F493708

General Info

Members Datasets Scaffolds Average Seq Length
1404 642 1215 230

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10127200|Ga0207700_101272002
Length 280
Sequence MPDYEAPYLEIREQKSEKAQRDNELVRDREVSFRFPGLLLWFDAKIGDENVTRALRRILVIEDDAETARQIVDFLKTRGYETNLAAHGGDGLRLGESPDYAVIVIDRMLPVVDGLAIIRRLRAAGIITPALIISALGEVDDRVRGLRAGGDDYLVKPFAFAELLARIEALARRSATVVKETVLRVGDLELDLVSRTANRDGRHIKLLPREFQVLEYLVRNEGHVVPRAMLLEKVWDLHFDPSTNIIDVYVGRVRRKVDGEQAYPLIHTIRGVGFCVRAPY

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
16 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
20 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
21 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
22 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
23 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
24 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
25 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
26 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
32 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
33 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
34 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
35 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
36 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
37 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
38 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
39 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
40 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
41 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
44 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
48 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
49 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
50 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
51 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
52 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
53 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
56 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
57 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
58 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
59 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
60 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
61 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
62 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
63 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
64 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
65 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
66 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
67 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
68 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
69 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
70 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
71 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
72 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
73 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
74 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
75 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
76 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
77 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
78 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
79 2904699407
80 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
81 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
82 2906610324
83 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
84 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
85 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
86 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
87 2922368715
88 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
89 2922425934
90 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
91 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
92 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
93 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
94 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
95 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
96 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
97 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
98 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
99 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
100 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
101 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
102 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
103 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
104 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
105 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
106 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
107 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
108 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
109 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
110 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
111 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
112 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
113 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
114 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
115 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
116 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
117 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
118 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
119 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
120 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
121 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
122 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
123 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
124 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
125 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
126 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
127 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
128 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
129 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
130 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
131 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
132 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
133 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
134 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
135 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
136 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
137 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
138 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
139 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
140 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
141 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
142 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
143 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
144 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
145 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
146 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
147 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
148 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
149 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
150 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
151 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
152 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
153 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
154 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
155 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
156 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
157 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
158 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
159 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
160 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
161 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
162 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
163 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
164 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
165 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
166 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
167 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
168 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
169 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
170 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
171 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
172 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
173 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
174 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
175 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
176 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
177 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
178 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
181 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
182 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
183 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
184 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
185 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
186 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
187 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
188 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
189 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
190 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
191 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
194 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
195 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
196 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
197 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
198 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
199 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
200 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
201 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
202 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
203 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
204 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
205 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
206 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
207 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
208 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
209 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
210 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
211 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
212 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
213 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
214 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
215 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
216 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
217 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
218 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
219 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
220 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
221 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
222 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
223 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
224 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
225 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
226 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
227 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
228 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
229 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
230 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
231 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
232 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
233 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
234 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
235 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
236 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
237 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
238 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
239 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
240 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
241 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
242 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
243 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
244 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
245 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
246 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
247 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
248 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
249 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
250 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
251 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
252 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
253 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
254 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
255 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
256 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
257 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
258 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
259 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
260 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
261 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
262 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
263 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
264 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
265 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
266 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
267 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
268 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
269 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
270 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
271 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
272 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
273 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
274 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
275 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
276 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
277 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
278 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
279 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
280 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
281 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
282 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
283 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
284 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
285 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
286 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
287 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
288 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
289 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
290 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
291 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
292 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
293 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
294 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
295 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
296 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
368 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
369 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
370 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
371 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
373 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
374 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
378 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
379 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
380 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
381 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
382 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
383 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
384 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
385 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
386 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
387 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
388 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
389 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
390 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
391 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
392 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
393 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
394 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
395 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
396 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
397 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
398 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
399 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
400 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
401 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
402 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
403 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
404 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
405 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
406 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
407 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
408 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
409 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
410 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
411 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
412 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
413 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
414 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
415 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
416 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
417 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
418 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
419 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
420 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
421 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
422 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
423 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
424 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
425 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
426 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
427 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
428 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
429 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
430 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
431 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
432 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
433 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
434 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
435 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
436 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
437 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
438 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
439 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
440 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
441 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
442 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
443 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
444 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
445 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
446 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
447 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
448 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
449 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
450 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
451 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
452 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
453 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
454 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
455 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
456 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
457 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
458 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
459 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
460 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
461 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
462 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
463 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
464 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
465 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
466 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
467 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
468 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
469 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
470 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
471 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
472 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
473 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
474 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
475 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
476 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
477 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
478 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
479 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
480 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
481 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
482 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
483 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
484 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
485 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
486 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
487 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
488 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
489 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
490 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
491 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
492 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
493 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
494 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
495 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
496 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
497 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
498 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
499 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
500 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
501 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
502 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
503 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
504 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
505 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
506 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
507 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
508 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
509 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
510 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
511 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
512 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
513 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
514 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
515 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
516 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
517 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
518 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
519 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
520 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
521 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
522 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
523 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
524 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
525 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
526 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
527 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
528 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
529 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
530 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
531 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
532 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
533 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
534 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
535 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
536 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
537 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
538 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
539 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
540 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
541 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
542 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
543 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
544 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
545 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
546 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
547 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
548 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
549 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
550 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
551 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
552 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
553 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
554 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
555 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
556 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
557 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
558 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
559 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
560 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
561 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
562 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
563 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
564 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
565 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
566 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
567 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
568 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
569 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
570 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
571 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
572 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
573 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
574 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
575 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
576 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
577 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
578 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
579 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
580 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
581 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
582 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
583 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
584 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
585 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
586 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
587 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
588 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
589 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
590 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
591 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
592 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
593 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
594 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
595 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
596 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
597 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
598 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
599 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
600 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
601 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
602 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
603 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
604 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
605 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
606 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
607 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
608 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
609 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
610 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
611 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
612 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
613 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
614 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
615 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
616 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
617 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
618 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
619 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
620 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
621 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
622 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
623 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
624 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
625 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
626 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
627 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
628 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
629 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
630 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
631 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
632 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
633 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
634 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
635 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
636 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
637 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
638 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
639 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
640 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
641 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
642 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.5
Metatranscriptomes 0.29
Isolates 13.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 11.04
Rhizoplane 8.69
Rhizosphere 64.46
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001020 3300003203 Bacteria 13105
2 JGI25153J46596_10000804 3300003215 Bacteria 19173
3 JGI25153J46596_10006566 3300003215 Bacteria 5864
4 JGI25153J46596_10058875 3300003215 Bacteria 1054
5 JGI25160J50197_1005212 3300003354 Bacteria 5450
6 Ga0055539_1009970 3300003752 Bacteria 1177
7 Ga0055526_1052374 3300003771 Bacteria 921
8 JGI25405J52794_10036643 3300003911 Bacteria 1030
9 Ga0055543_1006157 3300004625 Bacteria 2943
10 Ga0065165_1000701 3300005262 Bacteria 47638
11 Ga0065704_10215145 3300005289 Unclassified 1094
12 Ga0065707_10098746 3300005295 Unclassified 3062
13 Ga0070676_10097147 3300005328 Bacteria 1814
14 Ga0070676_10121744 3300005328 Bacteria 1638
15 Ga0070683_100017619 3300005329 Bacteria 6312
16 Ga0070683_100025232 3300005329 Bacteria 5335
17 Ga0070690_100230713 3300005330 Bacteria 1301
18 Ga0070670_100239789 3300005331 Bacteria 1579
19 Ga0068869_100074999 3300005334 Bacteria 2512
20 Ga0068869_100123560 3300005334 Bacteria 1982
21 Ga0070666_10045804 3300005335 Bacteria 2932
22 Ga0070680_100010505 3300005336 Bacteria 7142
23 Ga0070680_100052127 3300005336 Bacteria 3340
24 Ga0070680_100079764 3300005336 Bacteria 2699
25 Ga0070680_100117683 3300005336 Bacteria 2216
26 Ga0070680_100224201 3300005336 Bacteria 1587
27 Ga0068868_100111298 3300005338 Bacteria 2225
28 Ga0068868_100272363 3300005338 Bacteria 1430
29 Ga0068868_100459352 3300005338 Bacteria 1109
30 Ga0070660_100036145 3300005339 Bacteria 3741
31 Ga0070661_100093421 3300005344 Bacteria 2229
32 Ga0070668_100073802 3300005347 Bacteria 2660
33 Ga0070669_100084222 3300005353 Bacteria 2372
34 Ga0070669_100286917 3300005353 Bacteria 1320
35 Ga0070675_100228008 3300005354 Unclassified 1624
36 Ga0070675_100703003 3300005354 Bacteria 921
37 Ga0070671_100006252 3300005355 Bacteria 9486
38 Ga0070671_100075956 3300005355 Bacteria 2807
39 Ga0070671_100228249 3300005355 Bacteria 1580
40 Ga0070673_100450375 3300005364 Bacteria 1158
41 Ga0070688_100451454 3300005365 Bacteria 961
42 Ga0070659_100061054 3300005366 Bacteria 2978
43 Ga0070667_100056443 3300005367 Bacteria 3317
44 Ga0070667_100271815 3300005367 Bacteria 1520
45 Ga0070667_100460702 3300005367 Bacteria 1162
46 Ga0070667_101115238 3300005367 Bacteria 738
47 Ga0070709_10007584 3300005434 Bacteria 5956
48 Ga0070709_10310108 3300005434 Bacteria 1155
49 Ga0070714_100019222 3300005435 Bacteria 5561
50 Ga0070714_100027369 3300005435 Bacteria 4721
51 Ga0070714_100067406 3300005435 Bacteria 3085
52 Ga0070714_100084184 3300005435 Bacteria 2775
53 Ga0070714_100142258 3300005435 Unclassified 2154
54 Ga0070714_100151239 3300005435 Bacteria 2092
55 Ga0070714_100480520 3300005435 Bacteria 1183
56 Ga0070713_100001489 3300005436 Bacteria 14921
57 Ga0070713_100009110 3300005436 Bacteria 7080
58 Ga0070713_100023775 3300005436 Bacteria 4762
59 Ga0070713_100025632 3300005436 Bacteria 4613
60 Ga0070713_100129793 3300005436 Bacteria 2221
61 Ga0070713_100233179 3300005436 Bacteria 1674
62 Ga0070713_100327201 3300005436 Bacteria 1417
63 Ga0070710_10000992 3300005437 Bacteria 13504
64 Ga0070710_10109063 3300005437 Bacteria 1660
65 Ga0070701_10165576 3300005438 Bacteria 1284
66 Ga0070711_100013172 3300005439 Bacteria 5187
67 Ga0070711_100014021 3300005439 Bacteria 5043
68 Ga0070711_100017355 3300005439 Bacteria 4582
69 Ga0070711_100087592 3300005439 Bacteria 2236
70 Ga0070711_100232879 3300005439 Bacteria 1437
71 Ga0070705_100112482 3300005440 Bacteria 1742
72 Ga0070705_100312005 3300005440 Bacteria 1132
73 Ga0070700_100458675 3300005441 Bacteria 971
74 Ga0070663_100014207 3300005455 Bacteria 5105
75 Ga0070663_100024630 3300005455 Bacteria 4054
76 Ga0070663_100048295 3300005455 Bacteria 3017
77 Ga0070663_100088872 3300005455 Bacteria 2285
78 Ga0070663_100208158 3300005455 Bacteria 1530
79 Ga0070678_100337425 3300005456 Bacteria 1292
80 Ga0070662_100140328 3300005457 Bacteria 1872
81 Ga0070662_100327595 3300005457 Bacteria 1250
82 Ga0070681_10039976 3300005458 Bacteria 4702
83 Ga0070681_10088456 3300005458 Bacteria 3049
84 Ga0070681_10099965 3300005458 Bacteria 2847
85 Ga0070681_10409761 3300005458 Bacteria 1267
86 Ga0070681_10418163 3300005458 Bacteria 1252
87 Ga0068867_100247412 3300005459 Bacteria 1449
88 Ga0070706_100115771 3300005467 Bacteria 2496
89 Ga0070707_100202705 3300005468 Bacteria 1934
90 Ga0070707_100317350 3300005468 Bacteria 1514
91 Ga0070699_100009853 3300005518 Bacteria 8274
92 Ga0070699_100206939 3300005518 Bacteria 1746
93 Ga0070699_100208547 3300005518 Bacteria 1739
94 Ga0070679_100005756 3300005530 Bacteria 11497
95 Ga0070679_100015208 3300005530 Bacteria 7392
96 Ga0070679_100137820 3300005530 Bacteria 2421
97 Ga0070679_100150084 3300005530 Bacteria 2308
98 Ga0070684_100150192 3300005535 Bacteria 2110
99 Ga0070684_100161283 3300005535 Bacteria 2034
100 Ga0070697_100006018 3300005536 Bacteria 9382
101 Ga0068853_100165253 3300005539 Bacteria 2000
102 Ga0068853_100188949 3300005539 Bacteria 1870
103 Ga0068853_100218842 3300005539 Bacteria 1738
104 Ga0068853_100602922 3300005539 Bacteria 1043
105 Ga0070672_100198425 3300005543 Bacteria 1677
106 Ga0070695_100411581 3300005545 Bacteria 1028
107 Ga0070696_100056279 3300005546 Bacteria 2743
108 Ga0070696_100658708 3300005546 Bacteria 849
109 Ga0070693_100064920 3300005547 Bacteria 2132
110 Ga0070693_100175691 3300005547 Bacteria 1375
111 Ga0070665_100085403 3300005548 Bacteria 3161
112 Ga0070665_100106310 3300005548 Bacteria 2808
113 Ga0070665_100266993 3300005548 Bacteria 1713
114 Ga0070665_100325219 3300005548 Bacteria 1542
115 Ga0070665_100369316 3300005548 Bacteria 1441
116 Ga0070665_100482234 3300005548 Bacteria 1251
117 Ga0070665_100974957 3300005548 Bacteria 860
118 Ga0070704_100019036 3300005549 Bacteria 4404
119 Ga0068855_100040685 3300005563 Bacteria 5515
120 Ga0068855_100050976 3300005563 Bacteria 4876
121 Ga0068855_100099474 3300005563 Bacteria 3350
122 Ga0068855_100194372 3300005563 Bacteria 2287
123 Ga0068855_100277393 3300005563 Bacteria 1862
124 Ga0070664_100218889 3300005564 Bacteria 1703
125 Ga0070664_100373957 3300005564 Bacteria 1300
126 Ga0068857_100062281 3300005577 Bacteria 3316
127 Ga0068857_100071339 3300005577 Bacteria 3095
128 Ga0068857_100104583 3300005577 Bacteria 2542
129 Ga0068854_100092958 3300005578 Bacteria 2248
130 Ga0068854_100191680 3300005578 Bacteria 1602
131 Ga0068856_100000680 3300005614 Bacteria 36872
132 Ga0068856_100158954 3300005614 Bacteria 2270
133 Ga0068856_100540367 3300005614 Bacteria 1187
134 Ga0068856_100609299 3300005614 Bacteria 1113
135 Ga0068856_100687080 3300005614 Bacteria 1044
136 Ga0070702_100438987 3300005615 Bacteria 944
137 Ga0068852_100005622 3300005616 Bacteria 8992
138 Ga0068852_100023372 3300005616 Bacteria 4975
139 Ga0068852_100117720 3300005616 Bacteria 2427
140 Ga0068852_100145340 3300005616 Bacteria 2199
141 Ga0068852_100627694 3300005616 Bacteria 1080
142 Ga0068859_100380780 3300005617 Bacteria 1506
143 Ga0068864_100279930 3300005618 Bacteria 1556
144 Ga0068866_10373203 3300005718 Bacteria 913
145 Ga0068861_100345994 3300005719 Bacteria 1302
146 Ga0068861_100436992 3300005719 Bacteria 1169
147 Ga0068861_100473846 3300005719 Bacteria 1126
148 Ga0068851_10003594 3300005834 Bacteria 6913
149 Ga0068863_100092102 3300005841 Bacteria 2875
150 Ga0068863_100930360 3300005841 Bacteria 870
151 Ga0068858_100097039 3300005842 Bacteria 2747
152 Ga0068858_100101774 3300005842 Bacteria 2679
153 Ga0068858_100225054 3300005842 Bacteria 1777
154 Ga0068858_100347456 3300005842 Bacteria 1420
155 Ga0068858_100703364 3300005842 Bacteria 983
156 Ga0068858_100942837 3300005842 Bacteria 845
157 Ga0068860_100042873 3300005843 Bacteria 4318
158 Ga0068862_100054688 3300005844 Bacteria 3417
159 Ga0068862_100198629 3300005844 Bacteria 1807
160 Ga0081455_10002021 3300005937 Bacteria 24257
161 Ga0081455_10005151 3300005937 Bacteria 14395
162 Ga0081455_10026629 3300005937 Bacteria 5312
163 Ga0081455_10123567 3300005937 Bacteria 2036
164 Ga0081455_10198877 3300005937 Bacteria 1502
165 Ga0081538_10059078 3300005981 Bacteria 2218
166 Ga0081540_1002468 3300005983 Bacteria 15067
167 Ga0081540_1005678 3300005983 Bacteria 9273
168 Ga0081540_1021213 3300005983 Bacteria 3879
169 Ga0081540_1038858 3300005983 Bacteria 2502
170 Ga0081540_1048004 3300005983 Bacteria 2142
171 Ga0081540_1063911 3300005983 Bacteria 1739
172 Ga0081540_1115275 3300005983 Bacteria 1126
173 Ga0081539_10000486 3300005985 Bacteria 84009
174 Ga0081539_10050525 3300005985 Bacteria 2352
175 Ga0081539_10214037 3300005985 Bacteria 881
176 Ga0070717_10000990 3300006028 Bacteria 19039
177 Ga0070717_10051191 3300006028 Bacteria 3398
178 Ga0070717_10131446 3300006028 Bacteria 2153
179 Ga0070717_10147553 3300006028 Bacteria 2033
180 Ga0070717_10269953 3300006028 Bacteria 1507
181 Ga0070717_10292913 3300006028 Bacteria 1445
182 Ga0075365_10004620 3300006038 Bacteria 7326
183 Ga0075365_10006567 3300006038 Bacteria 6414
184 Ga0075365_10070651 3300006038 Bacteria 2349
185 Ga0075365_10086976 3300006038 Bacteria 2124
186 Ga0075368_10010675 3300006042 Bacteria 3325
187 Ga0075368_10021010 3300006042 Bacteria 2476
188 Ga0075363_100011493 3300006048 Bacteria 4241
189 Ga0075363_100028373 3300006048 Bacteria 2878
190 Ga0075364_10007860 3300006051 Bacteria 6348
191 Ga0075364_10009406 3300006051 Bacteria 5863
192 Ga0075364_10076927 3300006051 Bacteria 2203
193 Ga0070715_10004151 3300006163 Bacteria 4713
194 Ga0070716_100009679 3300006173 Bacteria 4809
195 Ga0070716_100230086 3300006173 Bacteria 1251
196 Ga0070716_100244920 3300006173 Bacteria 1218
197 Ga0070712_100117627 3300006175 Unclassified 1995
198 Ga0070712_100146036 3300006175 Bacteria 1810
199 Ga0070712_100220599 3300006175 Bacteria 1501
200 Ga0070712_100436219 3300006175 Bacteria 1088
201 Ga0075362_10007954 3300006177 Bacteria 4037
202 Ga0075362_10051963 3300006177 Bacteria 1835
203 Ga0075367_10018244 3300006178 Bacteria 3868
204 Ga0075367_10026441 3300006178 Bacteria 3292
205 Ga0075369_10040871 3300006186 Bacteria 1983
206 Ga0075427_10000325 3300006194 Bacteria 5220
207 Ga0075366_10185936 3300006195 Bacteria 1262
208 Ga0097621_100232981 3300006237 Bacteria 1608
209 Ga0068871_100037598 3300006358 Bacteria 3861
210 Ga0068871_101094563 3300006358 Bacteria 745
211 Ga0075428_100010666 3300006844 Bacteria 10214
212 Ga0075428_100221751 3300006844 Bacteria 2042
213 Ga0075428_100357100 3300006844 Bacteria 1568
214 Ga0075430_100007887 3300006846 Bacteria 9002
215 Ga0075430_100066957 3300006846 Bacteria 3016
216 Ga0075430_100280650 3300006846 Bacteria 1378
217 Ga0075431_100031468 3300006847 Bacteria 5465
218 Ga0075433_10004925 3300006852 Bacteria 10453
219 Ga0075433_10168068 3300006852 Bacteria 1952
220 Ga0075434_100000317 3300006871 Bacteria 34482
221 Ga0075434_100143535 3300006871 Bacteria 2408
222 Ga0075434_100330941 3300006871 Bacteria 1544
223 Ga0075434_100855394 3300006871 Bacteria 925
224 Ga0075429_100006024 3300006880 Bacteria 10483
225 Ga0068865_100253947 3300006881 Bacteria 1389
226 Ga0068865_100266361 3300006881 Bacteria 1359
227 Ga0097620_100144495 3300006931 Bacteria 2453
228 Ga0097620_100380781 3300006931 Bacteria 1506
229 Ga0097620_100764399 3300006931 Bacteria 1055
230 Ga0099825_1025113 3300006941 Bacteria 3369
231 Ga0099824_1010060 3300006942 Bacteria 11362
232 Ga0099824_1022821 3300006942 Bacteria 4028
233 Ga0099822_1001406 3300006943 Bacteria 27885
234 Ga0099822_1050681 3300006943 Bacteria 1731
235 Ga0099823_1014974 3300006944 Bacteria 7726
236 Ga0075435_100005165 3300007076 Bacteria 9079
237 Ga0075435_100057684 3300007076 Unclassified 3142
238 Ga0075435_100214632 3300007076 Bacteria 1633
239 Ga0075435_100231297 3300007076 Bacteria 1571
240 Ga0099794_10122002 3300007265 Bacteria 1312
241 Ga0099795_10024254 3300007788 Bacteria 2021
242 Ga0099795_10120540 3300007788 Bacteria 1048
243 Ga0105250_10019495 3300009092 Bacteria 2742
244 Ga0105240_10017091 3300009093 Bacteria 9795
245 Ga0105240_10029263 3300009093 Bacteria 7181
246 Ga0105240_10048975 3300009093 Bacteria 5337
247 Ga0105240_10102247 3300009093 Bacteria 3483
248 Ga0105240_10199456 3300009093 Bacteria 2346
249 Ga0105245_10007957 3300009098 Bacteria 9269
250 Ga0105245_10236299 3300009098 Bacteria 1770
251 Ga0105247_10054061 3300009101 Bacteria 2478
252 Ga0105247_10055478 3300009101 Bacteria 2445
253 Ga0105247_10062179 3300009101 Bacteria 2316
254 Ga0105247_10071416 3300009101 Bacteria 2171
255 Ga0105247_10292702 3300009101 Bacteria 1127
256 Ga0114129_10047472 3300009147 Bacteria 6032
257 Ga0105243_10081554 3300009148 Bacteria 2642
258 Ga0105243_10528849 3300009148 Bacteria 1123
259 Ga0105241_10076137 3300009174 Bacteria 2616
260 Ga0105241_10165398 3300009174 Bacteria 1822
261 Ga0105241_10308604 3300009174 Bacteria 1360
262 Ga0105241_10339451 3300009174 Bacteria 1301
263 Ga0105242_10121232 3300009176 Bacteria 2244
264 Ga0105242_10381639 3300009176 Bacteria 1310
265 Ga0105248_10227877 3300009177 Bacteria 2098
266 Ga0105248_10452006 3300009177 Bacteria 1448
267 Ga0105248_10742915 3300009177 Bacteria 1107
268 Ga0105237_10027872 3300009545 Bacteria 5756
269 Ga0105237_10040140 3300009545 Bacteria 4721
270 Ga0105237_10070663 3300009545 Bacteria 3487
271 Ga0105237_10111579 3300009545 Bacteria 2727
272 Ga0105237_10129113 3300009545 Bacteria 2522
273 Ga0105237_10143818 3300009545 Bacteria 2379
274 Ga0105237_10218484 3300009545 Bacteria 1906
275 Ga0105237_10584563 3300009545 Bacteria 1124
276 Ga0105237_10594467 3300009545 Bacteria 1113
277 Ga0105238_10013865 3300009551 Bacteria 8149
278 Ga0105238_10020769 3300009551 Bacteria 6688
279 Ga0105238_10037253 3300009551 Bacteria 4946
280 Ga0105238_10093120 3300009551 Bacteria 3001
281 Ga0105238_10104769 3300009551 Bacteria 2809
282 Ga0105249_10496004 3300009553 Bacteria 1266
283 Ga0099796_10019339 3300010159 Bacteria 2063
284 Ga0099796_10048339 3300010159 Bacteria 1466
285 Ga0099796_10055490 3300010159 Bacteria 1388
286 Ga0099796_10071488 3300010159 Bacteria 1254
287 Ga0105239_10013166 3300010375 Bacteria 9190
288 Ga0105239_10045820 3300010375 Bacteria 4792
289 Ga0105239_10055145 3300010375 Bacteria 4359
290 Ga0105239_10061464 3300010375 Bacteria 4123
291 Ga0105239_10091513 3300010375 Bacteria 3356
292 Ga0105239_10224554 3300010375 Bacteria 2106
293 Ga0105239_10241357 3300010375 Bacteria 2028
294 Ga0105239_10268022 3300010375 Bacteria 1920
295 Ga0105239_10394133 3300010375 Bacteria 1566
296 Ga0105239_10560005 3300010375 Bacteria 1302
297 Ga0105246_10019195 3300011119 Bacteria 4364
298 Ga0105246_10028021 3300011119 Bacteria 3697
299 Ga0105246_10039294 3300011119 Bacteria 3186
300 Ga0157370_10033613 3300013104 Bacteria 5000
301 Ga0157370_10530495 3300013104 Bacteria 1080
302 Ga0157369_10006140 3300013105 Bacteria 13943
303 Ga0157369_10016279 3300013105 Bacteria 8370
304 Ga0157369_10034922 3300013105 Bacteria 5515
305 Ga0157369_10217285 3300013105 Bacteria 2002
306 Ga0157374_10029773 3300013296 Bacteria 4950
307 Ga0157374_10030196 3300013296 Bacteria 4917
308 Ga0157374_10084717 3300013296 Bacteria 3013
309 Ga0157374_10222984 3300013296 Bacteria 1850
310 Ga0157374_10431935 3300013296 Bacteria 1317
311 Ga0157378_10182598 3300013297 Bacteria 1974
312 Ga0157378_10207394 3300013297 Bacteria 1857
313 Ga0163162_10029376 3300013306 Bacteria 5440
314 Ga0163162_10045464 3300013306 Bacteria 4398
315 Ga0163162_10070383 3300013306 Bacteria 3549
316 Ga0163162_10257331 3300013306 Bacteria 1877
317 Ga0163162_10310046 3300013306 Bacteria 1710
318 Ga0163162_10481129 3300013306 Bacteria 1373
319 Ga0163162_10488038 3300013306 Bacteria 1363
320 Ga0157372_10019384 3300013307 Bacteria 7330
321 Ga0157372_10068085 3300013307 Bacteria 4003
322 Ga0157372_10204351 3300013307 Bacteria 2289
323 Ga0157375_10013280 3300013308 Bacteria 7325
324 Ga0157375_10067562 3300013308 Bacteria 3572
325 Ga0157375_10258482 3300013308 Bacteria 1903
326 Ga0157375_10333598 3300013308 Bacteria 1682
327 Ga0157375_10361873 3300013308 Bacteria 1617
328 Ga0157375_10378261 3300013308 Bacteria 1583
329 Ga0157375_10493113 3300013308 Bacteria 1389
330 Ga0163163_10006759 3300014325 Bacteria 10055
331 Ga0163163_10036974 3300014325 Bacteria 4747
332 Ga0163163_10092655 3300014325 Bacteria 3037
333 Ga0163163_10146857 3300014325 Bacteria 2402
334 Ga0163163_10554706 3300014325 Bacteria 1211
335 Ga0157380_10195498 3300014326 Bacteria 1790
336 Ga0157379_10026109 3300014968 Bacteria 5197
337 Ga0157379_10098103 3300014968 Bacteria 2631
338 Ga0157379_10417141 3300014968 Bacteria 1236
339 Ga0157376_10153738 3300014969 Bacteria 2078
340 Ga0163161_10631680 3300017792 Bacteria 886
341 Ga0197907_11085692 3300020069 Bacteria 1848
342 Ga0206350_10147974 3300020080 Bacteria 1853
343 Ga0213872_10096894 3300021361 Bacteria 1317
344 Ga0213876_10102971 3300021384 Bacteria 1514
345 Ga0213875_10036010 3300021388 Bacteria 2334
346 Ga0213871_10048862 3300021441 Bacteria 1154
347 Ga0224712_10019052 3300022467 Bacteria 2307
348 Ga0224572_1032213 3300024225 Bacteria 999
349 Ga0228598_1009638 3300024227 Bacteria 1933
350 Ga0209677_102334 3300025253 Bacteria 7277
351 Ga0209148_1000445 3300025254 Bacteria 45388
352 Ga0209233_1003431 3300025261 Bacteria 5579
353 Ga0209233_1004607 3300025261 Bacteria 4662
354 Ga0209455_1006613 3300025272 Bacteria 3401
355 Ga0209455_1015439 3300025272 Bacteria 1679
356 Ga0209564_1002690 3300025295 Bacteria 13467
357 Ga0209758_1000416 3300025297 Bacteria 72312
358 Ga0209758_1001659 3300025297 Bacteria 25224
359 Ga0209758_1002229 3300025297 Bacteria 20140
360 Ga0209256_1025154 3300025299 Bacteria 1740
361 Ga0207426_1000522 3300025302 Bacteria 55802
362 Ga0207426_1000635 3300025302 Bacteria 44397
363 Ga0209257_1016037 3300025304 Bacteria 3061
364 Ga0207697_10011055 3300025315 Bacteria 3828
365 Ga0207697_10022021 3300025315 Bacteria 2611
366 Ga0207697_10145631 3300025315 Bacteria 1029
367 Ga0207697_10258194 3300025315 Bacteria 771
368 Ga0207656_10018876 3300025321 Bacteria 2721
369 Ga0207656_10144100 3300025321 Bacteria 1124
370 Ga0207656_10167179 3300025321 Bacteria 1050
371 Ga0207653_10048082 3300025885 Bacteria 1414
372 Ga0207692_10042604 3300025898 Bacteria 2254
373 Ga0207692_10121292 3300025898 Bacteria 1464
374 Ga0207642_10108021 3300025899 Bacteria 1411
375 Ga0207710_10158479 3300025900 Bacteria 1101
376 Ga0207710_10191171 3300025900 Bacteria 1008
377 Ga0207688_10038785 3300025901 Bacteria 2645
378 Ga0207688_10089512 3300025901 Bacteria 1766
379 Ga0207688_10097786 3300025901 Bacteria 1692
380 Ga0207688_10108116 3300025901 Bacteria 1612
381 Ga0207680_10063467 3300025903 Bacteria 2261
382 Ga0207680_10322521 3300025903 Bacteria 1080
383 Ga0207647_10007936 3300025904 Bacteria 7631
384 Ga0207647_10062745 3300025904 Bacteria 2263
385 Ga0207685_10005077 3300025905 Bacteria 3430
386 Ga0207685_10169337 3300025905 Bacteria 1004
387 Ga0207699_10013659 3300025906 Bacteria 4163
388 Ga0207699_10030108 3300025906 Bacteria 3034
389 Ga0207699_10036479 3300025906 Bacteria 2803
390 Ga0207699_10061933 3300025906 Bacteria 2253
391 Ga0207699_10172976 3300025906 Bacteria 1446
392 Ga0207699_10239781 3300025906 Bacteria 1245
393 Ga0207699_10275754 3300025906 Bacteria 1167
394 Ga0207645_10048662 3300025907 Bacteria 2708
395 Ga0207643_10013766 3300025908 Bacteria 4388
396 Ga0207684_10131984 3300025910 Bacteria 2143
397 Ga0207654_10067524 3300025911 Bacteria 2113
398 Ga0207654_10395843 3300025911 Bacteria 959
399 Ga0207654_10675868 3300025911 Bacteria 741
400 Ga0207707_10001623 3300025912 Bacteria 20718
401 Ga0207707_10013110 3300025912 Bacteria 7222
402 Ga0207707_10234210 3300025912 Bacteria 1597
403 Ga0207707_10395906 3300025912 Bacteria 1186
404 Ga0207695_10000556 3300025913 Bacteria 76837
405 Ga0207695_10168585 3300025913 Bacteria 2116
406 Ga0207695_10183258 3300025913 Bacteria 2014
407 Ga0207671_10006897 3300025914 Bacteria 10016
408 Ga0207671_10052332 3300025914 Bacteria 3026
409 Ga0207671_10085930 3300025914 Bacteria 2364
410 Ga0207671_10089640 3300025914 Bacteria 2315
411 Ga0207671_10097689 3300025914 Bacteria 2221
412 Ga0207671_10129438 3300025914 Bacteria 1936
413 Ga0207671_10242304 3300025914 Bacteria 1416
414 Ga0207693_10004012 3300025915 Bacteria 12514
415 Ga0207693_10017812 3300025915 Bacteria 5663
416 Ga0207693_10047086 3300025915 Bacteria 3389
417 Ga0207693_10127744 3300025915 Bacteria 1998
418 Ga0207693_10219735 3300025915 Unclassified 1493
419 Ga0207663_10001611 3300025916 Bacteria 10618
420 Ga0207663_10008168 3300025916 Bacteria 5457
421 Ga0207663_10060409 3300025916 Bacteria 2402
422 Ga0207663_10100050 3300025916 Bacteria 1945
423 Ga0207663_10177756 3300025916 Bacteria 1517
424 Ga0207663_10577732 3300025916 Bacteria 881
425 Ga0207660_10008313 3300025917 Bacteria 6708
426 Ga0207660_10023476 3300025917 Bacteria 4166
427 Ga0207660_10116612 3300025917 Bacteria 2017
428 Ga0207660_10136318 3300025917 Bacteria 1873
429 Ga0207662_10100917 3300025918 Bacteria 1788
430 Ga0207657_10138500 3300025919 Bacteria 1990
431 Ga0207657_10230224 3300025919 Bacteria 1482
432 Ga0207657_10394683 3300025919 Bacteria 1088
433 Ga0207649_10045148 3300025920 Bacteria 2700
434 Ga0207649_10280923 3300025920 Bacteria 1210
435 Ga0207652_10011502 3300025921 Bacteria 7136
436 Ga0207652_10097988 3300025921 Bacteria 2585
437 Ga0207652_10341074 3300025921 Bacteria 1353
438 Ga0207646_10091867 3300025922 Bacteria 2717
439 Ga0207646_10309416 3300025922 Bacteria 1427
440 Ga0207681_10071847 3300025923 Bacteria 2415
441 Ga0207681_10224236 3300025923 Bacteria 1456
442 Ga0207681_10250995 3300025923 Bacteria 1381
443 Ga0207694_10013820 3300025924 Bacteria 6086
444 Ga0207694_10015762 3300025924 Bacteria 5702
445 Ga0207694_10078197 3300025924 Bacteria 2593
446 Ga0207694_10277613 3300025924 Bacteria 1375
447 Ga0207650_10318937 3300025925 Bacteria 1272
448 Ga0207650_10445953 3300025925 Bacteria 1076
449 Ga0207659_10039497 3300025926 Bacteria 3292
450 Ga0207659_10253817 3300025926 Unclassified 1428
451 Ga0207659_10588391 3300025926 Bacteria 948
452 Ga0207687_10035089 3300025927 Bacteria 3410
453 Ga0207700_10027300 3300025928 Bacteria 3996
454 Ga0207700_10027577 3300025928 Bacteria 3980
455 Ga0207700_10123698 3300025928 Bacteria 2100
456 Ga0207700_10127200 3300025928 Bacteria 2075
457 Ga0207700_10163962 3300025928 Bacteria 1848
458 Ga0207700_10262290 3300025928 Bacteria 1480
459 Ga0207700_10415297 3300025928 Bacteria 1181
460 Ga0207700_10788026 3300025928 Bacteria 850
461 Ga0207664_10028753 3300025929 Bacteria 4227
462 Ga0207664_10064321 3300025929 Bacteria 2933
463 Ga0207664_10065652 3300025929 Bacteria 2906
464 Ga0207664_10123572 3300025929 Bacteria 2170
465 Ga0207664_11013763 3300025929 Bacteria 744
466 Ga0207644_10008270 3300025931 Bacteria 6816
467 Ga0207644_10035155 3300025931 Bacteria 3509
468 Ga0207644_10059574 3300025931 Bacteria 2761
469 Ga0207644_10251120 3300025931 Bacteria 1411
470 Ga0207644_10390309 3300025931 Bacteria 1136
471 Ga0207690_10077162 3300025932 Bacteria 2315
472 Ga0207690_10144926 3300025932 Bacteria 1755
473 Ga0207690_10310400 3300025932 Bacteria 1237
474 Ga0207706_10046302 3300025933 Bacteria 3851
475 Ga0207706_10046675 3300025933 Bacteria 3835
476 Ga0207706_10108737 3300025933 Bacteria 2440
477 Ga0207686_10099011 3300025934 Bacteria 1943
478 Ga0207686_10782012 3300025934 Bacteria 764
479 Ga0207709_10006210 3300025935 Bacteria 6722
480 Ga0207709_10149217 3300025935 Bacteria 1617
481 Ga0207709_10627923 3300025935 Bacteria 853
482 Ga0207669_10524787 3300025937 Bacteria 951
483 Ga0207669_10612833 3300025937 Bacteria 886
484 Ga0207665_10000118 3300025939 Bacteria 52078
485 Ga0207665_10115210 3300025939 Bacteria 1893
486 Ga0207665_10246970 3300025939 Bacteria 1317
487 Ga0207711_10267230 3300025941 Bacteria 1573
488 Ga0207711_10332009 3300025941 Bacteria 1406
489 Ga0207689_10148571 3300025942 Bacteria 1931
490 Ga0207689_10342501 3300025942 Bacteria 1242
491 Ga0207689_10354879 3300025942 Bacteria 1219
492 Ga0207689_10777627 3300025942 Bacteria 808
493 Ga0207661_10080282 3300025944 Bacteria 2691
494 Ga0207661_10133615 3300025944 Bacteria 2128
495 Ga0207661_10492371 3300025944 Bacteria 1120
496 Ga0207679_10208979 3300025945 Bacteria 1635
497 Ga0207679_10251597 3300025945 Bacteria 1502
498 Ga0207679_10933851 3300025945 Bacteria 794
499 Ga0207667_10018061 3300025949 Bacteria 7921
500 Ga0207667_10070915 3300025949 Bacteria 3625
501 Ga0207667_10163362 3300025949 Bacteria 2290
502 Ga0207651_10070768 3300025960 Bacteria 2469
503 Ga0207651_10316482 3300025960 Bacteria 1303
504 Ga0207712_10072290 3300025961 Bacteria 2483
505 Ga0207712_10117940 3300025961 Bacteria 2003
506 Ga0207668_10094229 3300025972 Bacteria 2207
507 Ga0207668_10102485 3300025972 Bacteria 2129
508 Ga0207668_10160645 3300025972 Bacteria 1750
509 Ga0207668_10858211 3300025972 Unclassified 806
510 Ga0207640_10180999 3300025981 Bacteria 1580
511 Ga0207640_10187154 3300025981 Bacteria 1558
512 Ga0207640_10231433 3300025981 Bacteria 1422
513 Ga0207640_10412429 3300025981 Bacteria 1103
514 Ga0207658_10299258 3300025986 Bacteria 1385
515 Ga0207658_10405198 3300025986 Bacteria 1199
516 Ga0207658_11006160 3300025986 Bacteria 760
517 Ga0207677_10098985 3300026023 Bacteria 2140
518 Ga0207677_10100641 3300026023 Bacteria 2126
519 Ga0207677_10250178 3300026023 Bacteria 1439
520 Ga0207703_10090586 3300026035 Bacteria 2570
521 Ga0207703_10240779 3300026035 Bacteria 1626
522 Ga0207703_10258803 3300026035 Bacteria 1572
523 Ga0207703_10327001 3300026035 Bacteria 1405
524 Ga0207703_10668106 3300026035 Bacteria 987
525 Ga0207639_10100675 3300026041 Bacteria 2335
526 Ga0207639_10145973 3300026041 Bacteria 1976
527 Ga0207639_10156045 3300026041 Bacteria 1918
528 Ga0207639_10200532 3300026041 Bacteria 1711
529 Ga0207639_10553307 3300026041 Bacteria 1057
530 Ga0207678_10025337 3300026067 Bacteria 5178
531 Ga0207678_10086267 3300026067 Bacteria 2683
532 Ga0207678_10105567 3300026067 Bacteria 2404
533 Ga0207678_10146128 3300026067 Bacteria 2018
534 Ga0207678_10791325 3300026067 Bacteria 837
535 Ga0207702_10000433 3300026078 Bacteria 47747
536 Ga0207702_10254452 3300026078 Bacteria 1651
537 Ga0207702_10306964 3300026078 Bacteria 1507
538 Ga0207702_10339239 3300026078 Bacteria 1435
539 Ga0207702_10413527 3300026078 Bacteria 1303
540 Ga0207702_10651599 3300026078 Bacteria 1036
541 Ga0207641_10124839 3300026088 Bacteria 2303
542 Ga0207641_10193761 3300026088 Bacteria 1869
543 Ga0207641_10459978 3300026088 Bacteria 1231
544 Ga0207648_10062751 3300026089 Bacteria 3239
545 Ga0207648_10093247 3300026089 Bacteria 2633
546 Ga0207648_10145761 3300026089 Bacteria 2088
547 Ga0207676_10046093 3300026095 Bacteria 3372
548 Ga0207676_10667451 3300026095 Bacteria 1004
549 Ga0207674_10018412 3300026116 Bacteria 7592
550 Ga0207674_10039233 3300026116 Bacteria 4910
551 Ga0207674_10080810 3300026116 Bacteria 3253
552 Ga0207675_100067493 3300026118 Bacteria 3343
553 Ga0207675_100751571 3300026118 Bacteria 986
554 Ga0207683_10016118 3300026121 Bacteria 6361
555 Ga0207683_10414642 3300026121 Bacteria 1240
556 Ga0207683_10546959 3300026121 Bacteria 1070
557 Ga0207698_10020154 3300026142 Bacteria 4584
558 Ga0207698_10198208 3300026142 Bacteria 1795
559 Ga0207698_10632148 3300026142 Bacteria 1058
560 Ga0207698_10649773 3300026142 Bacteria 1045
561 Ga0209389_1000045 3300027296 Bacteria 118598
562 Ga0209389_1007855 3300027296 Bacteria 9438
563 Ga0209589_1000007 3300027357 Bacteria 425699
564 Ga0209589_1015051 3300027357 Bacteria 9438
565 Ga0209489_100008 3300027361 Bacteria 425699
566 Ga0209489_100110 3300027361 Bacteria 117680
567 Ga0209489_100210 3300027361 Bacteria 96217
568 Ga0209700_100009 3300027363 Bacteria 425699
569 Ga0209700_100116 3300027363 Bacteria 115661
570 Ga0209588_1028759 3300027671 Bacteria 1770
571 Ga0209588_1103687 3300027671 Bacteria 915
572 Ga0209588_1116886 3300027671 Bacteria 855
573 Ga0209813_10131905 3300027866 Bacteria 880
574 Ga0207428_10000295 3300027907 Bacteria 66554
575 Ga0268266_10003838 3300028379 Bacteria 14677
576 Ga0268266_10112403 3300028379 Bacteria 2414
577 Ga0268266_10153142 3300028379 Bacteria 2080
578 Ga0268266_10186589 3300028379 Bacteria 1891
579 Ga0268266_10455183 3300028379 Bacteria 1217
580 Ga0268265_10049446 3300028380 Bacteria 3162
581 Ga0268265_10111402 3300028380 Bacteria 2235
582 Ga0268264_11146859 3300028381 Bacteria 786
583 Ga0307515_10184213 3300028794 Bacteria 2025
584 Ga0307511_10117520 3300030521 Bacteria 1661
585 Ga0265330_10033581 3300031235 Bacteria 2294
586 Ga0265332_10035187 3300031238 Bacteria 2175
587 Ga0265328_10044790 3300031239 Bacteria 1627
588 Ga0265325_10019092 3300031241 Bacteria 3794
589 Ga0265339_10051134 3300031249 Bacteria 2257
590 Ga0265316_10124590 3300031344 Bacteria 1944
591 Ga0307509_10066285 3300031507 Bacteria 3789
592 Ga0307509_10615399 3300031507 Bacteria 757
593 Ga0307508_10000003 3300031616 Bacteria 321602
594 Ga0307508_10097397 3300031616 Bacteria 2533
595 Ga0265314_10049278 3300031711 Bacteria 2950
596 Ga0307516_10118428 3300031730 Bacteria 2442
597 Ga0307516_10199295 3300031730 Bacteria 1722
598 Ga0307416_100060615 3300032002 Bacteria 3083
599 Ga0307507_10029922 3300033179 Bacteria 5758
600 Ga0307507_10166501 3300033179 Bacteria 1614
601 Ga0307507_10347247 3300033179 Bacteria 875
602 Ga0307510_10009102 3300033180 Bacteria 11824
603 Ga0307510_10202000 3300033180 Bacteria 1521
604 Ga0373950_0034781 3300034818 Bacteria 946
605 Ga0373926_0078204 3300035083 Bacteria 1221
606 Ga0373926_0079398 3300035083 Bacteria 1212
607 Ga0373934_0013009 3300035086 Bacteria 3143
608 Ga0373944_0006425 3300035089 Bacteria 3122
609 Ga0373923_0011095 3300035111 Bacteria 3297
610 Ga0373923_0044805 3300035111 Bacteria 1836
611 Ga0373936_0059173 3300035113 Bacteria 1561
612 Ga0373936_0062841 3300035113 Bacteria 1519
613 Ga0373945_0010383 3300035116 Bacteria 3065
614 Ga0373945_0028844 3300035116 Bacteria 1947
615 Ga0373945_0119881 3300035116 Bacteria 1045
616 Ga0373953_0010610 3300035117 Bacteria 3213
617 Ga0373953_0123108 3300035117 Bacteria 1102
618 Ga0373954_0019925 3300035118 Bacteria 3028
619 Ga0373956_0001075 3300035119 Bacteria 11230
620 Ga0373956_0179268 3300035119 Bacteria 1001
621 Ga0373956_0209632 3300035119 Bacteria 924
622 Ga0373957_0016737 3300035120 Bacteria 2544
623 Ga0373957_0068045 3300035120 Bacteria 1389
624 Ga0373943_0011760 3300035170 Bacteria 3939
625 Ga0373943_0021033 3300035170 Bacteria 3013
626 Ga0373943_0027693 3300035170 Bacteria 2665
627 Ga0373943_0074801 3300035170 Bacteria 1723
628 Ga0373943_0124772 3300035170 Bacteria 1372
629 Ga0373946_0003017 3300035171 Bacteria 5968
630 Ga0373946_0089578 3300035171 Bacteria 1361
631 Ga0373955_0019530 3300035172 Bacteria 3389
632 Ga0373955_0021727 3300035172 Unclassified 3244
633 Ga0373955_0042339 3300035172 Bacteria 2445
634 Ga0373955_0059346 3300035172 Bacteria 2107
635 Ga0373924_0007622 3300035410 Bacteria 3911
636 Ga0373924_0068729 3300035410 Bacteria 1492
637 Ga0373924_0130804 3300035410 Bacteria 1092
638 Ga0373931_0529061 3300035691 Unclassified 764
639 Ga0373935_0002155 3300035692 Bacteria 11170
640 Ga0373935_0051480 3300035692 Bacteria 2615
641 Ga0373935_0074297 3300035692 Bacteria 2197
642 Ga0373927_0001542 3300035695 Bacteria 17306
643 Ga0373927_0010229 3300035695 Bacteria 6266
644 Ga0373927_0015090 3300035695 Bacteria 5108
645 Ga0373927_0023988 3300035695 Bacteria 3991
646 Ga0373927_0041572 3300035695 Bacteria 2981
647 Ga0373927_0057537 3300035695 Unclassified 2514
648 Ga0373927_0250759 3300035695 Bacteria 1164
649 Ga0373933_0000241 3300035724 Bacteria 35958
650 Ga0373933_0010931 3300035724 Bacteria 4984
651 Ga0373933_0256190 3300035724 Bacteria 1127
652 Ga0373933_0402874 3300035724 Bacteria 892
653 Ga0373947_0006228 3300035725 Bacteria 6936
654 Ga0373947_0011801 3300035725 Bacteria 5006
655 Ga0373947_0134660 3300035725 Unclassified 1580
656 Ga0373947_0178964 3300035725 Bacteria 1379
657 Ga0373937_0048039 3300036401 Bacteria 3905
658 Ga0373937_0054473 3300036401 Bacteria 3670
659 Ga0373937_0090572 3300036401 Bacteria 2832
660 Ga0373937_0126219 3300036401 Bacteria 2387
661 Ga0373937_0595328 3300036401 Bacteria 1050
662 Ga0372808_015971 3300036459 Bacteria 1075
663 Ga0373925_0003576 3300037068 Bacteria 11979
664 Ga0373925_0036563 3300037068 Bacteria 3624
665 Ga0373925_0039425 3300037068 Bacteria 3495
666 Ga0373925_0062921 3300037068 Bacteria 2791
667 Ga0373925_0085992 3300037068 Unclassified 2398
668 Ga0373925_0160610 3300037068 Bacteria 1770
669 Ga0373925_0227968 3300037068 Bacteria 1489
670 Ga0373925_0320136 3300037068 Bacteria 1255
671 Ga0373925_0330956 3300037068 Bacteria 1234
672 Ga0395899_0026158 3300037312 Bacteria 4404
673 Ga0395900_0001570 3300037418 Bacteria 27058
674 Ga0395900_0019206 3300037418 Bacteria 6968
675 Ga0395900_0036457 3300037418 Bacteria 5070
676 Ga0395900_0051963 3300037418 Unclassified 4220
677 Ga0395900_0077860 3300037418 Bacteria 3407
678 Ga0395900_0102714 3300037418 Bacteria 2937
679 Ga0395898_0006693 3300037466 Bacteria 12284
680 Ga0395898_0009563 3300037466 Bacteria 10184
681 Ga0395898_0031476 3300037466 Bacteria 5300
682 Ga0395898_0061763 3300037466 Unclassified 3640
683 Ga0395898_0071539 3300037466 Unclassified 3351
684 Ga0395905_0000548 3300037471 Bacteria 51350
685 Ga0436364_0407668 3300037853 Bacteria 1082
686 Ga0436364_0790824 3300037853 Bacteria 5943
687 Ga0436364_0836945 3300037853 Bacteria 2138
688 Ga0436364_0974948 3300037853 Bacteria 1221
689 Ga0395901_0029002 3300038443 Bacteria 5693
690 Ga0395901_0033560 3300038443 Bacteria 5299
691 Ga0395901_0053412 3300038443 Bacteria 4198
692 Ga0395901_0107854 3300038443 Bacteria 2923
693 Ga0395901_0132133 3300038443 Unclassified 2623
694 Ga0395901_0269779 3300038443 Bacteria 1770
695 Ga0395901_0634116 3300038443 Bacteria 1074
696 Ga0436365_0182658 3300039437 Bacteria 1796
697 Ga0436365_0196266 3300039437 Bacteria 4337
698 Ga0436360_0825284 3300039438 Bacteria 1473
699 Ga0436360_1192895 3300039438 Bacteria 2868
700 Ga0436361_0284130 3300039447 Bacteria 2649
701 Ga0436361_1062074 3300039447 Bacteria 3715
702 Ga0436362_0999686 3300039453 Bacteria 814
703 Ga0451789_1145104 3300041443 Bacteria 2157
704 Ga0451795_1424660 3300041456 Bacteria 1719
705 Ga0466972_0000988 3300044658 Bacteria 13676
706 Ga0466972_0012012 3300044658 Bacteria 4351
707 Ga0466972_0101932 3300044658 Bacteria 1358
708 Ga0466965_0012855 3300044683 Bacteria 3941
709 Ga0466966_0000149 3300044684 Bacteria 44757
710 Ga0466966_0472036 3300044684 Bacteria 754
711 Ga0466961_0000066 3300044693 Bacteria 63201
712 Ga0466963_0104016 3300044694 Bacteria 1945
713 Ga0466960_0027844 3300044901 Bacteria 2582
714 Ga0466959_0178359 3300045049 Bacteria 1487
715 Ga0466967_0022427 3300045976 Bacteria 5151
716 Ga0466967_0178758 3300045976 Bacteria 2000
717 Ga0466967_0259726 3300045976 Bacteria 1662
718 Ga0495592_0011023 3300046454 Bacteria 6820
719 Ga0495592_0011821 3300046454 Bacteria 6613
720 Ga0495592_0026415 3300046454 Bacteria 4402
721 Ga0495592_0139601 3300046454 Bacteria 1687
722 Ga0495592_0139922 3300046454 Bacteria 1684
723 Ga0495592_0185533 3300046454 Bacteria 1413
724 Ga0495592_0419534 3300046454 Bacteria 844
725 Ga0495603_0003118 3300046455 Bacteria 9851
726 Ga0495603_0021697 3300046455 Bacteria 3889
727 Ga0495603_0066329 3300046455 Bacteria 2126
728 Ga0495603_0101618 3300046455 Bacteria 1678
729 Ga0495603_0116366 3300046455 Bacteria 1559
730 Ga0495590_0022134 3300046457 Bacteria 2249
731 Ga0495629_0003275 3300046459 Bacteria 12253
732 Ga0495629_0015956 3300046459 Bacteria 5397
733 Ga0495638_0024997 3300046460 Bacteria 3887
734 Ga0495638_0043746 3300046460 Bacteria 2823
735 Ga0495641_0030001 3300046461 Bacteria 2614
736 Ga0495641_0115030 3300046461 Bacteria 1200
737 Ga0495651_0009884 3300046462 Bacteria 7337
738 Ga0495651_0069342 3300046462 Bacteria 2686
739 Ga0495651_0120258 3300046462 Bacteria 1930
740 Ga0495651_0141575 3300046462 Bacteria 1743
741 Ga0495651_0146547 3300046462 Bacteria 1706
742 Ga0495653_0081247 3300046463 Bacteria 2395
743 Ga0495653_0107023 3300046463 Bacteria 2016
744 Ga0495653_0128000 3300046463 Bacteria 1801
745 Ga0495650_0056371 3300046471 Bacteria 1595
746 Ga0495582_0119603 3300046473 Bacteria 1484
747 Ga0495582_0123691 3300046473 Bacteria 1459
748 Ga0495582_0243960 3300046473 Bacteria 1030
749 Ga0495605_0044033 3300046474 Bacteria 2209
750 Ga0495605_0153098 3300046474 Bacteria 1028
751 Ga0495639_0009158 3300046475 Bacteria 4244
752 Ga0495639_0090184 3300046475 Bacteria 1437
753 Ga0495662_0037136 3300046476 Bacteria 2353
754 Ga0495662_0073671 3300046476 Bacteria 1656
755 Ga0495664_0007535 3300046477 Bacteria 6050
756 Ga0495664_0081407 3300046477 Bacteria 1941
757 Ga0495664_0133228 3300046477 Bacteria 1505
758 Ga0495664_0191422 3300046477 Bacteria 1240
759 Ga0495584_0162170 3300046491 Bacteria 1136
760 Ga0495594_0004206 3300046499 Bacteria 7391
761 Ga0495594_0119977 3300046499 Bacteria 1486
762 Ga0495594_0152941 3300046499 Bacteria 1310
763 Ga0495596_0044448 3300046500 Bacteria 1748
764 Ga0495607_0149788 3300046501 Bacteria 1195
765 Ga0495583_0054921 3300046506 Bacteria 1802
766 Ga0495583_0117909 3300046506 Bacteria 1120
767 Ga0495606_0007533 3300046507 Bacteria 9710
768 Ga0495606_0093566 3300046507 Bacteria 1843
769 Ga0495606_0188367 3300046507 Bacteria 1184
770 Ga0495608_0000834 3300046511 Bacteria 21529
771 Ga0495608_0046938 3300046511 Bacteria 2872
772 Ga0495608_0200560 3300046511 Bacteria 1257
773 Ga0495608_0393314 3300046511 Bacteria 849
774 Ga0495610_0006739 3300046512 Bacteria 7804
775 Ga0495616_0059110 3300046513 Bacteria 1886
776 Ga0495616_0120140 3300046513 Bacteria 1214
777 Ga0495618_0002623 3300046514 Bacteria 11509
778 Ga0495618_0012212 3300046514 Bacteria 5213
779 Ga0495618_0126488 3300046514 Bacteria 1637
780 Ga0495618_0279622 3300046514 Bacteria 1041
781 Ga0495620_0033910 3300046515 Bacteria 2312
782 Ga0495620_0061313 3300046515 Bacteria 1565
783 Ga0495628_0182029 3300046516 Bacteria 1589
784 Ga0495628_0294553 3300046516 Bacteria 1202
785 Ga0495630_0522472 3300046517 Bacteria 910
786 Ga0495631_0039962 3300046518 Bacteria 2079
787 Ga0495631_0117957 3300046518 Bacteria 1141
788 Ga0495632_0132573 3300046519 Bacteria 1159
789 Ga0495643_0152293 3300046522 Bacteria 1144
790 Ga0495644_0050848 3300046523 Bacteria 1556
791 Ga0495648_0040124 3300046524 Bacteria 2971
792 Ga0495648_0043639 3300046524 Bacteria 2808
793 Ga0495648_0060916 3300046524 Bacteria 2243
794 Ga0495648_0063008 3300046524 Bacteria 2192
795 Ga0495648_0162469 3300046524 Bacteria 1153
796 Ga0495648_0205274 3300046524 Bacteria 983
797 Ga0495666_0105487 3300046526 Bacteria 1326
798 Ga0495666_0135147 3300046526 Bacteria 1151
799 Ga0495652_0014781 3300046529 Bacteria 6997
800 Ga0495652_0024613 3300046529 Bacteria 5326
801 Ga0495652_0029195 3300046529 Bacteria 4845
802 Ga0495652_0042669 3300046529 Bacteria 3910
803 Ga0495652_0346956 3300046529 Bacteria 1065
804 Ga0495654_0145840 3300046530 Bacteria 1051
805 Ga0495665_0019833 3300046531 Bacteria 3616
806 Ga0495640_0014776 3300046533 Bacteria 5897
807 Ga0495640_0028670 3300046533 Bacteria 4005
808 Ga0495640_0039887 3300046533 Bacteria 3292
809 Ga0495640_0049784 3300046533 Bacteria 2887
810 Ga0495640_0111091 3300046533 Bacteria 1791
811 Ga0495640_0202370 3300046533 Bacteria 1258
812 Ga0495587_0001442 3300046536 Bacteria 15851
813 Ga0495587_0008806 3300046536 Bacteria 6476
814 Ga0495587_0044947 3300046536 Bacteria 2626
815 Ga0495587_0171281 3300046536 Bacteria 1233
816 Ga0495598_0024400 3300046537 Bacteria 1639
817 Ga0495609_0117339 3300046538 Bacteria 1146
818 Ga0495609_0142803 3300046538 Bacteria 1021
819 Ga0495621_0015676 3300046539 Bacteria 2420
820 Ga0495621_0020445 3300046539 Bacteria 2173
821 Ga0495645_0013005 3300046543 Bacteria 5876
822 Ga0495645_0019288 3300046543 Bacteria 4910
823 Ga0495645_0054563 3300046543 Bacteria 2903
824 Ga0495622_0011919 3300046557 Bacteria 4021
825 Ga0495622_0037987 3300046557 Bacteria 2242
826 Ga0495622_0110421 3300046557 Bacteria 1259
827 Ga0495633_0042222 3300046558 Bacteria 2167
828 Ga0495633_0137429 3300046558 Bacteria 1130
829 Ga0495667_0052777 3300046559 Bacteria 2677
830 Ga0495667_0055568 3300046559 Bacteria 2604
831 Ga0495667_0057663 3300046559 Bacteria 2552
832 Ga0495667_0089410 3300046559 Bacteria 1996
833 Ga0495667_0089835 3300046559 Bacteria 1991
834 Ga0495656_0008710 3300046615 Bacteria 3631
835 Ga0495634_0012455 3300046642 Bacteria 6154
836 Ga0495634_0031432 3300046642 Bacteria 3657
837 Ga0495634_0032939 3300046642 Bacteria 3562
838 Ga0495611_0064846 3300046648 Bacteria 1664
839 Ga0495611_0074037 3300046648 Bacteria 1559
840 Ga0495625_0140117 3300046660 Bacteria 1632
841 Ga0495625_0365570 3300046660 Bacteria 908
842 Ga0495625_0387311 3300046660 Bacteria 876
843 Ga0495635_0002510 3300046663 Bacteria 12539
844 Ga0495635_0060745 3300046663 Bacteria 2597
845 Ga0495635_0184521 3300046663 Bacteria 1417
846 Ga0495635_0216131 3300046663 Bacteria 1297
847 Ga0495659_0050529 3300046664 Bacteria 1512
848 Ga0495659_0086916 3300046664 Bacteria 1195
849 Ga0495661_0170104 3300046665 Bacteria 1163
850 Ga0495661_0235018 3300046665 Bacteria 943
851 Ga0495588_0004485 3300046674 Bacteria 6170
852 Ga0495588_0012719 3300046674 Bacteria 3987
853 Ga0495588_0046193 3300046674 Bacteria 2233
854 Ga0495588_0125812 3300046674 Bacteria 1352
855 Ga0495588_0324924 3300046674 Bacteria 809
856 Ga0495657_0005817 3300046675 Bacteria 9710
857 Ga0495657_0007621 3300046675 Bacteria 8338
858 Ga0495657_0033077 3300046675 Bacteria 3604
859 Ga0495657_0095799 3300046675 Bacteria 1897
860 Ga0495657_0167731 3300046675 Bacteria 1354
861 Ga0495599_0000991 3300046678 Bacteria 15920
862 Ga0495599_0104526 3300046678 Bacteria 1764
863 Ga0495599_0148784 3300046678 Bacteria 1451
864 Ga0495599_0220903 3300046678 Bacteria 1159
865 Ga0495599_0291087 3300046678 Bacteria 987
866 Ga0495646_0010983 3300046680 Bacteria 5753
867 Ga0495646_0038251 3300046680 Bacteria 2963
868 Ga0495646_0063449 3300046680 Bacteria 2193
869 Ga0495646_0065199 3300046680 Bacteria 2157
870 Ga0495646_0070361 3300046680 Bacteria 2061
871 Ga0495658_0018240 3300046683 Bacteria 3644
872 Ga0495658_0328464 3300046683 Bacteria 970
873 Ga0495658_0443144 3300046683 Bacteria 829
874 Ga0495669_0006054 3300046684 Bacteria 5048
875 Ga0495669_0101934 3300046684 Bacteria 1334
876 Ga0495613_0012888 3300046689 Bacteria 6214
877 Ga0495613_0021728 3300046689 Bacteria 4781
878 Ga0495613_0029885 3300046689 Bacteria 4049
879 Ga0495613_0093305 3300046689 Bacteria 2179
880 Ga0495624_0036474 3300046690 Bacteria 3169
881 Ga0495624_0157979 3300046690 Unclassified 1385
882 Ga0495624_0306406 3300046690 Bacteria 957
883 Ga0495670_0041892 3300046691 Bacteria 2285
884 Ga0495670_0069166 3300046691 Bacteria 1785
885 Ga0495670_0099272 3300046691 Bacteria 1498
886 Ga0495671_0044831 3300046692 Bacteria 2216
887 Ga0495649_0025832 3300046694 Bacteria 3270
888 Ga0495649_0114674 3300046694 Bacteria 1427
889 Ga0495589_0089041 3300046794 Bacteria 1499
890 Ga0495589_0117156 3300046794 Bacteria 1283
891 Ga0495589_0241245 3300046794 Bacteria 846
892 Ga0495600_0004571 3300046809 Bacteria 8297
893 Ga0495600_0112401 3300046809 Bacteria 1774
894 Ga0495600_0189415 3300046809 Bacteria 1323
895 Ga0495600_0260613 3300046809 Bacteria 1101
896 Ga0495600_0487843 3300046809 Bacteria 758
897 Ga0495660_0134341 3300046810 Bacteria 1238
898 Ga0495581_0003566 3300047315 Bacteria 8939
899 Ga0495581_0085424 3300047315 Bacteria 1829
900 Ga0495581_0086276 3300047315 Bacteria 1820
901 Ga0495581_0166509 3300047315 Bacteria 1289
902 Ga0495581_0243725 3300047315 Bacteria 1051
903 Ga0495581_0271070 3300047315 Bacteria 992
904 Ga0495581_0281241 3300047315 Bacteria 973
905 Ga0495581_0397774 3300047315 Bacteria 804
906 Ga0495604_0005577 3300047317 Bacteria 9977
907 Ga0495604_0019727 3300047317 Bacteria 5393
908 Ga0495604_0033071 3300047317 Bacteria 4095
909 Ga0495604_0042380 3300047317 Bacteria 3567
910 Ga0495604_0052858 3300047317 Bacteria 3143
911 Ga0495636_0026413 3300047318 Bacteria 2362
912 Ga0495674_0014033 3300047319 Bacteria 7510
913 Ga0495674_0052274 3300047319 Bacteria 3596
914 Ga0495674_0080136 3300047319 Bacteria 2802
915 Ga0495674_0363273 3300047319 Bacteria 1173
916 Ga0495674_0484793 3300047319 Bacteria 990
917 Ga0495674_0493459 3300047319 Bacteria 980
918 Ga0495672_0053019 3300047320 Bacteria 2379
919 Ga0495676_0001737 3300047321 Bacteria 19035
920 Ga0495676_0102848 3300047321 Bacteria 2110
921 Ga0495676_0116231 3300047321 Bacteria 1954
922 Ga0495676_0122925 3300047321 Bacteria 1885
923 Ga0495676_0197098 3300047321 Bacteria 1401
924 Ga0495680_0037719 3300047322 Bacteria 3870
925 Ga0495680_0045668 3300047322 Bacteria 3458
926 Ga0495680_0045938 3300047322 Bacteria 3446
927 Ga0495683_0073119 3300047323 Bacteria 1681
928 Ga0495687_006285 3300047443 Bacteria 7323
929 Ga0495675_0038437 3300047444 Bacteria 3047
930 Ga0495675_0103049 3300047444 Bacteria 1785
931 Ga0495675_0121302 3300047444 Bacteria 1628
932 Ga0495675_0139174 3300047444 Bacteria 1505
933 Ga0495685_068598 3300047447 Bacteria 1190
934 Ga0495673_0054823 3300047469 Bacteria 1732
935 Ga0495673_0090093 3300047469 Bacteria 1255
936 Ga0495684_0015155 3300047471 Bacteria 5935
937 Ga0495684_0059053 3300047471 Bacteria 2921
938 Ga0495684_0102686 3300047471 Bacteria 2161
939 Ga0495684_0236170 3300047471 Bacteria 1335
940 Ga0495686_0120427 3300047472 Bacteria 1565
941 Ga0495686_0199964 3300047472 Bacteria 1147
942 Ga0495593_0017756 3300047673 Bacteria 4006
943 Ga0495593_0150653 3300047673 Bacteria 1176
944 Ga0495602_0024576 3300048088 Bacteria 5845
945 Ga0495602_0026581 3300048088 Bacteria 5579
946 Ga0495602_0101196 3300048088 Bacteria 2364
947 Ga0495602_0134471 3300048088 Bacteria 1967
948 Ga0495602_0167640 3300048088 Bacteria 1708
949 Ga0495602_0460604 3300048088 Bacteria 896
950 Ga0495615_0169071 3300048090 Bacteria 661
951 Ga0495626_0151877 3300048091 Bacteria 976
952 Ga0496100_0108826 3300048903 Bacteria 1922
953 Ga0496100_0117362 3300048903 Bacteria 1858
954 Ga0496100_0121789 3300048903 Bacteria 1826
955 Ga0496100_0130864 3300048903 Bacteria 1767
956 Ga0496100_0165765 3300048903 Bacteria 1587
957 Ga0496100_0235512 3300048903 Bacteria 1349
958 Ga0496100_0331630 3300048903 Bacteria 1145
959 Ga0496101_0003782 3300048904 Bacteria 9454
960 Ga0496101_0033757 3300048904 Bacteria 3611
961 Ga0496101_0044088 3300048904 Bacteria 3191
962 Ga0496101_0070190 3300048904 Bacteria 2565
963 Ga0496101_0126355 3300048904 Bacteria 1938
964 Ga0496102_0025556 3300048905 Bacteria 5258
965 Ga0496102_0057710 3300048905 Bacteria 3545
966 Ga0496102_0067796 3300048905 Bacteria 3273
967 Ga0496102_0141715 3300048905 Bacteria 2254
968 Ga0496102_0183077 3300048905 Bacteria 1974
969 Ga0496102_0184885 3300048905 Bacteria 1964
970 Ga0496102_0648413 3300048905 Bacteria 979
971 Ga0496102_0659042 3300048905 Bacteria 970
972 Ga0496102_0701058 3300048905 Bacteria 935
973 Ga0496103_0049485 3300048906 Bacteria 2598
974 Ga0496103_0196409 3300048906 Bacteria 1297
975 Ga0496103_0327499 3300048906 Bacteria 985
976 Ga0496104_0008069 3300048907 Bacteria 9340
977 Ga0496104_0009739 3300048907 Bacteria 8565
978 Ga0496104_0011099 3300048907 Bacteria 8061
979 Ga0496104_0011247 3300048907 Bacteria 8009
980 Ga0496104_0061017 3300048907 Bacteria 3573
981 Ga0496104_0070610 3300048907 Bacteria 3320
982 Ga0496104_0087161 3300048907 Bacteria 2981
983 Ga0496104_0117781 3300048907 Bacteria 2549
984 Ga0496104_0143961 3300048907 Bacteria 2289
985 Ga0496104_0253095 3300048907 Bacteria 1674
986 Ga0496104_0294924 3300048907 Bacteria 1534
987 Ga0496104_0374708 3300048907 Bacteria 1336
988 Ga0496105_0001065 3300048908 Bacteria 18990
989 Ga0496105_0001708 3300048908 Bacteria 15675
990 Ga0496105_0029404 3300048908 Bacteria 4498
991 Ga0496105_0031695 3300048908 Bacteria 4334
992 Ga0496105_0054157 3300048908 Bacteria 3313
993 Ga0496105_0092136 3300048908 Bacteria 2502
994 Ga0496105_0094691 3300048908 Bacteria 2466
995 Ga0496105_0108474 3300048908 Bacteria 2292
996 Ga0496105_0133400 3300048908 Bacteria 2046
997 Ga0496105_0198024 3300048908 Bacteria 1640
998 Ga0496106_0002611 3300048909 Bacteria 13406
999 Ga0496106_0040583 3300048909 Bacteria 3486
1000 Ga0496106_0135424 3300048909 Bacteria 1934
1001 Ga0496106_0138461 3300048909 Bacteria 1913
1002 Ga0496107_0020603 3300048910 Bacteria 4658
1003 Ga0496107_0034039 3300048910 Bacteria 3646
1004 Ga0496107_0038762 3300048910 Bacteria 3417
1005 Ga0496107_0053987 3300048910 Bacteria 2899
1006 Ga0496107_0221377 3300048910 Bacteria 1408
1007 Ga0496107_0283467 3300048910 Bacteria 1233
1008 Ga0496108_0017610 3300048911 Bacteria 5845
1009 Ga0496108_0018579 3300048911 Bacteria 5694
1010 Ga0496108_0055047 3300048911 Bacteria 3339
1011 Ga0496108_0057622 3300048911 Bacteria 3264
1012 Ga0496108_0095651 3300048911 Bacteria 2529
1013 Ga0496108_0143737 3300048911 Bacteria 2056
1014 Ga0496108_0167823 3300048911 Bacteria 1898
1015 Ga0496108_0244187 3300048911 Bacteria 1562
1016 Ga0496109_0001152 3300048912 Bacteria 21967
1017 Ga0496109_0003675 3300048912 Bacteria 12814
1018 Ga0496109_0052743 3300048912 Bacteria 3708
1019 Ga0496109_0103705 3300048912 Bacteria 2640
1020 Ga0496109_0115523 3300048912 Bacteria 2497
1021 Ga0496109_0144495 3300048912 Bacteria 2225
1022 Ga0496109_0145098 3300048912 Bacteria 2220
1023 Ga0496109_0268704 3300048912 Bacteria 1607
1024 Ga0496109_0317386 3300048912 Bacteria 1470
1025 Ga0496110_0023309 3300048913 Bacteria 5263
1026 Ga0496110_0038897 3300048913 Bacteria 4141
1027 Ga0496110_0044214 3300048913 Bacteria 3889
1028 Ga0496110_0046121 3300048913 Bacteria 3812
1029 Ga0496110_0068797 3300048913 Bacteria 3134
1030 Ga0496110_0148874 3300048913 Bacteria 2118
1031 Ga0496110_0270405 3300048913 Bacteria 1547
1032 Ga0496110_0599628 3300048913 Bacteria 999
1033 Ga0496111_0000825 3300048914 Bacteria 16670
1034 Ga0496111_0066704 3300048914 Bacteria 2614
1035 Ga0496111_0191382 3300048914 Bacteria 1521
1036 Ga0496111_0354787 3300048914 Bacteria 1085
1037 Ga0496111_0417201 3300048914 Bacteria 991
1038 Ga0496112_0000051 3300048915 Bacteria 82351
1039 Ga0496112_0003123 3300048915 Bacteria 13585
1040 Ga0496112_0008384 3300048915 Bacteria 9256
1041 Ga0496112_0023197 3300048915 Bacteria 5923
1042 Ga0496112_0026067 3300048915 Bacteria 5620
1043 Ga0496112_0115446 3300048915 Bacteria 2655
1044 Ga0496112_0205523 3300048915 Bacteria 1927
1045 Ga0496112_0253569 3300048915 Bacteria 1710
1046 Ga0496112_0256980 3300048915 Bacteria 1697
1047 Ga0496112_0443208 3300048915 Bacteria 1237
1048 Ga0496113_0001092 3300048916 Bacteria 14692
1049 Ga0496113_0013878 3300048916 Bacteria 5476
1050 Ga0496113_0021246 3300048916 Bacteria 4576
1051 Ga0496113_0033118 3300048916 Bacteria 3760
1052 Ga0496113_0056314 3300048916 Bacteria 2951
1053 Ga0496113_0288571 3300048916 Bacteria 1312
1054 Ga0496113_0550036 3300048916 Bacteria 926
1055 Ga0496114_0144165 3300048917 Bacteria 2064
1056 Ga0496114_0269358 3300048917 Bacteria 1500
1057 Ga0496114_0286413 3300048917 Bacteria 1453
1058 Ga0496114_0350983 3300048917 Bacteria 1305
1059 Ga0496114_0493039 3300048917 Bacteria 1084
1060 Ga0496114_0751220 3300048917 Bacteria 853
1061 Ga0496115_0000756 3300048918 Bacteria 23793
1062 Ga0496115_0012216 3300048918 Bacteria 6456
1063 Ga0496115_0042668 3300048918 Bacteria 3614
1064 Ga0496115_0045211 3300048918 Bacteria 3514
1065 Ga0496115_0051742 3300048918 Bacteria 3293
1066 Ga0496115_0067152 3300048918 Bacteria 2900
1067 Ga0496115_0123786 3300048918 Bacteria 2129
1068 Ga0496115_0139324 3300048918 Bacteria 2001
1069 Ga0496115_0164954 3300048918 Bacteria 1832
1070 Ga0496115_0633515 3300048918 Bacteria 847
1071 Ga0496117_0055157 3300048920 Bacteria 2779
1072 Ga0496118_0028998 3300048921 Bacteria 4650
1073 Ga0496118_0052015 3300048921 Bacteria 3129
1074 Ga0496118_0063877 3300048921 Bacteria 2706
1075 Ga0496118_0075120 3300048921 Bacteria 2412
1076 Ga0496118_0137394 3300048921 Bacteria 1557
1077 Ga0496119_0000244 3300048922 Bacteria 76635
1078 Ga0496119_0030425 3300048922 Bacteria 3639
1079 Ga0496119_0098587 3300048922 Bacteria 1645
1080 Ga0496119_0112556 3300048922 Bacteria 1508
1081 Ga0496119_0140492 3300048922 Bacteria 1305
1082 Ga0496120_0017615 3300048923 Bacteria 4622
1083 Ga0496120_0068451 3300048923 Bacteria 1958
1084 Ga0496120_0133462 3300048923 Bacteria 1269
1085 Ga0496120_0152270 3300048923 Bacteria 1161
1086 Ga0496121_0012808 3300048924 Bacteria 9079
1087 Ga0496121_0034272 3300048924 Bacteria 4572
1088 Ga0496121_0083676 3300048924 Bacteria 2518
1089 Ga0496121_0121734 3300048924 Bacteria 1969
1090 Ga0496121_0179659 3300048924 Bacteria 1528
1091 Ga0496121_0194438 3300048924 Bacteria 1451
1092 Ga0496122_0090902 3300048925 Bacteria 2081
1093 Ga0496122_0122085 3300048925 Bacteria 1677
1094 Ga0496124_0238165 3300048927 Bacteria 1355
1095 Ga0496125_0038146 3300048928 Bacteria 4164
1096 Ga0496125_0056583 3300048928 Bacteria 3184
1097 Ga0496125_0137245 3300048928 Bacteria 1708
1098 Ga0496125_0165859 3300048928 Bacteria 1492
1099 Ga0496125_0228582 3300048928 Bacteria 1192
1100 Ga0496126_0010948 3300048929 Bacteria 9447
1101 Ga0496126_0057775 3300048929 Bacteria 3500
1102 Ga0496126_0071900 3300048929 Bacteria 3078
1103 Ga0496126_0074009 3300048929 Bacteria 3026
1104 Ga0496126_0085689 3300048929 Bacteria 2777
1105 Ga0496126_0101174 3300048929 Bacteria 2521
1106 Ga0496126_0171954 3300048929 Bacteria 1845
1107 Ga0495682_0089170 3300049460 Bacteria 1108
1108 Ga0501067_0044541 3300049583 Bacteria 2465
1109 nmdc:mga03683_16041_c1 3300050489 Bacteria 2806
1110 nmdc:mga03683_163998_c1 3300050489 Bacteria 1008
1111 nmdc:mga03683_90692_c1 3300050489 Bacteria 1332
1112 nmdc:mga03n38_22967_c1 3300050490 Bacteria 2532
1113 nmdc:mga03n38_27353_c1 3300050490 Bacteria 2365
1114 nmdc:mga00v17_181806_c1 3300050491 Bacteria 1357
1115 nmdc:mga00v17_230907_c1 3300050491 Bacteria 1199
1116 nmdc:mga00v17_272812_c1 3300050491 Bacteria 1098
1117 nmdc:mga0yw44_106694_c1 3300050492 Bacteria 1791
1118 nmdc:mga0yw44_11679_c1 3300050492 Bacteria 4548
1119 nmdc:mga0yw44_130944_c1 3300050492 Bacteria 1624
1120 nmdc:mga0yw44_13381_c2 3300050492 Bacteria 1048
1121 nmdc:mga0yw44_150923_c1 3300050492 Bacteria 1516
1122 nmdc:mga0yw44_180996_c1 3300050492 Bacteria 1387
1123 nmdc:mga0yw44_311742_c1 3300050492 Bacteria 1056
1124 nmdc:mga0k408_143346_c1 3300050493 Bacteria 1422
1125 nmdc:mga0k408_21086_c1 3300050493 Bacteria 3657
1126 nmdc:mga0k408_89303_c2 3300050493 Bacteria 1014
1127 nmdc:mga06z11_115467_c1 3300050494 Bacteria 1492
1128 nmdc:mga06z11_17732_c1 3300050494 Bacteria 3238
1129 nmdc:mga06z11_84253_c1 3300050494 Bacteria 1713
1130 nmdc:mga04h51_52137_c1 3300050495 Bacteria 1377
1131 nmdc:mga07m45_121766_c1 3300050496 Bacteria 1507
1132 nmdc:mga07m45_176638_c1 3300050496 Bacteria 1242
1133 nmdc:mga07m45_67113_c1 3300050496 Bacteria 2039
1134 nmdc:mga05p37_207007_c1 3300050507 Bacteria 2373
1135 nmdc:mga06r32_68261_c1 3300050510 Bacteria 3434
1136 nmdc:mga08y16_523063_c1 3300050511 Bacteria 1203
1137 nmdc:mga0n895_106524_c1 3300050512 Bacteria 2816
1138 nmdc:mga0n895_113926_c1 3300050512 Bacteria 2722
1139 nmdc:mga0n895_18014_c1 3300050512 Bacteria 6527
1140 nmdc:mga0rr50_336857_c1 3300050513 Bacteria 1267
1141 nmdc:mga0rr50_80317_c1 3300050513 Bacteria 2514
1142 nmdc:mga08x19_37496_c1 3300050514 Bacteria 3076
1143 nmdc:mga0a205_125945_c1 3300050515 Bacteria 2461
1144 nmdc:mga0a205_202108_c1 3300050515 Bacteria 1877
1145 nmdc:mga0sz30_32339_c1 3300050516 Bacteria 2170
1146 nmdc:mga0sz30_72717_c1 3300050516 Bacteria 1482
1147 Ga0495601_0001640 3300053077 Bacteria 12350
1148 Ga0495601_0023203 3300053077 Bacteria 3812
1149 Ga0495601_0023397 3300053077 Unclassified 3795
1150 Ga0495601_0028831 3300053077 Bacteria 3440
1151 Ga0495601_0267970 3300053077 Bacteria 1114
1152 Ga0495612_0019127 3300053078 Bacteria 2743
1153 Ga0500610_0028492 3300053079 Bacteria 2815
1154 Ga0500635_0008295 3300053080 Bacteria 2841
1155 Ga0495655_0043627 3300053083 Bacteria 1157
1156 Ga0495595_0007612 3300053084 Unclassified 4434
1157 Ga0495595_0027640 3300053084 Bacteria 2528
1158 Ga0495595_0052266 3300053084 Bacteria 1895
1159 Ga0495595_0061725 3300053084 Bacteria 1756
1160 Ga0495595_0178811 3300053084 Bacteria 1051
1161 Ga0495595_0221505 3300053084 Bacteria 944
1162 Ga0495619_0008243 3300053085 Bacteria 6594
1163 Ga0495619_0010343 3300053085 Bacteria 5872
1164 Ga0495619_0012352 3300053085 Bacteria 5376
1165 Ga0495619_0058763 3300053085 Bacteria 2554
1166 Ga0495619_0122870 3300053085 Bacteria 1780
1167 Ga0495619_0174754 3300053085 Bacteria 1486
1168 Ga0500643_000013 3300053087 Bacteria 324296
1169 Ga0500643_046243 3300053087 Bacteria 1258
1170 Ga0500647_0013414 3300053091 Bacteria 3707
1171 Ga0500583_0063488 3300053092 Bacteria 1749
1172 Ga0500651_0042202 3300053093 Bacteria 2874
1173 Ga0500651_0192977 3300053093 Bacteria 1205
1174 Ga0500566_0002168 3300053094 Bacteria 11555
1175 Ga0500641_0009257 3300053096 Bacteria 3538
1176 Ga0500641_0114321 3300053096 Bacteria 1162
1177 Ga0500650_0070830 3300053098 Bacteria 1630
1178 Ga0500555_009333 3300053103 Bacteria 2806
1179 Ga0500557_000069 3300053105 Bacteria 39500
1180 Ga0500562_009007 3300053108 Bacteria 2521
1181 Ga0500562_011635 3300053108 Bacteria 2234
1182 Ga0500572_000290 3300053111 Bacteria 18127
1183 Ga0500595_007010 3300053119 Bacteria 4720
1184 Ga0500626_126940 3300053128 Bacteria 1085
1185 Ga0500642_0000089 3300053130 Bacteria 47311
1186 Ga0500652_026345 3300053131 Bacteria 2238
1187 Ga0500655_020696 3300053133 Bacteria 1230
1188 Ga0500658_0090936 3300053134 Bacteria 1319
1189 Ga0500559_0000274 3300053136 Bacteria 39917
1190 Ga0500568_0068050 3300053139 Bacteria 1367
1191 Ga0500585_074316 3300053144 Bacteria 1228
1192 Ga0500603_029411 3300053150 Bacteria 1408
1193 Ga0500604_0074264 3300053151 Bacteria 1089
1194 Ga0500620_002584 3300053155 Bacteria 3686
1195 Ga0500622_0020174 3300053156 Bacteria 3539
1196 Ga0500624_010469 3300053157 Bacteria 1337
1197 Ga0500627_0006558 3300053158 Bacteria 3977
1198 Ga0500627_0077332 3300053158 Bacteria 1480
1199 Ga0500633_0103990 3300053160 Bacteria 1047
1200 Ga0500633_0113304 3300053160 Bacteria 1006
1201 Ga0500638_060912 3300053162 Bacteria 1814
1202 Ga0500639_116024 3300053163 Bacteria 1294
1203 Ga0500636_0000263 3300053177 Bacteria 29138
1204 Ga0500637_0009969 3300053178 Bacteria 4858
1205 Ga0500637_0061988 3300053178 Bacteria 2143
1206 Ga0500576_021480 3300053725 Bacteria 2946
1207 Ga0500611_012241 3300053727 Bacteria 1443
1208 Ga0500625_033352 3300053729 Bacteria 2444
1209 Ga0500645_027638 3300053730 Bacteria 1720
1210 Ga0500645_031956 3300053730 Bacteria 1580
1211 Ga0500609_005242 3300053731 Bacteria 1772
1212 Ga0500656_007136 3300053732 Bacteria 1154
1213 Ga0500596_004264 3300053735 Bacteria 2642
1214 Ga0500599_002544 3300053736 Bacteria 2190
1215 Ga0500601_000788 3300053737 Bacteria 4036

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048090 Ga0495615_0169071 Ga0495615_0169071_11_640 209
2 3300033180 Ga0307510_10202000 Ga0307510_102020002 210
3 3300046454 Ga0495592_0139601 Ga0495592_0139601_404_1225 210
4 3300046506 Ga0495583_0054921 Ga0495583_0054921_453_1145 210
5 3300046507 Ga0495606_0007533 Ga0495606_0007533_425_1117 210
6 3300046524 Ga0495648_0043639 Ga0495648_0043639_1941_2633 210
7 3300046660 Ga0495625_0365570 Ga0495625_0365570_50_742 210
8 3300046694 Ga0495649_0025832 Ga0495649_0025832_1156_1848 210
9 3300047472 Ga0495686_0120427 Ga0495686_0120427_522_1214 210
10 3300046473 Ga0495582_0119603 Ga0495582_0119603_208_1029 216
11 3300048923 Ga0496120_0133462 Ga0496120_0133462_102_782 222
12 3300035695 Ga0373927_0250759 Ga0373927_0250759_179_871 224
13 3300025933 Ga0207706_10046675 Ga0207706_100466752 226
14 iso_pu_bacteria 2507262055 2507511769 226
15 iso_pu_bacteria 2508501042 2508694254 226
16 iso_pu_bacteria 2511231028 2511398537 226
17 iso_pu_bacteria 2513237092 2513627300 226
18 iso_pu_bacteria 2513237094 2513642608 226
19 iso_pu_bacteria 2513237095 2513648291 226
20 iso_pu_bacteria 2513237101 2513692673 226
21 iso_pu_bacteria 2513237102 2513702654 226
22 iso_pu_bacteria 2513237141 2513891738 226
23 iso_pu_bacteria 2513237161 2514013332 226
24 iso_pu_bacteria 2515154112 2515624824 226
25 iso_pu_bacteria 2517093001 2517106108 226
26 iso_pu_bacteria 2524023205 2524442870 226
27 iso_pu_bacteria 2524023228 2524539131 226
28 iso_pu_bacteria 2528768022 2528854597 226
29 iso_pu_bacteria 2617270735 2617349509 226
30 iso_pu_bacteria 2667528175 2671122235 226
31 iso_pu_bacteria 2728368998 2728752160 226
32 iso_pu_bacteria 2744054633 2745077363 226
33 iso_pu_bacteria 2791355196 2793059748 226
34 iso_pu_bacteria 2791355197 2793069755 226
35 iso_pu_bacteria 2802429603 2805919558 226
36 iso_pu_bacteria 2816332527 2818239866 226
37 iso_pu_bacteria 2824600985 2824605975 226
38 iso_pu_bacteria 2824609381 2824613458 226
39 iso_pu_bacteria 2824617872 2824625811 226
40 iso_pu_bacteria 2824626560 2824633466 226
41 iso_pu_bacteria 2824635225 2824643889 226
42 iso_pu_bacteria 2824644064 2824652702 226
43 iso_pu_bacteria 2824653114 2824657006 226
44 iso_pu_bacteria 2824661429 2824670135 226
45 iso_pu_bacteria 2824671348 2824679475 226
46 iso_pu_bacteria 2824679649 2824687740 226
47 iso_pu_bacteria 2824687955 2824696096 226
48 iso_pu_bacteria 2824696289 2824703408 226
49 iso_pu_bacteria 2824704595 2824714329 226
50 iso_pu_bacteria 2824714736 2824723370 226
51 iso_pu_bacteria 2824723954 2824732641 226
52 iso_pu_bacteria 2824753945 2824760703 226
53 iso_pu_bacteria 2824763712 2824770420 226
54 iso_pu_bacteria 2824773399 2824777950 226
55 iso_pu_bacteria 2838122688 2838128244 226
56 iso_pu_bacteria 2841941048 2841942136 226
57 iso_pu_bacteria 2841949485 2841955393 226
58 iso_pu_bacteria 2841957949 2841963646 226
59 iso_pu_bacteria 2841966195 2841971331 226
60 iso_pu_bacteria 2841974524 2841981624 226
61 iso_pu_bacteria 2841983080 2841987048 226
62 iso_pu_bacteria 2842038055 2842042108 226
63 iso_pu_bacteria 2842045827 2842050151 226
64 iso_pu_bacteria 2844315083 2844320975 226
65 iso_pu_bacteria 2847930680 2847932506 226
66 iso_pu_bacteria 2847939898 2847943652 226
67 iso_pu_bacteria 2857509624 2857515020 226
68 iso_pu_bacteria 2874590934 2874593609 226
69 iso_pu_bacteria 2874612657 2874613988 226
70 iso_pu_bacteria 2874620515 2874624985 226
71 iso_pu_bacteria 2874628541 2874633986 226
72 iso_pu_bacteria 2874645413 2874648378 226
73 iso_pu_bacteria 2876761206 2876766003 226
74 iso_pu_bacteria 2876771140 2876774670 226
75 iso_pu_bacteria 2876818435 2876821461 226
76 iso_pu_bacteria 2879074833 2879079238 226
77 iso_pu_bacteria 2879083081 2879090256 226
78 iso_pu_bacteria 2879099564 2879102113 226
79 iso_pu_bacteria 2879127579 2879131239 226
80 iso_pu_bacteria 2879142872 2879145012 226
81 iso_pu_bacteria 2881364244 2881371262 226
82 iso_pu_bacteria 2881665667 2881667898 226
83 iso_pu_bacteria 2885374607 2885378814 226
84 iso_pu_bacteria 2885409591 2885414308 226
85 iso_pu_bacteria 2888378607 2888386343 226
86 iso_pu_bacteria 2888419890 2888426504 226
87 iso_pu_bacteria 2903727486 2903730784 226
88 iso_pu_bacteria 2903748898 2903750822 226
89 iso_pu_bacteria 2904666416 2904669040 226
90 iso_pu_bacteria 2904690495 2904698257 226
91 iso_pu_bacteria 2904699407 2904706882 226
92 iso_pu_bacteria 2904711408 2904715626 226
93 iso_pu_bacteria 2906602504 2906605262 226
94 iso_pu_bacteria 2906610324 2906615807 226
95 iso_pu_bacteria 2906626472 2906627566 226
96 iso_pu_bacteria 2906643746 2906651592 226
97 iso_pu_bacteria 2908739725 2908740823 226
98 iso_pu_bacteria 2908756301 2908762857 226
99 iso_pu_bacteria 2922368715 2922376986 226
100 iso_pu_bacteria 2922393267 2922396137 226
101 iso_pu_bacteria 2922425934 2922432217 226
102 iso_pu_bacteria 2929615660 2929620354 226
103 iso_pu_bacteria 2929624759 2929632983 226
104 iso_pu_bacteria 2932784394 2932790063 226
105 iso_pu_bacteria 2932794094 2932799389 226
106 iso_pu_bacteria 2932801729 2932802212 226
107 iso_pu_bacteria 2932809354 2932817836 226
108 iso_pu_bacteria 2932818245 2932823960 226
109 iso_pu_bacteria 2932828146 2932833483 226
110 iso_pu_bacteria 2933577622 2933582273 226
111 iso_pu_bacteria 2935616580 2935621244 226
112 iso_pu_bacteria 2935630451 2935630917 226
113 iso_pu_bacteria 2935638405 2935643436 226
114 iso_pu_bacteria 2935648319 2935650582 226
115 iso_pu_bacteria 2935656913 2935663024 226
116 iso_pu_bacteria 2935665750 2935671241 226
117 iso_pu_bacteria 2935675223 2935681153 226
118 iso_pu_bacteria 2935684952 2935689508 226
119 iso_pu_bacteria 2935694250 2935700080 226
120 iso_pu_bacteria 2935703347 2935710711 226
121 iso_pu_bacteria 2935713505 2935720759 226
122 iso_pu_bacteria 2935722832 2935727930 226
123 iso_pu_bacteria 2935732158 2935737474 226
124 iso_pu_bacteria 2935741537 2935746465 226
125 iso_pu_bacteria 2935750917 2935757432 226
126 iso_pu_bacteria 2935760218 2935763810 226
127 iso_pu_bacteria 2935769743 2935772414 226
128 iso_pu_bacteria 2935777560 2935781366 226
129 iso_pu_bacteria 2935785616 2935787865 226
130 iso_pu_bacteria 2935793552 2935793578 226
131 iso_pu_bacteria 2935801545 2935807790 226
132 iso_pu_bacteria 2935810662 2935818307 226
133 iso_pu_bacteria 2935827899 2935832953 226
134 iso_pu_bacteria 2935837841 2935844375 226
135 iso_pu_bacteria 2935855204 2935859563 226
136 iso_pu_bacteria 2935864058 2935871372 226
137 iso_pu_bacteria 2935873716 2935879115 226
138 iso_pu_bacteria 2935883170 2935889548 226
139 iso_pu_bacteria 2935908558 2935911130 226
140 iso_pu_bacteria 2935916978 2935920633 226
141 iso_pu_bacteria 2935926038 2935928159 226
142 iso_pu_bacteria 2935934488 2935937804 226
143 iso_pu_bacteria 2935942939 2935945086 226
144 iso_pu_bacteria 2935951376 2935954409 226
145 iso_pu_bacteria 2935959822 2935967002 226
146 iso_pu_bacteria 2935967501 2935971324 226
147 iso_pu_bacteria 2935975950 2935983099 226
148 iso_pu_bacteria 2935984226 2935990746 226
149 iso_pu_bacteria 2935992306 2935996758 226
150 iso_pu_bacteria 2936002035 2936008634 226
151 iso_pu_bacteria 2936011229 2936017062 226
152 iso_pu_bacteria 2936019824 2936027496 226
153 iso_pu_bacteria 2936028420 2936036320 226
154 iso_pu_bacteria 2936037263 2936044875 226
155 iso_pu_bacteria 2936046547 2936050805 226
156 iso_pu_bacteria 2936055302 2936063345 226
157 iso_pu_bacteria 2940556831 2940563744 226
158 iso_pu_bacteria 2941507105 2941507569 226
159 iso_pu_bacteria 2941515067 2941515996 226
160 iso_pu_bacteria 2941523033 2941523296 226
161 iso_pu_bacteria 2941531003 2941537749 226
162 iso_pu_bacteria 2941538514 2941542707 226
163 iso_pu_bacteria 3005474847 3005476753 226
164 iso_pu_bacteria 3005483717 3005487596 226
165 iso_pu_bacteria 3005587118 3005591351 226
166 iso_pu_bacteria 3005594810 3005601270 226
167 iso_pu_bacteria 3005710791 3005716749 226
168 iso_pu_bacteria 8006926726 8006926893 226
169 iso_pu_bacteria 8016511872 8016519611 226
170 iso_pu_bacteria 8016522445 8016524754 226
171 iso_pu_bacteria 8016530956 8016538324 226
172 iso_pu_bacteria 8016548790 8016550673 226
173 iso_pu_bacteria 8016557553 8016559090 226
174 iso_pu_bacteria 8016566248 8016567985 226
175 iso_pu_bacteria 8016575299 8016580671 226
176 iso_pu_bacteria 8016583857 8016588149 226
177 iso_pu_bacteria 8016595262 8016597047 226
178 iso_pu_bacteria 8016603502 8016607958 226
179 iso_pu_bacteria 8016613128 8016619741 226
180 iso_pu_bacteria 8016622563 8016624338 226
181 iso_pu_bacteria 8017057580 8017065918 226
182 iso_pu_bacteria 8019530166 8019537996 226
183 iso_pu_bacteria 8019538911 8019547293 226
184 iso_pu_bacteria 8019547302 8019551356 226
185 iso_pu_bacteria 8019555841 8019564009 226
186 iso_pu_bacteria 8019565922 8019574081 226
187 iso_pu_bacteria 8019576017 8019578731 226
188 iso_pu_bacteria 8019586578 8019596773 226
189 iso_pu_bacteria 8019608314 8019613615 226
190 iso_pu_bacteria 8019619141 8019624272 226
191 iso_pu_bacteria 8019629233 8019637733 226
192 iso_pu_bacteria 8019638758 8019641875 226
193 iso_pu_bacteria 8019648815 8019653816 226
194 iso_pu_bacteria 8019659431 8019665667 226
195 iso_pu_bacteria 8019668869 8019675204 226
196 iso_pu_bacteria 8019687851 8019694881 226
197 iso_pu_bacteria 8055742211 8055749889 226
198 iso_pu_bacteria 8056967851 8056969784 226
199 iso_pu_bacteria 2513237139 2513875188 227
200 iso_pu_bacteria 8006933436 8006934666 227
201 iso_pu_bacteria 8006973647 8006974635 227
202 3300005365 Ga0070688_100451454 Ga0070688_1004514542 229
203 3300005441 Ga0070700_100458675 Ga0070700_1004586751 229
204 3300005458 Ga0070681_10039976 Ga0070681_100399764 229
205 3300005518 Ga0070699_100009853 Ga0070699_1000098536 229
206 3300005518 Ga0070699_100208547 Ga0070699_1002085472 229
207 3300005549 Ga0070704_100019036 Ga0070704_1000190364 229
208 3300009553 Ga0105249_10496004 Ga0105249_104960041 229
209 3300010159 Ga0099796_10055490 Ga0099796_100554902 229
210 3300014326 Ga0157380_10195498 Ga0157380_101954982 229
211 3300037853 Ga0436364_0974948 Ga0436364_0974948_269_958 229
212 3300048915 Ga0496112_0256980 Ga0496112_0256980_750_1439 229
213 3300050492 nmdc:mga0yw44_180996_c1 nmdc:mga0yw44_180996_c1_389_1081 229
214 3300003203 JGI25406J46586_10001020 JGI25406J46586_100010204 230
215 3300003215 JGI25153J46596_10000804 JGI25153J46596_100008041 230
216 3300003215 JGI25153J46596_10006566 JGI25153J46596_100065661 230
217 3300003215 JGI25153J46596_10058875 JGI25153J46596_100588752 230
218 3300003354 JGI25160J50197_1005212 JGI25160J50197_10052126 230
219 3300003752 Ga0055539_1009970 Ga0055539_10099702 230
220 3300003771 Ga0055526_1052374 Ga0055526_10523742 230
221 3300003911 JGI25405J52794_10036643 JGI25405J52794_100366431 230
222 3300004625 Ga0055543_1006157 Ga0055543_10061573 230
223 3300005262 Ga0065165_1000701 Ga0065165_10007013 230
224 3300005289 Ga0065704_10215145 Ga0065704_102151452 230
225 3300005295 Ga0065707_10098746 Ga0065707_100987462 230
226 3300005328 Ga0070676_10097147 Ga0070676_100971472 230
227 3300005328 Ga0070676_10121744 Ga0070676_101217442 230
228 3300005329 Ga0070683_100017619 Ga0070683_1000176194 230
229 3300005329 Ga0070683_100025232 Ga0070683_1000252321 230
230 3300005330 Ga0070690_100230713 Ga0070690_1002307132 230
231 3300005331 Ga0070670_100239789 Ga0070670_1002397892 230
232 3300005334 Ga0068869_100074999 Ga0068869_1000749991 230
233 3300005334 Ga0068869_100123560 Ga0068869_1001235601 230
234 3300005335 Ga0070666_10045804 Ga0070666_100458043 230
235 3300005336 Ga0070680_100010505 Ga0070680_1000105055 230
236 3300005336 Ga0070680_100052127 Ga0070680_1000521273 230
237 3300005336 Ga0070680_100079764 Ga0070680_1000797641 230
238 3300005336 Ga0070680_100117683 Ga0070680_1001176833 230
239 3300005336 Ga0070680_100224201 Ga0070680_1002242011 230
240 3300005338 Ga0068868_100111298 Ga0068868_1001112982 230
241 3300005338 Ga0068868_100272363 Ga0068868_1002723632 230
242 3300005338 Ga0068868_100459352 Ga0068868_1004593521 230
243 3300005339 Ga0070660_100036145 Ga0070660_1000361454 230
244 3300005344 Ga0070661_100093421 Ga0070661_1000934216 230
245 3300005347 Ga0070668_100073802 Ga0070668_1000738023 230
246 3300005353 Ga0070669_100084222 Ga0070669_1000842223 230
247 3300005353 Ga0070669_100286917 Ga0070669_1002869172 230
248 3300005354 Ga0070675_100228008 Ga0070675_1002280082 230
249 3300005354 Ga0070675_100703003 Ga0070675_1007030032 230
250 3300005355 Ga0070671_100006252 Ga0070671_1000062522 230
251 3300005355 Ga0070671_100075956 Ga0070671_1000759562 230
252 3300005355 Ga0070671_100228249 Ga0070671_1002282492 230
253 3300005364 Ga0070673_100450375 Ga0070673_1004503753 230
254 3300005366 Ga0070659_100061054 Ga0070659_1000610543 230
255 3300005367 Ga0070667_100056443 Ga0070667_1000564432 230
256 3300005367 Ga0070667_100271815 Ga0070667_1002718152 230
257 3300005367 Ga0070667_100460702 Ga0070667_1004607022 230
258 3300005367 Ga0070667_101115238 Ga0070667_1011152381 230
259 3300005434 Ga0070709_10007584 Ga0070709_100075844 230
260 3300005434 Ga0070709_10310108 Ga0070709_103101082 230
261 3300005435 Ga0070714_100019222 Ga0070714_1000192225 230
262 3300005435 Ga0070714_100027369 Ga0070714_1000273694 230
263 3300005435 Ga0070714_100067406 Ga0070714_1000674062 230
264 3300005435 Ga0070714_100084184 Ga0070714_1000841842 230
265 3300005435 Ga0070714_100142258 Ga0070714_1001422582 230
266 3300005435 Ga0070714_100151239 Ga0070714_1001512392 230
267 3300005435 Ga0070714_100480520 Ga0070714_1004805202 230
268 3300005436 Ga0070713_100001489 Ga0070713_10000148910 230
269 3300005436 Ga0070713_100009110 Ga0070713_1000091102 230
270 3300005436 Ga0070713_100023775 Ga0070713_1000237751 230
271 3300005436 Ga0070713_100025632 Ga0070713_1000256323 230
272 3300005436 Ga0070713_100129793 Ga0070713_1001297932 230
273 3300005436 Ga0070713_100233179 Ga0070713_1002331792 230
274 3300005436 Ga0070713_100327201 Ga0070713_1003272012 230
275 3300005437 Ga0070710_10000992 Ga0070710_1000099210 230
276 3300005437 Ga0070710_10109063 Ga0070710_101090632 230
277 3300005438 Ga0070701_10165576 Ga0070701_101655763 230
278 3300005439 Ga0070711_100013172 Ga0070711_1000131726 230
279 3300005439 Ga0070711_100014021 Ga0070711_1000140217 230
280 3300005439 Ga0070711_100017355 Ga0070711_1000173554 230
281 3300005439 Ga0070711_100087592 Ga0070711_1000875922 230
282 3300005439 Ga0070711_100232879 Ga0070711_1002328792 230
283 3300005440 Ga0070705_100112482 Ga0070705_1001124822 230
284 3300005440 Ga0070705_100312005 Ga0070705_1003120051 230
285 3300005455 Ga0070663_100014207 Ga0070663_1000142075 230
286 3300005455 Ga0070663_100024630 Ga0070663_1000246302 230
287 3300005455 Ga0070663_100048295 Ga0070663_1000482953 230
288 3300005455 Ga0070663_100088872 Ga0070663_1000888723 230
289 3300005455 Ga0070663_100208158 Ga0070663_1002081582 230
290 3300005456 Ga0070678_100337425 Ga0070678_1003374253 230
291 3300005457 Ga0070662_100140328 Ga0070662_1001403282 230
292 3300005457 Ga0070662_100327595 Ga0070662_1003275951 230
293 3300005458 Ga0070681_10088456 Ga0070681_100884562 230
294 3300005458 Ga0070681_10099965 Ga0070681_100999653 230
295 3300005458 Ga0070681_10409761 Ga0070681_104097612 230
296 3300005458 Ga0070681_10418163 Ga0070681_104181631 230
297 3300005459 Ga0068867_100247412 Ga0068867_1002474121 230
298 3300005467 Ga0070706_100115771 Ga0070706_1001157715 230
299 3300005468 Ga0070707_100202705 Ga0070707_1002027052 230
300 3300005468 Ga0070707_100317350 Ga0070707_1003173502 230
301 3300005518 Ga0070699_100206939 Ga0070699_1002069392 230
302 3300005530 Ga0070679_100005756 Ga0070679_1000057566 230
303 3300005530 Ga0070679_100015208 Ga0070679_1000152087 230
304 3300005530 Ga0070679_100137820 Ga0070679_1001378202 230
305 3300005530 Ga0070679_100150084 Ga0070679_1001500841 230
306 3300005535 Ga0070684_100150192 Ga0070684_1001501922 230
307 3300005535 Ga0070684_100161283 Ga0070684_1001612832 230
308 3300005536 Ga0070697_100006018 Ga0070697_1000060182 230
309 3300005539 Ga0068853_100165253 Ga0068853_1001652533 230
310 3300005539 Ga0068853_100188949 Ga0068853_1001889492 230
311 3300005539 Ga0068853_100218842 Ga0068853_1002188422 230
312 3300005539 Ga0068853_100602922 Ga0068853_1006029222 230
313 3300005543 Ga0070672_100198425 Ga0070672_1001984252 230
314 3300005545 Ga0070695_100411581 Ga0070695_1004115812 230
315 3300005546 Ga0070696_100056279 Ga0070696_1000562792 230
316 3300005546 Ga0070696_100658708 Ga0070696_1006587081 230
317 3300005547 Ga0070693_100064920 Ga0070693_1000649202 230
318 3300005547 Ga0070693_100175691 Ga0070693_1001756912 230
319 3300005548 Ga0070665_100085403 Ga0070665_1000854032 230
320 3300005548 Ga0070665_100106310 Ga0070665_1001063103 230
321 3300005548 Ga0070665_100266993 Ga0070665_1002669932 230
322 3300005548 Ga0070665_100325219 Ga0070665_1003252192 230
323 3300005548 Ga0070665_100369316 Ga0070665_1003693162 230
324 3300005548 Ga0070665_100482234 Ga0070665_1004822342 230
325 3300005548 Ga0070665_100974957 Ga0070665_1009749572 230
326 3300005563 Ga0068855_100040685 Ga0068855_1000406852 230
327 3300005563 Ga0068855_100050976 Ga0068855_1000509764 230
328 3300005563 Ga0068855_100099474 Ga0068855_1000994743 230
329 3300005563 Ga0068855_100194372 Ga0068855_1001943722 230
330 3300005563 Ga0068855_100277393 Ga0068855_1002773932 230
331 3300005564 Ga0070664_100218889 Ga0070664_1002188892 230
332 3300005564 Ga0070664_100373957 Ga0070664_1003739571 230
333 3300005577 Ga0068857_100062281 Ga0068857_1000622812 230
334 3300005577 Ga0068857_100071339 Ga0068857_1000713392 230
335 3300005577 Ga0068857_100104583 Ga0068857_1001045832 230
336 3300005578 Ga0068854_100092958 Ga0068854_1000929582 230
337 3300005578 Ga0068854_100191680 Ga0068854_1001916802 230
338 3300005614 Ga0068856_100000680 Ga0068856_10000068037 230
339 3300005614 Ga0068856_100158954 Ga0068856_1001589543 230
340 3300005614 Ga0068856_100540367 Ga0068856_1005403672 230
341 3300005614 Ga0068856_100609299 Ga0068856_1006092991 230
342 3300005614 Ga0068856_100687080 Ga0068856_1006870802 230
343 3300005615 Ga0070702_100438987 Ga0070702_1004389871 230
344 3300005616 Ga0068852_100005622 Ga0068852_1000056222 230
345 3300005616 Ga0068852_100023372 Ga0068852_1000233722 230
346 3300005616 Ga0068852_100117720 Ga0068852_1001177202 230
347 3300005616 Ga0068852_100145340 Ga0068852_1001453403 230
348 3300005616 Ga0068852_100627694 Ga0068852_1006276942 230
349 3300005617 Ga0068859_100380780 Ga0068859_1003807802 230
350 3300005618 Ga0068864_100279930 Ga0068864_1002799302 230
351 3300005718 Ga0068866_10373203 Ga0068866_103732032 230
352 3300005719 Ga0068861_100345994 Ga0068861_1003459942 230
353 3300005719 Ga0068861_100436992 Ga0068861_1004369922 230
354 3300005719 Ga0068861_100473846 Ga0068861_1004738462 230
355 3300005834 Ga0068851_10003594 Ga0068851_100035947 230
356 3300005841 Ga0068863_100092102 Ga0068863_1000921024 230
357 3300005841 Ga0068863_100930360 Ga0068863_1009303602 230
358 3300005842 Ga0068858_100097039 Ga0068858_1000970393 230
359 3300005842 Ga0068858_100101774 Ga0068858_1001017742 230
360 3300005842 Ga0068858_100225054 Ga0068858_1002250542 230
361 3300005842 Ga0068858_100347456 Ga0068858_1003474562 230
362 3300005842 Ga0068858_100703364 Ga0068858_1007033642 230
363 3300005842 Ga0068858_100942837 Ga0068858_1009428371 230
364 3300005843 Ga0068860_100042873 Ga0068860_1000428734 230
365 3300005844 Ga0068862_100054688 Ga0068862_1000546882 230
366 3300005844 Ga0068862_100198629 Ga0068862_1001986291 230
367 3300005937 Ga0081455_10002021 Ga0081455_1000202115 230
368 3300005937 Ga0081455_10005151 Ga0081455_1000515112 230
369 3300005937 Ga0081455_10026629 Ga0081455_100266294 230
370 3300005937 Ga0081455_10123567 Ga0081455_101235672 230
371 3300005937 Ga0081455_10198877 Ga0081455_101988772 230
372 3300005981 Ga0081538_10059078 Ga0081538_100590782 230
373 3300005983 Ga0081540_1002468 Ga0081540_10024686 230
374 3300005983 Ga0081540_1005678 Ga0081540_10056789 230
375 3300005983 Ga0081540_1021213 Ga0081540_10212132 230
376 3300005983 Ga0081540_1038858 Ga0081540_10388582 230
377 3300005983 Ga0081540_1048004 Ga0081540_10480042 230
378 3300005983 Ga0081540_1063911 Ga0081540_10639111 230
379 3300005983 Ga0081540_1115275 Ga0081540_11152752 230
380 3300005985 Ga0081539_10000486 Ga0081539_1000048642 230
381 3300005985 Ga0081539_10050525 Ga0081539_100505252 230
382 3300005985 Ga0081539_10214037 Ga0081539_102140372 230
383 3300006028 Ga0070717_10000990 Ga0070717_1000099016 230
384 3300006028 Ga0070717_10051191 Ga0070717_100511912 230
385 3300006028 Ga0070717_10131446 Ga0070717_101314462 230
386 3300006028 Ga0070717_10147553 Ga0070717_101475532 230
387 3300006028 Ga0070717_10269953 Ga0070717_102699532 230
388 3300006028 Ga0070717_10292913 Ga0070717_102929133 230
389 3300006038 Ga0075365_10004620 Ga0075365_100046202 230
390 3300006038 Ga0075365_10006567 Ga0075365_100065672 230
391 3300006038 Ga0075365_10070651 Ga0075365_100706513 230
392 3300006038 Ga0075365_10086976 Ga0075365_100869762 230
393 3300006042 Ga0075368_10010675 Ga0075368_100106753 230
394 3300006042 Ga0075368_10021010 Ga0075368_100210102 230
395 3300006048 Ga0075363_100011493 Ga0075363_1000114933 230
396 3300006048 Ga0075363_100028373 Ga0075363_1000283732 230
397 3300006051 Ga0075364_10007860 Ga0075364_100078603 230
398 3300006051 Ga0075364_10009406 Ga0075364_100094066 230
399 3300006051 Ga0075364_10076927 Ga0075364_100769272 230
400 3300006163 Ga0070715_10004151 Ga0070715_100041518 230
401 3300006173 Ga0070716_100009679 Ga0070716_1000096791 230
402 3300006173 Ga0070716_100230086 Ga0070716_1002300862 230
403 3300006173 Ga0070716_100244920 Ga0070716_1002449202 230
404 3300006175 Ga0070712_100117627 Ga0070712_1001176273 230
405 3300006175 Ga0070712_100146036 Ga0070712_1001460362 230
406 3300006175 Ga0070712_100220599 Ga0070712_1002205991 230
407 3300006175 Ga0070712_100436219 Ga0070712_1004362192 230
408 3300006177 Ga0075362_10007954 Ga0075362_100079543 230
409 3300006177 Ga0075362_10051963 Ga0075362_100519633 230
410 3300006178 Ga0075367_10018244 Ga0075367_100182442 230
411 3300006178 Ga0075367_10026441 Ga0075367_100264412 230
412 3300006186 Ga0075369_10040871 Ga0075369_100408712 230
413 3300006194 Ga0075427_10000325 Ga0075427_100003254 230
414 3300006195 Ga0075366_10185936 Ga0075366_101859361 230
415 3300006237 Ga0097621_100232981 Ga0097621_1002329812 230
416 3300006358 Ga0068871_100037598 Ga0068871_1000375984 230
417 3300006358 Ga0068871_101094563 Ga0068871_1010945631 230
418 3300006844 Ga0075428_100010666 Ga0075428_1000106667 230
419 3300006844 Ga0075428_100221751 Ga0075428_1002217512 230
420 3300006844 Ga0075428_100357100 Ga0075428_1003571002 230
421 3300006846 Ga0075430_100007887 Ga0075430_1000078873 230
422 3300006846 Ga0075430_100066957 Ga0075430_1000669573 230
423 3300006846 Ga0075430_100280650 Ga0075430_1002806503 230
424 3300006847 Ga0075431_100031468 Ga0075431_1000314684 230
425 3300006852 Ga0075433_10004925 Ga0075433_100049259 230
426 3300006852 Ga0075433_10168068 Ga0075433_101680682 230
427 3300006871 Ga0075434_100000317 Ga0075434_10000031735 230
428 3300006871 Ga0075434_100143535 Ga0075434_1001435352 230
429 3300006871 Ga0075434_100330941 Ga0075434_1003309412 230
430 3300006871 Ga0075434_100855394 Ga0075434_1008553941 230
431 3300006880 Ga0075429_100006024 Ga0075429_1000060249 230
432 3300006881 Ga0068865_100253947 Ga0068865_1002539471 230
433 3300006881 Ga0068865_100266361 Ga0068865_1002663612 230
434 3300006931 Ga0097620_100144495 Ga0097620_1001444952 230
435 3300006931 Ga0097620_100380781 Ga0097620_1003807811 230
436 3300006931 Ga0097620_100764399 Ga0097620_1007643991 230
437 3300006941 Ga0099825_1025113 Ga0099825_10251132 230
438 3300006942 Ga0099824_1010060 Ga0099824_101006010 230
439 3300006942 Ga0099824_1022821 Ga0099824_10228213 230
440 3300006943 Ga0099822_1001406 Ga0099822_100140610 230
441 3300006943 Ga0099822_1050681 Ga0099822_10506812 230
442 3300006944 Ga0099823_1014974 Ga0099823_10149742 230
443 3300007076 Ga0075435_100005165 Ga0075435_1000051653 230
444 3300007076 Ga0075435_100057684 Ga0075435_1000576843 230
445 3300007076 Ga0075435_100214632 Ga0075435_1002146321 230
446 3300007076 Ga0075435_100231297 Ga0075435_1002312972 230
447 3300007265 Ga0099794_10122002 Ga0099794_101220022 230
448 3300007788 Ga0099795_10024254 Ga0099795_100242542 230
449 3300007788 Ga0099795_10120540 Ga0099795_101205402 230
450 3300009092 Ga0105250_10019495 Ga0105250_100194952 230
451 3300009093 Ga0105240_10017091 Ga0105240_100170913 230
452 3300009093 Ga0105240_10029263 Ga0105240_100292636 230
453 3300009093 Ga0105240_10048975 Ga0105240_100489752 230
454 3300009093 Ga0105240_10102247 Ga0105240_101022472 230
455 3300009093 Ga0105240_10199456 Ga0105240_101994563 230
456 3300009098 Ga0105245_10007957 Ga0105245_100079577 230
457 3300009098 Ga0105245_10236299 Ga0105245_102362992 230
458 3300009101 Ga0105247_10054061 Ga0105247_100540613 230
459 3300009101 Ga0105247_10055478 Ga0105247_100554782 230
460 3300009101 Ga0105247_10062179 Ga0105247_100621793 230
461 3300009101 Ga0105247_10071416 Ga0105247_100714161 230
462 3300009101 Ga0105247_10292702 Ga0105247_102927021 230
463 3300009147 Ga0114129_10047472 Ga0114129_100474728 230
464 3300009148 Ga0105243_10081554 Ga0105243_100815541 230
465 3300009148 Ga0105243_10528849 Ga0105243_105288491 230
466 3300009174 Ga0105241_10076137 Ga0105241_100761373 230
467 3300009174 Ga0105241_10165398 Ga0105241_101653982 230
468 3300009174 Ga0105241_10308604 Ga0105241_103086042 230
469 3300009174 Ga0105241_10339451 Ga0105241_103394512 230
470 3300009176 Ga0105242_10121232 Ga0105242_101212323 230
471 3300009176 Ga0105242_10381639 Ga0105242_103816392 230
472 3300009177 Ga0105248_10227877 Ga0105248_102278772 230
473 3300009177 Ga0105248_10452006 Ga0105248_104520062 230
474 3300009177 Ga0105248_10742915 Ga0105248_107429152 230
475 3300009545 Ga0105237_10027872 Ga0105237_100278725 230
476 3300009545 Ga0105237_10040140 Ga0105237_100401403 230
477 3300009545 Ga0105237_10070663 Ga0105237_100706632 230
478 3300009545 Ga0105237_10111579 Ga0105237_101115793 230
479 3300009545 Ga0105237_10129113 Ga0105237_101291133 230
480 3300009545 Ga0105237_10143818 Ga0105237_101438183 230
481 3300009545 Ga0105237_10218484 Ga0105237_102184841 230
482 3300009545 Ga0105237_10584563 Ga0105237_105845631 230
483 3300009545 Ga0105237_10594467 Ga0105237_105944672 230
484 3300009551 Ga0105238_10013865 Ga0105238_100138658 230
485 3300009551 Ga0105238_10020769 Ga0105238_100207697 230
486 3300009551 Ga0105238_10037253 Ga0105238_100372535 230
487 3300009551 Ga0105238_10093120 Ga0105238_100931202 230
488 3300009551 Ga0105238_10104769 Ga0105238_101047692 230
489 3300010159 Ga0099796_10019339 Ga0099796_100193392 230
490 3300010159 Ga0099796_10048339 Ga0099796_100483393 230
491 3300010159 Ga0099796_10071488 Ga0099796_100714881 230
492 3300010375 Ga0105239_10013166 Ga0105239_100131666 230
493 3300010375 Ga0105239_10045820 Ga0105239_100458205 230
494 3300010375 Ga0105239_10055145 Ga0105239_100551453 230
495 3300010375 Ga0105239_10061464 Ga0105239_100614644 230
496 3300010375 Ga0105239_10091513 Ga0105239_100915132 230
497 3300010375 Ga0105239_10224554 Ga0105239_102245542 230
498 3300010375 Ga0105239_10241357 Ga0105239_102413572 230
499 3300010375 Ga0105239_10268022 Ga0105239_102680222 230
500 3300010375 Ga0105239_10394133 Ga0105239_103941331 230
501 3300010375 Ga0105239_10560005 Ga0105239_105600052 230
502 3300011119 Ga0105246_10019195 Ga0105246_100191952 230
503 3300011119 Ga0105246_10028021 Ga0105246_100280212 230
504 3300011119 Ga0105246_10039294 Ga0105246_100392945 230
505 3300013104 Ga0157370_10033613 Ga0157370_100336135 230
506 3300013104 Ga0157370_10530495 Ga0157370_105304951 230
507 3300013105 Ga0157369_10006140 Ga0157369_100061409 230
508 3300013105 Ga0157369_10016279 Ga0157369_100162793 230
509 3300013105 Ga0157369_10034922 Ga0157369_100349227 230
510 3300013105 Ga0157369_10217285 Ga0157369_102172852 230
511 3300013296 Ga0157374_10029773 Ga0157374_100297734 230
512 3300013296 Ga0157374_10030196 Ga0157374_100301964 230
513 3300013296 Ga0157374_10084717 Ga0157374_100847172 230
514 3300013296 Ga0157374_10222984 Ga0157374_102229842 230
515 3300013296 Ga0157374_10431935 Ga0157374_104319351 230
516 3300013297 Ga0157378_10182598 Ga0157378_101825984 230
517 3300013297 Ga0157378_10207394 Ga0157378_102073942 230
518 3300013306 Ga0163162_10029376 Ga0163162_100293762 230
519 3300013306 Ga0163162_10045464 Ga0163162_100454645 230
520 3300013306 Ga0163162_10070383 Ga0163162_100703833 230
521 3300013306 Ga0163162_10257331 Ga0163162_102573312 230
522 3300013306 Ga0163162_10310046 Ga0163162_103100462 230
523 3300013306 Ga0163162_10481129 Ga0163162_104811293 230
524 3300013306 Ga0163162_10488038 Ga0163162_104880382 230
525 3300013307 Ga0157372_10019384 Ga0157372_100193846 230
526 3300013307 Ga0157372_10068085 Ga0157372_100680853 230
527 3300013307 Ga0157372_10204351 Ga0157372_102043512 230
528 3300013308 Ga0157375_10013280 Ga0157375_100132807 230
529 3300013308 Ga0157375_10067562 Ga0157375_100675624 230
530 3300013308 Ga0157375_10258482 Ga0157375_102584822 230
531 3300013308 Ga0157375_10333598 Ga0157375_103335982 230
532 3300013308 Ga0157375_10361873 Ga0157375_103618732 230
533 3300013308 Ga0157375_10378261 Ga0157375_103782612 230
534 3300013308 Ga0157375_10493113 Ga0157375_104931132 230
535 3300014325 Ga0163163_10006759 Ga0163163_100067592 230
536 3300014325 Ga0163163_10036974 Ga0163163_100369744 230
537 3300014325 Ga0163163_10092655 Ga0163163_100926553 230
538 3300014325 Ga0163163_10146857 Ga0163163_101468572 230
539 3300014325 Ga0163163_10554706 Ga0163163_105547062 230
540 3300014968 Ga0157379_10026109 Ga0157379_100261092 230
541 3300014968 Ga0157379_10098103 Ga0157379_100981032 230
542 3300014968 Ga0157379_10417141 Ga0157379_104171412 230
543 3300014969 Ga0157376_10153738 Ga0157376_101537384 230
544 3300017792 Ga0163161_10631680 Ga0163161_106316801 230
545 3300020069 Ga0197907_11085692 Ga0197907_110856922 230
546 3300020080 Ga0206350_10147974 Ga0206350_101479742 230
547 3300021361 Ga0213872_10096894 Ga0213872_100968941 230
548 3300021384 Ga0213876_10102971 Ga0213876_101029712 230
549 3300021388 Ga0213875_10036010 Ga0213875_100360101 230
550 3300021441 Ga0213871_10048862 Ga0213871_100488622 230
551 3300022467 Ga0224712_10019052 Ga0224712_100190523 230
552 3300024225 Ga0224572_1032213 Ga0224572_10322132 230
553 3300024227 Ga0228598_1009638 Ga0228598_10096382 230
554 3300025253 Ga0209677_102334 Ga0209677_10233410 230
555 3300025254 Ga0209148_1000445 Ga0209148_100044532 230
556 3300025261 Ga0209233_1003431 Ga0209233_10034312 230
557 3300025261 Ga0209233_1004607 Ga0209233_10046073 230
558 3300025272 Ga0209455_1006613 Ga0209455_10066132 230
559 3300025272 Ga0209455_1015439 Ga0209455_10154392 230
560 3300025295 Ga0209564_1002690 Ga0209564_100269013 230
561 3300025297 Ga0209758_1000416 Ga0209758_100041645 230
562 3300025297 Ga0209758_1001659 Ga0209758_100165916 230
563 3300025297 Ga0209758_1002229 Ga0209758_10022295 230
564 3300025299 Ga0209256_1025154 Ga0209256_10251542 230
565 3300025302 Ga0207426_1000522 Ga0207426_100052214 230
566 3300025302 Ga0207426_1000635 Ga0207426_100063516 230
567 3300025304 Ga0209257_1016037 Ga0209257_10160372 230
568 3300025315 Ga0207697_10011055 Ga0207697_100110555 230
569 3300025315 Ga0207697_10022021 Ga0207697_100220213 230
570 3300025315 Ga0207697_10145631 Ga0207697_101456312 230
571 3300025315 Ga0207697_10258194 Ga0207697_102581941 230
572 3300025321 Ga0207656_10018876 Ga0207656_100188762 230
573 3300025321 Ga0207656_10144100 Ga0207656_101441001 230
574 3300025321 Ga0207656_10167179 Ga0207656_101671792 230
575 3300025885 Ga0207653_10048082 Ga0207653_100480822 230
576 3300025898 Ga0207692_10042604 Ga0207692_100426042 230
577 3300025898 Ga0207692_10121292 Ga0207692_101212922 230
578 3300025899 Ga0207642_10108021 Ga0207642_101080212 230
579 3300025900 Ga0207710_10158479 Ga0207710_101584791 230
580 3300025900 Ga0207710_10191171 Ga0207710_101911712 230
581 3300025901 Ga0207688_10038785 Ga0207688_100387852 230
582 3300025901 Ga0207688_10089512 Ga0207688_100895123 230
583 3300025901 Ga0207688_10097786 Ga0207688_100977862 230
584 3300025901 Ga0207688_10108116 Ga0207688_101081163 230
585 3300025903 Ga0207680_10063467 Ga0207680_100634672 230
586 3300025903 Ga0207680_10322521 Ga0207680_103225212 230
587 3300025904 Ga0207647_10007936 Ga0207647_100079363 230
588 3300025904 Ga0207647_10062745 Ga0207647_100627452 230
589 3300025905 Ga0207685_10005077 Ga0207685_100050771 230
590 3300025905 Ga0207685_10169337 Ga0207685_101693372 230
591 3300025906 Ga0207699_10013659 Ga0207699_100136592 230
592 3300025906 Ga0207699_10030108 Ga0207699_100301082 230
593 3300025906 Ga0207699_10036479 Ga0207699_100364792 230
594 3300025906 Ga0207699_10061933 Ga0207699_100619333 230
595 3300025906 Ga0207699_10172976 Ga0207699_101729762 230
596 3300025906 Ga0207699_10239781 Ga0207699_102397812 230
597 3300025906 Ga0207699_10275754 Ga0207699_102757541 230
598 3300025907 Ga0207645_10048662 Ga0207645_100486623 230
599 3300025908 Ga0207643_10013766 Ga0207643_100137663 230
600 3300025910 Ga0207684_10131984 Ga0207684_101319842 230
601 3300025911 Ga0207654_10067524 Ga0207654_100675242 230
602 3300025911 Ga0207654_10395843 Ga0207654_103958431 230
603 3300025911 Ga0207654_10675868 Ga0207654_106758681 230
604 3300025912 Ga0207707_10001623 Ga0207707_100016237 230
605 3300025912 Ga0207707_10013110 Ga0207707_100131102 230
606 3300025912 Ga0207707_10234210 Ga0207707_102342102 230
607 3300025912 Ga0207707_10395906 Ga0207707_103959062 230
608 3300025913 Ga0207695_10000556 Ga0207695_100005564 230
609 3300025913 Ga0207695_10168585 Ga0207695_101685852 230
610 3300025913 Ga0207695_10183258 Ga0207695_101832582 230
611 3300025914 Ga0207671_10006897 Ga0207671_100068973 230
612 3300025914 Ga0207671_10052332 Ga0207671_100523323 230
613 3300025914 Ga0207671_10085930 Ga0207671_100859303 230
614 3300025914 Ga0207671_10089640 Ga0207671_100896402 230
615 3300025914 Ga0207671_10097689 Ga0207671_100976892 230
616 3300025914 Ga0207671_10129438 Ga0207671_101294382 230
617 3300025914 Ga0207671_10242304 Ga0207671_102423041 230
618 3300025915 Ga0207693_10004012 Ga0207693_100040128 230
619 3300025915 Ga0207693_10017812 Ga0207693_100178122 230
620 3300025915 Ga0207693_10047086 Ga0207693_100470863 230
621 3300025915 Ga0207693_10127744 Ga0207693_101277442 230
622 3300025915 Ga0207693_10219735 Ga0207693_102197352 230
623 3300025916 Ga0207663_10001611 Ga0207663_100016115 230
624 3300025916 Ga0207663_10008168 Ga0207663_100081687 230
625 3300025916 Ga0207663_10060409 Ga0207663_100604092 230
626 3300025916 Ga0207663_10100050 Ga0207663_101000501 230
627 3300025916 Ga0207663_10177756 Ga0207663_101777561 230
628 3300025916 Ga0207663_10577732 Ga0207663_105777322 230
629 3300025917 Ga0207660_10008313 Ga0207660_100083136 230
630 3300025917 Ga0207660_10023476 Ga0207660_100234764 230
631 3300025917 Ga0207660_10116612 Ga0207660_101166122 230
632 3300025917 Ga0207660_10136318 Ga0207660_101363182 230
633 3300025918 Ga0207662_10100917 Ga0207662_101009172 230
634 3300025919 Ga0207657_10138500 Ga0207657_101385002 230
635 3300025919 Ga0207657_10230224 Ga0207657_102302242 230
636 3300025919 Ga0207657_10394683 Ga0207657_103946832 230
637 3300025920 Ga0207649_10045148 Ga0207649_100451482 230
638 3300025920 Ga0207649_10280923 Ga0207649_102809231 230
639 3300025921 Ga0207652_10011502 Ga0207652_100115025 230
640 3300025921 Ga0207652_10097988 Ga0207652_100979882 230
641 3300025921 Ga0207652_10341074 Ga0207652_103410742 230
642 3300025922 Ga0207646_10091867 Ga0207646_100918675 230
643 3300025922 Ga0207646_10309416 Ga0207646_103094162 230
644 3300025923 Ga0207681_10071847 Ga0207681_100718472 230
645 3300025923 Ga0207681_10224236 Ga0207681_102242362 230
646 3300025923 Ga0207681_10250995 Ga0207681_102509952 230
647 3300025924 Ga0207694_10013820 Ga0207694_100138205 230
648 3300025924 Ga0207694_10015762 Ga0207694_100157624 230
649 3300025924 Ga0207694_10078197 Ga0207694_100781972 230
650 3300025924 Ga0207694_10277613 Ga0207694_102776132 230
651 3300025925 Ga0207650_10318937 Ga0207650_103189372 230
652 3300025925 Ga0207650_10445953 Ga0207650_104459532 230
653 3300025926 Ga0207659_10039497 Ga0207659_100394972 230
654 3300025926 Ga0207659_10253817 Ga0207659_102538172 230
655 3300025926 Ga0207659_10588391 Ga0207659_105883912 230
656 3300025927 Ga0207687_10035089 Ga0207687_100350892 230
657 3300025928 Ga0207700_10027300 Ga0207700_100273003 230
658 3300025928 Ga0207700_10027577 Ga0207700_100275772 230
659 3300025928 Ga0207700_10123698 Ga0207700_101236982 230
660 3300025928 Ga0207700_10127200 Ga0207700_101272002 230
661 3300025928 Ga0207700_10163962 Ga0207700_101639622 230
662 3300025928 Ga0207700_10262290 Ga0207700_102622902 230
663 3300025928 Ga0207700_10415297 Ga0207700_104152972 230
664 3300025928 Ga0207700_10788026 Ga0207700_107880261 230
665 3300025929 Ga0207664_10028753 Ga0207664_100287535 230
666 3300025929 Ga0207664_10064321 Ga0207664_100643212 230
667 3300025929 Ga0207664_10065652 Ga0207664_100656523 230
668 3300025929 Ga0207664_10123572 Ga0207664_101235722 230
669 3300025929 Ga0207664_11013763 Ga0207664_110137631 230
670 3300025931 Ga0207644_10008270 Ga0207644_100082701 230
671 3300025931 Ga0207644_10035155 Ga0207644_100351552 230
672 3300025931 Ga0207644_10059574 Ga0207644_100595742 230
673 3300025931 Ga0207644_10251120 Ga0207644_102511202 230
674 3300025931 Ga0207644_10390309 Ga0207644_103903092 230
675 3300025932 Ga0207690_10077162 Ga0207690_100771622 230
676 3300025932 Ga0207690_10144926 Ga0207690_101449262 230
677 3300025932 Ga0207690_10310400 Ga0207690_103104001 230
678 3300025933 Ga0207706_10046302 Ga0207706_100463022 230
679 3300025933 Ga0207706_10108737 Ga0207706_101087372 230
680 3300025934 Ga0207686_10099011 Ga0207686_100990112 230
681 3300025934 Ga0207686_10782012 Ga0207686_107820121 230
682 3300025935 Ga0207709_10006210 Ga0207709_100062104 230
683 3300025935 Ga0207709_10149217 Ga0207709_101492172 230
684 3300025935 Ga0207709_10627923 Ga0207709_106279232 230
685 3300025937 Ga0207669_10524787 Ga0207669_105247872 230
686 3300025937 Ga0207669_10612833 Ga0207669_106128331 230
687 3300025939 Ga0207665_10000118 Ga0207665_100001188 230
688 3300025939 Ga0207665_10115210 Ga0207665_101152101 230
689 3300025939 Ga0207665_10246970 Ga0207665_102469701 230
690 3300025941 Ga0207711_10267230 Ga0207711_102672302 230
691 3300025941 Ga0207711_10332009 Ga0207711_103320092 230
692 3300025942 Ga0207689_10148571 Ga0207689_101485713 230
693 3300025942 Ga0207689_10342501 Ga0207689_103425013 230
694 3300025942 Ga0207689_10354879 Ga0207689_103548792 230
695 3300025942 Ga0207689_10777627 Ga0207689_107776271 230
696 3300025944 Ga0207661_10080282 Ga0207661_100802822 230
697 3300025944 Ga0207661_10133615 Ga0207661_101336152 230
698 3300025944 Ga0207661_10492371 Ga0207661_104923711 230
699 3300025945 Ga0207679_10208979 Ga0207679_102089791 230
700 3300025945 Ga0207679_10251597 Ga0207679_102515972 230
701 3300025945 Ga0207679_10933851 Ga0207679_109338511 230
702 3300025949 Ga0207667_10018061 Ga0207667_100180614 230
703 3300025949 Ga0207667_10070915 Ga0207667_100709153 230
704 3300025949 Ga0207667_10163362 Ga0207667_101633622 230
705 3300025960 Ga0207651_10070768 Ga0207651_100707682 230
706 3300025960 Ga0207651_10316482 Ga0207651_103164822 230
707 3300025961 Ga0207712_10072290 Ga0207712_100722902 230
708 3300025961 Ga0207712_10117940 Ga0207712_101179402 230
709 3300025972 Ga0207668_10094229 Ga0207668_100942293 230
710 3300025972 Ga0207668_10102485 Ga0207668_101024853 230
711 3300025972 Ga0207668_10160645 Ga0207668_101606452 230
712 3300025972 Ga0207668_10858211 Ga0207668_108582111 230
713 3300025981 Ga0207640_10180999 Ga0207640_101809992 230
714 3300025981 Ga0207640_10187154 Ga0207640_101871542 230
715 3300025981 Ga0207640_10231433 Ga0207640_102314332 230
716 3300025981 Ga0207640_10412429 Ga0207640_104124292 230
717 3300025986 Ga0207658_10299258 Ga0207658_102992582 230
718 3300025986 Ga0207658_10405198 Ga0207658_104051982 230
719 3300025986 Ga0207658_11006160 Ga0207658_110061601 230
720 3300026023 Ga0207677_10098985 Ga0207677_100989852 230
721 3300026023 Ga0207677_10100641 Ga0207677_101006413 230
722 3300026023 Ga0207677_10250178 Ga0207677_102501782 230
723 3300026035 Ga0207703_10090586 Ga0207703_100905863 230
724 3300026035 Ga0207703_10240779 Ga0207703_102407792 230
725 3300026035 Ga0207703_10258803 Ga0207703_102588032 230
726 3300026035 Ga0207703_10327001 Ga0207703_103270012 230
727 3300026035 Ga0207703_10668106 Ga0207703_106681061 230
728 3300026041 Ga0207639_10100675 Ga0207639_101006752 230
729 3300026041 Ga0207639_10145973 Ga0207639_101459732 230
730 3300026041 Ga0207639_10156045 Ga0207639_101560452 230
731 3300026041 Ga0207639_10200532 Ga0207639_102005321 230
732 3300026041 Ga0207639_10553307 Ga0207639_105533072 230
733 3300026067 Ga0207678_10025337 Ga0207678_100253372 230
734 3300026067 Ga0207678_10086267 Ga0207678_100862673 230
735 3300026067 Ga0207678_10105567 Ga0207678_101055672 230
736 3300026067 Ga0207678_10146128 Ga0207678_101461282 230
737 3300026067 Ga0207678_10791325 Ga0207678_107913251 230
738 3300026078 Ga0207702_10000433 Ga0207702_1000043335 230
739 3300026078 Ga0207702_10254452 Ga0207702_102544522 230
740 3300026078 Ga0207702_10306964 Ga0207702_103069642 230
741 3300026078 Ga0207702_10339239 Ga0207702_103392392 230
742 3300026078 Ga0207702_10413527 Ga0207702_104135271 230
743 3300026078 Ga0207702_10651599 Ga0207702_106515992 230
744 3300026088 Ga0207641_10124839 Ga0207641_101248392 230
745 3300026088 Ga0207641_10193761 Ga0207641_101937612 230
746 3300026088 Ga0207641_10459978 Ga0207641_104599781 230
747 3300026089 Ga0207648_10062751 Ga0207648_100627513 230
748 3300026089 Ga0207648_10093247 Ga0207648_100932473 230
749 3300026089 Ga0207648_10145761 Ga0207648_101457612 230
750 3300026095 Ga0207676_10046093 Ga0207676_100460932 230
751 3300026095 Ga0207676_10667451 Ga0207676_106674512 230
752 3300026116 Ga0207674_10018412 Ga0207674_100184127 230
753 3300026116 Ga0207674_10039233 Ga0207674_100392332 230
