300061734 | Ga0530510_0175133 | Ga0530510_0175133_563_922 | 119 |
| 1416 | 3300061734 | Ga0530510_0610693 | Ga0530510_0610693_122_481 | 119 |
| 1417 | 3300061734 | Ga0530510_1100764 | Ga0530510_1100764_145_504 | 119 |
| 1418 | 3300061734 | Ga0530510_1343010 | Ga0530510_1343010_133_495 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zzd-assembly1.cif.gz_A-2 | crystal structure of multidrug resistance regulator lmrr bound to riboflavin | 0.9245 | 15 | 111 |
| 5zhv-assembly1.cif.gz_B | crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion | 0.9173 | 17 | 107 |
| 6fuu-assembly1.cif.gz_A | transcriptional regulator lmrr with bound heme | 0.9141 | 15 | 110 |
| 5h20-assembly1.cif.gz_A-2 | x-ray structure of padr-like transcription factor from bacteroid fragilis | 0.9031 | 14 | 110 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.902 | 15 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fuuA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9141 | 15 | 110 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9035 | 17 | 95 | 1.10.10.10 |
| 5h20A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9031 | 14 | 110 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8982 | 10 | 107 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8909 | 15 | 109 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7K7R8-F1-model_v4 | deleted | 0.9911 | 14 | 102 |
|
| AF-A0A2V8EBD2-F1-model_v4 | PadR family transcriptional regulator | 0.9828 | 9 | 112 |
|
| AF-A0A2V9A638-F1-model_v4 | PadR family transcriptional regulator | 0.9737 | 8 | 93 |
|
| AF-A0A0K2GYX4-F1-model_v4 | ParR family transcriptional regulator | 0.9705 | 18 | 98 |
|
| AF-A0A2V8UGP7-F1-model_v4 | Transcription regulator PadR N-terminal domain-containing protein | 0.9688 | 14 | 114 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar