F493708
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1404 | 642 | 1215 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300025928|Ga0207700_10127200|Ga0207700_101272002 |
| Length | 280 |
| Sequence | MPDYEAPYLEIREQKSEKAQRDNELVRDREVSFRFPGLLLWFDAKIGDENVTRALRRILVIEDDAETARQIVDFLKTRGYETNLAAHGGDGLRLGESPDYAVIVIDRMLPVVDGLAIIRRLRAAGIITPALIISALGEVDDRVRGLRAGGDDYLVKPFAFAELLARIEALARRSATVVKETVLRVGDLELDLVSRTANRDGRHIKLLPREFQVLEYLVRNEGHVVPRAMLLEKVWDLHFDPSTNIIDVYVGRVRRKVDGEQAYPLIHTIRGVGFCVRAPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 16 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 19 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 20 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 21 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 22 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 23 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 24 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 25 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 26 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 32 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 33 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 34 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 35 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 36 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 37 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 41 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 44 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 45 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 48 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 49 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 50 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 51 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 52 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 56 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 57 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 58 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 59 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 60 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 61 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 62 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 63 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 64 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 65 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 66 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 67 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 68 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 69 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 70 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 71 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 72 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 73 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 74 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 75 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 76 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 77 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 78 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 79 | 2904699407 | |||
| 80 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 81 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 82 | 2906610324 | |||
| 83 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 84 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 85 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 86 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 87 | 2922368715 | |||
| 88 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 89 | 2922425934 | |||
| 90 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 91 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 92 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 93 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 94 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 95 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 96 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 97 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 98 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 99 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 100 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 101 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 102 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 103 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 104 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 105 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 106 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 107 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 108 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 109 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 110 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 111 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 112 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 113 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 114 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 115 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 116 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 117 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 118 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 119 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 120 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 121 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 122 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 123 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 124 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 125 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 126 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 127 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 128 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 129 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 130 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 131 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 132 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 133 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 134 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 135 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 136 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 137 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 138 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 139 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 140 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 141 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 142 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 143 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 144 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 145 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 146 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 147 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 148 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 149 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 150 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 151 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 152 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 153 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 154 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 155 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 156 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 157 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 158 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 159 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 160 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 161 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 162 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 163 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 164 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 165 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 166 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 168 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 169 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 171 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 173 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 174 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 182 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 185 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 192 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 196 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 197 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 199 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 201 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 203 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 204 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 210 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 211 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 213 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 214 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 215 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 217 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 218 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 219 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 220 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 221 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 222 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 223 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 224 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 225 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 226 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 227 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 228 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 229 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 230 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 232 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 233 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 234 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 235 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 236 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 237 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 238 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 239 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 240 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 241 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 242 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 243 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 245 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 246 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 247 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 248 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 249 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 250 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 251 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 252 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 254 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 255 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 256 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 257 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 258 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 259 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 260 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 273 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 288 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 289 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 290 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 291 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 292 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 293 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 294 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 295 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 296 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 301 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 368 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 369 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 370 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 371 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 374 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 378 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 379 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 380 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 381 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 382 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 383 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 384 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 385 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 386 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 387 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 388 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 389 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 390 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 391 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 392 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 393 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 394 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 395 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 396 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 397 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 398 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 399 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 400 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 401 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 402 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 403 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 404 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 405 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 406 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 407 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 408 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 409 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 410 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 411 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 412 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 413 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 414 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 415 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 416 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 417 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 418 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 419 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 420 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 421 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 422 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 423 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 424 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 425 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 426 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 427 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 428 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 429 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 430 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 431 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 432 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 433 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 434 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 435 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 520 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 521 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 522 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 523 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 524 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 525 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 526 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 527 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 528 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 529 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 530 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 531 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 532 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 533 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 534 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 535 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 536 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 537 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 538 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 539 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 540 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 541 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 542 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 543 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 544 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 547 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 548 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 549 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 550 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 551 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 552 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 553 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 554 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 559 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 560 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 561 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 562 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 565 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 566 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 570 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 571 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 572 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 573 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 574 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 575 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 576 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 577 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 578 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 579 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 580 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 581 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 582 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 583 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 584 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 585 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 586 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 587 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 588 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 589 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 590 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 591 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 592 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 593 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 594 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 595 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 596 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 597 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 598 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 599 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 600 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 601 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 602 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 603 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 604 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 605 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 606 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 607 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 608 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 609 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 610 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 611 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 612 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 613 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 614 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 615 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 616 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 617 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 618 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 619 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 620 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 621 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 622 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 623 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 624 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 625 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 626 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 627 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 628 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 629 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 630 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 631 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 632 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 633 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 634 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 635 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 636 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 637 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 638 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 639 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 640 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 641 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 642 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.5 |
| Metatranscriptomes | 0.29 |
| Isolates | 13.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.33 |
| Nodule | 11.04 |
| Rhizoplane | 8.69 |
| Rhizosphere | 64.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001020 | 3300003203 | Bacteria | 13105 |
| 2 | JGI25153J46596_10000804 | 3300003215 | Bacteria | 19173 |
| 3 | JGI25153J46596_10006566 | 3300003215 | Bacteria | 5864 |
| 4 | JGI25153J46596_10058875 | 3300003215 | Bacteria | 1054 |
| 5 | JGI25160J50197_1005212 | 3300003354 | Bacteria | 5450 |
| 6 | Ga0055539_1009970 | 3300003752 | Bacteria | 1177 |
| 7 | Ga0055526_1052374 | 3300003771 | Bacteria | 921 |
| 8 | JGI25405J52794_10036643 | 3300003911 | Bacteria | 1030 |
| 9 | Ga0055543_1006157 | 3300004625 | Bacteria | 2943 |
| 10 | Ga0065165_1000701 | 3300005262 | Bacteria | 47638 |
| 11 | Ga0065704_10215145 | 3300005289 | Unclassified | 1094 |
| 12 | Ga0065707_10098746 | 3300005295 | Unclassified | 3062 |
| 13 | Ga0070676_10097147 | 3300005328 | Bacteria | 1814 |
| 14 | Ga0070676_10121744 | 3300005328 | Bacteria | 1638 |
| 15 | Ga0070683_100017619 | 3300005329 | Bacteria | 6312 |
| 16 | Ga0070683_100025232 | 3300005329 | Bacteria | 5335 |
| 17 | Ga0070690_100230713 | 3300005330 | Bacteria | 1301 |
| 18 | Ga0070670_100239789 | 3300005331 | Bacteria | 1579 |
| 19 | Ga0068869_100074999 | 3300005334 | Bacteria | 2512 |
| 20 | Ga0068869_100123560 | 3300005334 | Bacteria | 1982 |
| 21 | Ga0070666_10045804 | 3300005335 | Bacteria | 2932 |
| 22 | Ga0070680_100010505 | 3300005336 | Bacteria | 7142 |
| 23 | Ga0070680_100052127 | 3300005336 | Bacteria | 3340 |
| 24 | Ga0070680_100079764 | 3300005336 | Bacteria | 2699 |
| 25 | Ga0070680_100117683 | 3300005336 | Bacteria | 2216 |
| 26 | Ga0070680_100224201 | 3300005336 | Bacteria | 1587 |
| 27 | Ga0068868_100111298 | 3300005338 | Bacteria | 2225 |
| 28 | Ga0068868_100272363 | 3300005338 | Bacteria | 1430 |
| 29 | Ga0068868_100459352 | 3300005338 | Bacteria | 1109 |
| 30 | Ga0070660_100036145 | 3300005339 | Bacteria | 3741 |
| 31 | Ga0070661_100093421 | 3300005344 | Bacteria | 2229 |
| 32 | Ga0070668_100073802 | 3300005347 | Bacteria | 2660 |
| 33 | Ga0070669_100084222 | 3300005353 | Bacteria | 2372 |
| 34 | Ga0070669_100286917 | 3300005353 | Bacteria | 1320 |
| 35 | Ga0070675_100228008 | 3300005354 | Unclassified | 1624 |
| 36 | Ga0070675_100703003 | 3300005354 | Bacteria | 921 |
| 37 | Ga0070671_100006252 | 3300005355 | Bacteria | 9486 |
| 38 | Ga0070671_100075956 | 3300005355 | Bacteria | 2807 |
| 39 | Ga0070671_100228249 | 3300005355 | Bacteria | 1580 |
| 40 | Ga0070673_100450375 | 3300005364 | Bacteria | 1158 |
| 41 | Ga0070688_100451454 | 3300005365 | Bacteria | 961 |
| 42 | Ga0070659_100061054 | 3300005366 | Bacteria | 2978 |
| 43 | Ga0070667_100056443 | 3300005367 | Bacteria | 3317 |
| 44 | Ga0070667_100271815 | 3300005367 | Bacteria | 1520 |
| 45 | Ga0070667_100460702 | 3300005367 | Bacteria | 1162 |
| 46 | Ga0070667_101115238 | 3300005367 | Bacteria | 738 |
| 47 | Ga0070709_10007584 | 3300005434 | Bacteria | 5956 |
| 48 | Ga0070709_10310108 | 3300005434 | Bacteria | 1155 |
| 49 | Ga0070714_100019222 | 3300005435 | Bacteria | 5561 |
| 50 | Ga0070714_100027369 | 3300005435 | Bacteria | 4721 |
| 51 | Ga0070714_100067406 | 3300005435 | Bacteria | 3085 |
| 52 | Ga0070714_100084184 | 3300005435 | Bacteria | 2775 |
| 53 | Ga0070714_100142258 | 3300005435 | Unclassified | 2154 |
| 54 | Ga0070714_100151239 | 3300005435 | Bacteria | 2092 |
| 55 | Ga0070714_100480520 | 3300005435 | Bacteria | 1183 |
| 56 | Ga0070713_100001489 | 3300005436 | Bacteria | 14921 |
| 57 | Ga0070713_100009110 | 3300005436 | Bacteria | 7080 |
| 58 | Ga0070713_100023775 | 3300005436 | Bacteria | 4762 |
| 59 | Ga0070713_100025632 | 3300005436 | Bacteria | 4613 |
| 60 | Ga0070713_100129793 | 3300005436 | Bacteria | 2221 |
| 61 | Ga0070713_100233179 | 3300005436 | Bacteria | 1674 |
| 62 | Ga0070713_100327201 | 3300005436 | Bacteria | 1417 |
| 63 | Ga0070710_10000992 | 3300005437 | Bacteria | 13504 |
| 64 | Ga0070710_10109063 | 3300005437 | Bacteria | 1660 |
| 65 | Ga0070701_10165576 | 3300005438 | Bacteria | 1284 |
| 66 | Ga0070711_100013172 | 3300005439 | Bacteria | 5187 |
| 67 | Ga0070711_100014021 | 3300005439 | Bacteria | 5043 |
| 68 | Ga0070711_100017355 | 3300005439 | Bacteria | 4582 |
| 69 | Ga0070711_100087592 | 3300005439 | Bacteria | 2236 |
| 70 | Ga0070711_100232879 | 3300005439 | Bacteria | 1437 |
| 71 | Ga0070705_100112482 | 3300005440 | Bacteria | 1742 |
| 72 | Ga0070705_100312005 | 3300005440 | Bacteria | 1132 |
| 73 | Ga0070700_100458675 | 3300005441 | Bacteria | 971 |
| 74 | Ga0070663_100014207 | 3300005455 | Bacteria | 5105 |
| 75 | Ga0070663_100024630 | 3300005455 | Bacteria | 4054 |
| 76 | Ga0070663_100048295 | 3300005455 | Bacteria | 3017 |
| 77 | Ga0070663_100088872 | 3300005455 | Bacteria | 2285 |
| 78 | Ga0070663_100208158 | 3300005455 | Bacteria | 1530 |
| 79 | Ga0070678_100337425 | 3300005456 | Bacteria | 1292 |
| 80 | Ga0070662_100140328 | 3300005457 | Bacteria | 1872 |
| 81 | Ga0070662_100327595 | 3300005457 | Bacteria | 1250 |
| 82 | Ga0070681_10039976 | 3300005458 | Bacteria | 4702 |
| 83 | Ga0070681_10088456 | 3300005458 | Bacteria | 3049 |
| 84 | Ga0070681_10099965 | 3300005458 | Bacteria | 2847 |
| 85 | Ga0070681_10409761 | 3300005458 | Bacteria | 1267 |
| 86 | Ga0070681_10418163 | 3300005458 | Bacteria | 1252 |
| 87 | Ga0068867_100247412 | 3300005459 | Bacteria | 1449 |
| 88 | Ga0070706_100115771 | 3300005467 | Bacteria | 2496 |
| 89 | Ga0070707_100202705 | 3300005468 | Bacteria | 1934 |
| 90 | Ga0070707_100317350 | 3300005468 | Bacteria | 1514 |
| 91 | Ga0070699_100009853 | 3300005518 | Bacteria | 8274 |
| 92 | Ga0070699_100206939 | 3300005518 | Bacteria | 1746 |
| 93 | Ga0070699_100208547 | 3300005518 | Bacteria | 1739 |
| 94 | Ga0070679_100005756 | 3300005530 | Bacteria | 11497 |
| 95 | Ga0070679_100015208 | 3300005530 | Bacteria | 7392 |
| 96 | Ga0070679_100137820 | 3300005530 | Bacteria | 2421 |
| 97 | Ga0070679_100150084 | 3300005530 | Bacteria | 2308 |
| 98 | Ga0070684_100150192 | 3300005535 | Bacteria | 2110 |
| 99 | Ga0070684_100161283 | 3300005535 | Bacteria | 2034 |
| 100 | Ga0070697_100006018 | 3300005536 | Bacteria | 9382 |
| 101 | Ga0068853_100165253 | 3300005539 | Bacteria | 2000 |
| 102 | Ga0068853_100188949 | 3300005539 | Bacteria | 1870 |
| 103 | Ga0068853_100218842 | 3300005539 | Bacteria | 1738 |
| 104 | Ga0068853_100602922 | 3300005539 | Bacteria | 1043 |
| 105 | Ga0070672_100198425 | 3300005543 | Bacteria | 1677 |
| 106 | Ga0070695_100411581 | 3300005545 | Bacteria | 1028 |
| 107 | Ga0070696_100056279 | 3300005546 | Bacteria | 2743 |
| 108 | Ga0070696_100658708 | 3300005546 | Bacteria | 849 |
| 109 | Ga0070693_100064920 | 3300005547 | Bacteria | 2132 |
| 110 | Ga0070693_100175691 | 3300005547 | Bacteria | 1375 |
| 111 | Ga0070665_100085403 | 3300005548 | Bacteria | 3161 |
| 112 | Ga0070665_100106310 | 3300005548 | Bacteria | 2808 |
| 113 | Ga0070665_100266993 | 3300005548 | Bacteria | 1713 |
| 114 | Ga0070665_100325219 | 3300005548 | Bacteria | 1542 |
| 115 | Ga0070665_100369316 | 3300005548 | Bacteria | 1441 |
| 116 | Ga0070665_100482234 | 3300005548 | Bacteria | 1251 |
| 117 | Ga0070665_100974957 | 3300005548 | Bacteria | 860 |
| 118 | Ga0070704_100019036 | 3300005549 | Bacteria | 4404 |
| 119 | Ga0068855_100040685 | 3300005563 | Bacteria | 5515 |
| 120 | Ga0068855_100050976 | 3300005563 | Bacteria | 4876 |
| 121 | Ga0068855_100099474 | 3300005563 | Bacteria | 3350 |
| 122 | Ga0068855_100194372 | 3300005563 | Bacteria | 2287 |
| 123 | Ga0068855_100277393 | 3300005563 | Bacteria | 1862 |
| 124 | Ga0070664_100218889 | 3300005564 | Bacteria | 1703 |
| 125 | Ga0070664_100373957 | 3300005564 | Bacteria | 1300 |
| 126 | Ga0068857_100062281 | 3300005577 | Bacteria | 3316 |
| 127 | Ga0068857_100071339 | 3300005577 | Bacteria | 3095 |
| 128 | Ga0068857_100104583 | 3300005577 | Bacteria | 2542 |
| 129 | Ga0068854_100092958 | 3300005578 | Bacteria | 2248 |
| 130 | Ga0068854_100191680 | 3300005578 | Bacteria | 1602 |
| 131 | Ga0068856_100000680 | 3300005614 | Bacteria | 36872 |
| 132 | Ga0068856_100158954 | 3300005614 | Bacteria | 2270 |
| 133 | Ga0068856_100540367 | 3300005614 | Bacteria | 1187 |
| 134 | Ga0068856_100609299 | 3300005614 | Bacteria | 1113 |
| 135 | Ga0068856_100687080 | 3300005614 | Bacteria | 1044 |
| 136 | Ga0070702_100438987 | 3300005615 | Bacteria | 944 |
| 137 | Ga0068852_100005622 | 3300005616 | Bacteria | 8992 |
| 138 | Ga0068852_100023372 | 3300005616 | Bacteria | 4975 |
| 139 | Ga0068852_100117720 | 3300005616 | Bacteria | 2427 |
| 140 | Ga0068852_100145340 | 3300005616 | Bacteria | 2199 |
| 141 | Ga0068852_100627694 | 3300005616 | Bacteria | 1080 |
| 142 | Ga0068859_100380780 | 3300005617 | Bacteria | 1506 |
| 143 | Ga0068864_100279930 | 3300005618 | Bacteria | 1556 |
| 144 | Ga0068866_10373203 | 3300005718 | Bacteria | 913 |
| 145 | Ga0068861_100345994 | 3300005719 | Bacteria | 1302 |
| 146 | Ga0068861_100436992 | 3300005719 | Bacteria | 1169 |
| 147 | Ga0068861_100473846 | 3300005719 | Bacteria | 1126 |
| 148 | Ga0068851_10003594 | 3300005834 | Bacteria | 6913 |
| 149 | Ga0068863_100092102 | 3300005841 | Bacteria | 2875 |
| 150 | Ga0068863_100930360 | 3300005841 | Bacteria | 870 |
| 151 | Ga0068858_100097039 | 3300005842 | Bacteria | 2747 |
| 152 | Ga0068858_100101774 | 3300005842 | Bacteria | 2679 |
| 153 | Ga0068858_100225054 | 3300005842 | Bacteria | 1777 |
| 154 | Ga0068858_100347456 | 3300005842 | Bacteria | 1420 |
| 155 | Ga0068858_100703364 | 3300005842 | Bacteria | 983 |
| 156 | Ga0068858_100942837 | 3300005842 | Bacteria | 845 |
| 157 | Ga0068860_100042873 | 3300005843 | Bacteria | 4318 |
| 158 | Ga0068862_100054688 | 3300005844 | Bacteria | 3417 |
| 159 | Ga0068862_100198629 | 3300005844 | Bacteria | 1807 |
| 160 | Ga0081455_10002021 | 3300005937 | Bacteria | 24257 |
| 161 | Ga0081455_10005151 | 3300005937 | Bacteria | 14395 |
| 162 | Ga0081455_10026629 | 3300005937 | Bacteria | 5312 |
| 163 | Ga0081455_10123567 | 3300005937 | Bacteria | 2036 |
| 164 | Ga0081455_10198877 | 3300005937 | Bacteria | 1502 |
| 165 | Ga0081538_10059078 | 3300005981 | Bacteria | 2218 |
| 166 | Ga0081540_1002468 | 3300005983 | Bacteria | 15067 |
| 167 | Ga0081540_1005678 | 3300005983 | Bacteria | 9273 |
| 168 | Ga0081540_1021213 | 3300005983 | Bacteria | 3879 |
| 169 | Ga0081540_1038858 | 3300005983 | Bacteria | 2502 |
| 170 | Ga0081540_1048004 | 3300005983 | Bacteria | 2142 |
| 171 | Ga0081540_1063911 | 3300005983 | Bacteria | 1739 |
| 172 | Ga0081540_1115275 | 3300005983 | Bacteria | 1126 |
| 173 | Ga0081539_10000486 | 3300005985 | Bacteria | 84009 |
| 174 | Ga0081539_10050525 | 3300005985 | Bacteria | 2352 |
| 175 | Ga0081539_10214037 | 3300005985 | Bacteria | 881 |
| 176 | Ga0070717_10000990 | 3300006028 | Bacteria | 19039 |
| 177 | Ga0070717_10051191 | 3300006028 | Bacteria | 3398 |
| 178 | Ga0070717_10131446 | 3300006028 | Bacteria | 2153 |
| 179 | Ga0070717_10147553 | 3300006028 | Bacteria | 2033 |
| 180 | Ga0070717_10269953 | 3300006028 | Bacteria | 1507 |
| 181 | Ga0070717_10292913 | 3300006028 | Bacteria | 1445 |
| 182 | Ga0075365_10004620 | 3300006038 | Bacteria | 7326 |
| 183 | Ga0075365_10006567 | 3300006038 | Bacteria | 6414 |
| 184 | Ga0075365_10070651 | 3300006038 | Bacteria | 2349 |
| 185 | Ga0075365_10086976 | 3300006038 | Bacteria | 2124 |
| 186 | Ga0075368_10010675 | 3300006042 | Bacteria | 3325 |
| 187 | Ga0075368_10021010 | 3300006042 | Bacteria | 2476 |
| 188 | Ga0075363_100011493 | 3300006048 | Bacteria | 4241 |
| 189 | Ga0075363_100028373 | 3300006048 | Bacteria | 2878 |
| 190 | Ga0075364_10007860 | 3300006051 | Bacteria | 6348 |
| 191 | Ga0075364_10009406 | 3300006051 | Bacteria | 5863 |
| 192 | Ga0075364_10076927 | 3300006051 | Bacteria | 2203 |
| 193 | Ga0070715_10004151 | 3300006163 | Bacteria | 4713 |
| 194 | Ga0070716_100009679 | 3300006173 | Bacteria | 4809 |
| 195 | Ga0070716_100230086 | 3300006173 | Bacteria | 1251 |
| 196 | Ga0070716_100244920 | 3300006173 | Bacteria | 1218 |
| 197 | Ga0070712_100117627 | 3300006175 | Unclassified | 1995 |
| 198 | Ga0070712_100146036 | 3300006175 | Bacteria | 1810 |
| 199 | Ga0070712_100220599 | 3300006175 | Bacteria | 1501 |
| 200 | Ga0070712_100436219 | 3300006175 | Bacteria | 1088 |
| 201 | Ga0075362_10007954 | 3300006177 | Bacteria | 4037 |
| 202 | Ga0075362_10051963 | 3300006177 | Bacteria | 1835 |
| 203 | Ga0075367_10018244 | 3300006178 | Bacteria | 3868 |
| 204 | Ga0075367_10026441 | 3300006178 | Bacteria | 3292 |
| 205 | Ga0075369_10040871 | 3300006186 | Bacteria | 1983 |
| 206 | Ga0075427_10000325 | 3300006194 | Bacteria | 5220 |
| 207 | Ga0075366_10185936 | 3300006195 | Bacteria | 1262 |
| 208 | Ga0097621_100232981 | 3300006237 | Bacteria | 1608 |
| 209 | Ga0068871_100037598 | 3300006358 | Bacteria | 3861 |
| 210 | Ga0068871_101094563 | 3300006358 | Bacteria | 745 |
| 211 | Ga0075428_100010666 | 3300006844 | Bacteria | 10214 |
| 212 | Ga0075428_100221751 | 3300006844 | Bacteria | 2042 |
| 213 | Ga0075428_100357100 | 3300006844 | Bacteria | 1568 |
| 214 | Ga0075430_100007887 | 3300006846 | Bacteria | 9002 |
| 215 | Ga0075430_100066957 | 3300006846 | Bacteria | 3016 |
| 216 | Ga0075430_100280650 | 3300006846 | Bacteria | 1378 |
| 217 | Ga0075431_100031468 | 3300006847 | Bacteria | 5465 |
| 218 | Ga0075433_10004925 | 3300006852 | Bacteria | 10453 |
| 219 | Ga0075433_10168068 | 3300006852 | Bacteria | 1952 |
| 220 | Ga0075434_100000317 | 3300006871 | Bacteria | 34482 |
| 221 | Ga0075434_100143535 | 3300006871 | Bacteria | 2408 |
| 222 | Ga0075434_100330941 | 3300006871 | Bacteria | 1544 |
| 223 | Ga0075434_100855394 | 3300006871 | Bacteria | 925 |
| 224 | Ga0075429_100006024 | 3300006880 | Bacteria | 10483 |
| 225 | Ga0068865_100253947 | 3300006881 | Bacteria | 1389 |
| 226 | Ga0068865_100266361 | 3300006881 | Bacteria | 1359 |
| 227 | Ga0097620_100144495 | 3300006931 | Bacteria | 2453 |
| 228 | Ga0097620_100380781 | 3300006931 | Bacteria | 1506 |
| 229 | Ga0097620_100764399 | 3300006931 | Bacteria | 1055 |
| 230 | Ga0099825_1025113 | 3300006941 | Bacteria | 3369 |
| 231 | Ga0099824_1010060 | 3300006942 | Bacteria | 11362 |
| 232 | Ga0099824_1022821 | 3300006942 | Bacteria | 4028 |
| 233 | Ga0099822_1001406 | 3300006943 | Bacteria | 27885 |
| 234 | Ga0099822_1050681 | 3300006943 | Bacteria | 1731 |
| 235 | Ga0099823_1014974 | 3300006944 | Bacteria | 7726 |
| 236 | Ga0075435_100005165 | 3300007076 | Bacteria | 9079 |
| 237 | Ga0075435_100057684 | 3300007076 | Unclassified | 3142 |
| 238 | Ga0075435_100214632 | 3300007076 | Bacteria | 1633 |
| 239 | Ga0075435_100231297 | 3300007076 | Bacteria | 1571 |
| 240 | Ga0099794_10122002 | 3300007265 | Bacteria | 1312 |
| 241 | Ga0099795_10024254 | 3300007788 | Bacteria | 2021 |
| 242 | Ga0099795_10120540 | 3300007788 | Bacteria | 1048 |
| 243 | Ga0105250_10019495 | 3300009092 | Bacteria | 2742 |
| 244 | Ga0105240_10017091 | 3300009093 | Bacteria | 9795 |
| 245 | Ga0105240_10029263 | 3300009093 | Bacteria | 7181 |
| 246 | Ga0105240_10048975 | 3300009093 | Bacteria | 5337 |
| 247 | Ga0105240_10102247 | 3300009093 | Bacteria | 3483 |
| 248 | Ga0105240_10199456 | 3300009093 | Bacteria | 2346 |
| 249 | Ga0105245_10007957 | 3300009098 | Bacteria | 9269 |
| 250 | Ga0105245_10236299 | 3300009098 | Bacteria | 1770 |
| 251 | Ga0105247_10054061 | 3300009101 | Bacteria | 2478 |
| 252 | Ga0105247_10055478 | 3300009101 | Bacteria | 2445 |
| 253 | Ga0105247_10062179 | 3300009101 | Bacteria | 2316 |
| 254 | Ga0105247_10071416 | 3300009101 | Bacteria | 2171 |
| 255 | Ga0105247_10292702 | 3300009101 | Bacteria | 1127 |
| 256 | Ga0114129_10047472 | 3300009147 | Bacteria | 6032 |
| 257 | Ga0105243_10081554 | 3300009148 | Bacteria | 2642 |
| 258 | Ga0105243_10528849 | 3300009148 | Bacteria | 1123 |
| 259 | Ga0105241_10076137 | 3300009174 | Bacteria | 2616 |
| 260 | Ga0105241_10165398 | 3300009174 | Bacteria | 1822 |
| 261 | Ga0105241_10308604 | 3300009174 | Bacteria | 1360 |
| 262 | Ga0105241_10339451 | 3300009174 | Bacteria | 1301 |
| 263 | Ga0105242_10121232 | 3300009176 | Bacteria | 2244 |
| 264 | Ga0105242_10381639 | 3300009176 | Bacteria | 1310 |
| 265 | Ga0105248_10227877 | 3300009177 | Bacteria | 2098 |
| 266 | Ga0105248_10452006 | 3300009177 | Bacteria | 1448 |
| 267 | Ga0105248_10742915 | 3300009177 | Bacteria | 1107 |
| 268 | Ga0105237_10027872 | 3300009545 | Bacteria | 5756 |
| 269 | Ga0105237_10040140 | 3300009545 | Bacteria | 4721 |
| 270 | Ga0105237_10070663 | 3300009545 | Bacteria | 3487 |
| 271 | Ga0105237_10111579 | 3300009545 | Bacteria | 2727 |
| 272 | Ga0105237_10129113 | 3300009545 | Bacteria | 2522 |
| 273 | Ga0105237_10143818 | 3300009545 | Bacteria | 2379 |
| 274 | Ga0105237_10218484 | 3300009545 | Bacteria | 1906 |
| 275 | Ga0105237_10584563 | 3300009545 | Bacteria | 1124 |
| 276 | Ga0105237_10594467 | 3300009545 | Bacteria | 1113 |
| 277 | Ga0105238_10013865 | 3300009551 | Bacteria | 8149 |
| 278 | Ga0105238_10020769 | 3300009551 | Bacteria | 6688 |
| 279 | Ga0105238_10037253 | 3300009551 | Bacteria | 4946 |
| 280 | Ga0105238_10093120 | 3300009551 | Bacteria | 3001 |
| 281 | Ga0105238_10104769 | 3300009551 | Bacteria | 2809 |
| 282 | Ga0105249_10496004 | 3300009553 | Bacteria | 1266 |
| 283 | Ga0099796_10019339 | 3300010159 | Bacteria | 2063 |
| 284 | Ga0099796_10048339 | 3300010159 | Bacteria | 1466 |
| 285 | Ga0099796_10055490 | 3300010159 | Bacteria | 1388 |
| 286 | Ga0099796_10071488 | 3300010159 | Bacteria | 1254 |
| 287 | Ga0105239_10013166 | 3300010375 | Bacteria | 9190 |
| 288 | Ga0105239_10045820 | 3300010375 | Bacteria | 4792 |
| 289 | Ga0105239_10055145 | 3300010375 | Bacteria | 4359 |
| 290 | Ga0105239_10061464 | 3300010375 | Bacteria | 4123 |
| 291 | Ga0105239_10091513 | 3300010375 | Bacteria | 3356 |
| 292 | Ga0105239_10224554 | 3300010375 | Bacteria | 2106 |
| 293 | Ga0105239_10241357 | 3300010375 | Bacteria | 2028 |
| 294 | Ga0105239_10268022 | 3300010375 | Bacteria | 1920 |
| 295 | Ga0105239_10394133 | 3300010375 | Bacteria | 1566 |
| 296 | Ga0105239_10560005 | 3300010375 | Bacteria | 1302 |
| 297 | Ga0105246_10019195 | 3300011119 | Bacteria | 4364 |
| 298 | Ga0105246_10028021 | 3300011119 | Bacteria | 3697 |
| 299 | Ga0105246_10039294 | 3300011119 | Bacteria | 3186 |
| 300 | Ga0157370_10033613 | 3300013104 | Bacteria | 5000 |
| 301 | Ga0157370_10530495 | 3300013104 | Bacteria | 1080 |
| 302 | Ga0157369_10006140 | 3300013105 | Bacteria | 13943 |
| 303 | Ga0157369_10016279 | 3300013105 | Bacteria | 8370 |
| 304 | Ga0157369_10034922 | 3300013105 | Bacteria | 5515 |
| 305 | Ga0157369_10217285 | 3300013105 | Bacteria | 2002 |
| 306 | Ga0157374_10029773 | 3300013296 | Bacteria | 4950 |
| 307 | Ga0157374_10030196 | 3300013296 | Bacteria | 4917 |
| 308 | Ga0157374_10084717 | 3300013296 | Bacteria | 3013 |
| 309 | Ga0157374_10222984 | 3300013296 | Bacteria | 1850 |
| 310 | Ga0157374_10431935 | 3300013296 | Bacteria | 1317 |
| 311 | Ga0157378_10182598 | 3300013297 | Bacteria | 1974 |
| 312 | Ga0157378_10207394 | 3300013297 | Bacteria | 1857 |
| 313 | Ga0163162_10029376 | 3300013306 | Bacteria | 5440 |
| 314 | Ga0163162_10045464 | 3300013306 | Bacteria | 4398 |
| 315 | Ga0163162_10070383 | 3300013306 | Bacteria | 3549 |
| 316 | Ga0163162_10257331 | 3300013306 | Bacteria | 1877 |
| 317 | Ga0163162_10310046 | 3300013306 | Bacteria | 1710 |
| 318 | Ga0163162_10481129 | 3300013306 | Bacteria | 1373 |
| 319 | Ga0163162_10488038 | 3300013306 | Bacteria | 1363 |
| 320 | Ga0157372_10019384 | 3300013307 | Bacteria | 7330 |
| 321 | Ga0157372_10068085 | 3300013307 | Bacteria | 4003 |
| 322 | Ga0157372_10204351 | 3300013307 | Bacteria | 2289 |
| 323 | Ga0157375_10013280 | 3300013308 | Bacteria | 7325 |
| 324 | Ga0157375_10067562 | 3300013308 | Bacteria | 3572 |
| 325 | Ga0157375_10258482 | 3300013308 | Bacteria | 1903 |
| 326 | Ga0157375_10333598 | 3300013308 | Bacteria | 1682 |
| 327 | Ga0157375_10361873 | 3300013308 | Bacteria | 1617 |
| 328 | Ga0157375_10378261 | 3300013308 | Bacteria | 1583 |
| 329 | Ga0157375_10493113 | 3300013308 | Bacteria | 1389 |
| 330 | Ga0163163_10006759 | 3300014325 | Bacteria | 10055 |
| 331 | Ga0163163_10036974 | 3300014325 | Bacteria | 4747 |
| 332 | Ga0163163_10092655 | 3300014325 | Bacteria | 3037 |
| 333 | Ga0163163_10146857 | 3300014325 | Bacteria | 2402 |
| 334 | Ga0163163_10554706 | 3300014325 | Bacteria | 1211 |
| 335 | Ga0157380_10195498 | 3300014326 | Bacteria | 1790 |
| 336 | Ga0157379_10026109 | 3300014968 | Bacteria | 5197 |
| 337 | Ga0157379_10098103 | 3300014968 | Bacteria | 2631 |
| 338 | Ga0157379_10417141 | 3300014968 | Bacteria | 1236 |
| 339 | Ga0157376_10153738 | 3300014969 | Bacteria | 2078 |
| 340 | Ga0163161_10631680 | 3300017792 | Bacteria | 886 |
| 341 | Ga0197907_11085692 | 3300020069 | Bacteria | 1848 |
| 342 | Ga0206350_10147974 | 3300020080 | Bacteria | 1853 |
| 343 | Ga0213872_10096894 | 3300021361 | Bacteria | 1317 |
| 344 | Ga0213876_10102971 | 3300021384 | Bacteria | 1514 |
| 345 | Ga0213875_10036010 | 3300021388 | Bacteria | 2334 |
| 346 | Ga0213871_10048862 | 3300021441 | Bacteria | 1154 |
| 347 | Ga0224712_10019052 | 3300022467 | Bacteria | 2307 |
| 348 | Ga0224572_1032213 | 3300024225 | Bacteria | 999 |
| 349 | Ga0228598_1009638 | 3300024227 | Bacteria | 1933 |
| 350 | Ga0209677_102334 | 3300025253 | Bacteria | 7277 |
| 351 | Ga0209148_1000445 | 3300025254 | Bacteria | 45388 |
| 352 | Ga0209233_1003431 | 3300025261 | Bacteria | 5579 |
| 353 | Ga0209233_1004607 | 3300025261 | Bacteria | 4662 |
| 354 | Ga0209455_1006613 | 3300025272 | Bacteria | 3401 |
| 355 | Ga0209455_1015439 | 3300025272 | Bacteria | 1679 |
| 356 | Ga0209564_1002690 | 3300025295 | Bacteria | 13467 |
| 357 | Ga0209758_1000416 | 3300025297 | Bacteria | 72312 |
| 358 | Ga0209758_1001659 | 3300025297 | Bacteria | 25224 |
| 359 | Ga0209758_1002229 | 3300025297 | Bacteria | 20140 |
| 360 | Ga0209256_1025154 | 3300025299 | Bacteria | 1740 |
| 361 | Ga0207426_1000522 | 3300025302 | Bacteria | 55802 |
| 362 | Ga0207426_1000635 | 3300025302 | Bacteria | 44397 |
| 363 | Ga0209257_1016037 | 3300025304 | Bacteria | 3061 |
| 364 | Ga0207697_10011055 | 3300025315 | Bacteria | 3828 |
| 365 | Ga0207697_10022021 | 3300025315 | Bacteria | 2611 |
| 366 | Ga0207697_10145631 | 3300025315 | Bacteria | 1029 |
| 367 | Ga0207697_10258194 | 3300025315 | Bacteria | 771 |
| 368 | Ga0207656_10018876 | 3300025321 | Bacteria | 2721 |
| 369 | Ga0207656_10144100 | 3300025321 | Bacteria | 1124 |
| 370 | Ga0207656_10167179 | 3300025321 | Bacteria | 1050 |
| 371 | Ga0207653_10048082 | 3300025885 | Bacteria | 1414 |
| 372 | Ga0207692_10042604 | 3300025898 | Bacteria | 2254 |
| 373 | Ga0207692_10121292 | 3300025898 | Bacteria | 1464 |
| 374 | Ga0207642_10108021 | 3300025899 | Bacteria | 1411 |
| 375 | Ga0207710_10158479 | 3300025900 | Bacteria | 1101 |
| 376 | Ga0207710_10191171 | 3300025900 | Bacteria | 1008 |
| 377 | Ga0207688_10038785 | 3300025901 | Bacteria | 2645 |
| 378 | Ga0207688_10089512 | 3300025901 | Bacteria | 1766 |
| 379 | Ga0207688_10097786 | 3300025901 | Bacteria | 1692 |
| 380 | Ga0207688_10108116 | 3300025901 | Bacteria | 1612 |
| 381 | Ga0207680_10063467 | 3300025903 | Bacteria | 2261 |
| 382 | Ga0207680_10322521 | 3300025903 | Bacteria | 1080 |
| 383 | Ga0207647_10007936 | 3300025904 | Bacteria | 7631 |
| 384 | Ga0207647_10062745 | 3300025904 | Bacteria | 2263 |
| 385 | Ga0207685_10005077 | 3300025905 | Bacteria | 3430 |
| 386 | Ga0207685_10169337 | 3300025905 | Bacteria | 1004 |
| 387 | Ga0207699_10013659 | 3300025906 | Bacteria | 4163 |
| 388 | Ga0207699_10030108 | 3300025906 | Bacteria | 3034 |
| 389 | Ga0207699_10036479 | 3300025906 | Bacteria | 2803 |
| 390 | Ga0207699_10061933 | 3300025906 | Bacteria | 2253 |
| 391 | Ga0207699_10172976 | 3300025906 | Bacteria | 1446 |
| 392 | Ga0207699_10239781 | 3300025906 | Bacteria | 1245 |
| 393 | Ga0207699_10275754 | 3300025906 | Bacteria | 1167 |
| 394 | Ga0207645_10048662 | 3300025907 | Bacteria | 2708 |
| 395 | Ga0207643_10013766 | 3300025908 | Bacteria | 4388 |
| 396 | Ga0207684_10131984 | 3300025910 | Bacteria | 2143 |
| 397 | Ga0207654_10067524 | 3300025911 | Bacteria | 2113 |
| 398 | Ga0207654_10395843 | 3300025911 | Bacteria | 959 |
| 399 | Ga0207654_10675868 | 3300025911 | Bacteria | 741 |
| 400 | Ga0207707_10001623 | 3300025912 | Bacteria | 20718 |
| 401 | Ga0207707_10013110 | 3300025912 | Bacteria | 7222 |
| 402 | Ga0207707_10234210 | 3300025912 | Bacteria | 1597 |
| 403 | Ga0207707_10395906 | 3300025912 | Bacteria | 1186 |
| 404 | Ga0207695_10000556 | 3300025913 | Bacteria | 76837 |
| 405 | Ga0207695_10168585 | 3300025913 | Bacteria | 2116 |
| 406 | Ga0207695_10183258 | 3300025913 | Bacteria | 2014 |
| 407 | Ga0207671_10006897 | 3300025914 | Bacteria | 10016 |
| 408 | Ga0207671_10052332 | 3300025914 | Bacteria | 3026 |
| 409 | Ga0207671_10085930 | 3300025914 | Bacteria | 2364 |
| 410 | Ga0207671_10089640 | 3300025914 | Bacteria | 2315 |
| 411 | Ga0207671_10097689 | 3300025914 | Bacteria | 2221 |
| 412 | Ga0207671_10129438 | 3300025914 | Bacteria | 1936 |
| 413 | Ga0207671_10242304 | 3300025914 | Bacteria | 1416 |
| 414 | Ga0207693_10004012 | 3300025915 | Bacteria | 12514 |
| 415 | Ga0207693_10017812 | 3300025915 | Bacteria | 5663 |
| 416 | Ga0207693_10047086 | 3300025915 | Bacteria | 3389 |
| 417 | Ga0207693_10127744 | 3300025915 | Bacteria | 1998 |
| 418 | Ga0207693_10219735 | 3300025915 | Unclassified | 1493 |
| 419 | Ga0207663_10001611 | 3300025916 | Bacteria | 10618 |
| 420 | Ga0207663_10008168 | 3300025916 | Bacteria | 5457 |
| 421 | Ga0207663_10060409 | 3300025916 | Bacteria | 2402 |
| 422 | Ga0207663_10100050 | 3300025916 | Bacteria | 1945 |
| 423 | Ga0207663_10177756 | 3300025916 | Bacteria | 1517 |
| 424 | Ga0207663_10577732 | 3300025916 | Bacteria | 881 |
| 425 | Ga0207660_10008313 | 3300025917 | Bacteria | 6708 |
| 426 | Ga0207660_10023476 | 3300025917 | Bacteria | 4166 |
| 427 | Ga0207660_10116612 | 3300025917 | Bacteria | 2017 |
| 428 | Ga0207660_10136318 | 3300025917 | Bacteria | 1873 |
| 429 | Ga0207662_10100917 | 3300025918 | Bacteria | 1788 |
| 430 | Ga0207657_10138500 | 3300025919 | Bacteria | 1990 |
| 431 | Ga0207657_10230224 | 3300025919 | Bacteria | 1482 |
| 432 | Ga0207657_10394683 | 3300025919 | Bacteria | 1088 |
| 433 | Ga0207649_10045148 | 3300025920 | Bacteria | 2700 |
| 434 | Ga0207649_10280923 | 3300025920 | Bacteria | 1210 |
| 435 | Ga0207652_10011502 | 3300025921 | Bacteria | 7136 |
| 436 | Ga0207652_10097988 | 3300025921 | Bacteria | 2585 |
| 437 | Ga0207652_10341074 | 3300025921 | Bacteria | 1353 |
| 438 | Ga0207646_10091867 | 3300025922 | Bacteria | 2717 |
| 439 | Ga0207646_10309416 | 3300025922 | Bacteria | 1427 |
| 440 | Ga0207681_10071847 | 3300025923 | Bacteria | 2415 |
| 441 | Ga0207681_10224236 | 3300025923 | Bacteria | 1456 |
| 442 | Ga0207681_10250995 | 3300025923 | Bacteria | 1381 |
| 443 | Ga0207694_10013820 | 3300025924 | Bacteria | 6086 |
| 444 | Ga0207694_10015762 | 3300025924 | Bacteria | 5702 |
| 445 | Ga0207694_10078197 | 3300025924 | Bacteria | 2593 |
| 446 | Ga0207694_10277613 | 3300025924 | Bacteria | 1375 |
| 447 | Ga0207650_10318937 | 3300025925 | Bacteria | 1272 |
| 448 | Ga0207650_10445953 | 3300025925 | Bacteria | 1076 |
| 449 | Ga0207659_10039497 | 3300025926 | Bacteria | 3292 |
| 450 | Ga0207659_10253817 | 3300025926 | Unclassified | 1428 |
| 451 | Ga0207659_10588391 | 3300025926 | Bacteria | 948 |
| 452 | Ga0207687_10035089 | 3300025927 | Bacteria | 3410 |
| 453 | Ga0207700_10027300 | 3300025928 | Bacteria | 3996 |
| 454 | Ga0207700_10027577 | 3300025928 | Bacteria | 3980 |
| 455 | Ga0207700_10123698 | 3300025928 | Bacteria | 2100 |
| 456 | Ga0207700_10127200 | 3300025928 | Bacteria | 2075 |
| 457 | Ga0207700_10163962 | 3300025928 | Bacteria | 1848 |
| 458 | Ga0207700_10262290 | 3300025928 | Bacteria | 1480 |
| 459 | Ga0207700_10415297 | 3300025928 | Bacteria | 1181 |
| 460 | Ga0207700_10788026 | 3300025928 | Bacteria | 850 |
| 461 | Ga0207664_10028753 | 3300025929 | Bacteria | 4227 |
| 462 | Ga0207664_10064321 | 3300025929 | Bacteria | 2933 |
| 463 | Ga0207664_10065652 | 3300025929 | Bacteria | 2906 |
| 464 | Ga0207664_10123572 | 3300025929 | Bacteria | 2170 |
| 465 | Ga0207664_11013763 | 3300025929 | Bacteria | 744 |
| 466 | Ga0207644_10008270 | 3300025931 | Bacteria | 6816 |
| 467 | Ga0207644_10035155 | 3300025931 | Bacteria | 3509 |
| 468 | Ga0207644_10059574 | 3300025931 | Bacteria | 2761 |
| 469 | Ga0207644_10251120 | 3300025931 | Bacteria | 1411 |
| 470 | Ga0207644_10390309 | 3300025931 | Bacteria | 1136 |
| 471 | Ga0207690_10077162 | 3300025932 | Bacteria | 2315 |
| 472 | Ga0207690_10144926 | 3300025932 | Bacteria | 1755 |
| 473 | Ga0207690_10310400 | 3300025932 | Bacteria | 1237 |
| 474 | Ga0207706_10046302 | 3300025933 | Bacteria | 3851 |
| 475 | Ga0207706_10046675 | 3300025933 | Bacteria | 3835 |
| 476 | Ga0207706_10108737 | 3300025933 | Bacteria | 2440 |
| 477 | Ga0207686_10099011 | 3300025934 | Bacteria | 1943 |
| 478 | Ga0207686_10782012 | 3300025934 | Bacteria | 764 |
| 479 | Ga0207709_10006210 | 3300025935 | Bacteria | 6722 |
| 480 | Ga0207709_10149217 | 3300025935 | Bacteria | 1617 |
| 481 | Ga0207709_10627923 | 3300025935 | Bacteria | 853 |
| 482 | Ga0207669_10524787 | 3300025937 | Bacteria | 951 |
| 483 | Ga0207669_10612833 | 3300025937 | Bacteria | 886 |
| 484 | Ga0207665_10000118 | 3300025939 | Bacteria | 52078 |
| 485 | Ga0207665_10115210 | 3300025939 | Bacteria | 1893 |
| 486 | Ga0207665_10246970 | 3300025939 | Bacteria | 1317 |
| 487 | Ga0207711_10267230 | 3300025941 | Bacteria | 1573 |
| 488 | Ga0207711_10332009 | 3300025941 | Bacteria | 1406 |
| 489 | Ga0207689_10148571 | 3300025942 | Bacteria | 1931 |
| 490 | Ga0207689_10342501 | 3300025942 | Bacteria | 1242 |
| 491 | Ga0207689_10354879 | 3300025942 | Bacteria | 1219 |
| 492 | Ga0207689_10777627 | 3300025942 | Bacteria | 808 |
| 493 | Ga0207661_10080282 | 3300025944 | Bacteria | 2691 |
| 494 | Ga0207661_10133615 | 3300025944 | Bacteria | 2128 |
| 495 | Ga0207661_10492371 | 3300025944 | Bacteria | 1120 |
| 496 | Ga0207679_10208979 | 3300025945 | Bacteria | 1635 |
| 497 | Ga0207679_10251597 | 3300025945 | Bacteria | 1502 |
| 498 | Ga0207679_10933851 | 3300025945 | Bacteria | 794 |
| 499 | Ga0207667_10018061 | 3300025949 | Bacteria | 7921 |
| 500 | Ga0207667_10070915 | 3300025949 | Bacteria | 3625 |
| 501 | Ga0207667_10163362 | 3300025949 | Bacteria | 2290 |
| 502 | Ga0207651_10070768 | 3300025960 | Bacteria | 2469 |
| 503 | Ga0207651_10316482 | 3300025960 | Bacteria | 1303 |
| 504 | Ga0207712_10072290 | 3300025961 | Bacteria | 2483 |
| 505 | Ga0207712_10117940 | 3300025961 | Bacteria | 2003 |
| 506 | Ga0207668_10094229 | 3300025972 | Bacteria | 2207 |
| 507 | Ga0207668_10102485 | 3300025972 | Bacteria | 2129 |
| 508 | Ga0207668_10160645 | 3300025972 | Bacteria | 1750 |
| 509 | Ga0207668_10858211 | 3300025972 | Unclassified | 806 |
| 510 | Ga0207640_10180999 | 3300025981 | Bacteria | 1580 |
| 511 | Ga0207640_10187154 | 3300025981 | Bacteria | 1558 |
| 512 | Ga0207640_10231433 | 3300025981 | Bacteria | 1422 |
| 513 | Ga0207640_10412429 | 3300025981 | Bacteria | 1103 |
| 514 | Ga0207658_10299258 | 3300025986 | Bacteria | 1385 |
| 515 | Ga0207658_10405198 | 3300025986 | Bacteria | 1199 |
| 516 | Ga0207658_11006160 | 3300025986 | Bacteria | 760 |
| 517 | Ga0207677_10098985 | 3300026023 | Bacteria | 2140 |
| 518 | Ga0207677_10100641 | 3300026023 | Bacteria | 2126 |
| 519 | Ga0207677_10250178 | 3300026023 | Bacteria | 1439 |
| 520 | Ga0207703_10090586 | 3300026035 | Bacteria | 2570 |
| 521 | Ga0207703_10240779 | 3300026035 | Bacteria | 1626 |
| 522 | Ga0207703_10258803 | 3300026035 | Bacteria | 1572 |
| 523 | Ga0207703_10327001 | 3300026035 | Bacteria | 1405 |
| 524 | Ga0207703_10668106 | 3300026035 | Bacteria | 987 |
| 525 | Ga0207639_10100675 | 3300026041 | Bacteria | 2335 |
| 526 | Ga0207639_10145973 | 3300026041 | Bacteria | 1976 |
| 527 | Ga0207639_10156045 | 3300026041 | Bacteria | 1918 |
| 528 | Ga0207639_10200532 | 3300026041 | Bacteria | 1711 |
| 529 | Ga0207639_10553307 | 3300026041 | Bacteria | 1057 |
| 530 | Ga0207678_10025337 | 3300026067 | Bacteria | 5178 |
| 531 | Ga0207678_10086267 | 3300026067 | Bacteria | 2683 |
| 532 | Ga0207678_10105567 | 3300026067 | Bacteria | 2404 |
| 533 | Ga0207678_10146128 | 3300026067 | Bacteria | 2018 |
| 534 | Ga0207678_10791325 | 3300026067 | Bacteria | 837 |
| 535 | Ga0207702_10000433 | 3300026078 | Bacteria | 47747 |
| 536 | Ga0207702_10254452 | 3300026078 | Bacteria | 1651 |
| 537 | Ga0207702_10306964 | 3300026078 | Bacteria | 1507 |
| 538 | Ga0207702_10339239 | 3300026078 | Bacteria | 1435 |
| 539 | Ga0207702_10413527 | 3300026078 | Bacteria | 1303 |
| 540 | Ga0207702_10651599 | 3300026078 | Bacteria | 1036 |
| 541 | Ga0207641_10124839 | 3300026088 | Bacteria | 2303 |
| 542 | Ga0207641_10193761 | 3300026088 | Bacteria | 1869 |
| 543 | Ga0207641_10459978 | 3300026088 | Bacteria | 1231 |
| 544 | Ga0207648_10062751 | 3300026089 | Bacteria | 3239 |
| 545 | Ga0207648_10093247 | 3300026089 | Bacteria | 2633 |
| 546 | Ga0207648_10145761 | 3300026089 | Bacteria | 2088 |
| 547 | Ga0207676_10046093 | 3300026095 | Bacteria | 3372 |
| 548 | Ga0207676_10667451 | 3300026095 | Bacteria | 1004 |
| 549 | Ga0207674_10018412 | 3300026116 | Bacteria | 7592 |
| 550 | Ga0207674_10039233 | 3300026116 | Bacteria | 4910 |
| 551 | Ga0207674_10080810 | 3300026116 | Bacteria | 3253 |
| 552 | Ga0207675_100067493 | 3300026118 | Bacteria | 3343 |
| 553 | Ga0207675_100751571 | 3300026118 | Bacteria | 986 |
| 554 | Ga0207683_10016118 | 3300026121 | Bacteria | 6361 |
| 555 | Ga0207683_10414642 | 3300026121 | Bacteria | 1240 |
| 556 | Ga0207683_10546959 | 3300026121 | Bacteria | 1070 |
| 557 | Ga0207698_10020154 | 3300026142 | Bacteria | 4584 |
| 558 | Ga0207698_10198208 | 3300026142 | Bacteria | 1795 |
| 559 | Ga0207698_10632148 | 3300026142 | Bacteria | 1058 |
| 560 | Ga0207698_10649773 | 3300026142 | Bacteria | 1045 |
| 561 | Ga0209389_1000045 | 3300027296 | Bacteria | 118598 |
| 562 | Ga0209389_1007855 | 3300027296 | Bacteria | 9438 |
| 563 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 564 | Ga0209589_1015051 | 3300027357 | Bacteria | 9438 |
| 565 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 566 | Ga0209489_100110 | 3300027361 | Bacteria | 117680 |
| 567 | Ga0209489_100210 | 3300027361 | Bacteria | 96217 |
| 568 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 569 | Ga0209700_100116 | 3300027363 | Bacteria | 115661 |
| 570 | Ga0209588_1028759 | 3300027671 | Bacteria | 1770 |
| 571 | Ga0209588_1103687 | 3300027671 | Bacteria | 915 |
| 572 | Ga0209588_1116886 | 3300027671 | Bacteria | 855 |
| 573 | Ga0209813_10131905 | 3300027866 | Bacteria | 880 |
| 574 | Ga0207428_10000295 | 3300027907 | Bacteria | 66554 |
| 575 | Ga0268266_10003838 | 3300028379 | Bacteria | 14677 |
| 576 | Ga0268266_10112403 | 3300028379 | Bacteria | 2414 |
| 577 | Ga0268266_10153142 | 3300028379 | Bacteria | 2080 |
| 578 | Ga0268266_10186589 | 3300028379 | Bacteria | 1891 |
| 579 | Ga0268266_10455183 | 3300028379 | Bacteria | 1217 |
| 580 | Ga0268265_10049446 | 3300028380 | Bacteria | 3162 |
| 581 | Ga0268265_10111402 | 3300028380 | Bacteria | 2235 |
| 582 | Ga0268264_11146859 | 3300028381 | Bacteria | 786 |
| 583 | Ga0307515_10184213 | 3300028794 | Bacteria | 2025 |
| 584 | Ga0307511_10117520 | 3300030521 | Bacteria | 1661 |
| 585 | Ga0265330_10033581 | 3300031235 | Bacteria | 2294 |
| 586 | Ga0265332_10035187 | 3300031238 | Bacteria | 2175 |
| 587 | Ga0265328_10044790 | 3300031239 | Bacteria | 1627 |
| 588 | Ga0265325_10019092 | 3300031241 | Bacteria | 3794 |
| 589 | Ga0265339_10051134 | 3300031249 | Bacteria | 2257 |
| 590 | Ga0265316_10124590 | 3300031344 | Bacteria | 1944 |
| 591 | Ga0307509_10066285 | 3300031507 | Bacteria | 3789 |
| 592 | Ga0307509_10615399 | 3300031507 | Bacteria | 757 |
| 593 | Ga0307508_10000003 | 3300031616 | Bacteria | 321602 |
| 594 | Ga0307508_10097397 | 3300031616 | Bacteria | 2533 |
| 595 | Ga0265314_10049278 | 3300031711 | Bacteria | 2950 |
| 596 | Ga0307516_10118428 | 3300031730 | Bacteria | 2442 |
| 597 | Ga0307516_10199295 | 3300031730 | Bacteria | 1722 |
| 598 | Ga0307416_100060615 | 3300032002 | Bacteria | 3083 |
| 599 | Ga0307507_10029922 | 3300033179 | Bacteria | 5758 |
| 600 | Ga0307507_10166501 | 3300033179 | Bacteria | 1614 |
| 601 | Ga0307507_10347247 | 3300033179 | Bacteria | 875 |
| 602 | Ga0307510_10009102 | 3300033180 | Bacteria | 11824 |
| 603 | Ga0307510_10202000 | 3300033180 | Bacteria | 1521 |
| 604 | Ga0373950_0034781 | 3300034818 | Bacteria | 946 |
| 605 | Ga0373926_0078204 | 3300035083 | Bacteria | 1221 |
| 606 | Ga0373926_0079398 | 3300035083 | Bacteria | 1212 |
| 607 | Ga0373934_0013009 | 3300035086 | Bacteria | 3143 |
| 608 | Ga0373944_0006425 | 3300035089 | Bacteria | 3122 |
| 609 | Ga0373923_0011095 | 3300035111 | Bacteria | 3297 |
| 610 | Ga0373923_0044805 | 3300035111 | Bacteria | 1836 |
| 611 | Ga0373936_0059173 | 3300035113 | Bacteria | 1561 |
| 612 | Ga0373936_0062841 | 3300035113 | Bacteria | 1519 |
| 613 | Ga0373945_0010383 | 3300035116 | Bacteria | 3065 |
| 614 | Ga0373945_0028844 | 3300035116 | Bacteria | 1947 |
| 615 | Ga0373945_0119881 | 3300035116 | Bacteria | 1045 |
| 616 | Ga0373953_0010610 | 3300035117 | Bacteria | 3213 |
| 617 | Ga0373953_0123108 | 3300035117 | Bacteria | 1102 |
| 618 | Ga0373954_0019925 | 3300035118 | Bacteria | 3028 |
| 619 | Ga0373956_0001075 | 3300035119 | Bacteria | 11230 |
| 620 | Ga0373956_0179268 | 3300035119 | Bacteria | 1001 |
| 621 | Ga0373956_0209632 | 3300035119 | Bacteria | 924 |
| 622 | Ga0373957_0016737 | 3300035120 | Bacteria | 2544 |
| 623 | Ga0373957_0068045 | 3300035120 | Bacteria | 1389 |
| 624 | Ga0373943_0011760 | 3300035170 | Bacteria | 3939 |
| 625 | Ga0373943_0021033 | 3300035170 | Bacteria | 3013 |
| 626 | Ga0373943_0027693 | 3300035170 | Bacteria | 2665 |
| 627 | Ga0373943_0074801 | 3300035170 | Bacteria | 1723 |
| 628 | Ga0373943_0124772 | 3300035170 | Bacteria | 1372 |
| 629 | Ga0373946_0003017 | 3300035171 | Bacteria | 5968 |
| 630 | Ga0373946_0089578 | 3300035171 | Bacteria | 1361 |
| 631 | Ga0373955_0019530 | 3300035172 | Bacteria | 3389 |
| 632 | Ga0373955_0021727 | 3300035172 | Unclassified | 3244 |
| 633 | Ga0373955_0042339 | 3300035172 | Bacteria | 2445 |
| 634 | Ga0373955_0059346 | 3300035172 | Bacteria | 2107 |
| 635 | Ga0373924_0007622 | 3300035410 | Bacteria | 3911 |
| 636 | Ga0373924_0068729 | 3300035410 | Bacteria | 1492 |
| 637 | Ga0373924_0130804 | 3300035410 | Bacteria | 1092 |
| 638 | Ga0373931_0529061 | 3300035691 | Unclassified | 764 |
| 639 | Ga0373935_0002155 | 3300035692 | Bacteria | 11170 |
| 640 | Ga0373935_0051480 | 3300035692 | Bacteria | 2615 |
| 641 | Ga0373935_0074297 | 3300035692 | Bacteria | 2197 |
| 642 | Ga0373927_0001542 | 3300035695 | Bacteria | 17306 |
| 643 | Ga0373927_0010229 | 3300035695 | Bacteria | 6266 |
| 644 | Ga0373927_0015090 | 3300035695 | Bacteria | 5108 |
| 645 | Ga0373927_0023988 | 3300035695 | Bacteria | 3991 |
| 646 | Ga0373927_0041572 | 3300035695 | Bacteria | 2981 |
| 647 | Ga0373927_0057537 | 3300035695 | Unclassified | 2514 |
| 648 | Ga0373927_0250759 | 3300035695 | Bacteria | 1164 |
| 649 | Ga0373933_0000241 | 3300035724 | Bacteria | 35958 |
| 650 | Ga0373933_0010931 | 3300035724 | Bacteria | 4984 |
| 651 | Ga0373933_0256190 | 3300035724 | Bacteria | 1127 |
| 652 | Ga0373933_0402874 | 3300035724 | Bacteria | 892 |
| 653 | Ga0373947_0006228 | 3300035725 | Bacteria | 6936 |
| 654 | Ga0373947_0011801 | 3300035725 | Bacteria | 5006 |
| 655 | Ga0373947_0134660 | 3300035725 | Unclassified | 1580 |
| 656 | Ga0373947_0178964 | 3300035725 | Bacteria | 1379 |
| 657 | Ga0373937_0048039 | 3300036401 | Bacteria | 3905 |
| 658 | Ga0373937_0054473 | 3300036401 | Bacteria | 3670 |
| 659 | Ga0373937_0090572 | 3300036401 | Bacteria | 2832 |
| 660 | Ga0373937_0126219 | 3300036401 | Bacteria | 2387 |
| 661 | Ga0373937_0595328 | 3300036401 | Bacteria | 1050 |
| 662 | Ga0372808_015971 | 3300036459 | Bacteria | 1075 |
| 663 | Ga0373925_0003576 | 3300037068 | Bacteria | 11979 |
| 664 | Ga0373925_0036563 | 3300037068 | Bacteria | 3624 |
| 665 | Ga0373925_0039425 | 3300037068 | Bacteria | 3495 |
| 666 | Ga0373925_0062921 | 3300037068 | Bacteria | 2791 |
| 667 | Ga0373925_0085992 | 3300037068 | Unclassified | 2398 |
| 668 | Ga0373925_0160610 | 3300037068 | Bacteria | 1770 |
| 669 | Ga0373925_0227968 | 3300037068 | Bacteria | 1489 |
| 670 | Ga0373925_0320136 | 3300037068 | Bacteria | 1255 |
| 671 | Ga0373925_0330956 | 3300037068 | Bacteria | 1234 |
| 672 | Ga0395899_0026158 | 3300037312 | Bacteria | 4404 |
| 673 | Ga0395900_0001570 | 3300037418 | Bacteria | 27058 |
| 674 | Ga0395900_0019206 | 3300037418 | Bacteria | 6968 |
| 675 | Ga0395900_0036457 | 3300037418 | Bacteria | 5070 |
| 676 | Ga0395900_0051963 | 3300037418 | Unclassified | 4220 |
| 677 | Ga0395900_0077860 | 3300037418 | Bacteria | 3407 |
| 678 | Ga0395900_0102714 | 3300037418 | Bacteria | 2937 |
| 679 | Ga0395898_0006693 | 3300037466 | Bacteria | 12284 |
| 680 | Ga0395898_0009563 | 3300037466 | Bacteria | 10184 |
| 681 | Ga0395898_0031476 | 3300037466 | Bacteria | 5300 |
| 682 | Ga0395898_0061763 | 3300037466 | Unclassified | 3640 |
| 683 | Ga0395898_0071539 | 3300037466 | Unclassified | 3351 |
| 684 | Ga0395905_0000548 | 3300037471 | Bacteria | 51350 |
| 685 | Ga0436364_0407668 | 3300037853 | Bacteria | 1082 |
| 686 | Ga0436364_0790824 | 3300037853 | Bacteria | 5943 |
| 687 | Ga0436364_0836945 | 3300037853 | Bacteria | 2138 |
| 688 | Ga0436364_0974948 | 3300037853 | Bacteria | 1221 |
| 689 | Ga0395901_0029002 | 3300038443 | Bacteria | 5693 |
| 690 | Ga0395901_0033560 | 3300038443 | Bacteria | 5299 |
| 691 | Ga0395901_0053412 | 3300038443 | Bacteria | 4198 |
| 692 | Ga0395901_0107854 | 3300038443 | Bacteria | 2923 |
| 693 | Ga0395901_0132133 | 3300038443 | Unclassified | 2623 |
| 694 | Ga0395901_0269779 | 3300038443 | Bacteria | 1770 |
| 695 | Ga0395901_0634116 | 3300038443 | Bacteria | 1074 |
| 696 | Ga0436365_0182658 | 3300039437 | Bacteria | 1796 |
| 697 | Ga0436365_0196266 | 3300039437 | Bacteria | 4337 |
| 698 | Ga0436360_0825284 | 3300039438 | Bacteria | 1473 |
| 699 | Ga0436360_1192895 | 3300039438 | Bacteria | 2868 |
| 700 | Ga0436361_0284130 | 3300039447 | Bacteria | 2649 |
| 701 | Ga0436361_1062074 | 3300039447 | Bacteria | 3715 |
| 702 | Ga0436362_0999686 | 3300039453 | Bacteria | 814 |
| 703 | Ga0451789_1145104 | 3300041443 | Bacteria | 2157 |
| 704 | Ga0451795_1424660 | 3300041456 | Bacteria | 1719 |
| 705 | Ga0466972_0000988 | 3300044658 | Bacteria | 13676 |
| 706 | Ga0466972_0012012 | 3300044658 | Bacteria | 4351 |
| 707 | Ga0466972_0101932 | 3300044658 | Bacteria | 1358 |
| 708 | Ga0466965_0012855 | 3300044683 | Bacteria | 3941 |
| 709 | Ga0466966_0000149 | 3300044684 | Bacteria | 44757 |
| 710 | Ga0466966_0472036 | 3300044684 | Bacteria | 754 |
| 711 | Ga0466961_0000066 | 3300044693 | Bacteria | 63201 |
| 712 | Ga0466963_0104016 | 3300044694 | Bacteria | 1945 |
| 713 | Ga0466960_0027844 | 3300044901 | Bacteria | 2582 |
| 714 | Ga0466959_0178359 | 3300045049 | Bacteria | 1487 |
| 715 | Ga0466967_0022427 | 3300045976 | Bacteria | 5151 |
| 716 | Ga0466967_0178758 | 3300045976 | Bacteria | 2000 |
| 717 | Ga0466967_0259726 | 3300045976 | Bacteria | 1662 |
| 718 | Ga0495592_0011023 | 3300046454 | Bacteria | 6820 |
| 719 | Ga0495592_0011821 | 3300046454 | Bacteria | 6613 |
| 720 | Ga0495592_0026415 | 3300046454 | Bacteria | 4402 |
| 721 | Ga0495592_0139601 | 3300046454 | Bacteria | 1687 |
| 722 | Ga0495592_0139922 | 3300046454 | Bacteria | 1684 |
| 723 | Ga0495592_0185533 | 3300046454 | Bacteria | 1413 |
| 724 | Ga0495592_0419534 | 3300046454 | Bacteria | 844 |
| 725 | Ga0495603_0003118 | 3300046455 | Bacteria | 9851 |
| 726 | Ga0495603_0021697 | 3300046455 | Bacteria | 3889 |
| 727 | Ga0495603_0066329 | 3300046455 | Bacteria | 2126 |
| 728 | Ga0495603_0101618 | 3300046455 | Bacteria | 1678 |
| 729 | Ga0495603_0116366 | 3300046455 | Bacteria | 1559 |
| 730 | Ga0495590_0022134 | 3300046457 | Bacteria | 2249 |
| 731 | Ga0495629_0003275 | 3300046459 | Bacteria | 12253 |
| 732 | Ga0495629_0015956 | 3300046459 | Bacteria | 5397 |
| 733 | Ga0495638_0024997 | 3300046460 | Bacteria | 3887 |
| 734 | Ga0495638_0043746 | 3300046460 | Bacteria | 2823 |
| 735 | Ga0495641_0030001 | 3300046461 | Bacteria | 2614 |
| 736 | Ga0495641_0115030 | 3300046461 | Bacteria | 1200 |
| 737 | Ga0495651_0009884 | 3300046462 | Bacteria | 7337 |
| 738 | Ga0495651_0069342 | 3300046462 | Bacteria | 2686 |
| 739 | Ga0495651_0120258 | 3300046462 | Bacteria | 1930 |
| 740 | Ga0495651_0141575 | 3300046462 | Bacteria | 1743 |
| 741 | Ga0495651_0146547 | 3300046462 | Bacteria | 1706 |
| 742 | Ga0495653_0081247 | 3300046463 | Bacteria | 2395 |
| 743 | Ga0495653_0107023 | 3300046463 | Bacteria | 2016 |
| 744 | Ga0495653_0128000 | 3300046463 | Bacteria | 1801 |
| 745 | Ga0495650_0056371 | 3300046471 | Bacteria | 1595 |
| 746 | Ga0495582_0119603 | 3300046473 | Bacteria | 1484 |
| 747 | Ga0495582_0123691 | 3300046473 | Bacteria | 1459 |
| 748 | Ga0495582_0243960 | 3300046473 | Bacteria | 1030 |
| 749 | Ga0495605_0044033 | 3300046474 | Bacteria | 2209 |
| 750 | Ga0495605_0153098 | 3300046474 | Bacteria | 1028 |
| 751 | Ga0495639_0009158 | 3300046475 | Bacteria | 4244 |
| 752 | Ga0495639_0090184 | 3300046475 | Bacteria | 1437 |
| 753 | Ga0495662_0037136 | 3300046476 | Bacteria | 2353 |
| 754 | Ga0495662_0073671 | 3300046476 | Bacteria | 1656 |
| 755 | Ga0495664_0007535 | 3300046477 | Bacteria | 6050 |
| 756 | Ga0495664_0081407 | 3300046477 | Bacteria | 1941 |
| 757 | Ga0495664_0133228 | 3300046477 | Bacteria | 1505 |
| 758 | Ga0495664_0191422 | 3300046477 | Bacteria | 1240 |
| 759 | Ga0495584_0162170 | 3300046491 | Bacteria | 1136 |
| 760 | Ga0495594_0004206 | 3300046499 | Bacteria | 7391 |
| 761 | Ga0495594_0119977 | 3300046499 | Bacteria | 1486 |
| 762 | Ga0495594_0152941 | 3300046499 | Bacteria | 1310 |
| 763 | Ga0495596_0044448 | 3300046500 | Bacteria | 1748 |
| 764 | Ga0495607_0149788 | 3300046501 | Bacteria | 1195 |
| 765 | Ga0495583_0054921 | 3300046506 | Bacteria | 1802 |
| 766 | Ga0495583_0117909 | 3300046506 | Bacteria | 1120 |
| 767 | Ga0495606_0007533 | 3300046507 | Bacteria | 9710 |
| 768 | Ga0495606_0093566 | 3300046507 | Bacteria | 1843 |
| 769 | Ga0495606_0188367 | 3300046507 | Bacteria | 1184 |
| 770 | Ga0495608_0000834 | 3300046511 | Bacteria | 21529 |
| 771 | Ga0495608_0046938 | 3300046511 | Bacteria | 2872 |
| 772 | Ga0495608_0200560 | 3300046511 | Bacteria | 1257 |
| 773 | Ga0495608_0393314 | 3300046511 | Bacteria | 849 |
| 774 | Ga0495610_0006739 | 3300046512 | Bacteria | 7804 |
| 775 | Ga0495616_0059110 | 3300046513 | Bacteria | 1886 |
| 776 | Ga0495616_0120140 | 3300046513 | Bacteria | 1214 |
| 777 | Ga0495618_0002623 | 3300046514 | Bacteria | 11509 |
| 778 | Ga0495618_0012212 | 3300046514 | Bacteria | 5213 |
| 779 | Ga0495618_0126488 | 3300046514 | Bacteria | 1637 |
| 780 | Ga0495618_0279622 | 3300046514 | Bacteria | 1041 |
| 781 | Ga0495620_0033910 | 3300046515 | Bacteria | 2312 |
| 782 | Ga0495620_0061313 | 3300046515 | Bacteria | 1565 |
| 783 | Ga0495628_0182029 | 3300046516 | Bacteria | 1589 |
| 784 | Ga0495628_0294553 | 3300046516 | Bacteria | 1202 |
| 785 | Ga0495630_0522472 | 3300046517 | Bacteria | 910 |
| 786 | Ga0495631_0039962 | 3300046518 | Bacteria | 2079 |
| 787 | Ga0495631_0117957 | 3300046518 | Bacteria | 1141 |
| 788 | Ga0495632_0132573 | 3300046519 | Bacteria | 1159 |
| 789 | Ga0495643_0152293 | 3300046522 | Bacteria | 1144 |
| 790 | Ga0495644_0050848 | 3300046523 | Bacteria | 1556 |
| 791 | Ga0495648_0040124 | 3300046524 | Bacteria | 2971 |
| 792 | Ga0495648_0043639 | 3300046524 | Bacteria | 2808 |
| 793 | Ga0495648_0060916 | 3300046524 | Bacteria | 2243 |
| 794 | Ga0495648_0063008 | 3300046524 | Bacteria | 2192 |
| 795 | Ga0495648_0162469 | 3300046524 | Bacteria | 1153 |
| 796 | Ga0495648_0205274 | 3300046524 | Bacteria | 983 |
| 797 | Ga0495666_0105487 | 3300046526 | Bacteria | 1326 |
| 798 | Ga0495666_0135147 | 3300046526 | Bacteria | 1151 |
| 799 | Ga0495652_0014781 | 3300046529 | Bacteria | 6997 |
| 800 | Ga0495652_0024613 | 3300046529 | Bacteria | 5326 |
| 801 | Ga0495652_0029195 | 3300046529 | Bacteria | 4845 |
| 802 | Ga0495652_0042669 | 3300046529 | Bacteria | 3910 |
| 803 | Ga0495652_0346956 | 3300046529 | Bacteria | 1065 |
| 804 | Ga0495654_0145840 | 3300046530 | Bacteria | 1051 |
| 805 | Ga0495665_0019833 | 3300046531 | Bacteria | 3616 |
| 806 | Ga0495640_0014776 | 3300046533 | Bacteria | 5897 |
| 807 | Ga0495640_0028670 | 3300046533 | Bacteria | 4005 |
| 808 | Ga0495640_0039887 | 3300046533 | Bacteria | 3292 |
| 809 | Ga0495640_0049784 | 3300046533 | Bacteria | 2887 |
| 810 | Ga0495640_0111091 | 3300046533 | Bacteria | 1791 |
| 811 | Ga0495640_0202370 | 3300046533 | Bacteria | 1258 |
| 812 | Ga0495587_0001442 | 3300046536 | Bacteria | 15851 |
| 813 | Ga0495587_0008806 | 3300046536 | Bacteria | 6476 |
| 814 | Ga0495587_0044947 | 3300046536 | Bacteria | 2626 |
| 815 | Ga0495587_0171281 | 3300046536 | Bacteria | 1233 |
| 816 | Ga0495598_0024400 | 3300046537 | Bacteria | 1639 |
| 817 | Ga0495609_0117339 | 3300046538 | Bacteria | 1146 |
| 818 | Ga0495609_0142803 | 3300046538 | Bacteria | 1021 |
| 819 | Ga0495621_0015676 | 3300046539 | Bacteria | 2420 |
| 820 | Ga0495621_0020445 | 3300046539 | Bacteria | 2173 |
| 821 | Ga0495645_0013005 | 3300046543 | Bacteria | 5876 |
| 822 | Ga0495645_0019288 | 3300046543 | Bacteria | 4910 |
| 823 | Ga0495645_0054563 | 3300046543 | Bacteria | 2903 |
| 824 | Ga0495622_0011919 | 3300046557 | Bacteria | 4021 |
| 825 | Ga0495622_0037987 | 3300046557 | Bacteria | 2242 |
| 826 | Ga0495622_0110421 | 3300046557 | Bacteria | 1259 |
| 827 | Ga0495633_0042222 | 3300046558 | Bacteria | 2167 |
| 828 | Ga0495633_0137429 | 3300046558 | Bacteria | 1130 |
| 829 | Ga0495667_0052777 | 3300046559 | Bacteria | 2677 |
| 830 | Ga0495667_0055568 | 3300046559 | Bacteria | 2604 |
| 831 | Ga0495667_0057663 | 3300046559 | Bacteria | 2552 |
| 832 | Ga0495667_0089410 | 3300046559 | Bacteria | 1996 |
| 833 | Ga0495667_0089835 | 3300046559 | Bacteria | 1991 |
| 834 | Ga0495656_0008710 | 3300046615 | Bacteria | 3631 |
| 835 | Ga0495634_0012455 | 3300046642 | Bacteria | 6154 |
| 836 | Ga0495634_0031432 | 3300046642 | Bacteria | 3657 |
| 837 | Ga0495634_0032939 | 3300046642 | Bacteria | 3562 |
| 838 | Ga0495611_0064846 | 3300046648 | Bacteria | 1664 |
| 839 | Ga0495611_0074037 | 3300046648 | Bacteria | 1559 |
| 840 | Ga0495625_0140117 | 3300046660 | Bacteria | 1632 |
| 841 | Ga0495625_0365570 | 3300046660 | Bacteria | 908 |
| 842 | Ga0495625_0387311 | 3300046660 | Bacteria | 876 |
| 843 | Ga0495635_0002510 | 3300046663 | Bacteria | 12539 |
| 844 | Ga0495635_0060745 | 3300046663 | Bacteria | 2597 |
| 845 | Ga0495635_0184521 | 3300046663 | Bacteria | 1417 |
| 846 | Ga0495635_0216131 | 3300046663 | Bacteria | 1297 |
| 847 | Ga0495659_0050529 | 3300046664 | Bacteria | 1512 |
| 848 | Ga0495659_0086916 | 3300046664 | Bacteria | 1195 |
| 849 | Ga0495661_0170104 | 3300046665 | Bacteria | 1163 |
| 850 | Ga0495661_0235018 | 3300046665 | Bacteria | 943 |
| 851 | Ga0495588_0004485 | 3300046674 | Bacteria | 6170 |
| 852 | Ga0495588_0012719 | 3300046674 | Bacteria | 3987 |
| 853 | Ga0495588_0046193 | 3300046674 | Bacteria | 2233 |
| 854 | Ga0495588_0125812 | 3300046674 | Bacteria | 1352 |
| 855 | Ga0495588_0324924 | 3300046674 | Bacteria | 809 |
| 856 | Ga0495657_0005817 | 3300046675 | Bacteria | 9710 |
| 857 | Ga0495657_0007621 | 3300046675 | Bacteria | 8338 |
| 858 | Ga0495657_0033077 | 3300046675 | Bacteria | 3604 |
| 859 | Ga0495657_0095799 | 3300046675 | Bacteria | 1897 |
| 860 | Ga0495657_0167731 | 3300046675 | Bacteria | 1354 |
| 861 | Ga0495599_0000991 | 3300046678 | Bacteria | 15920 |
| 862 | Ga0495599_0104526 | 3300046678 | Bacteria | 1764 |
| 863 | Ga0495599_0148784 | 3300046678 | Bacteria | 1451 |
| 864 | Ga0495599_0220903 | 3300046678 | Bacteria | 1159 |
| 865 | Ga0495599_0291087 | 3300046678 | Bacteria | 987 |
| 866 | Ga0495646_0010983 | 3300046680 | Bacteria | 5753 |
| 867 | Ga0495646_0038251 | 3300046680 | Bacteria | 2963 |
| 868 | Ga0495646_0063449 | 3300046680 | Bacteria | 2193 |
| 869 | Ga0495646_0065199 | 3300046680 | Bacteria | 2157 |
| 870 | Ga0495646_0070361 | 3300046680 | Bacteria | 2061 |
| 871 | Ga0495658_0018240 | 3300046683 | Bacteria | 3644 |
| 872 | Ga0495658_0328464 | 3300046683 | Bacteria | 970 |
| 873 | Ga0495658_0443144 | 3300046683 | Bacteria | 829 |
| 874 | Ga0495669_0006054 | 3300046684 | Bacteria | 5048 |
| 875 | Ga0495669_0101934 | 3300046684 | Bacteria | 1334 |
| 876 | Ga0495613_0012888 | 3300046689 | Bacteria | 6214 |
| 877 | Ga0495613_0021728 | 3300046689 | Bacteria | 4781 |
| 878 | Ga0495613_0029885 | 3300046689 | Bacteria | 4049 |
| 879 | Ga0495613_0093305 | 3300046689 | Bacteria | 2179 |
| 880 | Ga0495624_0036474 | 3300046690 | Bacteria | 3169 |
| 881 | Ga0495624_0157979 | 3300046690 | Unclassified | 1385 |
| 882 | Ga0495624_0306406 | 3300046690 | Bacteria | 957 |
| 883 | Ga0495670_0041892 | 3300046691 | Bacteria | 2285 |
| 884 | Ga0495670_0069166 | 3300046691 | Bacteria | 1785 |
| 885 | Ga0495670_0099272 | 3300046691 | Bacteria | 1498 |
| 886 | Ga0495671_0044831 | 3300046692 | Bacteria | 2216 |
| 887 | Ga0495649_0025832 | 3300046694 | Bacteria | 3270 |
| 888 | Ga0495649_0114674 | 3300046694 | Bacteria | 1427 |
| 889 | Ga0495589_0089041 | 3300046794 | Bacteria | 1499 |
| 890 | Ga0495589_0117156 | 3300046794 | Bacteria | 1283 |
| 891 | Ga0495589_0241245 | 3300046794 | Bacteria | 846 |
| 892 | Ga0495600_0004571 | 3300046809 | Bacteria | 8297 |
| 893 | Ga0495600_0112401 | 3300046809 | Bacteria | 1774 |
| 894 | Ga0495600_0189415 | 3300046809 | Bacteria | 1323 |
| 895 | Ga0495600_0260613 | 3300046809 | Bacteria | 1101 |
| 896 | Ga0495600_0487843 | 3300046809 | Bacteria | 758 |
| 897 | Ga0495660_0134341 | 3300046810 | Bacteria | 1238 |
| 898 | Ga0495581_0003566 | 3300047315 | Bacteria | 8939 |
| 899 | Ga0495581_0085424 | 3300047315 | Bacteria | 1829 |
| 900 | Ga0495581_0086276 | 3300047315 | Bacteria | 1820 |
| 901 | Ga0495581_0166509 | 3300047315 | Bacteria | 1289 |
| 902 | Ga0495581_0243725 | 3300047315 | Bacteria | 1051 |
| 903 | Ga0495581_0271070 | 3300047315 | Bacteria | 992 |
| 904 | Ga0495581_0281241 | 3300047315 | Bacteria | 973 |
| 905 | Ga0495581_0397774 | 3300047315 | Bacteria | 804 |
| 906 | Ga0495604_0005577 | 3300047317 | Bacteria | 9977 |
| 907 | Ga0495604_0019727 | 3300047317 | Bacteria | 5393 |
| 908 | Ga0495604_0033071 | 3300047317 | Bacteria | 4095 |
| 909 | Ga0495604_0042380 | 3300047317 | Bacteria | 3567 |
| 910 | Ga0495604_0052858 | 3300047317 | Bacteria | 3143 |
| 911 | Ga0495636_0026413 | 3300047318 | Bacteria | 2362 |
| 912 | Ga0495674_0014033 | 3300047319 | Bacteria | 7510 |
| 913 | Ga0495674_0052274 | 3300047319 | Bacteria | 3596 |
| 914 | Ga0495674_0080136 | 3300047319 | Bacteria | 2802 |
| 915 | Ga0495674_0363273 | 3300047319 | Bacteria | 1173 |
| 916 | Ga0495674_0484793 | 3300047319 | Bacteria | 990 |
| 917 | Ga0495674_0493459 | 3300047319 | Bacteria | 980 |
| 918 | Ga0495672_0053019 | 3300047320 | Bacteria | 2379 |
| 919 | Ga0495676_0001737 | 3300047321 | Bacteria | 19035 |
| 920 | Ga0495676_0102848 | 3300047321 | Bacteria | 2110 |
| 921 | Ga0495676_0116231 | 3300047321 | Bacteria | 1954 |
| 922 | Ga0495676_0122925 | 3300047321 | Bacteria | 1885 |
| 923 | Ga0495676_0197098 | 3300047321 | Bacteria | 1401 |
| 924 | Ga0495680_0037719 | 3300047322 | Bacteria | 3870 |
| 925 | Ga0495680_0045668 | 3300047322 | Bacteria | 3458 |
| 926 | Ga0495680_0045938 | 3300047322 | Bacteria | 3446 |
| 927 | Ga0495683_0073119 | 3300047323 | Bacteria | 1681 |
| 928 | Ga0495687_006285 | 3300047443 | Bacteria | 7323 |
| 929 | Ga0495675_0038437 | 3300047444 | Bacteria | 3047 |
| 930 | Ga0495675_0103049 | 3300047444 | Bacteria | 1785 |
| 931 | Ga0495675_0121302 | 3300047444 | Bacteria | 1628 |
| 932 | Ga0495675_0139174 | 3300047444 | Bacteria | 1505 |
| 933 | Ga0495685_068598 | 3300047447 | Bacteria | 1190 |
| 934 | Ga0495673_0054823 | 3300047469 | Bacteria | 1732 |
| 935 | Ga0495673_0090093 | 3300047469 | Bacteria | 1255 |
| 936 | Ga0495684_0015155 | 3300047471 | Bacteria | 5935 |
| 937 | Ga0495684_0059053 | 3300047471 | Bacteria | 2921 |
| 938 | Ga0495684_0102686 | 3300047471 | Bacteria | 2161 |
| 939 | Ga0495684_0236170 | 3300047471 | Bacteria | 1335 |
| 940 | Ga0495686_0120427 | 3300047472 | Bacteria | 1565 |
| 941 | Ga0495686_0199964 | 3300047472 | Bacteria | 1147 |
| 942 | Ga0495593_0017756 | 3300047673 | Bacteria | 4006 |
| 943 | Ga0495593_0150653 | 3300047673 | Bacteria | 1176 |
| 944 | Ga0495602_0024576 | 3300048088 | Bacteria | 5845 |
| 945 | Ga0495602_0026581 | 3300048088 | Bacteria | 5579 |
| 946 | Ga0495602_0101196 | 3300048088 | Bacteria | 2364 |
| 947 | Ga0495602_0134471 | 3300048088 | Bacteria | 1967 |
| 948 | Ga0495602_0167640 | 3300048088 | Bacteria | 1708 |
| 949 | Ga0495602_0460604 | 3300048088 | Bacteria | 896 |
| 950 | Ga0495615_0169071 | 3300048090 | Bacteria | 661 |
| 951 | Ga0495626_0151877 | 3300048091 | Bacteria | 976 |
| 952 | Ga0496100_0108826 | 3300048903 | Bacteria | 1922 |
| 953 | Ga0496100_0117362 | 3300048903 | Bacteria | 1858 |
| 954 | Ga0496100_0121789 | 3300048903 | Bacteria | 1826 |
| 955 | Ga0496100_0130864 | 3300048903 | Bacteria | 1767 |
| 956 | Ga0496100_0165765 | 3300048903 | Bacteria | 1587 |
| 957 | Ga0496100_0235512 | 3300048903 | Bacteria | 1349 |
| 958 | Ga0496100_0331630 | 3300048903 | Bacteria | 1145 |
| 959 | Ga0496101_0003782 | 3300048904 | Bacteria | 9454 |
| 960 | Ga0496101_0033757 | 3300048904 | Bacteria | 3611 |
| 961 | Ga0496101_0044088 | 3300048904 | Bacteria | 3191 |
| 962 | Ga0496101_0070190 | 3300048904 | Bacteria | 2565 |
| 963 | Ga0496101_0126355 | 3300048904 | Bacteria | 1938 |
| 964 | Ga0496102_0025556 | 3300048905 | Bacteria | 5258 |
| 965 | Ga0496102_0057710 | 3300048905 | Bacteria | 3545 |
| 966 | Ga0496102_0067796 | 3300048905 | Bacteria | 3273 |
| 967 | Ga0496102_0141715 | 3300048905 | Bacteria | 2254 |
| 968 | Ga0496102_0183077 | 3300048905 | Bacteria | 1974 |
| 969 | Ga0496102_0184885 | 3300048905 | Bacteria | 1964 |
| 970 | Ga0496102_0648413 | 3300048905 | Bacteria | 979 |
| 971 | Ga0496102_0659042 | 3300048905 | Bacteria | 970 |
| 972 | Ga0496102_0701058 | 3300048905 | Bacteria | 935 |
| 973 | Ga0496103_0049485 | 3300048906 | Bacteria | 2598 |
| 974 | Ga0496103_0196409 | 3300048906 | Bacteria | 1297 |
| 975 | Ga0496103_0327499 | 3300048906 | Bacteria | 985 |
| 976 | Ga0496104_0008069 | 3300048907 | Bacteria | 9340 |
| 977 | Ga0496104_0009739 | 3300048907 | Bacteria | 8565 |
| 978 | Ga0496104_0011099 | 3300048907 | Bacteria | 8061 |
| 979 | Ga0496104_0011247 | 3300048907 | Bacteria | 8009 |
| 980 | Ga0496104_0061017 | 3300048907 | Bacteria | 3573 |
| 981 | Ga0496104_0070610 | 3300048907 | Bacteria | 3320 |
| 982 | Ga0496104_0087161 | 3300048907 | Bacteria | 2981 |
| 983 | Ga0496104_0117781 | 3300048907 | Bacteria | 2549 |
| 984 | Ga0496104_0143961 | 3300048907 | Bacteria | 2289 |
| 985 | Ga0496104_0253095 | 3300048907 | Bacteria | 1674 |
| 986 | Ga0496104_0294924 | 3300048907 | Bacteria | 1534 |
| 987 | Ga0496104_0374708 | 3300048907 | Bacteria | 1336 |
| 988 | Ga0496105_0001065 | 3300048908 | Bacteria | 18990 |
| 989 | Ga0496105_0001708 | 3300048908 | Bacteria | 15675 |
| 990 | Ga0496105_0029404 | 3300048908 | Bacteria | 4498 |
| 991 | Ga0496105_0031695 | 3300048908 | Bacteria | 4334 |
| 992 | Ga0496105_0054157 | 3300048908 | Bacteria | 3313 |
| 993 | Ga0496105_0092136 | 3300048908 | Bacteria | 2502 |
| 994 | Ga0496105_0094691 | 3300048908 | Bacteria | 2466 |
| 995 | Ga0496105_0108474 | 3300048908 | Bacteria | 2292 |
| 996 | Ga0496105_0133400 | 3300048908 | Bacteria | 2046 |
| 997 | Ga0496105_0198024 | 3300048908 | Bacteria | 1640 |
| 998 | Ga0496106_0002611 | 3300048909 | Bacteria | 13406 |
| 999 | Ga0496106_0040583 | 3300048909 | Bacteria | 3486 |
| 1000 | Ga0496106_0135424 | 3300048909 | Bacteria | 1934 |
| 1001 | Ga0496106_0138461 | 3300048909 | Bacteria | 1913 |
| 1002 | Ga0496107_0020603 | 3300048910 | Bacteria | 4658 |
| 1003 | Ga0496107_0034039 | 3300048910 | Bacteria | 3646 |
| 1004 | Ga0496107_0038762 | 3300048910 | Bacteria | 3417 |
| 1005 | Ga0496107_0053987 | 3300048910 | Bacteria | 2899 |
| 1006 | Ga0496107_0221377 | 3300048910 | Bacteria | 1408 |
| 1007 | Ga0496107_0283467 | 3300048910 | Bacteria | 1233 |
| 1008 | Ga0496108_0017610 | 3300048911 | Bacteria | 5845 |
| 1009 | Ga0496108_0018579 | 3300048911 | Bacteria | 5694 |
| 1010 | Ga0496108_0055047 | 3300048911 | Bacteria | 3339 |
| 1011 | Ga0496108_0057622 | 3300048911 | Bacteria | 3264 |
| 1012 | Ga0496108_0095651 | 3300048911 | Bacteria | 2529 |
| 1013 | Ga0496108_0143737 | 3300048911 | Bacteria | 2056 |
| 1014 | Ga0496108_0167823 | 3300048911 | Bacteria | 1898 |
| 1015 | Ga0496108_0244187 | 3300048911 | Bacteria | 1562 |
| 1016 | Ga0496109_0001152 | 3300048912 | Bacteria | 21967 |
| 1017 | Ga0496109_0003675 | 3300048912 | Bacteria | 12814 |
| 1018 | Ga0496109_0052743 | 3300048912 | Bacteria | 3708 |
| 1019 | Ga0496109_0103705 | 3300048912 | Bacteria | 2640 |
| 1020 | Ga0496109_0115523 | 3300048912 | Bacteria | 2497 |
| 1021 | Ga0496109_0144495 | 3300048912 | Bacteria | 2225 |
| 1022 | Ga0496109_0145098 | 3300048912 | Bacteria | 2220 |
| 1023 | Ga0496109_0268704 | 3300048912 | Bacteria | 1607 |
| 1024 | Ga0496109_0317386 | 3300048912 | Bacteria | 1470 |
| 1025 | Ga0496110_0023309 | 3300048913 | Bacteria | 5263 |
| 1026 | Ga0496110_0038897 | 3300048913 | Bacteria | 4141 |
| 1027 | Ga0496110_0044214 | 3300048913 | Bacteria | 3889 |
| 1028 | Ga0496110_0046121 | 3300048913 | Bacteria | 3812 |
| 1029 | Ga0496110_0068797 | 3300048913 | Bacteria | 3134 |
| 1030 | Ga0496110_0148874 | 3300048913 | Bacteria | 2118 |
| 1031 | Ga0496110_0270405 | 3300048913 | Bacteria | 1547 |
| 1032 | Ga0496110_0599628 | 3300048913 | Bacteria | 999 |
| 1033 | Ga0496111_0000825 | 3300048914 | Bacteria | 16670 |
| 1034 | Ga0496111_0066704 | 3300048914 | Bacteria | 2614 |
| 1035 | Ga0496111_0191382 | 3300048914 | Bacteria | 1521 |
| 1036 | Ga0496111_0354787 | 3300048914 | Bacteria | 1085 |
| 1037 | Ga0496111_0417201 | 3300048914 | Bacteria | 991 |
| 1038 | Ga0496112_0000051 | 3300048915 | Bacteria | 82351 |
| 1039 | Ga0496112_0003123 | 3300048915 | Bacteria | 13585 |
| 1040 | Ga0496112_0008384 | 3300048915 | Bacteria | 9256 |
| 1041 | Ga0496112_0023197 | 3300048915 | Bacteria | 5923 |
| 1042 | Ga0496112_0026067 | 3300048915 | Bacteria | 5620 |
| 1043 | Ga0496112_0115446 | 3300048915 | Bacteria | 2655 |
| 1044 | Ga0496112_0205523 | 3300048915 | Bacteria | 1927 |
| 1045 | Ga0496112_0253569 | 3300048915 | Bacteria | 1710 |
| 1046 | Ga0496112_0256980 | 3300048915 | Bacteria | 1697 |
| 1047 | Ga0496112_0443208 | 3300048915 | Bacteria | 1237 |
| 1048 | Ga0496113_0001092 | 3300048916 | Bacteria | 14692 |
| 1049 | Ga0496113_0013878 | 3300048916 | Bacteria | 5476 |
| 1050 | Ga0496113_0021246 | 3300048916 | Bacteria | 4576 |
| 1051 | Ga0496113_0033118 | 3300048916 | Bacteria | 3760 |
| 1052 | Ga0496113_0056314 | 3300048916 | Bacteria | 2951 |
| 1053 | Ga0496113_0288571 | 3300048916 | Bacteria | 1312 |
| 1054 | Ga0496113_0550036 | 3300048916 | Bacteria | 926 |
| 1055 | Ga0496114_0144165 | 3300048917 | Bacteria | 2064 |
| 1056 | Ga0496114_0269358 | 3300048917 | Bacteria | 1500 |
| 1057 | Ga0496114_0286413 | 3300048917 | Bacteria | 1453 |
| 1058 | Ga0496114_0350983 | 3300048917 | Bacteria | 1305 |
| 1059 | Ga0496114_0493039 | 3300048917 | Bacteria | 1084 |
| 1060 | Ga0496114_0751220 | 3300048917 | Bacteria | 853 |
| 1061 | Ga0496115_0000756 | 3300048918 | Bacteria | 23793 |
| 1062 | Ga0496115_0012216 | 3300048918 | Bacteria | 6456 |
| 1063 | Ga0496115_0042668 | 3300048918 | Bacteria | 3614 |
| 1064 | Ga0496115_0045211 | 3300048918 | Bacteria | 3514 |
| 1065 | Ga0496115_0051742 | 3300048918 | Bacteria | 3293 |
| 1066 | Ga0496115_0067152 | 3300048918 | Bacteria | 2900 |
| 1067 | Ga0496115_0123786 | 3300048918 | Bacteria | 2129 |
| 1068 | Ga0496115_0139324 | 3300048918 | Bacteria | 2001 |
| 1069 | Ga0496115_0164954 | 3300048918 | Bacteria | 1832 |
| 1070 | Ga0496115_0633515 | 3300048918 | Bacteria | 847 |
| 1071 | Ga0496117_0055157 | 3300048920 | Bacteria | 2779 |
| 1072 | Ga0496118_0028998 | 3300048921 | Bacteria | 4650 |
| 1073 | Ga0496118_0052015 | 3300048921 | Bacteria | 3129 |
| 1074 | Ga0496118_0063877 | 3300048921 | Bacteria | 2706 |
| 1075 | Ga0496118_0075120 | 3300048921 | Bacteria | 2412 |
| 1076 | Ga0496118_0137394 | 3300048921 | Bacteria | 1557 |
| 1077 | Ga0496119_0000244 | 3300048922 | Bacteria | 76635 |
| 1078 | Ga0496119_0030425 | 3300048922 | Bacteria | 3639 |
| 1079 | Ga0496119_0098587 | 3300048922 | Bacteria | 1645 |
| 1080 | Ga0496119_0112556 | 3300048922 | Bacteria | 1508 |
| 1081 | Ga0496119_0140492 | 3300048922 | Bacteria | 1305 |
| 1082 | Ga0496120_0017615 | 3300048923 | Bacteria | 4622 |
| 1083 | Ga0496120_0068451 | 3300048923 | Bacteria | 1958 |
| 1084 | Ga0496120_0133462 | 3300048923 | Bacteria | 1269 |
| 1085 | Ga0496120_0152270 | 3300048923 | Bacteria | 1161 |
| 1086 | Ga0496121_0012808 | 3300048924 | Bacteria | 9079 |
| 1087 | Ga0496121_0034272 | 3300048924 | Bacteria | 4572 |
| 1088 | Ga0496121_0083676 | 3300048924 | Bacteria | 2518 |
| 1089 | Ga0496121_0121734 | 3300048924 | Bacteria | 1969 |
| 1090 | Ga0496121_0179659 | 3300048924 | Bacteria | 1528 |
| 1091 | Ga0496121_0194438 | 3300048924 | Bacteria | 1451 |
| 1092 | Ga0496122_0090902 | 3300048925 | Bacteria | 2081 |
| 1093 | Ga0496122_0122085 | 3300048925 | Bacteria | 1677 |
| 1094 | Ga0496124_0238165 | 3300048927 | Bacteria | 1355 |
| 1095 | Ga0496125_0038146 | 3300048928 | Bacteria | 4164 |
| 1096 | Ga0496125_0056583 | 3300048928 | Bacteria | 3184 |
| 1097 | Ga0496125_0137245 | 3300048928 | Bacteria | 1708 |
| 1098 | Ga0496125_0165859 | 3300048928 | Bacteria | 1492 |
| 1099 | Ga0496125_0228582 | 3300048928 | Bacteria | 1192 |
| 1100 | Ga0496126_0010948 | 3300048929 | Bacteria | 9447 |
| 1101 | Ga0496126_0057775 | 3300048929 | Bacteria | 3500 |
| 1102 | Ga0496126_0071900 | 3300048929 | Bacteria | 3078 |
| 1103 | Ga0496126_0074009 | 3300048929 | Bacteria | 3026 |
| 1104 | Ga0496126_0085689 | 3300048929 | Bacteria | 2777 |
| 1105 | Ga0496126_0101174 | 3300048929 | Bacteria | 2521 |
| 1106 | Ga0496126_0171954 | 3300048929 | Bacteria | 1845 |
| 1107 | Ga0495682_0089170 | 3300049460 | Bacteria | 1108 |
| 1108 | Ga0501067_0044541 | 3300049583 | Bacteria | 2465 |
| 1109 | nmdc:mga03683_16041_c1 | 3300050489 | Bacteria | 2806 |
| 1110 | nmdc:mga03683_163998_c1 | 3300050489 | Bacteria | 1008 |
| 1111 | nmdc:mga03683_90692_c1 | 3300050489 | Bacteria | 1332 |
| 1112 | nmdc:mga03n38_22967_c1 | 3300050490 | Bacteria | 2532 |
| 1113 | nmdc:mga03n38_27353_c1 | 3300050490 | Bacteria | 2365 |
| 1114 | nmdc:mga00v17_181806_c1 | 3300050491 | Bacteria | 1357 |
| 1115 | nmdc:mga00v17_230907_c1 | 3300050491 | Bacteria | 1199 |
| 1116 | nmdc:mga00v17_272812_c1 | 3300050491 | Bacteria | 1098 |
| 1117 | nmdc:mga0yw44_106694_c1 | 3300050492 | Bacteria | 1791 |
| 1118 | nmdc:mga0yw44_11679_c1 | 3300050492 | Bacteria | 4548 |
| 1119 | nmdc:mga0yw44_130944_c1 | 3300050492 | Bacteria | 1624 |
| 1120 | nmdc:mga0yw44_13381_c2 | 3300050492 | Bacteria | 1048 |
| 1121 | nmdc:mga0yw44_150923_c1 | 3300050492 | Bacteria | 1516 |
| 1122 | nmdc:mga0yw44_180996_c1 | 3300050492 | Bacteria | 1387 |
| 1123 | nmdc:mga0yw44_311742_c1 | 3300050492 | Bacteria | 1056 |
| 1124 | nmdc:mga0k408_143346_c1 | 3300050493 | Bacteria | 1422 |
| 1125 | nmdc:mga0k408_21086_c1 | 3300050493 | Bacteria | 3657 |
| 1126 | nmdc:mga0k408_89303_c2 | 3300050493 | Bacteria | 1014 |
| 1127 | nmdc:mga06z11_115467_c1 | 3300050494 | Bacteria | 1492 |
| 1128 | nmdc:mga06z11_17732_c1 | 3300050494 | Bacteria | 3238 |
| 1129 | nmdc:mga06z11_84253_c1 | 3300050494 | Bacteria | 1713 |
| 1130 | nmdc:mga04h51_52137_c1 | 3300050495 | Bacteria | 1377 |
| 1131 | nmdc:mga07m45_121766_c1 | 3300050496 | Bacteria | 1507 |
| 1132 | nmdc:mga07m45_176638_c1 | 3300050496 | Bacteria | 1242 |
| 1133 | nmdc:mga07m45_67113_c1 | 3300050496 | Bacteria | 2039 |
| 1134 | nmdc:mga05p37_207007_c1 | 3300050507 | Bacteria | 2373 |
| 1135 | nmdc:mga06r32_68261_c1 | 3300050510 | Bacteria | 3434 |
| 1136 | nmdc:mga08y16_523063_c1 | 3300050511 | Bacteria | 1203 |
| 1137 | nmdc:mga0n895_106524_c1 | 3300050512 | Bacteria | 2816 |
| 1138 | nmdc:mga0n895_113926_c1 | 3300050512 | Bacteria | 2722 |
| 1139 | nmdc:mga0n895_18014_c1 | 3300050512 | Bacteria | 6527 |
| 1140 | nmdc:mga0rr50_336857_c1 | 3300050513 | Bacteria | 1267 |
| 1141 | nmdc:mga0rr50_80317_c1 | 3300050513 | Bacteria | 2514 |
| 1142 | nmdc:mga08x19_37496_c1 | 3300050514 | Bacteria | 3076 |
| 1143 | nmdc:mga0a205_125945_c1 | 3300050515 | Bacteria | 2461 |
| 1144 | nmdc:mga0a205_202108_c1 | 3300050515 | Bacteria | 1877 |
| 1145 | nmdc:mga0sz30_32339_c1 | 3300050516 | Bacteria | 2170 |
| 1146 | nmdc:mga0sz30_72717_c1 | 3300050516 | Bacteria | 1482 |
| 1147 | Ga0495601_0001640 | 3300053077 | Bacteria | 12350 |
| 1148 | Ga0495601_0023203 | 3300053077 | Bacteria | 3812 |
| 1149 | Ga0495601_0023397 | 3300053077 | Unclassified | 3795 |
| 1150 | Ga0495601_0028831 | 3300053077 | Bacteria | 3440 |
| 1151 | Ga0495601_0267970 | 3300053077 | Bacteria | 1114 |
| 1152 | Ga0495612_0019127 | 3300053078 | Bacteria | 2743 |
| 1153 | Ga0500610_0028492 | 3300053079 | Bacteria | 2815 |
| 1154 | Ga0500635_0008295 | 3300053080 | Bacteria | 2841 |
| 1155 | Ga0495655_0043627 | 3300053083 | Bacteria | 1157 |
| 1156 | Ga0495595_0007612 | 3300053084 | Unclassified | 4434 |
| 1157 | Ga0495595_0027640 | 3300053084 | Bacteria | 2528 |
| 1158 | Ga0495595_0052266 | 3300053084 | Bacteria | 1895 |
| 1159 | Ga0495595_0061725 | 3300053084 | Bacteria | 1756 |
| 1160 | Ga0495595_0178811 | 3300053084 | Bacteria | 1051 |
| 1161 | Ga0495595_0221505 | 3300053084 | Bacteria | 944 |
| 1162 | Ga0495619_0008243 | 3300053085 | Bacteria | 6594 |
| 1163 | Ga0495619_0010343 | 3300053085 | Bacteria | 5872 |
| 1164 | Ga0495619_0012352 | 3300053085 | Bacteria | 5376 |
| 1165 | Ga0495619_0058763 | 3300053085 | Bacteria | 2554 |
| 1166 | Ga0495619_0122870 | 3300053085 | Bacteria | 1780 |
| 1167 | Ga0495619_0174754 | 3300053085 | Bacteria | 1486 |
| 1168 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 1169 | Ga0500643_046243 | 3300053087 | Bacteria | 1258 |
| 1170 | Ga0500647_0013414 | 3300053091 | Bacteria | 3707 |
| 1171 | Ga0500583_0063488 | 3300053092 | Bacteria | 1749 |
| 1172 | Ga0500651_0042202 | 3300053093 | Bacteria | 2874 |
| 1173 | Ga0500651_0192977 | 3300053093 | Bacteria | 1205 |
| 1174 | Ga0500566_0002168 | 3300053094 | Bacteria | 11555 |
| 1175 | Ga0500641_0009257 | 3300053096 | Bacteria | 3538 |
| 1176 | Ga0500641_0114321 | 3300053096 | Bacteria | 1162 |
| 1177 | Ga0500650_0070830 | 3300053098 | Bacteria | 1630 |
| 1178 | Ga0500555_009333 | 3300053103 | Bacteria | 2806 |
| 1179 | Ga0500557_000069 | 3300053105 | Bacteria | 39500 |
| 1180 | Ga0500562_009007 | 3300053108 | Bacteria | 2521 |
| 1181 | Ga0500562_011635 | 3300053108 | Bacteria | 2234 |
| 1182 | Ga0500572_000290 | 3300053111 | Bacteria | 18127 |
| 1183 | Ga0500595_007010 | 3300053119 | Bacteria | 4720 |
| 1184 | Ga0500626_126940 | 3300053128 | Bacteria | 1085 |
| 1185 | Ga0500642_0000089 | 3300053130 | Bacteria | 47311 |
| 1186 | Ga0500652_026345 | 3300053131 | Bacteria | 2238 |
| 1187 | Ga0500655_020696 | 3300053133 | Bacteria | 1230 |
| 1188 | Ga0500658_0090936 | 3300053134 | Bacteria | 1319 |
| 1189 | Ga0500559_0000274 | 3300053136 | Bacteria | 39917 |
| 1190 | Ga0500568_0068050 | 3300053139 | Bacteria | 1367 |
| 1191 | Ga0500585_074316 | 3300053144 | Bacteria | 1228 |
| 1192 | Ga0500603_029411 | 3300053150 | Bacteria | 1408 |
| 1193 | Ga0500604_0074264 | 3300053151 | Bacteria | 1089 |
| 1194 | Ga0500620_002584 | 3300053155 | Bacteria | 3686 |
| 1195 | Ga0500622_0020174 | 3300053156 | Bacteria | 3539 |
| 1196 | Ga0500624_010469 | 3300053157 | Bacteria | 1337 |
| 1197 | Ga0500627_0006558 | 3300053158 | Bacteria | 3977 |
| 1198 | Ga0500627_0077332 | 3300053158 | Bacteria | 1480 |
| 1199 | Ga0500633_0103990 | 3300053160 | Bacteria | 1047 |
| 1200 | Ga0500633_0113304 | 3300053160 | Bacteria | 1006 |
| 1201 | Ga0500638_060912 | 3300053162 | Bacteria | 1814 |
| 1202 | Ga0500639_116024 | 3300053163 | Bacteria | 1294 |
| 1203 | Ga0500636_0000263 | 3300053177 | Bacteria | 29138 |
| 1204 | Ga0500637_0009969 | 3300053178 | Bacteria | 4858 |
| 1205 | Ga0500637_0061988 | 3300053178 | Bacteria | 2143 |
| 1206 | Ga0500576_021480 | 3300053725 | Bacteria | 2946 |
| 1207 | Ga0500611_012241 | 3300053727 | Bacteria | 1443 |
| 1208 | Ga0500625_033352 | 3300053729 | Bacteria | 2444 |
| 1209 | Ga0500645_027638 | 3300053730 | Bacteria | 1720 |
| 1210 | Ga0500645_031956 | 3300053730 | Bacteria | 1580 |
| 1211 | Ga0500609_005242 | 3300053731 | Bacteria | 1772 |
| 1212 | Ga0500656_007136 | 3300053732 | Bacteria | 1154 |
| 1213 | Ga0500596_004264 | 3300053735 | Bacteria | 2642 |
| 1214 | Ga0500599_002544 | 3300053736 | Bacteria | 2190 |
| 1215 | Ga0500601_000788 | 3300053737 | Bacteria | 4036 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048090 | Ga0495615_0169071 | Ga0495615_0169071_11_640 | 209 |
| 2 | 3300033180 | Ga0307510_10202000 | Ga0307510_102020002 | 210 |
| 3 | 3300046454 | Ga0495592_0139601 | Ga0495592_0139601_404_1225 | 210 |
| 4 | 3300046506 | Ga0495583_0054921 | Ga0495583_0054921_453_1145 | 210 |
| 5 | 3300046507 | Ga0495606_0007533 | Ga0495606_0007533_425_1117 | 210 |
| 6 | 3300046524 | Ga0495648_0043639 | Ga0495648_0043639_1941_2633 | 210 |
| 7 | 3300046660 | Ga0495625_0365570 | Ga0495625_0365570_50_742 | 210 |
| 8 | 3300046694 | Ga0495649_0025832 | Ga0495649_0025832_1156_1848 | 210 |
| 9 | 3300047472 | Ga0495686_0120427 | Ga0495686_0120427_522_1214 | 210 |
| 10 | 3300046473 | Ga0495582_0119603 | Ga0495582_0119603_208_1029 | 216 |
| 11 | 3300048923 | Ga0496120_0133462 | Ga0496120_0133462_102_782 | 222 |
| 12 | 3300035695 | Ga0373927_0250759 | Ga0373927_0250759_179_871 | 224 |
| 13 | 3300025933 | Ga0207706_10046675 | Ga0207706_100466752 | 226 |
| 14 | iso_pu_bacteria | 2507262055 | 2507511769 | 226 |
| 15 | iso_pu_bacteria | 2508501042 | 2508694254 | 226 |
| 16 | iso_pu_bacteria | 2511231028 | 2511398537 | 226 |
| 17 | iso_pu_bacteria | 2513237092 | 2513627300 | 226 |
| 18 | iso_pu_bacteria | 2513237094 | 2513642608 | 226 |
| 19 | iso_pu_bacteria | 2513237095 | 2513648291 | 226 |
| 20 | iso_pu_bacteria | 2513237101 | 2513692673 | 226 |
| 21 | iso_pu_bacteria | 2513237102 | 2513702654 | 226 |
| 22 | iso_pu_bacteria | 2513237141 | 2513891738 | 226 |
| 23 | iso_pu_bacteria | 2513237161 | 2514013332 | 226 |
| 24 | iso_pu_bacteria | 2515154112 | 2515624824 | 226 |
| 25 | iso_pu_bacteria | 2517093001 | 2517106108 | 226 |
| 26 | iso_pu_bacteria | 2524023205 | 2524442870 | 226 |
| 27 | iso_pu_bacteria | 2524023228 | 2524539131 | 226 |
| 28 | iso_pu_bacteria | 2528768022 | 2528854597 | 226 |
| 29 | iso_pu_bacteria | 2617270735 | 2617349509 | 226 |
| 30 | iso_pu_bacteria | 2667528175 | 2671122235 | 226 |
| 31 | iso_pu_bacteria | 2728368998 | 2728752160 | 226 |
| 32 | iso_pu_bacteria | 2744054633 | 2745077363 | 226 |
| 33 | iso_pu_bacteria | 2791355196 | 2793059748 | 226 |
| 34 | iso_pu_bacteria | 2791355197 | 2793069755 | 226 |
| 35 | iso_pu_bacteria | 2802429603 | 2805919558 | 226 |
| 36 | iso_pu_bacteria | 2816332527 | 2818239866 | 226 |
| 37 | iso_pu_bacteria | 2824600985 | 2824605975 | 226 |
| 38 | iso_pu_bacteria | 2824609381 | 2824613458 | 226 |
| 39 | iso_pu_bacteria | 2824617872 | 2824625811 | 226 |
| 40 | iso_pu_bacteria | 2824626560 | 2824633466 | 226 |
| 41 | iso_pu_bacteria | 2824635225 | 2824643889 | 226 |
| 42 | iso_pu_bacteria | 2824644064 | 2824652702 | 226 |
| 43 | iso_pu_bacteria | 2824653114 | 2824657006 | 226 |
| 44 | iso_pu_bacteria | 2824661429 | 2824670135 | 226 |
| 45 | iso_pu_bacteria | 2824671348 | 2824679475 | 226 |
| 46 | iso_pu_bacteria | 2824679649 | 2824687740 | 226 |
| 47 | iso_pu_bacteria | 2824687955 | 2824696096 | 226 |
| 48 | iso_pu_bacteria | 2824696289 | 2824703408 | 226 |
| 49 | iso_pu_bacteria | 2824704595 | 2824714329 | 226 |
| 50 | iso_pu_bacteria | 2824714736 | 2824723370 | 226 |
| 51 | iso_pu_bacteria | 2824723954 | 2824732641 | 226 |
| 52 | iso_pu_bacteria | 2824753945 | 2824760703 | 226 |
| 53 | iso_pu_bacteria | 2824763712 | 2824770420 | 226 |
| 54 | iso_pu_bacteria | 2824773399 | 2824777950 | 226 |
| 55 | iso_pu_bacteria | 2838122688 | 2838128244 | 226 |
| 56 | iso_pu_bacteria | 2841941048 | 2841942136 | 226 |
| 57 | iso_pu_bacteria | 2841949485 | 2841955393 | 226 |
| 58 | iso_pu_bacteria | 2841957949 | 2841963646 | 226 |
| 59 | iso_pu_bacteria | 2841966195 | 2841971331 | 226 |
| 60 | iso_pu_bacteria | 2841974524 | 2841981624 | 226 |
| 61 | iso_pu_bacteria | 2841983080 | 2841987048 | 226 |
| 62 | iso_pu_bacteria | 2842038055 | 2842042108 | 226 |
| 63 | iso_pu_bacteria | 2842045827 | 2842050151 | 226 |
| 64 | iso_pu_bacteria | 2844315083 | 2844320975 | 226 |
| 65 | iso_pu_bacteria | 2847930680 | 2847932506 | 226 |
| 66 | iso_pu_bacteria | 2847939898 | 2847943652 | 226 |
| 67 | iso_pu_bacteria | 2857509624 | 2857515020 | 226 |
| 68 | iso_pu_bacteria | 2874590934 | 2874593609 | 226 |
| 69 | iso_pu_bacteria | 2874612657 | 2874613988 | 226 |
| 70 | iso_pu_bacteria | 2874620515 | 2874624985 | 226 |
| 71 | iso_pu_bacteria | 2874628541 | 2874633986 | 226 |
| 72 | iso_pu_bacteria | 2874645413 | 2874648378 | 226 |
| 73 | iso_pu_bacteria | 2876761206 | 2876766003 | 226 |
| 74 | iso_pu_bacteria | 2876771140 | 2876774670 | 226 |
| 75 | iso_pu_bacteria | 2876818435 | 2876821461 | 226 |
| 76 | iso_pu_bacteria | 2879074833 | 2879079238 | 226 |
| 77 | iso_pu_bacteria | 2879083081 | 2879090256 | 226 |
| 78 | iso_pu_bacteria | 2879099564 | 2879102113 | 226 |
| 79 | iso_pu_bacteria | 2879127579 | 2879131239 | 226 |
| 80 | iso_pu_bacteria | 2879142872 | 2879145012 | 226 |
| 81 | iso_pu_bacteria | 2881364244 | 2881371262 | 226 |
| 82 | iso_pu_bacteria | 2881665667 | 2881667898 | 226 |
| 83 | iso_pu_bacteria | 2885374607 | 2885378814 | 226 |
| 84 | iso_pu_bacteria | 2885409591 | 2885414308 | 226 |
| 85 | iso_pu_bacteria | 2888378607 | 2888386343 | 226 |
| 86 | iso_pu_bacteria | 2888419890 | 2888426504 | 226 |
| 87 | iso_pu_bacteria | 2903727486 | 2903730784 | 226 |
| 88 | iso_pu_bacteria | 2903748898 | 2903750822 | 226 |
| 89 | iso_pu_bacteria | 2904666416 | 2904669040 | 226 |
| 90 | iso_pu_bacteria | 2904690495 | 2904698257 | 226 |
| 91 | iso_pu_bacteria | 2904699407 | 2904706882 | 226 |
| 92 | iso_pu_bacteria | 2904711408 | 2904715626 | 226 |
| 93 | iso_pu_bacteria | 2906602504 | 2906605262 | 226 |
| 94 | iso_pu_bacteria | 2906610324 | 2906615807 | 226 |
| 95 | iso_pu_bacteria | 2906626472 | 2906627566 | 226 |
| 96 | iso_pu_bacteria | 2906643746 | 2906651592 | 226 |
| 97 | iso_pu_bacteria | 2908739725 | 2908740823 | 226 |
| 98 | iso_pu_bacteria | 2908756301 | 2908762857 | 226 |
| 99 | iso_pu_bacteria | 2922368715 | 2922376986 | 226 |
| 100 | iso_pu_bacteria | 2922393267 | 2922396137 | 226 |
| 101 | iso_pu_bacteria | 2922425934 | 2922432217 | 226 |
| 102 | iso_pu_bacteria | 2929615660 | 2929620354 | 226 |
| 103 | iso_pu_bacteria | 2929624759 | 2929632983 | 226 |
| 104 | iso_pu_bacteria | 2932784394 | 2932790063 | 226 |
| 105 | iso_pu_bacteria | 2932794094 | 2932799389 | 226 |
| 106 | iso_pu_bacteria | 2932801729 | 2932802212 | 226 |
| 107 | iso_pu_bacteria | 2932809354 | 2932817836 | 226 |
| 108 | iso_pu_bacteria | 2932818245 | 2932823960 | 226 |
| 109 | iso_pu_bacteria | 2932828146 | 2932833483 | 226 |
| 110 | iso_pu_bacteria | 2933577622 | 2933582273 | 226 |
| 111 | iso_pu_bacteria | 2935616580 | 2935621244 | 226 |
| 112 | iso_pu_bacteria | 2935630451 | 2935630917 | 226 |
| 113 | iso_pu_bacteria | 2935638405 | 2935643436 | 226 |
| 114 | iso_pu_bacteria | 2935648319 | 2935650582 | 226 |
| 115 | iso_pu_bacteria | 2935656913 | 2935663024 | 226 |
| 116 | iso_pu_bacteria | 2935665750 | 2935671241 | 226 |
| 117 | iso_pu_bacteria | 2935675223 | 2935681153 | 226 |
| 118 | iso_pu_bacteria | 2935684952 | 2935689508 | 226 |
| 119 | iso_pu_bacteria | 2935694250 | 2935700080 | 226 |
| 120 | iso_pu_bacteria | 2935703347 | 2935710711 | 226 |
| 121 | iso_pu_bacteria | 2935713505 | 2935720759 | 226 |
| 122 | iso_pu_bacteria | 2935722832 | 2935727930 | 226 |
| 123 | iso_pu_bacteria | 2935732158 | 2935737474 | 226 |
| 124 | iso_pu_bacteria | 2935741537 | 2935746465 | 226 |
| 125 | iso_pu_bacteria | 2935750917 | 2935757432 | 226 |
| 126 | iso_pu_bacteria | 2935760218 | 2935763810 | 226 |
| 127 | iso_pu_bacteria | 2935769743 | 2935772414 | 226 |
| 128 | iso_pu_bacteria | 2935777560 | 2935781366 | 226 |
| 129 | iso_pu_bacteria | 2935785616 | 2935787865 | 226 |
| 130 | iso_pu_bacteria | 2935793552 | 2935793578 | 226 |
| 131 | iso_pu_bacteria | 2935801545 | 2935807790 | 226 |
| 132 | iso_pu_bacteria | 2935810662 | 2935818307 | 226 |
| 133 | iso_pu_bacteria | 2935827899 | 2935832953 | 226 |
| 134 | iso_pu_bacteria | 2935837841 | 2935844375 | 226 |
| 135 | iso_pu_bacteria | 2935855204 | 2935859563 | 226 |
| 136 | iso_pu_bacteria | 2935864058 | 2935871372 | 226 |
| 137 | iso_pu_bacteria | 2935873716 | 2935879115 | 226 |
| 138 | iso_pu_bacteria | 2935883170 | 2935889548 | 226 |
| 139 | iso_pu_bacteria | 2935908558 | 2935911130 | 226 |
| 140 | iso_pu_bacteria | 2935916978 | 2935920633 | 226 |
| 141 | iso_pu_bacteria | 2935926038 | 2935928159 | 226 |
| 142 | iso_pu_bacteria | 2935934488 | 2935937804 | 226 |
| 143 | iso_pu_bacteria | 2935942939 | 2935945086 | 226 |
| 144 | iso_pu_bacteria | 2935951376 | 2935954409 | 226 |
| 145 | iso_pu_bacteria | 2935959822 | 2935967002 | 226 |
| 146 | iso_pu_bacteria | 2935967501 | 2935971324 | 226 |
| 147 | iso_pu_bacteria | 2935975950 | 2935983099 | 226 |
| 148 | iso_pu_bacteria | 2935984226 | 2935990746 | 226 |
| 149 | iso_pu_bacteria | 2935992306 | 2935996758 | 226 |
| 150 | iso_pu_bacteria | 2936002035 | 2936008634 | 226 |
| 151 | iso_pu_bacteria | 2936011229 | 2936017062 | 226 |
| 152 | iso_pu_bacteria | 2936019824 | 2936027496 | 226 |
| 153 | iso_pu_bacteria | 2936028420 | 2936036320 | 226 |
| 154 | iso_pu_bacteria | 2936037263 | 2936044875 | 226 |
| 155 | iso_pu_bacteria | 2936046547 | 2936050805 | 226 |
| 156 | iso_pu_bacteria | 2936055302 | 2936063345 | 226 |
| 157 | iso_pu_bacteria | 2940556831 | 2940563744 | 226 |
| 158 | iso_pu_bacteria | 2941507105 | 2941507569 | 226 |
| 159 | iso_pu_bacteria | 2941515067 | 2941515996 | 226 |
| 160 | iso_pu_bacteria | 2941523033 | 2941523296 | 226 |
| 161 | iso_pu_bacteria | 2941531003 | 2941537749 | 226 |
| 162 | iso_pu_bacteria | 2941538514 | 2941542707 | 226 |
| 163 | iso_pu_bacteria | 3005474847 | 3005476753 | 226 |
| 164 | iso_pu_bacteria | 3005483717 | 3005487596 | 226 |
| 165 | iso_pu_bacteria | 3005587118 | 3005591351 | 226 |
| 166 | iso_pu_bacteria | 3005594810 | 3005601270 | 226 |
| 167 | iso_pu_bacteria | 3005710791 | 3005716749 | 226 |
| 168 | iso_pu_bacteria | 8006926726 | 8006926893 | 226 |
| 169 | iso_pu_bacteria | 8016511872 | 8016519611 | 226 |
| 170 | iso_pu_bacteria | 8016522445 | 8016524754 | 226 |
| 171 | iso_pu_bacteria | 8016530956 | 8016538324 | 226 |
| 172 | iso_pu_bacteria | 8016548790 | 8016550673 | 226 |
| 173 | iso_pu_bacteria | 8016557553 | 8016559090 | 226 |
| 174 | iso_pu_bacteria | 8016566248 | 8016567985 | 226 |
| 175 | iso_pu_bacteria | 8016575299 | 8016580671 | 226 |
| 176 | iso_pu_bacteria | 8016583857 | 8016588149 | 226 |
| 177 | iso_pu_bacteria | 8016595262 | 8016597047 | 226 |
| 178 | iso_pu_bacteria | 8016603502 | 8016607958 | 226 |
| 179 | iso_pu_bacteria | 8016613128 | 8016619741 | 226 |
| 180 | iso_pu_bacteria | 8016622563 | 8016624338 | 226 |
| 181 | iso_pu_bacteria | 8017057580 | 8017065918 | 226 |
| 182 | iso_pu_bacteria | 8019530166 | 8019537996 | 226 |
| 183 | iso_pu_bacteria | 8019538911 | 8019547293 | 226 |
| 184 | iso_pu_bacteria | 8019547302 | 8019551356 | 226 |
| 185 | iso_pu_bacteria | 8019555841 | 8019564009 | 226 |
| 186 | iso_pu_bacteria | 8019565922 | 8019574081 | 226 |
| 187 | iso_pu_bacteria | 8019576017 | 8019578731 | 226 |
| 188 | iso_pu_bacteria | 8019586578 | 8019596773 | 226 |
| 189 | iso_pu_bacteria | 8019608314 | 8019613615 | 226 |
| 190 | iso_pu_bacteria | 8019619141 | 8019624272 | 226 |
| 191 | iso_pu_bacteria | 8019629233 | 8019637733 | 226 |
| 192 | iso_pu_bacteria | 8019638758 | 8019641875 | 226 |
| 193 | iso_pu_bacteria | 8019648815 | 8019653816 | 226 |
| 194 | iso_pu_bacteria | 8019659431 | 8019665667 | 226 |
| 195 | iso_pu_bacteria | 8019668869 | 8019675204 | 226 |
| 196 | iso_pu_bacteria | 8019687851 | 8019694881 | 226 |
| 197 | iso_pu_bacteria | 8055742211 | 8055749889 | 226 |
| 198 | iso_pu_bacteria | 8056967851 | 8056969784 | 226 |
| 199 | iso_pu_bacteria | 2513237139 | 2513875188 | 227 |
| 200 | iso_pu_bacteria | 8006933436 | 8006934666 | 227 |
| 201 | iso_pu_bacteria | 8006973647 | 8006974635 | 227 |
| 202 | 3300005365 | Ga0070688_100451454 | Ga0070688_1004514542 | 229 |
| 203 | 3300005441 | Ga0070700_100458675 | Ga0070700_1004586751 | 229 |
| 204 | 3300005458 | Ga0070681_10039976 | Ga0070681_100399764 | 229 |
| 205 | 3300005518 | Ga0070699_100009853 | Ga0070699_1000098536 | 229 |
| 206 | 3300005518 | Ga0070699_100208547 | Ga0070699_1002085472 | 229 |
| 207 | 3300005549 | Ga0070704_100019036 | Ga0070704_1000190364 | 229 |
| 208 | 3300009553 | Ga0105249_10496004 | Ga0105249_104960041 | 229 |
| 209 | 3300010159 | Ga0099796_10055490 | Ga0099796_100554902 | 229 |
| 210 | 3300014326 | Ga0157380_10195498 | Ga0157380_101954982 | 229 |
| 211 | 3300037853 | Ga0436364_0974948 | Ga0436364_0974948_269_958 | 229 |
| 212 | 3300048915 | Ga0496112_0256980 | Ga0496112_0256980_750_1439 | 229 |
| 213 | 3300050492 | nmdc:mga0yw44_180996_c1 | nmdc:mga0yw44_180996_c1_389_1081 | 229 |
| 214 | 3300003203 | JGI25406J46586_10001020 | JGI25406J46586_100010204 | 230 |
| 215 | 3300003215 | JGI25153J46596_10000804 | JGI25153J46596_100008041 | 230 |
| 216 | 3300003215 | JGI25153J46596_10006566 | JGI25153J46596_100065661 | 230 |
| 217 | 3300003215 | JGI25153J46596_10058875 | JGI25153J46596_100588752 | 230 |
| 218 | 3300003354 | JGI25160J50197_1005212 | JGI25160J50197_10052126 | 230 |
| 219 | 3300003752 | Ga0055539_1009970 | Ga0055539_10099702 | 230 |
| 220 | 3300003771 | Ga0055526_1052374 | Ga0055526_10523742 | 230 |
| 221 | 3300003911 | JGI25405J52794_10036643 | JGI25405J52794_100366431 | 230 |
| 222 | 3300004625 | Ga0055543_1006157 | Ga0055543_10061573 | 230 |
| 223 | 3300005262 | Ga0065165_1000701 | Ga0065165_10007013 | 230 |
| 224 | 3300005289 | Ga0065704_10215145 | Ga0065704_102151452 | 230 |
| 225 | 3300005295 | Ga0065707_10098746 | Ga0065707_100987462 | 230 |
| 226 | 3300005328 | Ga0070676_10097147 | Ga0070676_100971472 | 230 |
| 227 | 3300005328 | Ga0070676_10121744 | Ga0070676_101217442 | 230 |
| 228 | 3300005329 | Ga0070683_100017619 | Ga0070683_1000176194 | 230 |
| 229 | 3300005329 | Ga0070683_100025232 | Ga0070683_1000252321 | 230 |
| 230 | 3300005330 | Ga0070690_100230713 | Ga0070690_1002307132 | 230 |
| 231 | 3300005331 | Ga0070670_100239789 | Ga0070670_1002397892 | 230 |
| 232 | 3300005334 | Ga0068869_100074999 | Ga0068869_1000749991 | 230 |
| 233 | 3300005334 | Ga0068869_100123560 | Ga0068869_1001235601 | 230 |
| 234 | 3300005335 | Ga0070666_10045804 | Ga0070666_100458043 | 230 |
| 235 | 3300005336 | Ga0070680_100010505 | Ga0070680_1000105055 | 230 |
| 236 | 3300005336 | Ga0070680_100052127 | Ga0070680_1000521273 | 230 |
| 237 | 3300005336 | Ga0070680_100079764 | Ga0070680_1000797641 | 230 |
| 238 | 3300005336 | Ga0070680_100117683 | Ga0070680_1001176833 | 230 |
| 239 | 3300005336 | Ga0070680_100224201 | Ga0070680_1002242011 | 230 |
| 240 | 3300005338 | Ga0068868_100111298 | Ga0068868_1001112982 | 230 |
| 241 | 3300005338 | Ga0068868_100272363 | Ga0068868_1002723632 | 230 |
| 242 | 3300005338 | Ga0068868_100459352 | Ga0068868_1004593521 | 230 |
| 243 | 3300005339 | Ga0070660_100036145 | Ga0070660_1000361454 | 230 |
| 244 | 3300005344 | Ga0070661_100093421 | Ga0070661_1000934216 | 230 |
| 245 | 3300005347 | Ga0070668_100073802 | Ga0070668_1000738023 | 230 |
| 246 | 3300005353 | Ga0070669_100084222 | Ga0070669_1000842223 | 230 |
| 247 | 3300005353 | Ga0070669_100286917 | Ga0070669_1002869172 | 230 |
| 248 | 3300005354 | Ga0070675_100228008 | Ga0070675_1002280082 | 230 |
| 249 | 3300005354 | Ga0070675_100703003 | Ga0070675_1007030032 | 230 |
| 250 | 3300005355 | Ga0070671_100006252 | Ga0070671_1000062522 | 230 |
| 251 | 3300005355 | Ga0070671_100075956 | Ga0070671_1000759562 | 230 |
| 252 | 3300005355 | Ga0070671_100228249 | Ga0070671_1002282492 | 230 |
| 253 | 3300005364 | Ga0070673_100450375 | Ga0070673_1004503753 | 230 |
| 254 | 3300005366 | Ga0070659_100061054 | Ga0070659_1000610543 | 230 |
| 255 | 3300005367 | Ga0070667_100056443 | Ga0070667_1000564432 | 230 |
| 256 | 3300005367 | Ga0070667_100271815 | Ga0070667_1002718152 | 230 |
| 257 | 3300005367 | Ga0070667_100460702 | Ga0070667_1004607022 | 230 |
| 258 | 3300005367 | Ga0070667_101115238 | Ga0070667_1011152381 | 230 |
| 259 | 3300005434 | Ga0070709_10007584 | Ga0070709_100075844 | 230 |
| 260 | 3300005434 | Ga0070709_10310108 | Ga0070709_103101082 | 230 |
| 261 | 3300005435 | Ga0070714_100019222 | Ga0070714_1000192225 | 230 |
| 262 | 3300005435 | Ga0070714_100027369 | Ga0070714_1000273694 | 230 |
| 263 | 3300005435 | Ga0070714_100067406 | Ga0070714_1000674062 | 230 |
| 264 | 3300005435 | Ga0070714_100084184 | Ga0070714_1000841842 | 230 |
| 265 | 3300005435 | Ga0070714_100142258 | Ga0070714_1001422582 | 230 |
| 266 | 3300005435 | Ga0070714_100151239 | Ga0070714_1001512392 | 230 |
| 267 | 3300005435 | Ga0070714_100480520 | Ga0070714_1004805202 | 230 |
| 268 | 3300005436 | Ga0070713_100001489 | Ga0070713_10000148910 | 230 |
| 269 | 3300005436 | Ga0070713_100009110 | Ga0070713_1000091102 | 230 |
| 270 | 3300005436 | Ga0070713_100023775 | Ga0070713_1000237751 | 230 |
| 271 | 3300005436 | Ga0070713_100025632 | Ga0070713_1000256323 | 230 |
| 272 | 3300005436 | Ga0070713_100129793 | Ga0070713_1001297932 | 230 |
| 273 | 3300005436 | Ga0070713_100233179 | Ga0070713_1002331792 | 230 |
| 274 | 3300005436 | Ga0070713_100327201 | Ga0070713_1003272012 | 230 |
| 275 | 3300005437 | Ga0070710_10000992 | Ga0070710_1000099210 | 230 |
| 276 | 3300005437 | Ga0070710_10109063 | Ga0070710_101090632 | 230 |
| 277 | 3300005438 | Ga0070701_10165576 | Ga0070701_101655763 | 230 |
| 278 | 3300005439 | Ga0070711_100013172 | Ga0070711_1000131726 | 230 |
| 279 | 3300005439 | Ga0070711_100014021 | Ga0070711_1000140217 | 230 |
| 280 | 3300005439 | Ga0070711_100017355 | Ga0070711_1000173554 | 230 |
| 281 | 3300005439 | Ga0070711_100087592 | Ga0070711_1000875922 | 230 |
| 282 | 3300005439 | Ga0070711_100232879 | Ga0070711_1002328792 | 230 |
| 283 | 3300005440 | Ga0070705_100112482 | Ga0070705_1001124822 | 230 |
| 284 | 3300005440 | Ga0070705_100312005 | Ga0070705_1003120051 | 230 |
| 285 | 3300005455 | Ga0070663_100014207 | Ga0070663_1000142075 | 230 |
| 286 | 3300005455 | Ga0070663_100024630 | Ga0070663_1000246302 | 230 |
| 287 | 3300005455 | Ga0070663_100048295 | Ga0070663_1000482953 | 230 |
| 288 | 3300005455 | Ga0070663_100088872 | Ga0070663_1000888723 | 230 |
| 289 | 3300005455 | Ga0070663_100208158 | Ga0070663_1002081582 | 230 |
| 290 | 3300005456 | Ga0070678_100337425 | Ga0070678_1003374253 | 230 |
| 291 | 3300005457 | Ga0070662_100140328 | Ga0070662_1001403282 | 230 |
| 292 | 3300005457 | Ga0070662_100327595 | Ga0070662_1003275951 | 230 |
| 293 | 3300005458 | Ga0070681_10088456 | Ga0070681_100884562 | 230 |
| 294 | 3300005458 | Ga0070681_10099965 | Ga0070681_100999653 | 230 |
| 295 | 3300005458 | Ga0070681_10409761 | Ga0070681_104097612 | 230 |
| 296 | 3300005458 | Ga0070681_10418163 | Ga0070681_104181631 | 230 |
| 297 | 3300005459 | Ga0068867_100247412 | Ga0068867_1002474121 | 230 |
| 298 | 3300005467 | Ga0070706_100115771 | Ga0070706_1001157715 | 230 |
| 299 | 3300005468 | Ga0070707_100202705 | Ga0070707_1002027052 | 230 |
| 300 | 3300005468 | Ga0070707_100317350 | Ga0070707_1003173502 | 230 |
| 301 | 3300005518 | Ga0070699_100206939 | Ga0070699_1002069392 | 230 |
| 302 | 3300005530 | Ga0070679_100005756 | Ga0070679_1000057566 | 230 |
| 303 | 3300005530 | Ga0070679_100015208 | Ga0070679_1000152087 | 230 |
| 304 | 3300005530 | Ga0070679_100137820 | Ga0070679_1001378202 | 230 |
| 305 | 3300005530 | Ga0070679_100150084 | Ga0070679_1001500841 | 230 |
| 306 | 3300005535 | Ga0070684_100150192 | Ga0070684_1001501922 | 230 |
| 307 | 3300005535 | Ga0070684_100161283 | Ga0070684_1001612832 | 230 |
| 308 | 3300005536 | Ga0070697_100006018 | Ga0070697_1000060182 | 230 |
| 309 | 3300005539 | Ga0068853_100165253 | Ga0068853_1001652533 | 230 |
| 310 | 3300005539 | Ga0068853_100188949 | Ga0068853_1001889492 | 230 |
| 311 | 3300005539 | Ga0068853_100218842 | Ga0068853_1002188422 | 230 |
| 312 | 3300005539 | Ga0068853_100602922 | Ga0068853_1006029222 | 230 |
| 313 | 3300005543 | Ga0070672_100198425 | Ga0070672_1001984252 | 230 |
| 314 | 3300005545 | Ga0070695_100411581 | Ga0070695_1004115812 | 230 |
| 315 | 3300005546 | Ga0070696_100056279 | Ga0070696_1000562792 | 230 |
| 316 | 3300005546 | Ga0070696_100658708 | Ga0070696_1006587081 | 230 |
| 317 | 3300005547 | Ga0070693_100064920 | Ga0070693_1000649202 | 230 |
| 318 | 3300005547 | Ga0070693_100175691 | Ga0070693_1001756912 | 230 |
| 319 | 3300005548 | Ga0070665_100085403 | Ga0070665_1000854032 | 230 |
| 320 | 3300005548 | Ga0070665_100106310 | Ga0070665_1001063103 | 230 |
| 321 | 3300005548 | Ga0070665_100266993 | Ga0070665_1002669932 | 230 |
| 322 | 3300005548 | Ga0070665_100325219 | Ga0070665_1003252192 | 230 |
| 323 | 3300005548 | Ga0070665_100369316 | Ga0070665_1003693162 | 230 |
| 324 | 3300005548 | Ga0070665_100482234 | Ga0070665_1004822342 | 230 |
| 325 | 3300005548 | Ga0070665_100974957 | Ga0070665_1009749572 | 230 |
| 326 | 3300005563 | Ga0068855_100040685 | Ga0068855_1000406852 | 230 |
| 327 | 3300005563 | Ga0068855_100050976 | Ga0068855_1000509764 | 230 |
| 328 | 3300005563 | Ga0068855_100099474 | Ga0068855_1000994743 | 230 |
| 329 | 3300005563 | Ga0068855_100194372 | Ga0068855_1001943722 | 230 |
| 330 | 3300005563 | Ga0068855_100277393 | Ga0068855_1002773932 | 230 |
| 331 | 3300005564 | Ga0070664_100218889 | Ga0070664_1002188892 | 230 |
| 332 | 3300005564 | Ga0070664_100373957 | Ga0070664_1003739571 | 230 |
| 333 | 3300005577 | Ga0068857_100062281 | Ga0068857_1000622812 | 230 |
| 334 | 3300005577 | Ga0068857_100071339 | Ga0068857_1000713392 | 230 |
| 335 | 3300005577 | Ga0068857_100104583 | Ga0068857_1001045832 | 230 |
| 336 | 3300005578 | Ga0068854_100092958 | Ga0068854_1000929582 | 230 |
| 337 | 3300005578 | Ga0068854_100191680 | Ga0068854_1001916802 | 230 |
| 338 | 3300005614 | Ga0068856_100000680 | Ga0068856_10000068037 | 230 |
| 339 | 3300005614 | Ga0068856_100158954 | Ga0068856_1001589543 | 230 |
| 340 | 3300005614 | Ga0068856_100540367 | Ga0068856_1005403672 | 230 |
| 341 | 3300005614 | Ga0068856_100609299 | Ga0068856_1006092991 | 230 |
| 342 | 3300005614 | Ga0068856_100687080 | Ga0068856_1006870802 | 230 |
| 343 | 3300005615 | Ga0070702_100438987 | Ga0070702_1004389871 | 230 |
| 344 | 3300005616 | Ga0068852_100005622 | Ga0068852_1000056222 | 230 |
| 345 | 3300005616 | Ga0068852_100023372 | Ga0068852_1000233722 | 230 |
| 346 | 3300005616 | Ga0068852_100117720 | Ga0068852_1001177202 | 230 |
| 347 | 3300005616 | Ga0068852_100145340 | Ga0068852_1001453403 | 230 |
| 348 | 3300005616 | Ga0068852_100627694 | Ga0068852_1006276942 | 230 |
| 349 | 3300005617 | Ga0068859_100380780 | Ga0068859_1003807802 | 230 |
| 350 | 3300005618 | Ga0068864_100279930 | Ga0068864_1002799302 | 230 |
| 351 | 3300005718 | Ga0068866_10373203 | Ga0068866_103732032 | 230 |
| 352 | 3300005719 | Ga0068861_100345994 | Ga0068861_1003459942 | 230 |
| 353 | 3300005719 | Ga0068861_100436992 | Ga0068861_1004369922 | 230 |
| 354 | 3300005719 | Ga0068861_100473846 | Ga0068861_1004738462 | 230 |
| 355 | 3300005834 | Ga0068851_10003594 | Ga0068851_100035947 | 230 |
| 356 | 3300005841 | Ga0068863_100092102 | Ga0068863_1000921024 | 230 |
| 357 | 3300005841 | Ga0068863_100930360 | Ga0068863_1009303602 | 230 |
| 358 | 3300005842 | Ga0068858_100097039 | Ga0068858_1000970393 | 230 |
| 359 | 3300005842 | Ga0068858_100101774 | Ga0068858_1001017742 | 230 |
| 360 | 3300005842 | Ga0068858_100225054 | Ga0068858_1002250542 | 230 |
| 361 | 3300005842 | Ga0068858_100347456 | Ga0068858_1003474562 | 230 |
| 362 | 3300005842 | Ga0068858_100703364 | Ga0068858_1007033642 | 230 |
| 363 | 3300005842 | Ga0068858_100942837 | Ga0068858_1009428371 | 230 |
| 364 | 3300005843 | Ga0068860_100042873 | Ga0068860_1000428734 | 230 |
| 365 | 3300005844 | Ga0068862_100054688 | Ga0068862_1000546882 | 230 |
| 366 | 3300005844 | Ga0068862_100198629 | Ga0068862_1001986291 | 230 |
| 367 | 3300005937 | Ga0081455_10002021 | Ga0081455_1000202115 | 230 |
| 368 | 3300005937 | Ga0081455_10005151 | Ga0081455_1000515112 | 230 |
| 369 | 3300005937 | Ga0081455_10026629 | Ga0081455_100266294 | 230 |
| 370 | 3300005937 | Ga0081455_10123567 | Ga0081455_101235672 | 230 |
| 371 | 3300005937 | Ga0081455_10198877 | Ga0081455_101988772 | 230 |
| 372 | 3300005981 | Ga0081538_10059078 | Ga0081538_100590782 | 230 |
| 373 | 3300005983 | Ga0081540_1002468 | Ga0081540_10024686 | 230 |
| 374 | 3300005983 | Ga0081540_1005678 | Ga0081540_10056789 | 230 |
| 375 | 3300005983 | Ga0081540_1021213 | Ga0081540_10212132 | 230 |
| 376 | 3300005983 | Ga0081540_1038858 | Ga0081540_10388582 | 230 |
| 377 | 3300005983 | Ga0081540_1048004 | Ga0081540_10480042 | 230 |
| 378 | 3300005983 | Ga0081540_1063911 | Ga0081540_10639111 | 230 |
| 379 | 3300005983 | Ga0081540_1115275 | Ga0081540_11152752 | 230 |
| 380 | 3300005985 | Ga0081539_10000486 | Ga0081539_1000048642 | 230 |
| 381 | 3300005985 | Ga0081539_10050525 | Ga0081539_100505252 | 230 |
| 382 | 3300005985 | Ga0081539_10214037 | Ga0081539_102140372 | 230 |
| 383 | 3300006028 | Ga0070717_10000990 | Ga0070717_1000099016 | 230 |
| 384 | 3300006028 | Ga0070717_10051191 | Ga0070717_100511912 | 230 |
| 385 | 3300006028 | Ga0070717_10131446 | Ga0070717_101314462 | 230 |
| 386 | 3300006028 | Ga0070717_10147553 | Ga0070717_101475532 | 230 |
| 387 | 3300006028 | Ga0070717_10269953 | Ga0070717_102699532 | 230 |
| 388 | 3300006028 | Ga0070717_10292913 | Ga0070717_102929133 | 230 |
| 389 | 3300006038 | Ga0075365_10004620 | Ga0075365_100046202 | 230 |
| 390 | 3300006038 | Ga0075365_10006567 | Ga0075365_100065672 | 230 |
| 391 | 3300006038 | Ga0075365_10070651 | Ga0075365_100706513 | 230 |
| 392 | 3300006038 | Ga0075365_10086976 | Ga0075365_100869762 | 230 |
| 393 | 3300006042 | Ga0075368_10010675 | Ga0075368_100106753 | 230 |
| 394 | 3300006042 | Ga0075368_10021010 | Ga0075368_100210102 | 230 |
| 395 | 3300006048 | Ga0075363_100011493 | Ga0075363_1000114933 | 230 |
| 396 | 3300006048 | Ga0075363_100028373 | Ga0075363_1000283732 | 230 |
| 397 | 3300006051 | Ga0075364_10007860 | Ga0075364_100078603 | 230 |
| 398 | 3300006051 | Ga0075364_10009406 | Ga0075364_100094066 | 230 |
| 399 | 3300006051 | Ga0075364_10076927 | Ga0075364_100769272 | 230 |
| 400 | 3300006163 | Ga0070715_10004151 | Ga0070715_100041518 | 230 |
| 401 | 3300006173 | Ga0070716_100009679 | Ga0070716_1000096791 | 230 |
| 402 | 3300006173 | Ga0070716_100230086 | Ga0070716_1002300862 | 230 |
| 403 | 3300006173 | Ga0070716_100244920 | Ga0070716_1002449202 | 230 |
| 404 | 3300006175 | Ga0070712_100117627 | Ga0070712_1001176273 | 230 |
| 405 | 3300006175 | Ga0070712_100146036 | Ga0070712_1001460362 | 230 |
| 406 | 3300006175 | Ga0070712_100220599 | Ga0070712_1002205991 | 230 |
| 407 | 3300006175 | Ga0070712_100436219 | Ga0070712_1004362192 | 230 |
| 408 | 3300006177 | Ga0075362_10007954 | Ga0075362_100079543 | 230 |
| 409 | 3300006177 | Ga0075362_10051963 | Ga0075362_100519633 | 230 |
| 410 | 3300006178 | Ga0075367_10018244 | Ga0075367_100182442 | 230 |
| 411 | 3300006178 | Ga0075367_10026441 | Ga0075367_100264412 | 230 |
| 412 | 3300006186 | Ga0075369_10040871 | Ga0075369_100408712 | 230 |
| 413 | 3300006194 | Ga0075427_10000325 | Ga0075427_100003254 | 230 |
| 414 | 3300006195 | Ga0075366_10185936 | Ga0075366_101859361 | 230 |
| 415 | 3300006237 | Ga0097621_100232981 | Ga0097621_1002329812 | 230 |
| 416 | 3300006358 | Ga0068871_100037598 | Ga0068871_1000375984 | 230 |
| 417 | 3300006358 | Ga0068871_101094563 | Ga0068871_1010945631 | 230 |
| 418 | 3300006844 | Ga0075428_100010666 | Ga0075428_1000106667 | 230 |
| 419 | 3300006844 | Ga0075428_100221751 | Ga0075428_1002217512 | 230 |
| 420 | 3300006844 | Ga0075428_100357100 | Ga0075428_1003571002 | 230 |
| 421 | 3300006846 | Ga0075430_100007887 | Ga0075430_1000078873 | 230 |
| 422 | 3300006846 | Ga0075430_100066957 | Ga0075430_1000669573 | 230 |
| 423 | 3300006846 | Ga0075430_100280650 | Ga0075430_1002806503 | 230 |
| 424 | 3300006847 | Ga0075431_100031468 | Ga0075431_1000314684 | 230 |
| 425 | 3300006852 | Ga0075433_10004925 | Ga0075433_100049259 | 230 |
| 426 | 3300006852 | Ga0075433_10168068 | Ga0075433_101680682 | 230 |
| 427 | 3300006871 | Ga0075434_100000317 | Ga0075434_10000031735 | 230 |
| 428 | 3300006871 | Ga0075434_100143535 | Ga0075434_1001435352 | 230 |
| 429 | 3300006871 | Ga0075434_100330941 | Ga0075434_1003309412 | 230 |
| 430 | 3300006871 | Ga0075434_100855394 | Ga0075434_1008553941 | 230 |
| 431 | 3300006880 | Ga0075429_100006024 | Ga0075429_1000060249 | 230 |
| 432 | 3300006881 | Ga0068865_100253947 | Ga0068865_1002539471 | 230 |
| 433 | 3300006881 | Ga0068865_100266361 | Ga0068865_1002663612 | 230 |
| 434 | 3300006931 | Ga0097620_100144495 | Ga0097620_1001444952 | 230 |
| 435 | 3300006931 | Ga0097620_100380781 | Ga0097620_1003807811 | 230 |
| 436 | 3300006931 | Ga0097620_100764399 | Ga0097620_1007643991 | 230 |
| 437 | 3300006941 | Ga0099825_1025113 | Ga0099825_10251132 | 230 |
| 438 | 3300006942 | Ga0099824_1010060 | Ga0099824_101006010 | 230 |
| 439 | 3300006942 | Ga0099824_1022821 | Ga0099824_10228213 | 230 |
| 440 | 3300006943 | Ga0099822_1001406 | Ga0099822_100140610 | 230 |
| 441 | 3300006943 | Ga0099822_1050681 | Ga0099822_10506812 | 230 |
| 442 | 3300006944 | Ga0099823_1014974 | Ga0099823_10149742 | 230 |
| 443 | 3300007076 | Ga0075435_100005165 | Ga0075435_1000051653 | 230 |
| 444 | 3300007076 | Ga0075435_100057684 | Ga0075435_1000576843 | 230 |
| 445 | 3300007076 | Ga0075435_100214632 | Ga0075435_1002146321 | 230 |
| 446 | 3300007076 | Ga0075435_100231297 | Ga0075435_1002312972 | 230 |
| 447 | 3300007265 | Ga0099794_10122002 | Ga0099794_101220022 | 230 |
| 448 | 3300007788 | Ga0099795_10024254 | Ga0099795_100242542 | 230 |
| 449 | 3300007788 | Ga0099795_10120540 | Ga0099795_101205402 | 230 |
| 450 | 3300009092 | Ga0105250_10019495 | Ga0105250_100194952 | 230 |
| 451 | 3300009093 | Ga0105240_10017091 | Ga0105240_100170913 | 230 |
| 452 | 3300009093 | Ga0105240_10029263 | Ga0105240_100292636 | 230 |
| 453 | 3300009093 | Ga0105240_10048975 | Ga0105240_100489752 | 230 |
| 454 | 3300009093 | Ga0105240_10102247 | Ga0105240_101022472 | 230 |
| 455 | 3300009093 | Ga0105240_10199456 | Ga0105240_101994563 | 230 |
| 456 | 3300009098 | Ga0105245_10007957 | Ga0105245_100079577 | 230 |
| 457 | 3300009098 | Ga0105245_10236299 | Ga0105245_102362992 | 230 |
| 458 | 3300009101 | Ga0105247_10054061 | Ga0105247_100540613 | 230 |
| 459 | 3300009101 | Ga0105247_10055478 | Ga0105247_100554782 | 230 |
| 460 | 3300009101 | Ga0105247_10062179 | Ga0105247_100621793 | 230 |
| 461 | 3300009101 | Ga0105247_10071416 | Ga0105247_100714161 | 230 |
| 462 | 3300009101 | Ga0105247_10292702 | Ga0105247_102927021 | 230 |
| 463 | 3300009147 | Ga0114129_10047472 | Ga0114129_100474728 | 230 |
| 464 | 3300009148 | Ga0105243_10081554 | Ga0105243_100815541 | 230 |
| 465 | 3300009148 | Ga0105243_10528849 | Ga0105243_105288491 | 230 |
| 466 | 3300009174 | Ga0105241_10076137 | Ga0105241_100761373 | 230 |
| 467 | 3300009174 | Ga0105241_10165398 | Ga0105241_101653982 | 230 |
| 468 | 3300009174 | Ga0105241_10308604 | Ga0105241_103086042 | 230 |
| 469 | 3300009174 | Ga0105241_10339451 | Ga0105241_103394512 | 230 |
| 470 | 3300009176 | Ga0105242_10121232 | Ga0105242_101212323 | 230 |
| 471 | 3300009176 | Ga0105242_10381639 | Ga0105242_103816392 | 230 |
| 472 | 3300009177 | Ga0105248_10227877 | Ga0105248_102278772 | 230 |
| 473 | 3300009177 | Ga0105248_10452006 | Ga0105248_104520062 | 230 |
| 474 | 3300009177 | Ga0105248_10742915 | Ga0105248_107429152 | 230 |
| 475 | 3300009545 | Ga0105237_10027872 | Ga0105237_100278725 | 230 |
| 476 | 3300009545 | Ga0105237_10040140 | Ga0105237_100401403 | 230 |
| 477 | 3300009545 | Ga0105237_10070663 | Ga0105237_100706632 | 230 |
| 478 | 3300009545 | Ga0105237_10111579 | Ga0105237_101115793 | 230 |
| 479 | 3300009545 | Ga0105237_10129113 | Ga0105237_101291133 | 230 |
| 480 | 3300009545 | Ga0105237_10143818 | Ga0105237_101438183 | 230 |
| 481 | 3300009545 | Ga0105237_10218484 | Ga0105237_102184841 | 230 |
| 482 | 3300009545 | Ga0105237_10584563 | Ga0105237_105845631 | 230 |
| 483 | 3300009545 | Ga0105237_10594467 | Ga0105237_105944672 | 230 |
| 484 | 3300009551 | Ga0105238_10013865 | Ga0105238_100138658 | 230 |
| 485 | 3300009551 | Ga0105238_10020769 | Ga0105238_100207697 | 230 |
| 486 | 3300009551 | Ga0105238_10037253 | Ga0105238_100372535 | 230 |
| 487 | 3300009551 | Ga0105238_10093120 | Ga0105238_100931202 | 230 |
| 488 | 3300009551 | Ga0105238_10104769 | Ga0105238_101047692 | 230 |
| 489 | 3300010159 | Ga0099796_10019339 | Ga0099796_100193392 | 230 |
| 490 | 3300010159 | Ga0099796_10048339 | Ga0099796_100483393 | 230 |
| 491 | 3300010159 | Ga0099796_10071488 | Ga0099796_100714881 | 230 |
| 492 | 3300010375 | Ga0105239_10013166 | Ga0105239_100131666 | 230 |
| 493 | 3300010375 | Ga0105239_10045820 | Ga0105239_100458205 | 230 |
| 494 | 3300010375 | Ga0105239_10055145 | Ga0105239_100551453 | 230 |
| 495 | 3300010375 | Ga0105239_10061464 | Ga0105239_100614644 | 230 |
| 496 | 3300010375 | Ga0105239_10091513 | Ga0105239_100915132 | 230 |
| 497 | 3300010375 | Ga0105239_10224554 | Ga0105239_102245542 | 230 |
| 498 | 3300010375 | Ga0105239_10241357 | Ga0105239_102413572 | 230 |
| 499 | 3300010375 | Ga0105239_10268022 | Ga0105239_102680222 | 230 |
| 500 | 3300010375 | Ga0105239_10394133 | Ga0105239_103941331 | 230 |
| 501 | 3300010375 | Ga0105239_10560005 | Ga0105239_105600052 | 230 |
| 502 | 3300011119 | Ga0105246_10019195 | Ga0105246_100191952 | 230 |
| 503 | 3300011119 | Ga0105246_10028021 | Ga0105246_100280212 | 230 |
| 504 | 3300011119 | Ga0105246_10039294 | Ga0105246_100392945 | 230 |
| 505 | 3300013104 | Ga0157370_10033613 | Ga0157370_100336135 | 230 |
| 506 | 3300013104 | Ga0157370_10530495 | Ga0157370_105304951 | 230 |
| 507 | 3300013105 | Ga0157369_10006140 | Ga0157369_100061409 | 230 |
| 508 | 3300013105 | Ga0157369_10016279 | Ga0157369_100162793 | 230 |
| 509 | 3300013105 | Ga0157369_10034922 | Ga0157369_100349227 | 230 |
| 510 | 3300013105 | Ga0157369_10217285 | Ga0157369_102172852 | 230 |
| 511 | 3300013296 | Ga0157374_10029773 | Ga0157374_100297734 | 230 |
| 512 | 3300013296 | Ga0157374_10030196 | Ga0157374_100301964 | 230 |
| 513 | 3300013296 | Ga0157374_10084717 | Ga0157374_100847172 | 230 |
| 514 | 3300013296 | Ga0157374_10222984 | Ga0157374_102229842 | 230 |
| 515 | 3300013296 | Ga0157374_10431935 | Ga0157374_104319351 | 230 |
| 516 | 3300013297 | Ga0157378_10182598 | Ga0157378_101825984 | 230 |
| 517 | 3300013297 | Ga0157378_10207394 | Ga0157378_102073942 | 230 |
| 518 | 3300013306 | Ga0163162_10029376 | Ga0163162_100293762 | 230 |
| 519 | 3300013306 | Ga0163162_10045464 | Ga0163162_100454645 | 230 |
| 520 | 3300013306 | Ga0163162_10070383 | Ga0163162_100703833 | 230 |
| 521 | 3300013306 | Ga0163162_10257331 | Ga0163162_102573312 | 230 |
| 522 | 3300013306 | Ga0163162_10310046 | Ga0163162_103100462 | 230 |
| 523 | 3300013306 | Ga0163162_10481129 | Ga0163162_104811293 | 230 |
| 524 | 3300013306 | Ga0163162_10488038 | Ga0163162_104880382 | 230 |
| 525 | 3300013307 | Ga0157372_10019384 | Ga0157372_100193846 | 230 |
| 526 | 3300013307 | Ga0157372_10068085 | Ga0157372_100680853 | 230 |
| 527 | 3300013307 | Ga0157372_10204351 | Ga0157372_102043512 | 230 |
| 528 | 3300013308 | Ga0157375_10013280 | Ga0157375_100132807 | 230 |
| 529 | 3300013308 | Ga0157375_10067562 | Ga0157375_100675624 | 230 |
| 530 | 3300013308 | Ga0157375_10258482 | Ga0157375_102584822 | 230 |
| 531 | 3300013308 | Ga0157375_10333598 | Ga0157375_103335982 | 230 |
| 532 | 3300013308 | Ga0157375_10361873 | Ga0157375_103618732 | 230 |
| 533 | 3300013308 | Ga0157375_10378261 | Ga0157375_103782612 | 230 |
| 534 | 3300013308 | Ga0157375_10493113 | Ga0157375_104931132 | 230 |
| 535 | 3300014325 | Ga0163163_10006759 | Ga0163163_100067592 | 230 |
| 536 | 3300014325 | Ga0163163_10036974 | Ga0163163_100369744 | 230 |
| 537 | 3300014325 | Ga0163163_10092655 | Ga0163163_100926553 | 230 |
| 538 | 3300014325 | Ga0163163_10146857 | Ga0163163_101468572 | 230 |
| 539 | 3300014325 | Ga0163163_10554706 | Ga0163163_105547062 | 230 |
| 540 | 3300014968 | Ga0157379_10026109 | Ga0157379_100261092 | 230 |
| 541 | 3300014968 | Ga0157379_10098103 | Ga0157379_100981032 | 230 |
| 542 | 3300014968 | Ga0157379_10417141 | Ga0157379_104171412 | 230 |
| 543 | 3300014969 | Ga0157376_10153738 | Ga0157376_101537384 | 230 |
| 544 | 3300017792 | Ga0163161_10631680 | Ga0163161_106316801 | 230 |
| 545 | 3300020069 | Ga0197907_11085692 | Ga0197907_110856922 | 230 |
| 546 | 3300020080 | Ga0206350_10147974 | Ga0206350_101479742 | 230 |
| 547 | 3300021361 | Ga0213872_10096894 | Ga0213872_100968941 | 230 |
| 548 | 3300021384 | Ga0213876_10102971 | Ga0213876_101029712 | 230 |
| 549 | 3300021388 | Ga0213875_10036010 | Ga0213875_100360101 | 230 |
| 550 | 3300021441 | Ga0213871_10048862 | Ga0213871_100488622 | 230 |
| 551 | 3300022467 | Ga0224712_10019052 | Ga0224712_100190523 | 230 |
| 552 | 3300024225 | Ga0224572_1032213 | Ga0224572_10322132 | 230 |
| 553 | 3300024227 | Ga0228598_1009638 | Ga0228598_10096382 | 230 |
| 554 | 3300025253 | Ga0209677_102334 | Ga0209677_10233410 | 230 |
| 555 | 3300025254 | Ga0209148_1000445 | Ga0209148_100044532 | 230 |
| 556 | 3300025261 | Ga0209233_1003431 | Ga0209233_10034312 | 230 |
| 557 | 3300025261 | Ga0209233_1004607 | Ga0209233_10046073 | 230 |
| 558 | 3300025272 | Ga0209455_1006613 | Ga0209455_10066132 | 230 |
| 559 | 3300025272 | Ga0209455_1015439 | Ga0209455_10154392 | 230 |
| 560 | 3300025295 | Ga0209564_1002690 | Ga0209564_100269013 | 230 |
| 561 | 3300025297 | Ga0209758_1000416 | Ga0209758_100041645 | 230 |
| 562 | 3300025297 | Ga0209758_1001659 | Ga0209758_100165916 | 230 |
| 563 | 3300025297 | Ga0209758_1002229 | Ga0209758_10022295 | 230 |
| 564 | 3300025299 | Ga0209256_1025154 | Ga0209256_10251542 | 230 |
| 565 | 3300025302 | Ga0207426_1000522 | Ga0207426_100052214 | 230 |
| 566 | 3300025302 | Ga0207426_1000635 | Ga0207426_100063516 | 230 |
| 567 | 3300025304 | Ga0209257_1016037 | Ga0209257_10160372 | 230 |
| 568 | 3300025315 | Ga0207697_10011055 | Ga0207697_100110555 | 230 |
| 569 | 3300025315 | Ga0207697_10022021 | Ga0207697_100220213 | 230 |
| 570 | 3300025315 | Ga0207697_10145631 | Ga0207697_101456312 | 230 |
| 571 | 3300025315 | Ga0207697_10258194 | Ga0207697_102581941 | 230 |
| 572 | 3300025321 | Ga0207656_10018876 | Ga0207656_100188762 | 230 |
| 573 | 3300025321 | Ga0207656_10144100 | Ga0207656_101441001 | 230 |
| 574 | 3300025321 | Ga0207656_10167179 | Ga0207656_101671792 | 230 |
| 575 | 3300025885 | Ga0207653_10048082 | Ga0207653_100480822 | 230 |
| 576 | 3300025898 | Ga0207692_10042604 | Ga0207692_100426042 | 230 |
| 577 | 3300025898 | Ga0207692_10121292 | Ga0207692_101212922 | 230 |
| 578 | 3300025899 | Ga0207642_10108021 | Ga0207642_101080212 | 230 |
| 579 | 3300025900 | Ga0207710_10158479 | Ga0207710_101584791 | 230 |
| 580 | 3300025900 | Ga0207710_10191171 | Ga0207710_101911712 | 230 |
| 581 | 3300025901 | Ga0207688_10038785 | Ga0207688_100387852 | 230 |
| 582 | 3300025901 | Ga0207688_10089512 | Ga0207688_100895123 | 230 |
| 583 | 3300025901 | Ga0207688_10097786 | Ga0207688_100977862 | 230 |
| 584 | 3300025901 | Ga0207688_10108116 | Ga0207688_101081163 | 230 |
| 585 | 3300025903 | Ga0207680_10063467 | Ga0207680_100634672 | 230 |
| 586 | 3300025903 | Ga0207680_10322521 | Ga0207680_103225212 | 230 |
| 587 | 3300025904 | Ga0207647_10007936 | Ga0207647_100079363 | 230 |
| 588 | 3300025904 | Ga0207647_10062745 | Ga0207647_100627452 | 230 |
| 589 | 3300025905 | Ga0207685_10005077 | Ga0207685_100050771 | 230 |
| 590 | 3300025905 | Ga0207685_10169337 | Ga0207685_101693372 | 230 |
| 591 | 3300025906 | Ga0207699_10013659 | Ga0207699_100136592 | 230 |
| 592 | 3300025906 | Ga0207699_10030108 | Ga0207699_100301082 | 230 |
| 593 | 3300025906 | Ga0207699_10036479 | Ga0207699_100364792 | 230 |
| 594 | 3300025906 | Ga0207699_10061933 | Ga0207699_100619333 | 230 |
| 595 | 3300025906 | Ga0207699_10172976 | Ga0207699_101729762 | 230 |
| 596 | 3300025906 | Ga0207699_10239781 | Ga0207699_102397812 | 230 |
| 597 | 3300025906 | Ga0207699_10275754 | Ga0207699_102757541 | 230 |
| 598 | 3300025907 | Ga0207645_10048662 | Ga0207645_100486623 | 230 |
| 599 | 3300025908 | Ga0207643_10013766 | Ga0207643_100137663 | 230 |
| 600 | 3300025910 | Ga0207684_10131984 | Ga0207684_101319842 | 230 |
| 601 | 3300025911 | Ga0207654_10067524 | Ga0207654_100675242 | 230 |
| 602 | 3300025911 | Ga0207654_10395843 | Ga0207654_103958431 | 230 |
| 603 | 3300025911 | Ga0207654_10675868 | Ga0207654_106758681 | 230 |
| 604 | 3300025912 | Ga0207707_10001623 | Ga0207707_100016237 | 230 |
| 605 | 3300025912 | Ga0207707_10013110 | Ga0207707_100131102 | 230 |
| 606 | 3300025912 | Ga0207707_10234210 | Ga0207707_102342102 | 230 |
| 607 | 3300025912 | Ga0207707_10395906 | Ga0207707_103959062 | 230 |
| 608 | 3300025913 | Ga0207695_10000556 | Ga0207695_100005564 | 230 |
| 609 | 3300025913 | Ga0207695_10168585 | Ga0207695_101685852 | 230 |
| 610 | 3300025913 | Ga0207695_10183258 | Ga0207695_101832582 | 230 |
| 611 | 3300025914 | Ga0207671_10006897 | Ga0207671_100068973 | 230 |
| 612 | 3300025914 | Ga0207671_10052332 | Ga0207671_100523323 | 230 |
| 613 | 3300025914 | Ga0207671_10085930 | Ga0207671_100859303 | 230 |
| 614 | 3300025914 | Ga0207671_10089640 | Ga0207671_100896402 | 230 |
| 615 | 3300025914 | Ga0207671_10097689 | Ga0207671_100976892 | 230 |
| 616 | 3300025914 | Ga0207671_10129438 | Ga0207671_101294382 | 230 |
| 617 | 3300025914 | Ga0207671_10242304 | Ga0207671_102423041 | 230 |
| 618 | 3300025915 | Ga0207693_10004012 | Ga0207693_100040128 | 230 |
| 619 | 3300025915 | Ga0207693_10017812 | Ga0207693_100178122 | 230 |
| 620 | 3300025915 | Ga0207693_10047086 | Ga0207693_100470863 | 230 |
| 621 | 3300025915 | Ga0207693_10127744 | Ga0207693_101277442 | 230 |
| 622 | 3300025915 | Ga0207693_10219735 | Ga0207693_102197352 | 230 |
| 623 | 3300025916 | Ga0207663_10001611 | Ga0207663_100016115 | 230 |
| 624 | 3300025916 | Ga0207663_10008168 | Ga0207663_100081687 | 230 |
| 625 | 3300025916 | Ga0207663_10060409 | Ga0207663_100604092 | 230 |
| 626 | 3300025916 | Ga0207663_10100050 | Ga0207663_101000501 | 230 |
| 627 | 3300025916 | Ga0207663_10177756 | Ga0207663_101777561 | 230 |
| 628 | 3300025916 | Ga0207663_10577732 | Ga0207663_105777322 | 230 |
| 629 | 3300025917 | Ga0207660_10008313 | Ga0207660_100083136 | 230 |
| 630 | 3300025917 | Ga0207660_10023476 | Ga0207660_100234764 | 230 |
| 631 | 3300025917 | Ga0207660_10116612 | Ga0207660_101166122 | 230 |
| 632 | 3300025917 | Ga0207660_10136318 | Ga0207660_101363182 | 230 |
| 633 | 3300025918 | Ga0207662_10100917 | Ga0207662_101009172 | 230 |
| 634 | 3300025919 | Ga0207657_10138500 | Ga0207657_101385002 | 230 |
| 635 | 3300025919 | Ga0207657_10230224 | Ga0207657_102302242 | 230 |
| 636 | 3300025919 | Ga0207657_10394683 | Ga0207657_103946832 | 230 |
| 637 | 3300025920 | Ga0207649_10045148 | Ga0207649_100451482 | 230 |
| 638 | 3300025920 | Ga0207649_10280923 | Ga0207649_102809231 | 230 |
| 639 | 3300025921 | Ga0207652_10011502 | Ga0207652_100115025 | 230 |
| 640 | 3300025921 | Ga0207652_10097988 | Ga0207652_100979882 | 230 |
| 641 | 3300025921 | Ga0207652_10341074 | Ga0207652_103410742 | 230 |
| 642 | 3300025922 | Ga0207646_10091867 | Ga0207646_100918675 | 230 |
| 643 | 3300025922 | Ga0207646_10309416 | Ga0207646_103094162 | 230 |
| 644 | 3300025923 | Ga0207681_10071847 | Ga0207681_100718472 | 230 |
| 645 | 3300025923 | Ga0207681_10224236 | Ga0207681_102242362 | 230 |
| 646 | 3300025923 | Ga0207681_10250995 | Ga0207681_102509952 | 230 |
| 647 | 3300025924 | Ga0207694_10013820 | Ga0207694_100138205 | 230 |
| 648 | 3300025924 | Ga0207694_10015762 | Ga0207694_100157624 | 230 |
| 649 | 3300025924 | Ga0207694_10078197 | Ga0207694_100781972 | 230 |
| 650 | 3300025924 | Ga0207694_10277613 | Ga0207694_102776132 | 230 |
| 651 | 3300025925 | Ga0207650_10318937 | Ga0207650_103189372 | 230 |
| 652 | 3300025925 | Ga0207650_10445953 | Ga0207650_104459532 | 230 |
| 653 | 3300025926 | Ga0207659_10039497 | Ga0207659_100394972 | 230 |
| 654 | 3300025926 | Ga0207659_10253817 | Ga0207659_102538172 | 230 |
| 655 | 3300025926 | Ga0207659_10588391 | Ga0207659_105883912 | 230 |
| 656 | 3300025927 | Ga0207687_10035089 | Ga0207687_100350892 | 230 |
| 657 | 3300025928 | Ga0207700_10027300 | Ga0207700_100273003 | 230 |
| 658 | 3300025928 | Ga0207700_10027577 | Ga0207700_100275772 | 230 |
| 659 | 3300025928 | Ga0207700_10123698 | Ga0207700_101236982 | 230 |
| 660 | 3300025928 | Ga0207700_10127200 | Ga0207700_101272002 | 230 |
| 661 | 3300025928 | Ga0207700_10163962 | Ga0207700_101639622 | 230 |
| 662 | 3300025928 | Ga0207700_10262290 | Ga0207700_102622902 | 230 |
| 663 | 3300025928 | Ga0207700_10415297 | Ga0207700_104152972 | 230 |
| 664 | 3300025928 | Ga0207700_10788026 | Ga0207700_107880261 | 230 |
| 665 | 3300025929 | Ga0207664_10028753 | Ga0207664_100287535 | 230 |
| 666 | 3300025929 | Ga0207664_10064321 | Ga0207664_100643212 | 230 |
| 667 | 3300025929 | Ga0207664_10065652 | Ga0207664_100656523 | 230 |
| 668 | 3300025929 | Ga0207664_10123572 | Ga0207664_101235722 | 230 |
| 669 | 3300025929 | Ga0207664_11013763 | Ga0207664_110137631 | 230 |
| 670 | 3300025931 | Ga0207644_10008270 | Ga0207644_100082701 | 230 |
| 671 | 3300025931 | Ga0207644_10035155 | Ga0207644_100351552 | 230 |
| 672 | 3300025931 | Ga0207644_10059574 | Ga0207644_100595742 | 230 |
| 673 | 3300025931 | Ga0207644_10251120 | Ga0207644_102511202 | 230 |
| 674 | 3300025931 | Ga0207644_10390309 | Ga0207644_103903092 | 230 |
| 675 | 3300025932 | Ga0207690_10077162 | Ga0207690_100771622 | 230 |
| 676 | 3300025932 | Ga0207690_10144926 | Ga0207690_101449262 | 230 |
| 677 | 3300025932 | Ga0207690_10310400 | Ga0207690_103104001 | 230 |
| 678 | 3300025933 | Ga0207706_10046302 | Ga0207706_100463022 | 230 |
| 679 | 3300025933 | Ga0207706_10108737 | Ga0207706_101087372 | 230 |
| 680 | 3300025934 | Ga0207686_10099011 | Ga0207686_100990112 | 230 |
| 681 | 3300025934 | Ga0207686_10782012 | Ga0207686_107820121 | 230 |
| 682 | 3300025935 | Ga0207709_10006210 | Ga0207709_100062104 | 230 |
| 683 | 3300025935 | Ga0207709_10149217 | Ga0207709_101492172 | 230 |
| 684 | 3300025935 | Ga0207709_10627923 | Ga0207709_106279232 | 230 |
| 685 | 3300025937 | Ga0207669_10524787 | Ga0207669_105247872 | 230 |
| 686 | 3300025937 | Ga0207669_10612833 | Ga0207669_106128331 | 230 |
| 687 | 3300025939 | Ga0207665_10000118 | Ga0207665_100001188 | 230 |
| 688 | 3300025939 | Ga0207665_10115210 | Ga0207665_101152101 | 230 |
| 689 | 3300025939 | Ga0207665_10246970 | Ga0207665_102469701 | 230 |
| 690 | 3300025941 | Ga0207711_10267230 | Ga0207711_102672302 | 230 |
| 691 | 3300025941 | Ga0207711_10332009 | Ga0207711_103320092 | 230 |
| 692 | 3300025942 | Ga0207689_10148571 | Ga0207689_101485713 | 230 |
| 693 | 3300025942 | Ga0207689_10342501 | Ga0207689_103425013 | 230 |
| 694 | 3300025942 | Ga0207689_10354879 | Ga0207689_103548792 | 230 |
| 695 | 3300025942 | Ga0207689_10777627 | Ga0207689_107776271 | 230 |
| 696 | 3300025944 | Ga0207661_10080282 | Ga0207661_100802822 | 230 |
| 697 | 3300025944 | Ga0207661_10133615 | Ga0207661_101336152 | 230 |
| 698 | 3300025944 | Ga0207661_10492371 | Ga0207661_104923711 | 230 |
| 699 | 3300025945 | Ga0207679_10208979 | Ga0207679_102089791 | 230 |
| 700 | 3300025945 | Ga0207679_10251597 | Ga0207679_102515972 | 230 |
| 701 | 3300025945 | Ga0207679_10933851 | Ga0207679_109338511 | 230 |
| 702 | 3300025949 | Ga0207667_10018061 | Ga0207667_100180614 | 230 |
| 703 | 3300025949 | Ga0207667_10070915 | Ga0207667_100709153 | 230 |
| 704 | 3300025949 | Ga0207667_10163362 | Ga0207667_101633622 | 230 |
| 705 | 3300025960 | Ga0207651_10070768 | Ga0207651_100707682 | 230 |
| 706 | 3300025960 | Ga0207651_10316482 | Ga0207651_103164822 | 230 |
| 707 | 3300025961 | Ga0207712_10072290 | Ga0207712_100722902 | 230 |
| 708 | 3300025961 | Ga0207712_10117940 | Ga0207712_101179402 | 230 |
| 709 | 3300025972 | Ga0207668_10094229 | Ga0207668_100942293 | 230 |
| 710 | 3300025972 | Ga0207668_10102485 | Ga0207668_101024853 | 230 |
| 711 | 3300025972 | Ga0207668_10160645 | Ga0207668_101606452 | 230 |
| 712 | 3300025972 | Ga0207668_10858211 | Ga0207668_108582111 | 230 |
| 713 | 3300025981 | Ga0207640_10180999 | Ga0207640_101809992 | 230 |
| 714 | 3300025981 | Ga0207640_10187154 | Ga0207640_101871542 | 230 |
| 715 | 3300025981 | Ga0207640_10231433 | Ga0207640_102314332 | 230 |
| 716 | 3300025981 | Ga0207640_10412429 | Ga0207640_104124292 | 230 |
| 717 | 3300025986 | Ga0207658_10299258 | Ga0207658_102992582 | 230 |
| 718 | 3300025986 | Ga0207658_10405198 | Ga0207658_104051982 | 230 |
| 719 | 3300025986 | Ga0207658_11006160 | Ga0207658_110061601 | 230 |
| 720 | 3300026023 | Ga0207677_10098985 | Ga0207677_100989852 | 230 |
| 721 | 3300026023 | Ga0207677_10100641 | Ga0207677_101006413 | 230 |
| 722 | 3300026023 | Ga0207677_10250178 | Ga0207677_102501782 | 230 |
| 723 | 3300026035 | Ga0207703_10090586 | Ga0207703_100905863 | 230 |
| 724 | 3300026035 | Ga0207703_10240779 | Ga0207703_102407792 | 230 |
| 725 | 3300026035 | Ga0207703_10258803 | Ga0207703_102588032 | 230 |
| 726 | 3300026035 | Ga0207703_10327001 | Ga0207703_103270012 | 230 |
| 727 | 3300026035 | Ga0207703_10668106 | Ga0207703_106681061 | 230 |
| 728 | 3300026041 | Ga0207639_10100675 | Ga0207639_101006752 | 230 |
| 729 | 3300026041 | Ga0207639_10145973 | Ga0207639_101459732 | 230 |
| 730 | 3300026041 | Ga0207639_10156045 | Ga0207639_101560452 | 230 |
| 731 | 3300026041 | Ga0207639_10200532 | Ga0207639_102005321 | 230 |
| 732 | 3300026041 | Ga0207639_10553307 | Ga0207639_105533072 | 230 |