754 3300026116 Ga0207674_10080810 Ga0207674_100808102 230
755 3300026118 Ga0207675_100067493 Ga0207675_1000674932 230
756 3300026118 Ga0207675_100751571 Ga0207675_1007515712 230
757 3300026121 Ga0207683_10016118 Ga0207683_100161187 230
758 3300026121 Ga0207683_10414642 Ga0207683_104146422 230
759 3300026121 Ga0207683_10546959 Ga0207683_105469592 230
760 3300026142 Ga0207698_10020154 Ga0207698_100201545 230
761 3300026142 Ga0207698_10198208 Ga0207698_101982082 230
762 3300026142 Ga0207698_10632148 Ga0207698_106321482 230
763 3300026142 Ga0207698_10649773 Ga0207698_106497731 230
764 3300027296 Ga0209389_1000045 Ga0209389_100004584 230
765 3300027296 Ga0209389_1007855 Ga0209389_10078552 230
766 3300027357 Ga0209589_1000007 Ga0209589_1000007252 230
767 3300027357 Ga0209589_1015051 Ga0209589_10150518 230
768 3300027361 Ga0209489_100008 Ga0209489_100008252 230
769 3300027361 Ga0209489_100110 Ga0209489_10011031 230
770 3300027361 Ga0209489_100210 Ga0209489_10021062 230
771 3300027363 Ga0209700_100009 Ga0209700_100009252 230
772 3300027363 Ga0209700_100116 Ga0209700_10011678 230
773 3300027671 Ga0209588_1028759 Ga0209588_10287591 230
774 3300027671 Ga0209588_1103687 Ga0209588_11036872 230
775 3300027671 Ga0209588_1116886 Ga0209588_11168862 230
776 3300027866 Ga0209813_10131905 Ga0209813_101319052 230
777 3300027907 Ga0207428_10000295 Ga0207428_1000029532 230
778 3300028379 Ga0268266_10003838 Ga0268266_1000383814 230
779 3300028379 Ga0268266_10112403 Ga0268266_101124031 230
780 3300028379 Ga0268266_10153142 Ga0268266_101531422 230
781 3300028379 Ga0268266_10186589 Ga0268266_101865892 230
782 3300028379 Ga0268266_10455183 Ga0268266_104551833 230
783 3300028380 Ga0268265_10049446 Ga0268265_100494463 230
784 3300028380 Ga0268265_10111402 Ga0268265_101114021 230
785 3300028381 Ga0268264_11146859 Ga0268264_111468592 230
786 3300028794 Ga0307515_10184213 Ga0307515_101842133 230
787 3300030521 Ga0307511_10117520 Ga0307511_101175201 230
788 3300031235 Ga0265330_10033581 Ga0265330_100335812 230
789 3300031238 Ga0265332_10035187 Ga0265332_100351872 230
790 3300031239 Ga0265328_10044790 Ga0265328_100447901 230
791 3300031241 Ga0265325_10019092 Ga0265325_100190923 230
792 3300031249 Ga0265339_10051134 Ga0265339_100511342 230
793 3300031344 Ga0265316_10124590 Ga0265316_101245901 230
794 3300031507 Ga0307509_10066285 Ga0307509_100662852 230
795 3300031507 Ga0307509_10615399 Ga0307509_106153991 230
796 3300031616 Ga0307508_10000003 Ga0307508_10000003140 230
797 3300031616 Ga0307508_10097397 Ga0307508_100973972 230
798 3300031711 Ga0265314_10049278 Ga0265314_100492783 230
799 3300031730 Ga0307516_10118428 Ga0307516_101184282 230
800 3300031730 Ga0307516_10199295 Ga0307516_101992952 230
801 3300032002 Ga0307416_100060615 Ga0307416_1000606151 230
802 3300033179 Ga0307507_10029922 Ga0307507_100299223 230
803 3300033179 Ga0307507_10166501 Ga0307507_101665011 230
804 3300033179 Ga0307507_10347247 Ga0307507_103472471 230
805 3300033180 Ga0307510_10009102 Ga0307510_100091023 230
806 3300034818 Ga0373950_0034781 Ga0373950_0034781_32_724 230
807 3300035083 Ga0373926_0078204 Ga0373926_0078204_72_764 230
808 3300035083 Ga0373926_0079398 Ga0373926_0079398_300_1007 230
809 3300035086 Ga0373934_0013009 Ga0373934_0013009_2225_2917 230
810 3300035089 Ga0373944_0006425 Ga0373944_0006425_148_840 230
811 3300035111 Ga0373923_0011095 Ga0373923_0011095_2570_3262 230
812 3300035111 Ga0373923_0044805 Ga0373923_0044805_24_716 230
813 3300035113 Ga0373936_0059173 Ga0373936_0059173_280_972 230
814 3300035113 Ga0373936_0062841 Ga0373936_0062841_117_809 230
815 3300035116 Ga0373945_0010383 Ga0373945_0010383_2359_3051 230
816 3300035116 Ga0373945_0028844 Ga0373945_0028844_909_1601 230
817 3300035116 Ga0373945_0119881 Ga0373945_0119881_320_1012 230
818 3300035117 Ga0373953_0010610 Ga0373953_0010610_2238_2930 230
819 3300035117 Ga0373953_0123108 Ga0373953_0123108_221_913 230
820 3300035118 Ga0373954_0019925 Ga0373954_0019925_1403_2095 230
821 3300035119 Ga0373956_0001075 Ga0373956_0001075_8852_9544 230
822 3300035119 Ga0373956_0179268 Ga0373956_0179268_25_717 230
823 3300035119 Ga0373956_0209632 Ga0373956_0209632_113_805 230
824 3300035120 Ga0373957_0016737 Ga0373957_0016737_1315_2007 230
825 3300035120 Ga0373957_0068045 Ga0373957_0068045_639_1334 230
826 3300035170 Ga0373943_0011760 Ga0373943_0011760_963_1655 230
827 3300035170 Ga0373943_0021033 Ga0373943_0021033_1677_2369 230
828 3300035170 Ga0373943_0027693 Ga0373943_0027693_622_1314 230
829 3300035170 Ga0373943_0074801 Ga0373943_0074801_865_1557 230
830 3300035170 Ga0373943_0124772 Ga0373943_0124772_46_747 230
831 3300035171 Ga0373946_0003017 Ga0373946_0003017_4522_5214 230
832 3300035171 Ga0373946_0089578 Ga0373946_0089578_613_1305 230
833 3300035172 Ga0373955_0019530 Ga0373955_0019530_1765_2457 230
834 3300035172 Ga0373955_0021727 Ga0373955_0021727_137_829 230
835 3300035172 Ga0373955_0042339 Ga0373955_0042339_314_1009 230
836 3300035172 Ga0373955_0059346 Ga0373955_0059346_1176_1868 230
837 3300035410 Ga0373924_0007622 Ga0373924_0007622_2129_2821 230
838 3300035410 Ga0373924_0068729 Ga0373924_0068729_324_1016 230
839 3300035410 Ga0373924_0130804 Ga0373924_0130804_70_765 230
840 3300035691 Ga0373931_0529061 Ga0373931_0529061_44_736 230
841 3300035692 Ga0373935_0002155 Ga0373935_0002155_2421_3113 230
842 3300035692 Ga0373935_0051480 Ga0373935_0051480_1719_2411 230
843 3300035692 Ga0373935_0074297 Ga0373935_0074297_452_1144 230
844 3300035695 Ga0373927_0001542 Ga0373927_0001542_8935_9627 230
845 3300035695 Ga0373927_0010229 Ga0373927_0010229_5243_5935 230
846 3300035695 Ga0373927_0015090 Ga0373927_0015090_4099_4791 230
847 3300035695 Ga0373927_0023988 Ga0373927_0023988_1546_2253 230
848 3300035695 Ga0373927_0041572 Ga0373927_0041572_1566_2258 230
849 3300035695 Ga0373927_0057537 Ga0373927_0057537_281_982 230
850 3300035724 Ga0373933_0000241 Ga0373933_0000241_20483_21238 230
851 3300035724 Ga0373933_0010931 Ga0373933_0010931_3896_4588 230
852 3300035724 Ga0373933_0256190 Ga0373933_0256190_424_1116 230
853 3300035724 Ga0373933_0402874 Ga0373933_0402874_21_716 230
854 3300035725 Ga0373947_0006228 Ga0373947_0006228_4686_5378 230
855 3300035725 Ga0373947_0011801 Ga0373947_0011801_1541_2233 230
856 3300035725 Ga0373947_0134660 Ga0373947_0134660_455_1222 230
857 3300035725 Ga0373947_0178964 Ga0373947_0178964_632_1324 230
858 3300036401 Ga0373937_0048039 Ga0373937_0048039_1998_2693 230
859 3300036401 Ga0373937_0054473 Ga0373937_0054473_2879_3571 230
860 3300036401 Ga0373937_0090572 Ga0373937_0090572_469_1161 230
861 3300036401 Ga0373937_0126219 Ga0373937_0126219_1044_1736 230
862 3300036401 Ga0373937_0595328 Ga0373937_0595328_206_898 230
863 3300036459 Ga0372808_015971 Ga0372808_015971_69_761 230
864 3300037068 Ga0373925_0003576 Ga0373925_0003576_2930_3622 230
865 3300037068 Ga0373925_0036563 Ga0373925_0036563_1159_1851 230
866 3300037068 Ga0373925_0039425 Ga0373925_0039425_469_1161 230
867 3300037068 Ga0373925_0062921 Ga0373925_0062921_333_1028 230
868 3300037068 Ga0373925_0085992 Ga0373925_0085992_1467_2174 230
869 3300037068 Ga0373925_0160610 Ga0373925_0160610_418_1119 230
870 3300037068 Ga0373925_0227968 Ga0373925_0227968_302_994 230
871 3300037068 Ga0373925_0320136 Ga0373925_0320136_439_1131 230
872 3300037068 Ga0373925_0330956 Ga0373925_0330956_176_868 230
873 3300037312 Ga0395899_0026158 Ga0395899_0026158_3530_4222 230
874 3300037418 Ga0395900_0001570 Ga0395900_0001570_6234_6926 230
875 3300037418 Ga0395900_0019206 Ga0395900_0019206_5841_6533 230
876 3300037418 Ga0395900_0036457 Ga0395900_0036457_1887_2582 230
877 3300037418 Ga0395900_0051963 Ga0395900_0051963_1934_2629 230
878 3300037418 Ga0395900_0077860 Ga0395900_0077860_383_1078 230
879 3300037418 Ga0395900_0102714 Ga0395900_0102714_747_1439 230
880 3300037466 Ga0395898_0006693 Ga0395898_0006693_1555_2250 230
881 3300037466 Ga0395898_0009563 Ga0395898_0009563_5928_6620 230
882 3300037466 Ga0395898_0031476 Ga0395898_0031476_3778_4470 230
883 3300037466 Ga0395898_0061763 Ga0395898_0061763_2326_3021 230
884 3300037466 Ga0395898_0071539 Ga0395898_0071539_2236_2931 230
885 3300037471 Ga0395905_0000548 Ga0395905_0000548_26245_26937 230
886 3300037853 Ga0436364_0407668 Ga0436364_0407668_121_813 230
887 3300037853 Ga0436364_0790824 Ga0436364_0790824_5158_5850 230
888 3300037853 Ga0436364_0836945 Ga0436364_0836945_203_901 230
889 3300038443 Ga0395901_0029002 Ga0395901_0029002_2882_3577 230
890 3300038443 Ga0395901_0033560 Ga0395901_0033560_663_1355 230
891 3300038443 Ga0395901_0053412 Ga0395901_0053412_3049_3741 230
892 3300038443 Ga0395901_0107854 Ga0395901_0107854_674_1369 230
893 3300038443 Ga0395901_0132133 Ga0395901_0132133_1794_2489 230
894 3300038443 Ga0395901_0269779 Ga0395901_0269779_944_1639 230
895 3300038443 Ga0395901_0634116 Ga0395901_0634116_351_1043 230
896 3300039437 Ga0436365_0182658 Ga0436365_0182658_913_1605 230
897 3300039437 Ga0436365_0196266 Ga0436365_0196266_3170_3862 230
898 3300039438 Ga0436360_0825284 Ga0436360_0825284_45_737 230
899 3300039438 Ga0436360_1192895 Ga0436360_1192895_852_1544 230
900 3300039447 Ga0436361_0284130 Ga0436361_0284130_1609_2307 230
901 3300039447 Ga0436361_1062074 Ga0436361_1062074_952_1644 230
902 3300039453 Ga0436362_0999686 Ga0436362_0999686_41_733 230
903 3300041443 Ga0451789_1145104 Ga0451789_1145104_860_1552 230
904 3300041456 Ga0451795_1424660 Ga0451795_1424660_723_1415 230
905 3300044658 Ga0466972_0000988 Ga0466972_0000988_3790_4482 230
906 3300044658 Ga0466972_0012012 Ga0466972_0012012_897_1589 230
907 3300044658 Ga0466972_0101932 Ga0466972_0101932_290_982 230
908 3300044683 Ga0466965_0012855 Ga0466965_0012855_379_1071 230
909 3300044684 Ga0466966_0000149 Ga0466966_0000149_8190_8882 230
910 3300044684 Ga0466966_0472036 Ga0466966_0472036_19_711 230
911 3300044693 Ga0466961_0000066 Ga0466961_0000066_16049_16741 230
912 3300044694 Ga0466963_0104016 Ga0466963_0104016_434_1126 230
913 3300044901 Ga0466960_0027844 Ga0466960_0027844_1031_1723 230
914 3300045049 Ga0466959_0178359 Ga0466959_0178359_560_1252 230
915 3300045976 Ga0466967_0022427 Ga0466967_0022427_2342_3034 230
916 3300045976 Ga0466967_0178758 Ga0466967_0178758_1014_1706 230
917 3300045976 Ga0466967_0259726 Ga0466967_0259726_215_907 230
918 3300046454 Ga0495592_0011023 Ga0495592_0011023_1835_2527 230
919 3300046454 Ga0495592_0011821 Ga0495592_0011821_4187_4879 230
920 3300046454 Ga0495592_0026415 Ga0495592_0026415_1932_2624 230
921 3300046454 Ga0495592_0139922 Ga0495592_0139922_620_1315 230
922 3300046454 Ga0495592_0185533 Ga0495592_0185533_164_856 230
923 3300046454 Ga0495592_0419534 Ga0495592_0419534_81_773 230
924 3300046455 Ga0495603_0003118 Ga0495603_0003118_8364_9056 230
925 3300046455 Ga0495603_0021697 Ga0495603_0021697_1624_2316 230
926 3300046455 Ga0495603_0066329 Ga0495603_0066329_1389_2081 230
927 3300046455 Ga0495603_0101618 Ga0495603_0101618_723_1415 230
928 3300046455 Ga0495603_0116366 Ga0495603_0116366_267_959 230
929 3300046457 Ga0495590_0022134 Ga0495590_0022134_229_921 230
930 3300046459 Ga0495629_0003275 Ga0495629_0003275_3211_3903 230
931 3300046459 Ga0495629_0015956 Ga0495629_0015956_1398_2090 230
932 3300046460 Ga0495638_0024997 Ga0495638_0024997_2564_3256 230
933 3300046460 Ga0495638_0043746 Ga0495638_0043746_1975_2667 230
934 3300046461 Ga0495641_0030001 Ga0495641_0030001_1479_2171 230
935 3300046461 Ga0495641_0115030 Ga0495641_0115030_276_968 230
936 3300046462 Ga0495651_0009884 Ga0495651_0009884_2130_2822 230
937 3300046462 Ga0495651_0069342 Ga0495651_0069342_144_836 230
938 3300046462 Ga0495651_0120258 Ga0495651_0120258_392_1087 230
939 3300046462 Ga0495651_0141575 Ga0495651_0141575_794_1486 230
940 3300046462 Ga0495651_0146547 Ga0495651_0146547_306_998 230
941 3300046463 Ga0495653_0081247 Ga0495653_0081247_1292_1984 230
942 3300046463 Ga0495653_0107023 Ga0495653_0107023_614_1306 230
943 3300046463 Ga0495653_0128000 Ga0495653_0128000_717_1409 230
944 3300046471 Ga0495650_0056371 Ga0495650_0056371_806_1498 230
945 3300046473 Ga0495582_0123691 Ga0495582_0123691_581_1273 230
946 3300046473 Ga0495582_0243960 Ga0495582_0243960_277_969 230
947 3300046474 Ga0495605_0044033 Ga0495605_0044033_329_1021 230
948 3300046474 Ga0495605_0153098 Ga0495605_0153098_68_760 230
949 3300046475 Ga0495639_0009158 Ga0495639_0009158_1768_2460 230
950 3300046475 Ga0495639_0090184 Ga0495639_0090184_140_832 230
951 3300046476 Ga0495662_0037136 Ga0495662_0037136_887_1579 230
952 3300046476 Ga0495662_0073671 Ga0495662_0073671_916_1608 230
953 3300046477 Ga0495664_0007535 Ga0495664_0007535_3821_4513 230
954 3300046477 Ga0495664_0081407 Ga0495664_0081407_1112_1804 230
955 3300046477 Ga0495664_0133228 Ga0495664_0133228_198_890 230
956 3300046477 Ga0495664_0191422 Ga0495664_0191422_423_1115 230
957 3300046491 Ga0495584_0162170 Ga0495584_0162170_410_1102 230
958 3300046499 Ga0495594_0004206 Ga0495594_0004206_2752_3444 230
959 3300046499 Ga0495594_0119977 Ga0495594_0119977_169_861 230
960 3300046499 Ga0495594_0152941 Ga0495594_0152941_529_1221 230
961 3300046500 Ga0495596_0044448 Ga0495596_0044448_447_1139 230
962 3300046501 Ga0495607_0149788 Ga0495607_0149788_458_1150 230
963 3300046506 Ga0495583_0117909 Ga0495583_0117909_255_947 230
964 3300046507 Ga0495606_0093566 Ga0495606_0093566_432_1124 230
965 3300046507 Ga0495606_0188367 Ga0495606_0188367_92_784 230
966 3300046511 Ga0495608_0000834 Ga0495608_0000834_18579_19271 230
967 3300046511 Ga0495608_0046938 Ga0495608_0046938_100_792 230
968 3300046511 Ga0495608_0200560 Ga0495608_0200560_470_1162 230
969 3300046511 Ga0495608_0393314 Ga0495608_0393314_96_788 230
970 3300046512 Ga0495610_0006739 Ga0495610_0006739_1677_2369 230
971 3300046513 Ga0495616_0059110 Ga0495616_0059110_652_1344 230
972 3300046513 Ga0495616_0120140 Ga0495616_0120140_162_854 230
973 3300046514 Ga0495618_0002623 Ga0495618_0002623_6177_6869 230
974 3300046514 Ga0495618_0012212 Ga0495618_0012212_1191_1883 230
975 3300046514 Ga0495618_0126488 Ga0495618_0126488_429_1121 230
976 3300046514 Ga0495618_0279622 Ga0495618_0279622_55_876 230
977 3300046515 Ga0495620_0033910 Ga0495620_0033910_35_727 230
978 3300046515 Ga0495620_0061313 Ga0495620_0061313_486_1178 230
979 3300046516 Ga0495628_0182029 Ga0495628_0182029_543_1235 230
980 3300046516 Ga0495628_0294553 Ga0495628_0294553_86_778 230
981 3300046517 Ga0495630_0522472 Ga0495630_0522472_98_790 230
982 3300046518 Ga0495631_0039962 Ga0495631_0039962_681_1373 230
983 3300046518 Ga0495631_0117957 Ga0495631_0117957_438_1130 230
984 3300046519 Ga0495632_0132573 Ga0495632_0132573_317_1009 230
985 3300046522 Ga0495643_0152293 Ga0495643_0152293_395_1087 230
986 3300046523 Ga0495644_0050848 Ga0495644_0050848_187_879 230
987 3300046524 Ga0495648_0040124 Ga0495648_0040124_767_1459 230
988 3300046524 Ga0495648_0060916 Ga0495648_0060916_1059_1751 230
989 3300046524 Ga0495648_0063008 Ga0495648_0063008_1068_1760 230
990 3300046524 Ga0495648_0162469 Ga0495648_0162469_128_820 230
991 3300046524 Ga0495648_0205274 Ga0495648_0205274_10_702 230
992 3300046526 Ga0495666_0105487 Ga0495666_0105487_356_1048 230
993 3300046526 Ga0495666_0135147 Ga0495666_0135147_403_1095 230
994 3300046529 Ga0495652_0014781 Ga0495652_0014781_2963_3655 230
995 3300046529 Ga0495652_0024613 Ga0495652_0024613_3946_4767 230
996 3300046529 Ga0495652_0029195 Ga0495652_0029195_3757_4449 230
997 3300046529 Ga0495652_0042669 Ga0495652_0042669_775_1467 230
998 3300046529 Ga0495652_0346956 Ga0495652_0346956_156_848 230
999 3300046530 Ga0495654_0145840 Ga0495654_0145840_37_729 230
1000 3300046531 Ga0495665_0019833 Ga0495665_0019833_2230_2922 230
1001 3300046533 Ga0495640_0014776 Ga0495640_0014776_2927_3619 230
1002 3300046533 Ga0495640_0028670 Ga0495640_0028670_352_1173 230
1003 3300046533 Ga0495640_0039887 Ga0495640_0039887_1170_1862 230
1004 3300046533 Ga0495640_0049784 Ga0495640_0049784_715_1407 230
1005 3300046533 Ga0495640_0111091 Ga0495640_0111091_603_1295 230
1006 3300046533 Ga0495640_0202370 Ga0495640_0202370_65_766 230
1007 3300046536 Ga0495587_0001442 Ga0495587_0001442_1734_2426 230
1008 3300046536 Ga0495587_0008806 Ga0495587_0008806_3612_4304 230
1009 3300046536 Ga0495587_0044947 Ga0495587_0044947_982_1674 230
1010 3300046536 Ga0495587_0171281 Ga0495587_0171281_399_1091 230
1011 3300046537 Ga0495598_0024400 Ga0495598_0024400_455_1147 230
1012 3300046538 Ga0495609_0117339 Ga0495609_0117339_410_1102 230
1013 3300046538 Ga0495609_0142803 Ga0495609_0142803_56_748 230
1014 3300046539 Ga0495621_0015676 Ga0495621_0015676_374_1066 230
1015 3300046539 Ga0495621_0020445 Ga0495621_0020445_833_1525 230
1016 3300046543 Ga0495645_0013005 Ga0495645_0013005_3754_4446 230
1017 3300046543 Ga0495645_0019288 Ga0495645_0019288_2337_3029 230
1018 3300046543 Ga0495645_0054563 Ga0495645_0054563_932_1624 230
1019 3300046557 Ga0495622_0011919 Ga0495622_0011919_1988_2680 230
1020 3300046557 Ga0495622_0037987 Ga0495622_0037987_57_749 230
1021 3300046557 Ga0495622_0110421 Ga0495622_0110421_194_886 230
1022 3300046558 Ga0495633_0042222 Ga0495633_0042222_550_1242 230
1023 3300046558 Ga0495633_0137429 Ga0495633_0137429_319_1011 230
1024 3300046559 Ga0495667_0052777 Ga0495667_0052777_1007_1699 230
1025 3300046559 Ga0495667_0055568 Ga0495667_0055568_492_1184 230
1026 3300046559 Ga0495667_0057663 Ga0495667_0057663_1300_1992 230
1027 3300046559 Ga0495667_0089410 Ga0495667_0089410_406_1098 230
1028 3300046559 Ga0495667_0089835 Ga0495667_0089835_454_1275 230
1029 3300046615 Ga0495656_0008710 Ga0495656_0008710_2474_3166 230
1030 3300046642 Ga0495634_0012455 Ga0495634_0012455_2923_3615 230
1031 3300046642 Ga0495634_0031432 Ga0495634_0031432_1699_2391 230
1032 3300046642 Ga0495634_0032939 Ga0495634_0032939_2144_2836 230
1033 3300046648 Ga0495611_0064846 Ga0495611_0064846_453_1145 230
1034 3300046648 Ga0495611_0074037 Ga0495611_0074037_272_964 230
1035 3300046660 Ga0495625_0140117 Ga0495625_0140117_470_1162 230
1036 3300046660 Ga0495625_0387311 Ga0495625_0387311_166_858 230
1037 3300046663 Ga0495635_0002510 Ga0495635_0002510_9809_10501 230
1038 3300046663 Ga0495635_0060745 Ga0495635_0060745_588_1280 230
1039 3300046663 Ga0495635_0184521 Ga0495635_0184521_227_922 230
1040 3300046663 Ga0495635_0216131 Ga0495635_0216131_572_1264 230
1041 3300046664 Ga0495659_0050529 Ga0495659_0050529_118_810 230
1042 3300046664 Ga0495659_0086916 Ga0495659_0086916_350_1042 230
1043 3300046665 Ga0495661_0170104 Ga0495661_0170104_152_844 230
1044 3300046665 Ga0495661_0235018 Ga0495661_0235018_225_917 230
1045 3300046674 Ga0495588_0004485 Ga0495588_0004485_5240_5932 230
1046 3300046674 Ga0495588_0012719 Ga0495588_0012719_2464_3156 230
1047 3300046674 Ga0495588_0046193 Ga0495588_0046193_715_1407 230
1048 3300046674 Ga0495588_0125812 Ga0495588_0125812_430_1122 230
1049 3300046674 Ga0495588_0324924 Ga0495588_0324924_25_717 230
1050 3300046675 Ga0495657_0005817 Ga0495657_0005817_7964_8656 230
1051 3300046675 Ga0495657_0007621 Ga0495657_0007621_2434_3255 230
1052 3300046675 Ga0495657_0033077 Ga0495657_0033077_1449_2141 230
1053 3300046675 Ga0495657_0095799 Ga0495657_0095799_930_1625 230
1054 3300046675 Ga0495657_0167731 Ga0495657_0167731_595_1287 230
1055 3300046678 Ga0495599_0000991 Ga0495599_0000991_9366_10058 230
1056 3300046678 Ga0495599_0104526 Ga0495599_0104526_668_1360 230
1057 3300046678 Ga0495599_0148784 Ga0495599_0148784_137_829 230
1058 3300046678 Ga0495599_0220903 Ga0495599_0220903_168_860 230
1059 3300046678 Ga0495599_0291087 Ga0495599_0291087_266_958 230
1060 3300046680 Ga0495646_0010983 Ga0495646_0010983_2132_2824 230
1061 3300046680 Ga0495646_0038251 Ga0495646_0038251_331_1023 230
1062 3300046680 Ga0495646_0063449 Ga0495646_0063449_784_1476 230
1063 3300046680 Ga0495646_0065199 Ga0495646_0065199_1300_1992 230
1064 3300046680 Ga0495646_0070361 Ga0495646_0070361_560_1252 230
1065 3300046683 Ga0495658_0018240 Ga0495658_0018240_2856_3548 230
1066 3300046683 Ga0495658_0328464 Ga0495658_0328464_48_740 230
1067 3300046683 Ga0495658_0443144 Ga0495658_0443144_39_731 230
1068 3300046684 Ga0495669_0006054 Ga0495669_0006054_1185_1877 230
1069 3300046684 Ga0495669_0101934 Ga0495669_0101934_149_841 230
1070 3300046689 Ga0495613_0012888 Ga0495613_0012888_538_1359 230
1071 3300046689 Ga0495613_0021728 Ga0495613_0021728_2904_3596 230
1072 3300046689 Ga0495613_0029885 Ga0495613_0029885_100_792 230
1073 3300046689 Ga0495613_0093305 Ga0495613_0093305_753_1445 230
1074 3300046690 Ga0495624_0036474 Ga0495624_0036474_1051_1743 230
1075 3300046690 Ga0495624_0157979 Ga0495624_0157979_433_1140 230
1076 3300046690 Ga0495624_0306406 Ga0495624_0306406_120_821 230
1077 3300046691 Ga0495670_0041892 Ga0495670_0041892_22_714 230
1078 3300046691 Ga0495670_0069166 Ga0495670_0069166_451_1143 230
1079 3300046691 Ga0495670_0099272 Ga0495670_0099272_199_891 230
1080 3300046692 Ga0495671_0044831 Ga0495671_0044831_943_1635 230
1081 3300046694 Ga0495649_0114674 Ga0495649_0114674_132_824 230
1082 3300046794 Ga0495589_0089041 Ga0495589_0089041_623_1315 230
1083 3300046794 Ga0495589_0117156 Ga0495589_0117156_518_1210 230
1084 3300046794 Ga0495589_0241245 Ga0495589_0241245_42_734 230
1085 3300046809 Ga0495600_0004571 Ga0495600_0004571_2866_3558 230
1086 3300046809 Ga0495600_0112401 Ga0495600_0112401_500_1321 230
1087 3300046809 Ga0495600_0189415 Ga0495600_0189415_371_1063 230
1088 3300046809 Ga0495600_0260613 Ga0495600_0260613_337_1032 230
1089 3300046809 Ga0495600_0487843 Ga0495600_0487843_34_726 230
1090 3300046810 Ga0495660_0134341 Ga0495660_0134341_435_1127 230
1091 3300047315 Ga0495581_0003566 Ga0495581_0003566_4974_5666 230
1092 3300047315 Ga0495581_0085424 Ga0495581_0085424_892_1584 230
1093 3300047315 Ga0495581_0086276 Ga0495581_0086276_46_738 230
1094 3300047315 Ga0495581_0166509 Ga0495581_0166509_233_925 230
1095 3300047315 Ga0495581_0243725 Ga0495581_0243725_306_998 230
1096 3300047315 Ga0495581_0271070 Ga0495581_0271070_81_902 230
1097 3300047315 Ga0495581_0281241 Ga0495581_0281241_71_763 230
1098 3300047315 Ga0495581_0397774 Ga0495581_0397774_69_776 230
1099 3300047317 Ga0495604_0005577 Ga0495604_0005577_6082_6774 230
1100 3300047317 Ga0495604_0019727 Ga0495604_0019727_283_1104 230
1101 3300047317 Ga0495604_0033071 Ga0495604_0033071_2375_3070 230
1102 3300047317 Ga0495604_0042380 Ga0495604_0042380_2479_3171 230
1103 3300047317 Ga0495604_0052858 Ga0495604_0052858_745_1437 230
1104 3300047318 Ga0495636_0026413 Ga0495636_0026413_896_1588 230
1105 3300047319 Ga0495674_0014033 Ga0495674_0014033_2103_2795 230
1106 3300047319 Ga0495674_0052274 Ga0495674_0052274_1834_2526 230
1107 3300047319 Ga0495674_0080136 Ga0495674_0080136_996_1688 230
1108 3300047319 Ga0495674_0363273 Ga0495674_0363273_216_908 230
1109 3300047319 Ga0495674_0484793 Ga0495674_0484793_149_844 230
1110 3300047319 Ga0495674_0493459 Ga0495674_0493459_100_792 230
1111 3300047320 Ga0495672_0053019 Ga0495672_0053019_78_770 230
1112 3300047321 Ga0495676_0001737 Ga0495676_0001737_8364_9056 230
1113 3300047321 Ga0495676_0102848 Ga0495676_0102848_1357_2049 230
1114 3300047321 Ga0495676_0116231 Ga0495676_0116231_915_1607 230
1115 3300047321 Ga0495676_0122925 Ga0495676_0122925_203_895 230
1116 3300047321 Ga0495676_0197098 Ga0495676_0197098_35_727 230
1117 3300047322 Ga0495680_0037719 Ga0495680_0037719_537_1232 230
1118 3300047322 Ga0495680_0045668 Ga0495680_0045668_620_1312 230
1119 3300047322 Ga0495680_0045938 Ga0495680_0045938_746_1438 230
1120 3300047323 Ga0495683_0073119 Ga0495683_0073119_813_1505 230
1121 3300047443 Ga0495687_006285 Ga0495687_006285_1963_2655 230
1122 3300047444 Ga0495675_0038437 Ga0495675_0038437_1922_2614 230
1123 3300047444 Ga0495675_0103049 Ga0495675_0103049_448_1140 230
1124 3300047444 Ga0495675_0121302 Ga0495675_0121302_593_1288 230
1125 3300047444 Ga0495675_0139174 Ga0495675_0139174_76_768 230
1126 3300047447 Ga0495685_068598 Ga0495685_068598_417_1109 230
1127 3300047469 Ga0495673_0054823 Ga0495673_0054823_412_1104 230
1128 3300047469 Ga0495673_0090093 Ga0495673_0090093_261_1007 230
1129 3300047471 Ga0495684_0015155 Ga0495684_0015155_3118_3810 230
1130 3300047471 Ga0495684_0059053 Ga0495684_0059053_222_914 230
1131 3300047471 Ga0495684_0102686 Ga0495684_0102686_829_1521 230
1132 3300047471 Ga0495684_0236170 Ga0495684_0236170_398_1099 230
1133 3300047472 Ga0495686_0199964 Ga0495686_0199964_351_1043 230
1134 3300047673 Ga0495593_0017756 Ga0495593_0017756_1277_1969 230
1135 3300047673 Ga0495593_0150653 Ga0495593_0150653_282_1103 230
1136 3300048088 Ga0495602_0024576 Ga0495602_0024576_846_1538 230
1137 3300048088 Ga0495602_0026581 Ga0495602_0026581_4170_4862 230
1138 3300048088 Ga0495602_0101196 Ga0495602_0101196_951_1646 230
1139 3300048088 Ga0495602_0134471 Ga0495602_0134471_26_718 230
1140 3300048088 Ga0495602_0167640 Ga0495602_0167640_833_1561 230
1141 3300048088 Ga0495602_0460604 Ga0495602_0460604_150_842 230
1142 3300048091 Ga0495626_0151877 Ga0495626_0151877_264_956 230
1143 3300048903 Ga0496100_0108826 Ga0496100_0108826_989_1681 230
1144 3300048903 Ga0496100_0117362 Ga0496100_0117362_350_1042 230
1145 3300048903 Ga0496100_0121789 Ga0496100_0121789_669_1361 230
1146 3300048903 Ga0496100_0130864 Ga0496100_0130864_113_805 230
1147 3300048903 Ga0496100_0165765 Ga0496100_0165765_185_877 230
1148 3300048903 Ga0496100_0235512 Ga0496100_0235512_148_876 230
1149 3300048903 Ga0496100_0331630 Ga0496100_0331630_389_1081 230
1150 3300048904 Ga0496101_0003782 Ga0496101_0003782_4896_5588 230
1151 3300048904 Ga0496101_0033757 Ga0496101_0033757_1462_2154 230
1152 3300048904 Ga0496101_0044088 Ga0496101_0044088_1465_2157 230
1153 3300048904 Ga0496101_0070190 Ga0496101_0070190_1793_2485 230
1154 3300048904 Ga0496101_0126355 Ga0496101_0126355_335_1027 230
1155 3300048905 Ga0496102_0025556 Ga0496102_0025556_1090_1782 230
1156 3300048905 Ga0496102_0057710 Ga0496102_0057710_270_962 230
1157 3300048905 Ga0496102_0067796 Ga0496102_0067796_1184_1876 230
1158 3300048905 Ga0496102_0141715 Ga0496102_0141715_674_1366 230
1159 3300048905 Ga0496102_0183077 Ga0496102_0183077_379_1071 230
1160 3300048905 Ga0496102_0184885 Ga0496102_0184885_105_797 230
1161 3300048905 Ga0496102_0648413 Ga0496102_0648413_46_738 230
1162 3300048905 Ga0496102_0659042 Ga0496102_0659042_93_785 230
1163 3300048905 Ga0496102_0701058 Ga0496102_0701058_21_713 230
1164 3300048906 Ga0496103_0049485 Ga0496103_0049485_40_732 230
1165 3300048906 Ga0496103_0196409 Ga0496103_0196409_258_950 230
1166 3300048906 Ga0496103_0327499 Ga0496103_0327499_129_821 230
1167 3300048907 Ga0496104_0008069 Ga0496104_0008069_5061_5882 230
1168 3300048907 Ga0496104_0009739 Ga0496104_0009739_2028_2720 230
1169 3300048907 Ga0496104_0011099 Ga0496104_0011099_6953_7645 230
1170 3300048907 Ga0496104_0011247 Ga0496104_0011247_4520_5212 230
1171 3300048907 Ga0496104_0061017 Ga0496104_0061017_2674_3366 230
1172 3300048907 Ga0496104_0070610 Ga0496104_0070610_688_1380 230
1173 3300048907 Ga0496104_0087161 Ga0496104_0087161_834_1526 230
1174 3300048907 Ga0496104_0117781 Ga0496104_0117781_1438_2130 230
1175 3300048907 Ga0496104_0143961 Ga0496104_0143961_397_1089 230
1176 3300048907 Ga0496104_0253095 Ga0496104_0253095_763_1491 230
1177 3300048907 Ga0496104_0294924 Ga0496104_0294924_151_849 230
1178 3300048907 Ga0496104_0374708 Ga0496104_0374708_132_824 230
1179 3300048908 Ga0496105_0001065 Ga0496105_0001065_7199_8020 230
1180 3300048908 Ga0496105_0001708 Ga0496105_0001708_393_1085 230
1181 3300048908 Ga0496105_0029404 Ga0496105_0029404_3026_3718 230
1182 3300048908 Ga0496105_0031695 Ga0496105_0031695_1615_2307 230
1183 3300048908 Ga0496105_0054157 Ga0496105_0054157_787_1479 230
1184 3300048908 Ga0496105_0092136 Ga0496105_0092136_1136_1828 230
1185 3300048908 Ga0496105_0094691 Ga0496105_0094691_715_1407 230
1186 3300048908 Ga0496105_0108474 Ga0496105_0108474_130_951 230
1187 3300048908 Ga0496105_0133400 Ga0496105_0133400_950_1642 230
1188 3300048908 Ga0496105_0198024 Ga0496105_0198024_590_1282 230
1189 3300048909 Ga0496106_0002611 Ga0496106_0002611_1498_2190 230
1190 3300048909 Ga0496106_0040583 Ga0496106_0040583_975_1667 230
1191 3300048909 Ga0496106_0135424 Ga0496106_0135424_821_1513 230
1192 3300048909 Ga0496106_0138461 Ga0496106_0138461_55_747 230
1193 3300048910 Ga0496107_0020603 Ga0496107_0020603_1699_2391 230
1194 3300048910 Ga0496107_0034039 Ga0496107_0034039_1484_2176 230
1195 3300048910 Ga0496107_0038762 Ga0496107_0038762_2404_3096 230
1196 3300048910 Ga0496107_0053987 Ga0496107_0053987_871_1563 230
1197 3300048910 Ga0496107_0221377 Ga0496107_0221377_10_702 230
1198 3300048910 Ga0496107_0283467 Ga0496107_0283467_484_1176 230
1199 3300048911 Ga0496108_0017610 Ga0496108_0017610_4969_5661 230
1200 3300048911 Ga0496108_0018579 Ga0496108_0018579_2508_3200 230
1201 3300048911 Ga0496108_0055047 Ga0496108_0055047_1485_2177 230
1202 3300048911 Ga0496108_0057622 Ga0496108_0057622_1603_2295 230
1203 3300048911 Ga0496108_0095651 Ga0496108_0095651_866_1558 230
1204 3300048911 Ga0496108_0143737 Ga0496108_0143737_486_1178 230
1205 3300048911 Ga0496108_0167823 Ga0496108_0167823_897_1718 230
1206 3300048911 Ga0496108_0244187 Ga0496108_0244187_792_1484 230
1207 3300048912 Ga0496109_0001152 Ga0496109_0001152_2742_3434 230
1208 3300048912 Ga0496109_0003675 Ga0496109_0003675_5911_6603 230
1209 3300048912 Ga0496109_0052743 Ga0496109_0052743_2697_3389 230
1210 3300048912 Ga0496109_0103705 Ga0496109_0103705_268_960 230
1211 3300048912 Ga0496109_0115523 Ga0496109_0115523_1081_1773 230
1212 3300048912 Ga0496109_0144495 Ga0496109_0144495_1095_1793 230
1213 3300048912 Ga0496109_0145098 Ga0496109_0145098_143_835 230
1214 3300048912 Ga0496109_0268704 Ga0496109_0268704_882_1574 230
1215 3300048912 Ga0496109_0317386 Ga0496109_0317386_545_1237 230
1216 3300048913 Ga0496110_0023309 Ga0496110_0023309_3995_4687 230
1217 3300048913 Ga0496110_0038897 Ga0496110_0038897_1659_2351 230
1218 3300048913 Ga0496110_0044214 Ga0496110_0044214_2246_2938 230
1219 3300048913 Ga0496110_0046121 Ga0496110_0046121_1234_1926 230
1220 3300048913 Ga0496110_0068797 Ga0496110_0068797_486_1178 230
1221 3300048913 Ga0496110_0148874 Ga0496110_0148874_961_1653 230
1222 3300048913 Ga0496110_0270405 Ga0496110_0270405_85_777 230
1223 3300048913 Ga0496110_0599628 Ga0496110_0599628_275_973 230
1224 3300048914 Ga0496111_0000825 Ga0496111_0000825_1404_2096 230
1225 3300048914 Ga0496111_0066704 Ga0496111_0066704_1495_2193 230
1226 3300048914 Ga0496111_0191382 Ga0496111_0191382_40_732 230
1227 3300048914 Ga0496111_0354787 Ga0496111_0354787_293_985 230
1228 3300048914 Ga0496111_0417201 Ga0496111_0417201_178_870 230
1229 3300048915 Ga0496112_0000051 Ga0496112_0000051_44730_45422 230
1230 3300048915 Ga0496112_0003123 Ga0496112_0003123_526_1218 230
1231 3300048915 Ga0496112_0008384 Ga0496112_0008384_746_1438 230
1232 3300048915 Ga0496112_0023197 Ga0496112_0023197_1284_1976 230
1233 3300048915 Ga0496112_0026067 Ga0496112_0026067_1117_1809 230
1234 3300048915 Ga0496112_0115446 Ga0496112_0115446_405_1097 230
1235 3300048915 Ga0496112_0205523 Ga0496112_0205523_520_1212 230
1236 3300048915 Ga0496112_0253569 Ga0496112_0253569_478_1176 230
1237 3300048915 Ga0496112_0443208 Ga0496112_0443208_205_951 230
1238 3300048916 Ga0496113_0001092 Ga0496113_0001092_1527_2219 230
1239 3300048916 Ga0496113_0013878 Ga0496113_0013878_3586_4407 230
1240 3300048916 Ga0496113_0021246 Ga0496113_0021246_3704_4396 230
1241 3300048916 Ga0496113_0033118 Ga0496113_0033118_1476_2168 230
1242 3300048916 Ga0496113_0056314 Ga0496113_0056314_1461_2153 230
1243 3300048916 Ga0496113_0288571 Ga0496113_0288571_238_930 230
1244 3300048916 Ga0496113_0550036 Ga0496113_0550036_81_809 230
1245 3300048917 Ga0496114_0144165 Ga0496114_0144165_944_1636 230
1246 3300048917 Ga0496114_0269358 Ga0496114_0269358_527_1219 230
1247 3300048917 Ga0496114_0286413 Ga0496114_0286413_531_1223 230
1248 3300048917 Ga0496114_0350983 Ga0496114_0350983_454_1146 230
1249 3300048917 Ga0496114_0493039 Ga0496114_0493039_242_934 230
1250 3300048917 Ga0496114_0751220 Ga0496114_0751220_93_785 230
1251 3300048918 Ga0496115_0000756 Ga0496115_0000756_9194_9886 230
1252 3300048918 Ga0496115_0012216 Ga0496115_0012216_1206_1898 230
1253 3300048918 Ga0496115_0042668 Ga0496115_0042668_1174_1866 230
1254 3300048918 Ga0496115_0045211 Ga0496115_0045211_725_1417 230
1255 3300048918 Ga0496115_0051742 Ga0496115_0051742_2554_3246 230
1256 3300048918 Ga0496115_0067152 Ga0496115_0067152_1959_2651 230
1257 3300048918 Ga0496115_0123786 Ga0496115_0123786_14_706 230
1258 3300048918 Ga0496115_0139324 Ga0496115_0139324_139_831 230
1259 3300048918 Ga0496115_0164954 Ga0496115_0164954_756_1448 230
1260 3300048918 Ga0496115_0633515 Ga0496115_0633515_115_807 230
1261 3300048920 Ga0496117_0055157 Ga0496117_0055157_1589_2281 230
1262 3300048921 Ga0496118_0028998 Ga0496118_0028998_163_855 230
1263 3300048921 Ga0496118_0052015 Ga0496118_0052015_487_1179 230
1264 3300048921 Ga0496118_0063877 Ga0496118_0063877_1336_2028 230
1265 3300048921 Ga0496118_0075120 Ga0496118_0075120_402_1094 230
1266 3300048921 Ga0496118_0137394 Ga0496118_0137394_23_715 230
1267 3300048922 Ga0496119_0000244 Ga0496119_0000244_18785_19477 230
1268 3300048922 Ga0496119_0030425 Ga0496119_0030425_2220_3041 230
1269 3300048922 Ga0496119_0098587 Ga0496119_0098587_485_1177 230
1270 3300048922 Ga0496119_0112556 Ga0496119_0112556_87_779 230
1271 3300048922 Ga0496119_0140492 Ga0496119_0140492_489_1181 230
1272 3300048923 Ga0496120_0017615 Ga0496120_0017615_3920_4612 230
1273 3300048923 Ga0496120_0068451 Ga0496120_0068451_741_1433 230
1274 3300048923 Ga0496120_0152270 Ga0496120_0152270_45_737 230
1275 3300048924 Ga0496121_0012808 Ga0496121_0012808_271_963 230
1276 3300048924 Ga0496121_0034272 Ga0496121_0034272_2423_3115 230
1277 3300048924 Ga0496121_0083676 Ga0496121_0083676_1246_1938 230
1278 3300048924 Ga0496121_0121734 Ga0496121_0121734_895_1716 230
1279 3300048924 Ga0496121_0179659 Ga0496121_0179659_744_1436 230
1280 3300048924 Ga0496121_0194438 Ga0496121_0194438_84_776 230
1281 3300048925 Ga0496122_0090902 Ga0496122_0090902_869_1561 230
1282 3300048925 Ga0496122_0122085 Ga0496122_0122085_267_1088 230
1283 3300048927 Ga0496124_0238165 Ga0496124_0238165_24_740 230
1284 3300048928 Ga0496125_0038146 Ga0496125_0038146_2726_3418 230
1285 3300048928 Ga0496125_0056583 Ga0496125_0056583_628_1449 230
1286 3300048928 Ga0496125_0137245 Ga0496125_0137245_388_1080 230
1287 3300048928 Ga0496125_0165859 Ga0496125_0165859_386_1078 230
1288 3300048928 Ga0496125_0228582 Ga0496125_0228582_110_802 230
1289 3300048929 Ga0496126_0010948 Ga0496126_0010948_4638_5330 230
1290 3300048929 Ga0496126_0057775 Ga0496126_0057775_1754_2575 230
1291 3300048929 Ga0496126_0071900 Ga0496126_0071900_1774_2466 230
1292 3300048929 Ga0496126_0074009 Ga0496126_0074009_30_722 230
1293 3300048929 Ga0496126_0085689 Ga0496126_0085689_1992_2684 230
1294 3300048929 Ga0496126_0101174 Ga0496126_0101174_1320_2012 230
1295 3300048929 Ga0496126_0171954 Ga0496126_0171954_1058_1750 230
1296 3300049460 Ga0495682_0089170 Ga0495682_0089170_252_944 230
1297 3300049583 Ga0501067_0044541 Ga0501067_0044541_1500_2192 230
1298 3300050489 nmdc:mga03683_16041_c1 nmdc:mga03683_16041_c1_453_1145 230
1299 3300050489 nmdc:mga03683_163998_c1 nmdc:mga03683_163998_c1_68_760 230
1300 3300050489 nmdc:mga03683_90692_c1 nmdc:mga03683_90692_c1_533_1225 230
1301 3300050490 nmdc:mga03n38_22967_c1 nmdc:mga03n38_22967_c1_1756_2448 230
1302 3300050490 nmdc:mga03n38_27353_c1 nmdc:mga03n38_27353_c1_666_1358 230
1303 3300050491 nmdc:mga00v17_181806_c1 nmdc:mga00v17_181806_c1_312_1004 230
1304 3300050491 nmdc:mga00v17_230907_c1 nmdc:mga00v17_230907_c1_15_707 230
1305 3300050491 nmdc:mga00v17_272812_c1 nmdc:mga00v17_272812_c1_370_1062 230
1306 3300050492 nmdc:mga0yw44_106694_c1 nmdc:mga0yw44_106694_c1_185_877 230
1307 3300050492 nmdc:mga0yw44_11679_c1 nmdc:mga0yw44_11679_c1_1177_1869 230
1308 3300050492 nmdc:mga0yw44_130944_c1 nmdc:mga0yw44_130944_c1_263_955 230
1309 3300050492 nmdc:mga0yw44_13381_c2 nmdc:mga0yw44_13381_c2_238_930 230
1310 3300050492 nmdc:mga0yw44_150923_c1 nmdc:mga0yw44_150923_c1_140_832 230
1311 3300050492 nmdc:mga0yw44_311742_c1 nmdc:mga0yw44_311742_c1_169_861 230
1312 3300050493 nmdc:mga0k408_143346_c1 nmdc:mga0k408_143346_c1_249_941 230
1313 3300050493 nmdc:mga0k408_21086_c1 nmdc:mga0k408_21086_c1_1890_2582 230
1314 3300050493 nmdc:mga0k408_89303_c2 nmdc:mga0k408_89303_c2_311_1003 230
1315 3300050494 nmdc:mga06z11_115467_c1 nmdc:mga06z11_115467_c1_321_1013 230
1316 3300050494 nmdc:mga06z11_17732_c1 nmdc:mga06z11_17732_c1_1149_1841 230
1317 3300050494 nmdc:mga06z11_84253_c1 nmdc:mga06z11_84253_c1_32_724 230
1318 3300050495 nmdc:mga04h51_52137_c1 nmdc:mga04h51_52137_c1_580_1272 230
1319 3300050496 nmdc:mga07m45_121766_c1 nmdc:mga07m45_121766_c1_316_1008 230
1320 3300050496 nmdc:mga07m45_176638_c1 nmdc:mga07m45_176638_c1_418_1110 230
1321 3300050496 nmdc:mga07m45_67113_c1 nmdc:mga07m45_67113_c1_715_1407 230
1322 3300050507 nmdc:mga05p37_207007_c1 nmdc:mga05p37_207007_c1_360_1052 230
1323 3300050510 nmdc:mga06r32_68261_c1 nmdc:mga06r32_68261_c1_2580_3272 230
1324 3300050511 nmdc:mga08y16_523063_c1 nmdc:mga08y16_523063_c1_420_1112 230
1325 3300050512 nmdc:mga0n895_106524_c1 nmdc:mga0n895_106524_c1_244_936 230
1326 3300050512 nmdc:mga0n895_113926_c1 nmdc:mga0n895_113926_c1_711_1403 230
1327 3300050512 nmdc:mga0n895_18014_c1 nmdc:mga0n895_18014_c1_5100_5792 230
1328 3300050513 nmdc:mga0rr50_336857_c1 nmdc:mga0rr50_336857_c1_311_1003 230
1329 3300050513 nmdc:mga0rr50_80317_c1 nmdc:mga0rr50_80317_c1_987_1679 230
1330 3300050514 nmdc:mga08x19_37496_c1 nmdc:mga08x19_37496_c1_711_1403 230
1331 3300050515 nmdc:mga0a205_125945_c1 nmdc:mga0a205_125945_c1_273_965 230
1332 3300050515 nmdc:mga0a205_202108_c1 nmdc:mga0a205_202108_c1_230_922 230
1333 3300050516 nmdc:mga0sz30_32339_c1 nmdc:mga0sz30_32339_c1_1153_1845 230
1334 3300050516 nmdc:mga0sz30_72717_c1 nmdc:mga0sz30_72717_c1_133_825 230
1335 3300053077 Ga0495601_0001640 Ga0495601_0001640_2905_3597 230
1336 3300053077 Ga0495601_0023203 Ga0495601_0023203_2938_3630 230
1337 3300053077 Ga0495601_0023397 Ga0495601_0023397_2525_3217 230
1338 3300053077 Ga0495601_0028831 Ga0495601_0028831_617_1309 230
1339 3300053077 Ga0495601_0267970 Ga0495601_0267970_374_1066 230
1340 3300053078 Ga0495612_0019127 Ga0495612_0019127_103_795 230
1341 3300053079 Ga0500610_0028492 Ga0500610_0028492_46_738 230
1342 3300053080 Ga0500635_0008295 Ga0500635_0008295_1722_2414 230
1343 3300053083 Ga0495655_0043627 Ga0495655_0043627_83_775 230
1344 3300053084 Ga0495595_0007612 Ga0495595_0007612_1813_2505 230
1345 3300053084 Ga0495595_0027640 Ga0495595_0027640_1297_1989 230
1346 3300053084 Ga0495595_0052266 Ga0495595_0052266_665_1357 230
1347 3300053084 Ga0495595_0061725 Ga0495595_0061725_692_1384 230
1348 3300053084 Ga0495595_0178811 Ga0495595_0178811_248_943 230
1349 3300053084 Ga0495595_0221505 Ga0495595_0221505_231_923 230
1350 3300053085 Ga0495619_0008243 Ga0495619_0008243_4582_5274 230
1351 3300053085 Ga0495619_0010343 Ga0495619_0010343_2929_3621 230
1352 3300053085 Ga0495619_0012352 Ga0495619_0012352_677_1369 230
1353 3300053085 Ga0495619_0058763 Ga0495619_0058763_692_1393 230
1354 3300053085 Ga0495619_0122870 Ga0495619_0122870_439_1131 230
1355 3300053085 Ga0495619_0174754 Ga0495619_0174754_606_1298 230
1356 3300053087 Ga0500643_000013 Ga0500643_000013_76682_77374 230
1357 3300053087 Ga0500643_046243 Ga0500643_046243_249_941 230
1358 3300053091 Ga0500647_0013414 Ga0500647_0013414_1722_2414 230
1359 3300053092 Ga0500583_0063488 Ga0500583_0063488_1047_1739 230
1360 3300053093 Ga0500651_0042202 Ga0500651_0042202_1219_1911 230
1361 3300053093 Ga0500651_0192977 Ga0500651_0192977_436_1128 230
1362 3300053094 Ga0500566_0002168 Ga0500566_0002168_7456_8148 230
1363 3300053096 Ga0500641_0009257 Ga0500641_0009257_1199_1891 230
1364 3300053096 Ga0500641_0114321 Ga0500641_0114321_449_1141 230
1365 3300053098 Ga0500650_0070830 Ga0500650_0070830_713_1405 230
1366 3300053103 Ga0500555_009333 Ga0500555_009333_137_829 230
1367 3300053105 Ga0500557_000069 Ga0500557_000069_6862_7554 230
1368 3300053108 Ga0500562_009007 Ga0500562_009007_241_933 230
1369 3300053108 Ga0500562_011635 Ga0500562_011635_647_1339 230
1370 3300053111 Ga0500572_000290 Ga0500572_000290_4243_4935 230
1371 3300053119 Ga0500595_007010 Ga0500595_007010_2057_2749 230
1372 3300053128 Ga0500626_126940 Ga0500626_126940_85_777 230
1373 3300053130 Ga0500642_0000089 Ga0500642_0000089_23938_24630 230
1374 3300053131 Ga0500652_026345 Ga0500652_026345_1047_1739 230
1375 3300053133 Ga0500655_020696 Ga0500655_020696_275_967 230
1376 3300053134 Ga0500658_0090936 Ga0500658_0090936_552_1244 230
1377 3300053136 Ga0500559_0000274 Ga0500559_0000274_15210_15902 230
1378 3300053139 Ga0500568_0068050 Ga0500568_0068050_58_750 230
1379 3300053144 Ga0500585_074316 Ga0500585_074316_212_904 230
1380 3300053150 Ga0500603_029411 Ga0500603_029411_112_804 230
1381 3300053151 Ga0500604_0074264 Ga0500604_0074264_20_712 230
1382 3300053155 Ga0500620_002584 Ga0500620_002584_978_1670 230
1383 3300053156 Ga0500622_0020174 Ga0500622_0020174_2429_3121 230
1384 3300053157 Ga0500624_010469 Ga0500624_010469_153_845 230
1385 3300053158 Ga0500627_0006558 Ga0500627_0006558_542_1234 230
1386 3300053158 Ga0500627_0077332 Ga0500627_0077332_680_1372 230
1387 3300053160 Ga0500633_0103990 Ga0500633_0103990_210_902 230
1388 3300053160 Ga0500633_0113304 Ga0500633_0113304_85_777 230
1389 3300053162 Ga0500638_060912 Ga0500638_060912_482_1174 230
1390 3300053163 Ga0500639_116024 Ga0500639_116024_241_933 230
1391 3300053177 Ga0500636_0000263 Ga0500636_0000263_3441_4133 230
1392 3300053178 Ga0500637_0009969 Ga0500637_0009969_3527_4219 230
1393 3300053178 Ga0500637_0061988 Ga0500637_0061988_1069_1761 230
1394 3300053725 Ga0500576_021480 Ga0500576_021480_711_1403 230
1395 3300053727 Ga0500611_012241 Ga0500611_012241_410_1102 230
1396 3300053729 Ga0500625_033352 Ga0500625_033352_1292_1984 230
1397 3300053730 Ga0500645_027638 Ga0500645_027638_472_1164 230
1398 3300053730 Ga0500645_031956 Ga0500645_031956_606_1298 230
1399 3300053731 Ga0500609_005242 Ga0500609_005242_1001_1693 230
1400 3300053732 Ga0500656_007136 Ga0500656_007136_151_843 230
1401 3300053735 Ga0500596_004264 Ga0500596_004264_1327_2019 230
1402 3300053736 Ga0500599_002544 Ga0500599_002544_1109_1801 230
1403 3300053737 Ga0500601_000788 Ga0500601_000788_789_1481 230
1404 iso_pu_bacteria 8056689827 8056691513 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

58

168

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

201

276

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pmu-assembly1.cif.gz_C crystal structure of the dna-binding domain of phop 0.9426 130 229
5x5j-assembly1.cif.gz_A crystal structure of response regulator ader receiver domain 0.9378 6 123
2pmu-assembly1.cif.gz_C crystal structure of the dna-binding domain of phop 0.9329 130 229
8hml-assembly1.cif.gz_B co-crystal structure of the c terminal dna binding domain of saccharopolyspora erythraea glnr in complex with its conserved promoter dna in 2.95 angstrom resolution 0.9311 135 230
7cci-assembly1.cif.gz_A acinetobacter baumannii response regulator ader with disordered n terminus 0.9302 6 124
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9887 7 85 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9719 6 85 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9719 7 85 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9705 7 85 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9693 7 85 3.40.50.2300
ID Description Score Start End GO Terms
AF-X1CMB6-F1-model_v4 OmpR/PhoB-type domain-containing protein 0.9387 155 228 GO:0000160
GO:0003677
GO:0006355
AF-A0A354DKL1-F1-model_v4 DNA-binding response regulator 0.9358 6 90 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A419F6T0-F1-model_v4 Response regulator 0.9211 7 125 GO:0000160
AF-A0A6G7PXV4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9208 6 126 GO:0000155
AF-A0A2N2HFV0-F1-model_v4 Fis family transcriptional regulator 0.9207 7 126 GO:0000160
GO:0005524
GO:0006355
GO:0016887

Feature Viewer

pLDDT pTM Quality
86.83 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map