| 733 | 3300026067 | Ga0207678_10025337 | Ga0207678_100253372 | 230 |
| 734 | 3300026067 | Ga0207678_10086267 | Ga0207678_100862673 | 230 |
| 735 | 3300026067 | Ga0207678_10105567 | Ga0207678_101055672 | 230 |
| 736 | 3300026067 | Ga0207678_10146128 | Ga0207678_101461282 | 230 |
| 737 | 3300026067 | Ga0207678_10791325 | Ga0207678_107913251 | 230 |
| 738 | 3300026078 | Ga0207702_10000433 | Ga0207702_1000043335 | 230 |
| 739 | 3300026078 | Ga0207702_10254452 | Ga0207702_102544522 | 230 |
| 740 | 3300026078 | Ga0207702_10306964 | Ga0207702_103069642 | 230 |
| 741 | 3300026078 | Ga0207702_10339239 | Ga0207702_103392392 | 230 |
| 742 | 3300026078 | Ga0207702_10413527 | Ga0207702_104135271 | 230 |
| 743 | 3300026078 | Ga0207702_10651599 | Ga0207702_106515992 | 230 |
| 744 | 3300026088 | Ga0207641_10124839 | Ga0207641_101248392 | 230 |
| 745 | 3300026088 | Ga0207641_10193761 | Ga0207641_101937612 | 230 |
| 746 | 3300026088 | Ga0207641_10459978 | Ga0207641_104599781 | 230 |
| 747 | 3300026089 | Ga0207648_10062751 | Ga0207648_100627513 | 230 |
| 748 | 3300026089 | Ga0207648_10093247 | Ga0207648_100932473 | 230 |
| 749 | 3300026089 | Ga0207648_10145761 | Ga0207648_101457612 | 230 |
| 750 | 3300026095 | Ga0207676_10046093 | Ga0207676_100460932 | 230 |
| 751 | 3300026095 | Ga0207676_10667451 | Ga0207676_106674512 | 230 |
| 752 | 3300026116 | Ga0207674_10018412 | Ga0207674_100184127 | 230 |
| 753 | 3300026116 | Ga0207674_10039233 | Ga0207674_100392332 | 230 |
| 754 | 3300026116 | Ga0207674_10080810 | Ga0207674_100808102 | 230 |
| 755 | 3300026118 | Ga0207675_100067493 | Ga0207675_1000674932 | 230 |
| 756 | 3300026118 | Ga0207675_100751571 | Ga0207675_1007515712 | 230 |
| 757 | 3300026121 | Ga0207683_10016118 | Ga0207683_100161187 | 230 |
| 758 | 3300026121 | Ga0207683_10414642 | Ga0207683_104146422 | 230 |
| 759 | 3300026121 | Ga0207683_10546959 | Ga0207683_105469592 | 230 |
| 760 | 3300026142 | Ga0207698_10020154 | Ga0207698_100201545 | 230 |
| 761 | 3300026142 | Ga0207698_10198208 | Ga0207698_101982082 | 230 |
| 762 | 3300026142 | Ga0207698_10632148 | Ga0207698_106321482 | 230 |
| 763 | 3300026142 | Ga0207698_10649773 | Ga0207698_106497731 | 230 |
| 764 | 3300027296 | Ga0209389_1000045 | Ga0209389_100004584 | 230 |
| 765 | 3300027296 | Ga0209389_1007855 | Ga0209389_10078552 | 230 |
| 766 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007252 | 230 |
| 767 | 3300027357 | Ga0209589_1015051 | Ga0209589_10150518 | 230 |
| 768 | 3300027361 | Ga0209489_100008 | Ga0209489_100008252 | 230 |
| 769 | 3300027361 | Ga0209489_100110 | Ga0209489_10011031 | 230 |
| 770 | 3300027361 | Ga0209489_100210 | Ga0209489_10021062 | 230 |
| 771 | 3300027363 | Ga0209700_100009 | Ga0209700_100009252 | 230 |
| 772 | 3300027363 | Ga0209700_100116 | Ga0209700_10011678 | 230 |
| 773 | 3300027671 | Ga0209588_1028759 | Ga0209588_10287591 | 230 |
| 774 | 3300027671 | Ga0209588_1103687 | Ga0209588_11036872 | 230 |
| 775 | 3300027671 | Ga0209588_1116886 | Ga0209588_11168862 | 230 |
| 776 | 3300027866 | Ga0209813_10131905 | Ga0209813_101319052 | 230 |
| 777 | 3300027907 | Ga0207428_10000295 | Ga0207428_1000029532 | 230 |
| 778 | 3300028379 | Ga0268266_10003838 | Ga0268266_1000383814 | 230 |
| 779 | 3300028379 | Ga0268266_10112403 | Ga0268266_101124031 | 230 |
| 780 | 3300028379 | Ga0268266_10153142 | Ga0268266_101531422 | 230 |
| 781 | 3300028379 | Ga0268266_10186589 | Ga0268266_101865892 | 230 |
| 782 | 3300028379 | Ga0268266_10455183 | Ga0268266_104551833 | 230 |
| 783 | 3300028380 | Ga0268265_10049446 | Ga0268265_100494463 | 230 |
| 784 | 3300028380 | Ga0268265_10111402 | Ga0268265_101114021 | 230 |
| 785 | 3300028381 | Ga0268264_11146859 | Ga0268264_111468592 | 230 |
| 786 | 3300028794 | Ga0307515_10184213 | Ga0307515_101842133 | 230 |
| 787 | 3300030521 | Ga0307511_10117520 | Ga0307511_101175201 | 230 |
| 788 | 3300031235 | Ga0265330_10033581 | Ga0265330_100335812 | 230 |
| 789 | 3300031238 | Ga0265332_10035187 | Ga0265332_100351872 | 230 |
| 790 | 3300031239 | Ga0265328_10044790 | Ga0265328_100447901 | 230 |
| 791 | 3300031241 | Ga0265325_10019092 | Ga0265325_100190923 | 230 |
| 792 | 3300031249 | Ga0265339_10051134 | Ga0265339_100511342 | 230 |
| 793 | 3300031344 | Ga0265316_10124590 | Ga0265316_101245901 | 230 |
| 794 | 3300031507 | Ga0307509_10066285 | Ga0307509_100662852 | 230 |
| 795 | 3300031507 | Ga0307509_10615399 | Ga0307509_106153991 | 230 |
| 796 | 3300031616 | Ga0307508_10000003 | Ga0307508_10000003140 | 230 |
| 797 | 3300031616 | Ga0307508_10097397 | Ga0307508_100973972 | 230 |
| 798 | 3300031711 | Ga0265314_10049278 | Ga0265314_100492783 | 230 |
| 799 | 3300031730 | Ga0307516_10118428 | Ga0307516_101184282 | 230 |
| 800 | 3300031730 | Ga0307516_10199295 | Ga0307516_101992952 | 230 |
| 801 | 3300032002 | Ga0307416_100060615 | Ga0307416_1000606151 | 230 |
| 802 | 3300033179 | Ga0307507_10029922 | Ga0307507_100299223 | 230 |
| 803 | 3300033179 | Ga0307507_10166501 | Ga0307507_101665011 | 230 |
| 804 | 3300033179 | Ga0307507_10347247 | Ga0307507_103472471 | 230 |
| 805 | 3300033180 | Ga0307510_10009102 | Ga0307510_100091023 | 230 |
| 806 | 3300034818 | Ga0373950_0034781 | Ga0373950_0034781_32_724 | 230 |
| 807 | 3300035083 | Ga0373926_0078204 | Ga0373926_0078204_72_764 | 230 |
| 808 | 3300035083 | Ga0373926_0079398 | Ga0373926_0079398_300_1007 | 230 |
| 809 | 3300035086 | Ga0373934_0013009 | Ga0373934_0013009_2225_2917 | 230 |
| 810 | 3300035089 | Ga0373944_0006425 | Ga0373944_0006425_148_840 | 230 |
| 811 | 3300035111 | Ga0373923_0011095 | Ga0373923_0011095_2570_3262 | 230 |
| 812 | 3300035111 | Ga0373923_0044805 | Ga0373923_0044805_24_716 | 230 |
| 813 | 3300035113 | Ga0373936_0059173 | Ga0373936_0059173_280_972 | 230 |
| 814 | 3300035113 | Ga0373936_0062841 | Ga0373936_0062841_117_809 | 230 |
| 815 | 3300035116 | Ga0373945_0010383 | Ga0373945_0010383_2359_3051 | 230 |
| 816 | 3300035116 | Ga0373945_0028844 | Ga0373945_0028844_909_1601 | 230 |
| 817 | 3300035116 | Ga0373945_0119881 | Ga0373945_0119881_320_1012 | 230 |
| 818 | 3300035117 | Ga0373953_0010610 | Ga0373953_0010610_2238_2930 | 230 |
| 819 | 3300035117 | Ga0373953_0123108 | Ga0373953_0123108_221_913 | 230 |
| 820 | 3300035118 | Ga0373954_0019925 | Ga0373954_0019925_1403_2095 | 230 |
| 821 | 3300035119 | Ga0373956_0001075 | Ga0373956_0001075_8852_9544 | 230 |
| 822 | 3300035119 | Ga0373956_0179268 | Ga0373956_0179268_25_717 | 230 |
| 823 | 3300035119 | Ga0373956_0209632 | Ga0373956_0209632_113_805 | 230 |
| 824 | 3300035120 | Ga0373957_0016737 | Ga0373957_0016737_1315_2007 | 230 |
| 825 | 3300035120 | Ga0373957_0068045 | Ga0373957_0068045_639_1334 | 230 |
| 826 | 3300035170 | Ga0373943_0011760 | Ga0373943_0011760_963_1655 | 230 |
| 827 | 3300035170 | Ga0373943_0021033 | Ga0373943_0021033_1677_2369 | 230 |
| 828 | 3300035170 | Ga0373943_0027693 | Ga0373943_0027693_622_1314 | 230 |
| 829 | 3300035170 | Ga0373943_0074801 | Ga0373943_0074801_865_1557 | 230 |
| 830 | 3300035170 | Ga0373943_0124772 | Ga0373943_0124772_46_747 | 230 |
| 831 | 3300035171 | Ga0373946_0003017 | Ga0373946_0003017_4522_5214 | 230 |
| 832 | 3300035171 | Ga0373946_0089578 | Ga0373946_0089578_613_1305 | 230 |
| 833 | 3300035172 | Ga0373955_0019530 | Ga0373955_0019530_1765_2457 | 230 |
| 834 | 3300035172 | Ga0373955_0021727 | Ga0373955_0021727_137_829 | 230 |
| 835 | 3300035172 | Ga0373955_0042339 | Ga0373955_0042339_314_1009 | 230 |
| 836 | 3300035172 | Ga0373955_0059346 | Ga0373955_0059346_1176_1868 | 230 |
| 837 | 3300035410 | Ga0373924_0007622 | Ga0373924_0007622_2129_2821 | 230 |
| 838 | 3300035410 | Ga0373924_0068729 | Ga0373924_0068729_324_1016 | 230 |
| 839 | 3300035410 | Ga0373924_0130804 | Ga0373924_0130804_70_765 | 230 |
| 840 | 3300035691 | Ga0373931_0529061 | Ga0373931_0529061_44_736 | 230 |
| 841 | 3300035692 | Ga0373935_0002155 | Ga0373935_0002155_2421_3113 | 230 |
| 842 | 3300035692 | Ga0373935_0051480 | Ga0373935_0051480_1719_2411 | 230 |
| 843 | 3300035692 | Ga0373935_0074297 | Ga0373935_0074297_452_1144 | 230 |
| 844 | 3300035695 | Ga0373927_0001542 | Ga0373927_0001542_8935_9627 | 230 |
| 845 | 3300035695 | Ga0373927_0010229 | Ga0373927_0010229_5243_5935 | 230 |
| 846 | 3300035695 | Ga0373927_0015090 | Ga0373927_0015090_4099_4791 | 230 |
| 847 | 3300035695 | Ga0373927_0023988 | Ga0373927_0023988_1546_2253 | 230 |
| 848 | 3300035695 | Ga0373927_0041572 | Ga0373927_0041572_1566_2258 | 230 |
| 849 | 3300035695 | Ga0373927_0057537 | Ga0373927_0057537_281_982 | 230 |
| 850 | 3300035724 | Ga0373933_0000241 | Ga0373933_0000241_20483_21238 | 230 |
| 851 | 3300035724 | Ga0373933_0010931 | Ga0373933_0010931_3896_4588 | 230 |
| 852 | 3300035724 | Ga0373933_0256190 | Ga0373933_0256190_424_1116 | 230 |
| 853 | 3300035724 | Ga0373933_0402874 | Ga0373933_0402874_21_716 | 230 |
| 854 | 3300035725 | Ga0373947_0006228 | Ga0373947_0006228_4686_5378 | 230 |
| 855 | 3300035725 | Ga0373947_0011801 | Ga0373947_0011801_1541_2233 | 230 |
| 856 | 3300035725 | Ga0373947_0134660 | Ga0373947_0134660_455_1222 | 230 |
| 857 | 3300035725 | Ga0373947_0178964 | Ga0373947_0178964_632_1324 | 230 |
| 858 | 3300036401 | Ga0373937_0048039 | Ga0373937_0048039_1998_2693 | 230 |
| 859 | 3300036401 | Ga0373937_0054473 | Ga0373937_0054473_2879_3571 | 230 |
| 860 | 3300036401 | Ga0373937_0090572 | Ga0373937_0090572_469_1161 | 230 |
| 861 | 3300036401 | Ga0373937_0126219 | Ga0373937_0126219_1044_1736 | 230 |
| 862 | 3300036401 | Ga0373937_0595328 | Ga0373937_0595328_206_898 | 230 |
| 863 | 3300036459 | Ga0372808_015971 | Ga0372808_015971_69_761 | 230 |
| 864 | 3300037068 | Ga0373925_0003576 | Ga0373925_0003576_2930_3622 | 230 |
| 865 | 3300037068 | Ga0373925_0036563 | Ga0373925_0036563_1159_1851 | 230 |
| 866 | 3300037068 | Ga0373925_0039425 | Ga0373925_0039425_469_1161 | 230 |
| 867 | 3300037068 | Ga0373925_0062921 | Ga0373925_0062921_333_1028 | 230 |
| 868 | 3300037068 | Ga0373925_0085992 | Ga0373925_0085992_1467_2174 | 230 |
| 869 | 3300037068 | Ga0373925_0160610 | Ga0373925_0160610_418_1119 | 230 |
| 870 | 3300037068 | Ga0373925_0227968 | Ga0373925_0227968_302_994 | 230 |
| 871 | 3300037068 | Ga0373925_0320136 | Ga0373925_0320136_439_1131 | 230 |
| 872 | 3300037068 | Ga0373925_0330956 | Ga0373925_0330956_176_868 | 230 |
| 873 | 3300037312 | Ga0395899_0026158 | Ga0395899_0026158_3530_4222 | 230 |
| 874 | 3300037418 | Ga0395900_0001570 | Ga0395900_0001570_6234_6926 | 230 |
| 875 | 3300037418 | Ga0395900_0019206 | Ga0395900_0019206_5841_6533 | 230 |
| 876 | 3300037418 | Ga0395900_0036457 | Ga0395900_0036457_1887_2582 | 230 |
| 877 | 3300037418 | Ga0395900_0051963 | Ga0395900_0051963_1934_2629 | 230 |
| 878 | 3300037418 | Ga0395900_0077860 | Ga0395900_0077860_383_1078 | 230 |
| 879 | 3300037418 | Ga0395900_0102714 | Ga0395900_0102714_747_1439 | 230 |
| 880 | 3300037466 | Ga0395898_0006693 | Ga0395898_0006693_1555_2250 | 230 |
| 881 | 3300037466 | Ga0395898_0009563 | Ga0395898_0009563_5928_6620 | 230 |
| 882 | 3300037466 | Ga0395898_0031476 | Ga0395898_0031476_3778_4470 | 230 |
| 883 | 3300037466 | Ga0395898_0061763 | Ga0395898_0061763_2326_3021 | 230 |
| 884 | 3300037466 | Ga0395898_0071539 | Ga0395898_0071539_2236_2931 | 230 |
| 885 | 3300037471 | Ga0395905_0000548 | Ga0395905_0000548_26245_26937 | 230 |
| 886 | 3300037853 | Ga0436364_0407668 | Ga0436364_0407668_121_813 | 230 |
| 887 | 3300037853 | Ga0436364_0790824 | Ga0436364_0790824_5158_5850 | 230 |
| 888 | 3300037853 | Ga0436364_0836945 | Ga0436364_0836945_203_901 | 230 |
| 889 | 3300038443 | Ga0395901_0029002 | Ga0395901_0029002_2882_3577 | 230 |
| 890 | 3300038443 | Ga0395901_0033560 | Ga0395901_0033560_663_1355 | 230 |
| 891 | 3300038443 | Ga0395901_0053412 | Ga0395901_0053412_3049_3741 | 230 |
| 892 | 3300038443 | Ga0395901_0107854 | Ga0395901_0107854_674_1369 | 230 |
| 893 | 3300038443 | Ga0395901_0132133 | Ga0395901_0132133_1794_2489 | 230 |
| 894 | 3300038443 | Ga0395901_0269779 | Ga0395901_0269779_944_1639 | 230 |
| 895 | 3300038443 | Ga0395901_0634116 | Ga0395901_0634116_351_1043 | 230 |
| 896 | 3300039437 | Ga0436365_0182658 | Ga0436365_0182658_913_1605 | 230 |
| 897 | 3300039437 | Ga0436365_0196266 | Ga0436365_0196266_3170_3862 | 230 |
| 898 | 3300039438 | Ga0436360_0825284 | Ga0436360_0825284_45_737 | 230 |
| 899 | 3300039438 | Ga0436360_1192895 | Ga0436360_1192895_852_1544 | 230 |
| 900 | 3300039447 | Ga0436361_0284130 | Ga0436361_0284130_1609_2307 | 230 |
| 901 | 3300039447 | Ga0436361_1062074 | Ga0436361_1062074_952_1644 | 230 |
| 902 | 3300039453 | Ga0436362_0999686 | Ga0436362_0999686_41_733 | 230 |
| 903 | 3300041443 | Ga0451789_1145104 | Ga0451789_1145104_860_1552 | 230 |
| 904 | 3300041456 | Ga0451795_1424660 | Ga0451795_1424660_723_1415 | 230 |
| 905 | 3300044658 | Ga0466972_0000988 | Ga0466972_0000988_3790_4482 | 230 |
| 906 | 3300044658 | Ga0466972_0012012 | Ga0466972_0012012_897_1589 | 230 |
| 907 | 3300044658 | Ga0466972_0101932 | Ga0466972_0101932_290_982 | 230 |
| 908 | 3300044683 | Ga0466965_0012855 | Ga0466965_0012855_379_1071 | 230 |
| 909 | 3300044684 | Ga0466966_0000149 | Ga0466966_0000149_8190_8882 | 230 |
| 910 | 3300044684 | Ga0466966_0472036 | Ga0466966_0472036_19_711 | 230 |
| 911 | 3300044693 | Ga0466961_0000066 | Ga0466961_0000066_16049_16741 | 230 |
| 912 | 3300044694 | Ga0466963_0104016 | Ga0466963_0104016_434_1126 | 230 |
| 913 | 3300044901 | Ga0466960_0027844 | Ga0466960_0027844_1031_1723 | 230 |
| 914 | 3300045049 | Ga0466959_0178359 | Ga0466959_0178359_560_1252 | 230 |
| 915 | 3300045976 | Ga0466967_0022427 | Ga0466967_0022427_2342_3034 | 230 |
| 916 | 3300045976 | Ga0466967_0178758 | Ga0466967_0178758_1014_1706 | 230 |
| 917 | 3300045976 | Ga0466967_0259726 | Ga0466967_0259726_215_907 | 230 |
| 918 | 3300046454 | Ga0495592_0011023 | Ga0495592_0011023_1835_2527 | 230 |
| 919 | 3300046454 | Ga0495592_0011821 | Ga0495592_0011821_4187_4879 | 230 |
| 920 | 3300046454 | Ga0495592_0026415 | Ga0495592_0026415_1932_2624 | 230 |
| 921 | 3300046454 | Ga0495592_0139922 | Ga0495592_0139922_620_1315 | 230 |
| 922 | 3300046454 | Ga0495592_0185533 | Ga0495592_0185533_164_856 | 230 |
| 923 | 3300046454 | Ga0495592_0419534 | Ga0495592_0419534_81_773 | 230 |
| 924 | 3300046455 | Ga0495603_0003118 | Ga0495603_0003118_8364_9056 | 230 |
| 925 | 3300046455 | Ga0495603_0021697 | Ga0495603_0021697_1624_2316 | 230 |
| 926 | 3300046455 | Ga0495603_0066329 | Ga0495603_0066329_1389_2081 | 230 |
| 927 | 3300046455 | Ga0495603_0101618 | Ga0495603_0101618_723_1415 | 230 |
| 928 | 3300046455 | Ga0495603_0116366 | Ga0495603_0116366_267_959 | 230 |
| 929 | 3300046457 | Ga0495590_0022134 | Ga0495590_0022134_229_921 | 230 |
| 930 | 3300046459 | Ga0495629_0003275 | Ga0495629_0003275_3211_3903 | 230 |
| 931 | 3300046459 | Ga0495629_0015956 | Ga0495629_0015956_1398_2090 | 230 |
| 932 | 3300046460 | Ga0495638_0024997 | Ga0495638_0024997_2564_3256 | 230 |
| 933 | 3300046460 | Ga0495638_0043746 | Ga0495638_0043746_1975_2667 | 230 |
| 934 | 3300046461 | Ga0495641_0030001 | Ga0495641_0030001_1479_2171 | 230 |
| 935 | 3300046461 | Ga0495641_0115030 | Ga0495641_0115030_276_968 | 230 |
| 936 | 3300046462 | Ga0495651_0009884 | Ga0495651_0009884_2130_2822 | 230 |
| 937 | 3300046462 | Ga0495651_0069342 | Ga0495651_0069342_144_836 | 230 |
| 938 | 3300046462 | Ga0495651_0120258 | Ga0495651_0120258_392_1087 | 230 |
| 939 | 3300046462 | Ga0495651_0141575 | Ga0495651_0141575_794_1486 | 230 |
| 940 | 3300046462 | Ga0495651_0146547 | Ga0495651_0146547_306_998 | 230 |
| 941 | 3300046463 | Ga0495653_0081247 | Ga0495653_0081247_1292_1984 | 230 |
| 942 | 3300046463 | Ga0495653_0107023 | Ga0495653_0107023_614_1306 | 230 |
| 943 | 3300046463 | Ga0495653_0128000 | Ga0495653_0128000_717_1409 | 230 |
| 944 | 3300046471 | Ga0495650_0056371 | Ga0495650_0056371_806_1498 | 230 |
| 945 | 3300046473 | Ga0495582_0123691 | Ga0495582_0123691_581_1273 | 230 |
| 946 | 3300046473 | Ga0495582_0243960 | Ga0495582_0243960_277_969 | 230 |
| 947 | 3300046474 | Ga0495605_0044033 | Ga0495605_0044033_329_1021 | 230 |
| 948 | 3300046474 | Ga0495605_0153098 | Ga0495605_0153098_68_760 | 230 |
| 949 | 3300046475 | Ga0495639_0009158 | Ga0495639_0009158_1768_2460 | 230 |
| 950 | 3300046475 | Ga0495639_0090184 | Ga0495639_0090184_140_832 | 230 |
| 951 | 3300046476 | Ga0495662_0037136 | Ga0495662_0037136_887_1579 | 230 |
| 952 | 3300046476 | Ga0495662_0073671 | Ga0495662_0073671_916_1608 | 230 |
| 953 | 3300046477 | Ga0495664_0007535 | Ga0495664_0007535_3821_4513 | 230 |
| 954 | 3300046477 | Ga0495664_0081407 | Ga0495664_0081407_1112_1804 | 230 |
| 955 | 3300046477 | Ga0495664_0133228 | Ga0495664_0133228_198_890 | 230 |
| 956 | 3300046477 | Ga0495664_0191422 | Ga0495664_0191422_423_1115 | 230 |
| 957 | 3300046491 | Ga0495584_0162170 | Ga0495584_0162170_410_1102 | 230 |
| 958 | 3300046499 | Ga0495594_0004206 | Ga0495594_0004206_2752_3444 | 230 |
| 959 | 3300046499 | Ga0495594_0119977 | Ga0495594_0119977_169_861 | 230 |
| 960 | 3300046499 | Ga0495594_0152941 | Ga0495594_0152941_529_1221 | 230 |
| 961 | 3300046500 | Ga0495596_0044448 | Ga0495596_0044448_447_1139 | 230 |
| 962 | 3300046501 | Ga0495607_0149788 | Ga0495607_0149788_458_1150 | 230 |
| 963 | 3300046506 | Ga0495583_0117909 | Ga0495583_0117909_255_947 | 230 |
| 964 | 3300046507 | Ga0495606_0093566 | Ga0495606_0093566_432_1124 | 230 |
| 965 | 3300046507 | Ga0495606_0188367 | Ga0495606_0188367_92_784 | 230 |
| 966 | 3300046511 | Ga0495608_0000834 | Ga0495608_0000834_18579_19271 | 230 |
| 967 | 3300046511 | Ga0495608_0046938 | Ga0495608_0046938_100_792 | 230 |
| 968 | 3300046511 | Ga0495608_0200560 | Ga0495608_0200560_470_1162 | 230 |
| 969 | 3300046511 | Ga0495608_0393314 | Ga0495608_0393314_96_788 | 230 |
| 970 | 3300046512 | Ga0495610_0006739 | Ga0495610_0006739_1677_2369 | 230 |
| 971 | 3300046513 | Ga0495616_0059110 | Ga0495616_0059110_652_1344 | 230 |
| 972 | 3300046513 | Ga0495616_0120140 | Ga0495616_0120140_162_854 | 230 |
| 973 | 3300046514 | Ga0495618_0002623 | Ga0495618_0002623_6177_6869 | 230 |
| 974 | 3300046514 | Ga0495618_0012212 | Ga0495618_0012212_1191_1883 | 230 |
| 975 | 3300046514 | Ga0495618_0126488 | Ga0495618_0126488_429_1121 | 230 |
| 976 | 3300046514 | Ga0495618_0279622 | Ga0495618_0279622_55_876 | 230 |
| 977 | 3300046515 | Ga0495620_0033910 | Ga0495620_0033910_35_727 | 230 |
| 978 | 3300046515 | Ga0495620_0061313 | Ga0495620_0061313_486_1178 | 230 |
| 979 | 3300046516 | Ga0495628_0182029 | Ga0495628_0182029_543_1235 | 230 |
| 980 | 3300046516 | Ga0495628_0294553 | Ga0495628_0294553_86_778 | 230 |
| 981 | 3300046517 | Ga0495630_0522472 | Ga0495630_0522472_98_790 | 230 |
| 982 | 3300046518 | Ga0495631_0039962 | Ga0495631_0039962_681_1373 | 230 |
| 983 | 3300046518 | Ga0495631_0117957 | Ga0495631_0117957_438_1130 | 230 |
| 984 | 3300046519 | Ga0495632_0132573 | Ga0495632_0132573_317_1009 | 230 |
| 985 | 3300046522 | Ga0495643_0152293 | Ga0495643_0152293_395_1087 | 230 |
| 986 | 3300046523 | Ga0495644_0050848 | Ga0495644_0050848_187_879 | 230 |
| 987 | 3300046524 | Ga0495648_0040124 | Ga0495648_0040124_767_1459 | 230 |
| 988 | 3300046524 | Ga0495648_0060916 | Ga0495648_0060916_1059_1751 | 230 |
| 989 | 3300046524 | Ga0495648_0063008 | Ga0495648_0063008_1068_1760 | 230 |
| 990 | 3300046524 | Ga0495648_0162469 | Ga0495648_0162469_128_820 | 230 |
| 991 | 3300046524 | Ga0495648_0205274 | Ga0495648_0205274_10_702 | 230 |
| 992 | 3300046526 | Ga0495666_0105487 | Ga0495666_0105487_356_1048 | 230 |
| 993 | 3300046526 | Ga0495666_0135147 | Ga0495666_0135147_403_1095 | 230 |
| 994 | 3300046529 | Ga0495652_0014781 | Ga0495652_0014781_2963_3655 | 230 |
| 995 | 3300046529 | Ga0495652_0024613 | Ga0495652_0024613_3946_4767 | 230 |
| 996 | 3300046529 | Ga0495652_0029195 | Ga0495652_0029195_3757_4449 | 230 |
| 997 | 3300046529 | Ga0495652_0042669 | Ga0495652_0042669_775_1467 | 230 |
| 998 | 3300046529 | Ga0495652_0346956 | Ga0495652_0346956_156_848 | 230 |
| 999 | 3300046530 | Ga0495654_0145840 | Ga0495654_0145840_37_729 | 230 |
| 1000 | 3300046531 | Ga0495665_0019833 | Ga0495665_0019833_2230_2922 | 230 |
| 1001 | 3300046533 | Ga0495640_0014776 | Ga0495640_0014776_2927_3619 | 230 |
| 1002 | 3300046533 | Ga0495640_0028670 | Ga0495640_0028670_352_1173 | 230 |
| 1003 | 3300046533 | Ga0495640_0039887 | Ga0495640_0039887_1170_1862 | 230 |
| 1004 | 3300046533 | Ga0495640_0049784 | Ga0495640_0049784_715_1407 | 230 |
| 1005 | 3300046533 | Ga0495640_0111091 | Ga0495640_0111091_603_1295 | 230 |
| 1006 | 3300046533 | Ga0495640_0202370 | Ga0495640_0202370_65_766 | 230 |
| 1007 | 3300046536 | Ga0495587_0001442 | Ga0495587_0001442_1734_2426 | 230 |
| 1008 | 3300046536 | Ga0495587_0008806 | Ga0495587_0008806_3612_4304 | 230 |
| 1009 | 3300046536 | Ga0495587_0044947 | Ga0495587_0044947_982_1674 | 230 |
| 1010 | 3300046536 | Ga0495587_0171281 | Ga0495587_0171281_399_1091 | 230 |
| 1011 | 3300046537 | Ga0495598_0024400 | Ga0495598_0024400_455_1147 | 230 |
| 1012 | 3300046538 | Ga0495609_0117339 | Ga0495609_0117339_410_1102 | 230 |
| 1013 | 3300046538 | Ga0495609_0142803 | Ga0495609_0142803_56_748 | 230 |
| 1014 | 3300046539 | Ga0495621_0015676 | Ga0495621_0015676_374_1066 | 230 |
| 1015 | 3300046539 | Ga0495621_0020445 | Ga0495621_0020445_833_1525 | 230 |
| 1016 | 3300046543 | Ga0495645_0013005 | Ga0495645_0013005_3754_4446 | 230 |
| 1017 | 3300046543 | Ga0495645_0019288 | Ga0495645_0019288_2337_3029 | 230 |
| 1018 | 3300046543 | Ga0495645_0054563 | Ga0495645_0054563_932_1624 | 230 |
| 1019 | 3300046557 | Ga0495622_0011919 | Ga0495622_0011919_1988_2680 | 230 |
| 1020 | 3300046557 | Ga0495622_0037987 | Ga0495622_0037987_57_749 | 230 |
| 1021 | 3300046557 | Ga0495622_0110421 | Ga0495622_0110421_194_886 | 230 |
| 1022 | 3300046558 | Ga0495633_0042222 | Ga0495633_0042222_550_1242 | 230 |
| 1023 | 3300046558 | Ga0495633_0137429 | Ga0495633_0137429_319_1011 | 230 |
| 1024 | 3300046559 | Ga0495667_0052777 | Ga0495667_0052777_1007_1699 | 230 |
| 1025 | 3300046559 | Ga0495667_0055568 | Ga0495667_0055568_492_1184 | 230 |
| 1026 | 3300046559 | Ga0495667_0057663 | Ga0495667_0057663_1300_1992 | 230 |
| 1027 | 3300046559 | Ga0495667_0089410 | Ga0495667_0089410_406_1098 | 230 |
| 1028 | 3300046559 | Ga0495667_0089835 | Ga0495667_0089835_454_1275 | 230 |
| 1029 | 3300046615 | Ga0495656_0008710 | Ga0495656_0008710_2474_3166 | 230 |
| 1030 | 3300046642 | Ga0495634_0012455 | Ga0495634_0012455_2923_3615 | 230 |
| 1031 | 3300046642 | Ga0495634_0031432 | Ga0495634_0031432_1699_2391 | 230 |
| 1032 | 3300046642 | Ga0495634_0032939 | Ga0495634_0032939_2144_2836 | 230 |
| 1033 | 3300046648 | Ga0495611_0064846 | Ga0495611_0064846_453_1145 | 230 |
| 1034 | 3300046648 | Ga0495611_0074037 | Ga0495611_0074037_272_964 | 230 |
| 1035 | 3300046660 | Ga0495625_0140117 | Ga0495625_0140117_470_1162 | 230 |
| 1036 | 3300046660 | Ga0495625_0387311 | Ga0495625_0387311_166_858 | 230 |
| 1037 | 3300046663 | Ga0495635_0002510 | Ga0495635_0002510_9809_10501 | 230 |
| 1038 | 3300046663 | Ga0495635_0060745 | Ga0495635_0060745_588_1280 | 230 |
| 1039 | 3300046663 | Ga0495635_0184521 | Ga0495635_0184521_227_922 | 230 |
| 1040 | 3300046663 | Ga0495635_0216131 | Ga0495635_0216131_572_1264 | 230 |
| 1041 | 3300046664 | Ga0495659_0050529 | Ga0495659_0050529_118_810 | 230 |
| 1042 | 3300046664 | Ga0495659_0086916 | Ga0495659_0086916_350_1042 | 230 |
| 1043 | 3300046665 | Ga0495661_0170104 | Ga0495661_0170104_152_844 | 230 |
| 1044 | 3300046665 | Ga0495661_0235018 | Ga0495661_0235018_225_917 | 230 |
| 1045 | 3300046674 | Ga0495588_0004485 | Ga0495588_0004485_5240_5932 | 230 |
| 1046 | 3300046674 | Ga0495588_0012719 | Ga0495588_0012719_2464_3156 | 230 |
| 1047 | 3300046674 | Ga0495588_0046193 | Ga0495588_0046193_715_1407 | 230 |
| 1048 | 3300046674 | Ga0495588_0125812 | Ga0495588_0125812_430_1122 | 230 |
| 1049 | 3300046674 | Ga0495588_0324924 | Ga0495588_0324924_25_717 | 230 |
| 1050 | 3300046675 | Ga0495657_0005817 | Ga0495657_0005817_7964_8656 | 230 |
| 1051 | 3300046675 | Ga0495657_0007621 | Ga0495657_0007621_2434_3255 | 230 |
| 1052 | 3300046675 | Ga0495657_0033077 | Ga0495657_0033077_1449_2141 | 230 |
| 1053 | 3300046675 | Ga0495657_0095799 | Ga0495657_0095799_930_1625 | 230 |
| 1054 | 3300046675 | Ga0495657_0167731 | Ga0495657_0167731_595_1287 | 230 |
| 1055 | 3300046678 | Ga0495599_0000991 | Ga0495599_0000991_9366_10058 | 230 |
| 1056 | 3300046678 | Ga0495599_0104526 | Ga0495599_0104526_668_1360 | 230 |
| 1057 | 3300046678 | Ga0495599_0148784 | Ga0495599_0148784_137_829 | 230 |
| 1058 | 3300046678 | Ga0495599_0220903 | Ga0495599_0220903_168_860 | 230 |
| 1059 | 3300046678 | Ga0495599_0291087 | Ga0495599_0291087_266_958 | 230 |
| 1060 | 3300046680 | Ga0495646_0010983 | Ga0495646_0010983_2132_2824 | 230 |
| 1061 | 3300046680 | Ga0495646_0038251 | Ga0495646_0038251_331_1023 | 230 |
| 1062 | 3300046680 | Ga0495646_0063449 | Ga0495646_0063449_784_1476 | 230 |
| 1063 | 3300046680 | Ga0495646_0065199 | Ga0495646_0065199_1300_1992 | 230 |
| 1064 | 3300046680 | Ga0495646_0070361 | Ga0495646_0070361_560_1252 | 230 |
| 1065 | 3300046683 | Ga0495658_0018240 | Ga0495658_0018240_2856_3548 | 230 |
| 1066 | 3300046683 | Ga0495658_0328464 | Ga0495658_0328464_48_740 | 230 |
| 1067 | 3300046683 | Ga0495658_0443144 | Ga0495658_0443144_39_731 | 230 |
| 1068 | 3300046684 | Ga0495669_0006054 | Ga0495669_0006054_1185_1877 | 230 |
| 1069 | 3300046684 | Ga0495669_0101934 | Ga0495669_0101934_149_841 | 230 |
| 1070 | 3300046689 | Ga0495613_0012888 | Ga0495613_0012888_538_1359 | 230 |
| 1071 | 3300046689 | Ga0495613_0021728 | Ga0495613_0021728_2904_3596 | 230 |
| 1072 | 3300046689 | Ga0495613_0029885 | Ga0495613_0029885_100_792 | 230 |
| 1073 | 3300046689 | Ga0495613_0093305 | Ga0495613_0093305_753_1445 | 230 |
| 1074 | 3300046690 | Ga0495624_0036474 | Ga0495624_0036474_1051_1743 | 230 |
| 1075 | 3300046690 | Ga0495624_0157979 | Ga0495624_0157979_433_1140 | 230 |
| 1076 | 3300046690 | Ga0495624_0306406 | Ga0495624_0306406_120_821 | 230 |
| 1077 | 3300046691 | Ga0495670_0041892 | Ga0495670_0041892_22_714 | 230 |
| 1078 | 3300046691 | Ga0495670_0069166 | Ga0495670_0069166_451_1143 | 230 |
| 1079 | 3300046691 | Ga0495670_0099272 | Ga0495670_0099272_199_891 | 230 |
| 1080 | 3300046692 | Ga0495671_0044831 | Ga0495671_0044831_943_1635 | 230 |
| 1081 | 3300046694 | Ga0495649_0114674 | Ga0495649_0114674_132_824 | 230 |
| 1082 | 3300046794 | Ga0495589_0089041 | Ga0495589_0089041_623_1315 | 230 |
| 1083 | 3300046794 | Ga0495589_0117156 | Ga0495589_0117156_518_1210 | 230 |
| 1084 | 3300046794 | Ga0495589_0241245 | Ga0495589_0241245_42_734 | 230 |
| 1085 | 3300046809 | Ga0495600_0004571 | Ga0495600_0004571_2866_3558 | 230 |
| 1086 | 3300046809 | Ga0495600_0112401 | Ga0495600_0112401_500_1321 | 230 |
| 1087 | 3300046809 | Ga0495600_0189415 | Ga0495600_0189415_371_1063 | 230 |
| 1088 | 3300046809 | Ga0495600_0260613 | Ga0495600_0260613_337_1032 | 230 |
| 1089 | 3300046809 | Ga0495600_0487843 | Ga0495600_0487843_34_726 | 230 |
| 1090 | 3300046810 | Ga0495660_0134341 | Ga0495660_0134341_435_1127 | 230 |
| 1091 | 3300047315 | Ga0495581_0003566 | Ga0495581_0003566_4974_5666 | 230 |
| 1092 | 3300047315 | Ga0495581_0085424 | Ga0495581_0085424_892_1584 | 230 |
| 1093 | 3300047315 | Ga0495581_0086276 | Ga0495581_0086276_46_738 | 230 |
| 1094 | 3300047315 | Ga0495581_0166509 | Ga0495581_0166509_233_925 | 230 |
| 1095 | 3300047315 | Ga0495581_0243725 | Ga0495581_0243725_306_998 | 230 |
| 1096 | 3300047315 | Ga0495581_0271070 | Ga0495581_0271070_81_902 | 230 |
| 1097 | 3300047315 | Ga0495581_0281241 | Ga0495581_0281241_71_763 | 230 |
| 1098 | 3300047315 | Ga0495581_0397774 | Ga0495581_0397774_69_776 | 230 |
| 1099 | 3300047317 | Ga0495604_0005577 | Ga0495604_0005577_6082_6774 | 230 |
| 1100 | 3300047317 | Ga0495604_0019727 | Ga0495604_0019727_283_1104 | 230 |
| 1101 | 3300047317 | Ga0495604_0033071 | Ga0495604_0033071_2375_3070 | 230 |
| 1102 | 3300047317 | Ga0495604_0042380 | Ga0495604_0042380_2479_3171 | 230 |
| 1103 | 3300047317 | Ga0495604_0052858 | Ga0495604_0052858_745_1437 | 230 |
| 1104 | 3300047318 | Ga0495636_0026413 | Ga0495636_0026413_896_1588 | 230 |
| 1105 | 3300047319 | Ga0495674_0014033 | Ga0495674_0014033_2103_2795 | 230 |
| 1106 | 3300047319 | Ga0495674_0052274 | Ga0495674_0052274_1834_2526 | 230 |
| 1107 | 3300047319 | Ga0495674_0080136 | Ga0495674_0080136_996_1688 | 230 |
| 1108 | 3300047319 | Ga0495674_0363273 | Ga0495674_0363273_216_908 | 230 |
| 1109 | 3300047319 | Ga0495674_0484793 | Ga0495674_0484793_149_844 | 230 |
| 1110 | 3300047319 | Ga0495674_0493459 | Ga0495674_0493459_100_792 | 230 |
| 1111 | 3300047320 | Ga0495672_0053019 | Ga0495672_0053019_78_770 | 230 |
| 1112 | 3300047321 | Ga0495676_0001737 | Ga0495676_0001737_8364_9056 | 230 |
| 1113 | 3300047321 | Ga0495676_0102848 | Ga0495676_0102848_1357_2049 | 230 |
| 1114 | 3300047321 | Ga0495676_0116231 | Ga0495676_0116231_915_1607 | 230 |
| 1115 | 3300047321 | Ga0495676_0122925 | Ga0495676_0122925_203_895 | 230 |
| 1116 | 3300047321 | Ga0495676_0197098 | Ga0495676_0197098_35_727 | 230 |
| 1117 | 3300047322 | Ga0495680_0037719 | Ga0495680_0037719_537_1232 | 230 |
| 1118 | 3300047322 | Ga0495680_0045668 | Ga0495680_0045668_620_1312 | 230 |
| 1119 | 3300047322 | Ga0495680_0045938 | Ga0495680_0045938_746_1438 | 230 |
| 1120 | 3300047323 | Ga0495683_0073119 | Ga0495683_0073119_813_1505 | 230 |
| 1121 | 3300047443 | Ga0495687_006285 | Ga0495687_006285_1963_2655 | 230 |
| 1122 | 3300047444 | Ga0495675_0038437 | Ga0495675_0038437_1922_2614 | 230 |
| 1123 | 3300047444 | Ga0495675_0103049 | Ga0495675_0103049_448_1140 | 230 |
| 1124 | 3300047444 | Ga0495675_0121302 | Ga0495675_0121302_593_1288 | 230 |
| 1125 | 3300047444 | Ga0495675_0139174 | Ga0495675_0139174_76_768 | 230 |
| 1126 | 3300047447 | Ga0495685_068598 | Ga0495685_068598_417_1109 | 230 |
| 1127 | 3300047469 | Ga0495673_0054823 | Ga0495673_0054823_412_1104 | 230 |
| 1128 | 3300047469 | Ga0495673_0090093 | Ga0495673_0090093_261_1007 | 230 |
| 1129 | 3300047471 | Ga0495684_0015155 | Ga0495684_0015155_3118_3810 | 230 |
| 1130 | 3300047471 | Ga0495684_0059053 | Ga0495684_0059053_222_914 | 230 |
| 1131 | 3300047471 | Ga0495684_0102686 | Ga0495684_0102686_829_1521 | 230 |
| 1132 | 3300047471 | Ga0495684_0236170 | Ga0495684_0236170_398_1099 | 230 |
| 1133 | 3300047472 | Ga0495686_0199964 | Ga0495686_0199964_351_1043 | 230 |
| 1134 | 3300047673 | Ga0495593_0017756 | Ga0495593_0017756_1277_1969 | 230 |
| 1135 | 3300047673 | Ga0495593_0150653 | Ga0495593_0150653_282_1103 | 230 |
| 1136 | 3300048088 | Ga0495602_0024576 | Ga0495602_0024576_846_1538 | 230 |
| 1137 | 3300048088 | Ga0495602_0026581 | Ga0495602_0026581_4170_4862 | 230 |
| 1138 | 3300048088 | Ga0495602_0101196 | Ga0495602_0101196_951_1646 | 230 |
| 1139 | 3300048088 | Ga0495602_0134471 | Ga0495602_0134471_26_718 | 230 |
| 1140 | 3300048088 | Ga0495602_0167640 | Ga0495602_0167640_833_1561 | 230 |
| 1141 | 3300048088 | Ga0495602_0460604 | Ga0495602_0460604_150_842 | 230 |
| 1142 | 3300048091 | Ga0495626_0151877 | Ga0495626_0151877_264_956 | 230 |
| 1143 | 3300048903 | Ga0496100_0108826 | Ga0496100_0108826_989_1681 | 230 |
| 1144 | 3300048903 | Ga0496100_0117362 | Ga0496100_0117362_350_1042 | 230 |
| 1145 | 3300048903 | Ga0496100_0121789 | Ga0496100_0121789_669_1361 | 230 |
| 1146 | 3300048903 | Ga0496100_0130864 | Ga0496100_0130864_113_805 | 230 |
| 1147 | 3300048903 | Ga0496100_0165765 | Ga0496100_0165765_185_877 | 230 |
| 1148 | 3300048903 | Ga0496100_0235512 | Ga0496100_0235512_148_876 | 230 |
| 1149 | 3300048903 | Ga0496100_0331630 | Ga0496100_0331630_389_1081 | 230 |
| 1150 | 3300048904 | Ga0496101_0003782 | Ga0496101_0003782_4896_5588 | 230 |
| 1151 | 3300048904 | Ga0496101_0033757 | Ga0496101_0033757_1462_2154 | 230 |
| 1152 | 3300048904 | Ga0496101_0044088 | Ga0496101_0044088_1465_2157 | 230 |
| 1153 | 3300048904 | Ga0496101_0070190 | Ga0496101_0070190_1793_2485 | 230 |
| 1154 | 3300048904 | Ga0496101_0126355 | Ga0496101_0126355_335_1027 | 230 |
| 1155 | 3300048905 | Ga0496102_0025556 | Ga0496102_0025556_1090_1782 | 230 |
| 1156 | 3300048905 | Ga0496102_0057710 | Ga0496102_0057710_270_962 | 230 |
| 1157 | 3300048905 | Ga0496102_0067796 | Ga0496102_0067796_1184_1876 | 230 |
| 1158 | 3300048905 | Ga0496102_0141715 | Ga0496102_0141715_674_1366 | 230 |
| 1159 | 3300048905 | Ga0496102_0183077 | Ga0496102_0183077_379_1071 | 230 |
| 1160 | 3300048905 | Ga0496102_0184885 | Ga0496102_0184885_105_797 | 230 |
| 1161 | 3300048905 | Ga0496102_0648413 | Ga0496102_0648413_46_738 | 230 |
| 1162 | 3300048905 | Ga0496102_0659042 | Ga0496102_0659042_93_785 | 230 |
| 1163 | 3300048905 | Ga0496102_0701058 | Ga0496102_0701058_21_713 | 230 |
| 1164 | 3300048906 | Ga0496103_0049485 | Ga0496103_0049485_40_732 | 230 |
| 1165 | 3300048906 | Ga0496103_0196409 | Ga0496103_0196409_258_950 | 230 |
| 1166 | 3300048906 | Ga0496103_0327499 | Ga0496103_0327499_129_821 | 230 |
| 1167 | 3300048907 | Ga0496104_0008069 | Ga0496104_0008069_5061_5882 | 230 |
| 1168 | 3300048907 | Ga0496104_0009739 | Ga0496104_0009739_2028_2720 | 230 |
| 1169 | 3300048907 | Ga0496104_0011099 | Ga0496104_0011099_6953_7645 | 230 |
| 1170 | 3300048907 | Ga0496104_0011247 | Ga0496104_0011247_4520_5212 | 230 |
| 1171 | 3300048907 | Ga0496104_0061017 | Ga0496104_0061017_2674_3366 | 230 |
| 1172 | 3300048907 | Ga0496104_0070610 | Ga0496104_0070610_688_1380 | 230 |
| 1173 | 3300048907 | Ga0496104_0087161 | Ga0496104_0087161_834_1526 | 230 |
| 1174 | 3300048907 | Ga0496104_0117781 | Ga0496104_0117781_1438_2130 | 230 |
| 1175 | 3300048907 | Ga0496104_0143961 | Ga0496104_0143961_397_1089 | 230 |
| 1176 | 3300048907 | Ga0496104_0253095 | Ga0496104_0253095_763_1491 | 230 |
| 1177 | 3300048907 | Ga0496104_0294924 | Ga0496104_0294924_151_849 | 230 |
| 1178 | 3300048907 | Ga0496104_0374708 | Ga0496104_0374708_132_824 | 230 |
| 1179 | 3300048908 | Ga0496105_0001065 | Ga0496105_0001065_7199_8020 | 230 |
| 1180 | 3300048908 | Ga0496105_0001708 | Ga0496105_0001708_393_1085 | 230 |
| 1181 | 3300048908 | Ga0496105_0029404 | Ga0496105_0029404_3026_3718 | 230 |
| 1182 | 3300048908 | Ga0496105_0031695 | Ga0496105_0031695_1615_2307 | 230 |
| 1183 | 3300048908 | Ga0496105_0054157 | Ga0496105_0054157_787_1479 | 230 |
| 1184 | 3300048908 | Ga0496105_0092136 | Ga0496105_0092136_1136_1828 | 230 |
| 1185 | 3300048908 | Ga0496105_0094691 | Ga0496105_0094691_715_1407 | 230 |
| 1186 | 3300048908 | Ga0496105_0108474 | Ga0496105_0108474_130_951 | 230 |
| 1187 | 3300048908 | Ga0496105_0133400 | Ga0496105_0133400_950_1642 | 230 |
| 1188 | 3300048908 | Ga0496105_0198024 | Ga0496105_0198024_590_1282 | 230 |
| 1189 | 3300048909 | Ga0496106_0002611 | Ga0496106_0002611_1498_2190 | 230 |
| 1190 | 3300048909 | Ga0496106_0040583 | Ga0496106_0040583_975_1667 | 230 |
| 1191 | 3300048909 | Ga0496106_0135424 | Ga0496106_0135424_821_1513 | 230 |
| 1192 | 3300048909 | Ga0496106_0138461 | Ga0496106_0138461_55_747 | 230 |
| 1193 | 3300048910 | Ga0496107_0020603 | Ga0496107_0020603_1699_2391 | 230 |
| 1194 | 3300048910 | Ga0496107_0034039 | Ga0496107_0034039_1484_2176 | 230 |
| 1195 | 3300048910 | Ga0496107_0038762 | Ga0496107_0038762_2404_3096 | 230 |
| 1196 | 3300048910 | Ga0496107_0053987 | Ga0496107_0053987_871_1563 | 230 |
| 1197 | 3300048910 | Ga0496107_0221377 | Ga0496107_0221377_10_702 | 230 |
| 1198 | 3300048910 | Ga0496107_0283467 | Ga0496107_0283467_484_1176 | 230 |
| 1199 | 3300048911 | Ga0496108_0017610 | Ga0496108_0017610_4969_5661 | 230 |
| 1200 | 3300048911 | Ga0496108_0018579 | Ga0496108_0018579_2508_3200 | 230 |
| 1201 | 3300048911 | Ga0496108_0055047 | Ga0496108_0055047_1485_2177 | 230 |
| 1202 | 3300048911 | Ga0496108_0057622 | Ga0496108_0057622_1603_2295 | 230 |
| 1203 | 3300048911 | Ga0496108_0095651 | Ga0496108_0095651_866_1558 | 230 |
| 1204 | 3300048911 | Ga0496108_0143737 | Ga0496108_0143737_486_1178 | 230 |
| 1205 | 3300048911 | Ga0496108_0167823 | Ga0496108_0167823_897_1718 | 230 |
| 1206 | 3300048911 | Ga0496108_0244187 | Ga0496108_0244187_792_1484 | 230 |
| 1207 | 3300048912 | Ga0496109_0001152 | Ga0496109_0001152_2742_3434 | 230 |
| 1208 | 3300048912 | Ga0496109_0003675 | Ga0496109_0003675_5911_6603 | 230 |
| 1209 | 3300048912 | Ga0496109_0052743 | Ga0496109_0052743_2697_3389 | 230 |
| 1210 | 3300048912 | Ga0496109_0103705 | Ga0496109_0103705_268_960 | 230 |
| 1211 | 3300048912 | Ga0496109_0115523 | Ga0496109_0115523_1081_1773 | 230 |
| 1212 | 3300048912 | Ga0496109_0144495 | Ga0496109_0144495_1095_1793 | 230 |
| 1213 | 3300048912 | Ga0496109_0145098 | Ga0496109_0145098_143_835 | 230 |
| 1214 | 3300048912 | Ga0496109_0268704 | Ga0496109_0268704_882_1574 | 230 |
| 1215 | 3300048912 | Ga0496109_0317386 | Ga0496109_0317386_545_1237 | 230 |
| 1216 | 3300048913 | Ga0496110_0023309 | Ga0496110_0023309_3995_4687 | 230 |
| 1217 | 3300048913 | Ga0496110_0038897 | Ga0496110_0038897_1659_2351 | 230 |
| 1218 | 3300048913 | Ga0496110_0044214 | Ga0496110_0044214_2246_2938 | 230 |
| 1219 | 3300048913 | Ga0496110_0046121 | Ga0496110_0046121_1234_1926 | 230 |
| 1220 | 3300048913 | Ga0496110_0068797 | Ga0496110_0068797_486_1178 | 230 |
| 1221 | 3300048913 | Ga0496110_0148874 | Ga0496110_0148874_961_1653 | 230 |
| 1222 | 3300048913 | Ga0496110_0270405 | Ga0496110_0270405_85_777 | 230 |
| 1223 | 3300048913 | Ga0496110_0599628 | Ga0496110_0599628_275_973 | 230 |
| 1224 | 3300048914 | Ga0496111_0000825 | Ga0496111_0000825_1404_2096 | 230 |
| 1225 | 3300048914 | Ga0496111_0066704 | Ga0496111_0066704_1495_2193 | 230 |
| 1226 | 3300048914 | Ga0496111_0191382 | Ga0496111_0191382_40_732 | 230 |
| 1227 | 3300048914 | Ga0496111_0354787 | Ga0496111_0354787_293_985 | 230 |
| 1228 | 3300048914 | Ga0496111_0417201 | Ga0496111_0417201_178_870 | 230 |
| 1229 | 3300048915 | Ga0496112_0000051 | Ga0496112_0000051_44730_45422 | 230 |
| 1230 | 3300048915 | Ga0496112_0003123 | Ga0496112_0003123_526_1218 | 230 |
| 1231 | 3300048915 | Ga0496112_0008384 | Ga0496112_0008384_746_1438 | 230 |
| 1232 | 3300048915 | Ga0496112_0023197 | Ga0496112_0023197_1284_1976 | 230 |
| 1233 | 3300048915 | Ga0496112_0026067 | Ga0496112_0026067_1117_1809 | 230 |
| 1234 | 3300048915 | Ga0496112_0115446 | Ga0496112_0115446_405_1097 | 230 |
| 1235 | 3300048915 | Ga0496112_0205523 | Ga0496112_0205523_520_1212 | 230 |
| 1236 | 3300048915 | Ga0496112_0253569 | Ga0496112_0253569_478_1176 | 230 |
| 1237 | 3300048915 | Ga0496112_0443208 | Ga0496112_0443208_205_951 | 230 |
| 1238 | 3300048916 | Ga0496113_0001092 | Ga0496113_0001092_1527_2219 | 230 |
| 1239 | 3300048916 | Ga0496113_0013878 | Ga0496113_0013878_3586_4407 | 230 |
| 1240 | 3300048916 | Ga0496113_0021246 | Ga0496113_0021246_3704_4396 | 230 |
| 1241 | 3300048916 | Ga0496113_0033118 | Ga0496113_0033118_1476_2168 | 230 |
| 1242 | 3300048916 | Ga0496113_0056314 | Ga0496113_0056314_1461_2153 | 230 |
| 1243 | 3300048916 | Ga0496113_0288571 | Ga0496113_0288571_238_930 | 230 |
| 1244 | 3300048916 | Ga0496113_0550036 | Ga0496113_0550036_81_809 | 230 |
| 1245 | 3300048917 | Ga0496114_0144165 | Ga0496114_0144165_944_1636 | 230 |
| 1246 | 3300048917 | Ga0496114_0269358 | Ga0496114_0269358_527_1219 | 230 |
| 1247 | 3300048917 | Ga0496114_0286413 | Ga0496114_0286413_531_1223 | 230 |
| 1248 | 3300048917 | Ga0496114_0350983 | Ga0496114_0350983_454_1146 | 230 |
| 1249 | 3300048917 | Ga0496114_0493039 | Ga0496114_0493039_242_934 | 230 |
| 1250 | 3300048917 | Ga0496114_0751220 | Ga0496114_0751220_93_785 | 230 |
| 1251 | 3300048918 | Ga0496115_0000756 | Ga0496115_0000756_9194_9886 | 230 |
| 1252 | 3300048918 | Ga0496115_0012216 | Ga0496115_0012216_1206_1898 | 230 |
| 1253 | 3300048918 | Ga0496115_0042668 | Ga0496115_0042668_1174_1866 | 230 |
| 1254 | 3300048918 | Ga0496115_0045211 | Ga0496115_0045211_725_1417 | 230 |
| 1255 | 3300048918 | Ga0496115_0051742 | Ga0496115_0051742_2554_3246 | 230 |
| 1256 | 3300048918 | Ga0496115_0067152 | Ga0496115_0067152_1959_2651 | 230 |
| 1257 | 3300048918 | Ga0496115_0123786 | Ga0496115_0123786_14_706 | 230 |
| 1258 | 3300048918 | Ga0496115_0139324 | Ga0496115_0139324_139_831 | 230 |
| 1259 | 3300048918 | Ga0496115_0164954 | Ga0496115_0164954_756_1448 | 230 |
| 1260 | 3300048918 | Ga0496115_0633515 | Ga0496115_0633515_115_807 | 230 |
| 1261 | 3300048920 | Ga0496117_0055157 | Ga0496117_0055157_1589_2281 | 230 |
| 1262 | 3300048921 | Ga0496118_0028998 | Ga0496118_0028998_163_855 | 230 |
| 1263 | 3300048921 | Ga0496118_0052015 | Ga0496118_0052015_487_1179 | 230 |
| 1264 | 3300048921 | Ga0496118_0063877 | Ga0496118_0063877_1336_2028 | 230 |
| 1265 | 3300048921 | Ga0496118_0075120 | Ga0496118_0075120_402_1094 | 230 |
| 1266 | 3300048921 | Ga0496118_0137394 | Ga0496118_0137394_23_715 | 230 |
| 1267 | 3300048922 | Ga0496119_0000244 | Ga0496119_0000244_18785_19477 | 230 |
| 1268 | 3300048922 | Ga0496119_0030425 | Ga0496119_0030425_2220_3041 | 230 |
| 1269 | 3300048922 | Ga0496119_0098587 | Ga0496119_0098587_485_1177 | 230 |
| 1270 | 3300048922 | Ga0496119_0112556 | Ga0496119_0112556_87_779 | 230 |
| 1271 | 3300048922 | Ga0496119_0140492 | Ga0496119_0140492_489_1181 | 230 |
| 1272 | 3300048923 | Ga0496120_0017615 | Ga0496120_0017615_3920_4612 | 230 |
| 1273 | 3300048923 | Ga0496120_0068451 | Ga0496120_0068451_741_1433 | 230 |
| 1274 | 3300048923 | Ga0496120_0152270 | Ga0496120_0152270_45_737 | 230 |
| 1275 | 3300048924 | Ga0496121_0012808 | Ga0496121_0012808_271_963 | 230 |
| 1276 | 3300048924 | Ga0496121_0034272 | Ga0496121_0034272_2423_3115 | 230 |
| 1277 | 3300048924 | Ga0496121_0083676 | Ga0496121_0083676_1246_1938 | 230 |
| 1278 | 3300048924 | Ga0496121_0121734 | Ga0496121_0121734_895_1716 | 230 |
| 1279 | 3300048924 | Ga0496121_0179659 | Ga0496121_0179659_744_1436 | 230 |
| 1280 | 3300048924 | Ga0496121_0194438 | Ga0496121_0194438_84_776 | 230 |
| 1281 | 3300048925 | Ga0496122_0090902 | Ga0496122_0090902_869_1561 | 230 |
| 1282 | 3300048925 | Ga0496122_0122085 | Ga0496122_0122085_267_1088 | 230 |
| 1283 | 3300048927 | Ga0496124_0238165 | Ga0496124_0238165_24_740 | 230 |
| 1284 | 3300048928 | Ga0496125_0038146 | Ga0496125_0038146_2726_3418 | 230 |
| 1285 | 3300048928 | Ga0496125_0056583 | Ga0496125_0056583_628_1449 | 230 |
| 1286 | 3300048928 | Ga0496125_0137245 | Ga0496125_0137245_388_1080 | 230 |
| 1287 | 3300048928 | Ga0496125_0165859 | Ga0496125_0165859_386_1078 | 230 |
| 1288 | 3300048928 | Ga0496125_0228582 | Ga0496125_0228582_110_802 | 230 |
| 1289 | 3300048929 | Ga0496126_0010948 | Ga0496126_0010948_4638_5330 | 230 |
| 1290 | 3300048929 | Ga0496126_0057775 | Ga0496126_0057775_1754_2575 | 230 |
| 1291 | 3300048929 | Ga0496126_0071900 | Ga0496126_0071900_1774_2466 | 230 |
| 1292 | 3300048929 | Ga0496126_0074009 | Ga0496126_0074009_30_722 | 230 |
| 1293 | 3300048929 | Ga0496126_0085689 | Ga0496126_0085689_1992_2684 | 230 |
| 1294 | 3300048929 | Ga0496126_0101174 | Ga0496126_0101174_1320_2012 | 230 |
| 1295 | 3300048929 | Ga0496126_0171954 | Ga0496126_0171954_1058_1750 | 230 |
| 1296 | 3300049460 | Ga0495682_0089170 | Ga0495682_0089170_252_944 | 230 |
| 1297 | 3300049583 | Ga0501067_0044541 | Ga0501067_0044541_1500_2192 | 230 |
| 1298 | 3300050489 | nmdc:mga03683_16041_c1 | nmdc:mga03683_16041_c1_453_1145 | 230 |
| 1299 | 3300050489 | nmdc:mga03683_163998_c1 | nmdc:mga03683_163998_c1_68_760 | 230 |
| 1300 | 3300050489 | nmdc:mga03683_90692_c1 | nmdc:mga03683_90692_c1_533_1225 | 230 |
| 1301 | 3300050490 | nmdc:mga03n38_22967_c1 | nmdc:mga03n38_22967_c1_1756_2448 | 230 |
| 1302 | 3300050490 | nmdc:mga03n38_27353_c1 | nmdc:mga03n38_27353_c1_666_1358 | 230 |
| 1303 | 3300050491 | nmdc:mga00v17_181806_c1 | nmdc:mga00v17_181806_c1_312_1004 | 230 |
| 1304 | 3300050491 | nmdc:mga00v17_230907_c1 | nmdc:mga00v17_230907_c1_15_707 | 230 |
| 1305 | 3300050491 | nmdc:mga00v17_272812_c1 | nmdc:mga00v17_272812_c1_370_1062 | 230 |
| 1306 | 3300050492 | nmdc:mga0yw44_106694_c1 | nmdc:mga0yw44_106694_c1_185_877 | 230 |
| 1307 | 3300050492 | nmdc:mga0yw44_11679_c1 | nmdc:mga0yw44_11679_c1_1177_1869 | 230 |
| 1308 | 3300050492 | nmdc:mga0yw44_130944_c1 | nmdc:mga0yw44_130944_c1_263_955 | 230 |
| 1309 | 3300050492 | nmdc:mga0yw44_13381_c2 | nmdc:mga0yw44_13381_c2_238_930 | 230 |
| 1310 | 3300050492 | nmdc:mga0yw44_150923_c1 | nmdc:mga0yw44_150923_c1_140_832 | 230 |
| 1311 | 3300050492 | nmdc:mga0yw44_311742_c1 | nmdc:mga0yw44_311742_c1_169_861 | 230 |
| 1312 | 3300050493 | nmdc:mga0k408_143346_c1 | nmdc:mga0k408_143346_c1_249_941 | 230 |
| 1313 | 3300050493 | nmdc:mga0k408_21086_c1 | nmdc:mga0k408_21086_c1_1890_2582 | 230 |
| 1314 | 3300050493 | nmdc:mga0k408_89303_c2 | nmdc:mga0k408_89303_c2_311_1003 | 230 |
| 1315 | 3300050494 | nmdc:mga06z11_115467_c1 | nmdc:mga06z11_115467_c1_321_1013 | 230 |
| 1316 | 3300050494 | nmdc:mga06z11_17732_c1 | nmdc:mga06z11_17732_c1_1149_1841 | 230 |
| 1317 | 3300050494 | nmdc:mga06z11_84253_c1 | nmdc:mga06z11_84253_c1_32_724 | 230 |
| 1318 | 3300050495 | nmdc:mga04h51_52137_c1 | nmdc:mga04h51_52137_c1_580_1272 | 230 |
| 1319 | 3300050496 | nmdc:mga07m45_121766_c1 | nmdc:mga07m45_121766_c1_316_1008 | 230 |
| 1320 | 3300050496 | nmdc:mga07m45_176638_c1 | nmdc:mga07m45_176638_c1_418_1110 | 230 |
| 1321 | 3300050496 | nmdc:mga07m45_67113_c1 | nmdc:mga07m45_67113_c1_715_1407 | 230 |
| 1322 | 3300050507 | nmdc:mga05p37_207007_c1 | nmdc:mga05p37_207007_c1_360_1052 | 230 |
| 1323 | 3300050510 | nmdc:mga06r32_68261_c1 | nmdc:mga06r32_68261_c1_2580_3272 | 230 |
| 1324 | 3300050511 | nmdc:mga08y16_523063_c1 | nmdc:mga08y16_523063_c1_420_1112 | 230 |
| 1325 | 3300050512 | nmdc:mga0n895_106524_c1 | nmdc:mga0n895_106524_c1_244_936 | 230 |
| 1326 | 3300050512 | nmdc:mga0n895_113926_c1 | nmdc:mga0n895_113926_c1_711_1403 | 230 |
| 1327 | 3300050512 | nmdc:mga0n895_18014_c1 | nmdc:mga0n895_18014_c1_5100_5792 | 230 |
| 1328 | 3300050513 | nmdc:mga0rr50_336857_c1 | nmdc:mga0rr50_336857_c1_311_1003 | 230 |
| 1329 | 3300050513 | nmdc:mga0rr50_80317_c1 | nmdc:mga0rr50_80317_c1_987_1679 | 230 |
| 1330 | 3300050514 | nmdc:mga08x19_37496_c1 | nmdc:mga08x19_37496_c1_711_1403 | 230 |
| 1331 | 3300050515 | nmdc:mga0a205_125945_c1 | nmdc:mga0a205_125945_c1_273_965 | 230 |
| 1332 | 3300050515 | nmdc:mga0a205_202108_c1 | nmdc:mga0a205_202108_c1_230_922 | 230 |
| 1333 | 3300050516 | nmdc:mga0sz30_32339_c1 | nmdc:mga0sz30_32339_c1_1153_1845 | 230 |
| 1334 | 3300050516 | nmdc:mga0sz30_72717_c1 | nmdc:mga0sz30_72717_c1_133_825 | 230 |
| 1335 | 3300053077 | Ga0495601_0001640 | Ga0495601_0001640_2905_3597 | 230 |
| 1336 | 3300053077 | Ga0495601_0023203 | Ga0495601_0023203_2938_3630 | 230 |
| 1337 | 3300053077 | Ga0495601_0023397 | Ga0495601_0023397_2525_3217 | 230 |
| 1338 | 3300053077 | Ga0495601_0028831 | Ga0495601_0028831_617_1309 | 230 |
| 1339 | 3300053077 | Ga0495601_0267970 | Ga0495601_0267970_374_1066 | 230 |
| 1340 | 3300053078 | Ga0495612_0019127 | Ga0495612_0019127_103_795 | 230 |
| 1341 | 3300053079 | Ga0500610_0028492 | Ga0500610_0028492_46_738 | 230 |
| 1342 | 3300053080 | Ga0500635_0008295 | Ga0500635_0008295_1722_2414 | 230 |
| 1343 | 3300053083 | Ga0495655_0043627 | Ga0495655_0043627_83_775 | 230 |
| 1344 | 3300053084 | Ga0495595_0007612 | Ga0495595_0007612_1813_2505 | 230 |
| 1345 | 3300053084 | Ga0495595_0027640 | Ga0495595_0027640_1297_1989 | 230 |
| 1346 | 3300053084 | Ga0495595_0052266 | Ga0495595_0052266_665_1357 | 230 |
| 1347 | 3300053084 | Ga0495595_0061725 | Ga0495595_0061725_692_1384 | 230 |
| 1348 | 3300053084 | Ga0495595_0178811 | Ga0495595_0178811_248_943 | 230 |
| 1349 | 3300053084 | Ga0495595_0221505 | Ga0495595_0221505_231_923 | 230 |
| 1350 | 3300053085 | Ga0495619_0008243 | Ga0495619_0008243_4582_5274 | 230 |
| 1351 | 3300053085 | Ga0495619_0010343 | Ga0495619_0010343_2929_3621 | 230 |
| 1352 | 3300053085 | Ga0495619_0012352 | Ga0495619_0012352_677_1369 | 230 |
| 1353 | 3300053085 | Ga0495619_0058763 | Ga0495619_0058763_692_1393 | 230 |
| 1354 | 3300053085 | Ga0495619_0122870 | Ga0495619_0122870_439_1131 | 230 |
| 1355 | 3300053085 | Ga0495619_0174754 | Ga0495619_0174754_606_1298 | 230 |
| 1356 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_76682_77374 | 230 |
| 1357 | 3300053087 | Ga0500643_046243 | Ga0500643_046243_249_941 | 230 |
| 1358 | 3300053091 | Ga0500647_0013414 | Ga0500647_0013414_1722_2414 | 230 |
| 1359 | 3300053092 | Ga0500583_0063488 | Ga0500583_0063488_1047_1739 | 230 |
| 1360 | 3300053093 | Ga0500651_0042202 | Ga0500651_0042202_1219_1911 | 230 |
| 1361 | 3300053093 | Ga0500651_0192977 | Ga0500651_0192977_436_1128 | 230 |
| 1362 | 3300053094 | Ga0500566_0002168 | Ga0500566_0002168_7456_8148 | 230 |
| 1363 | 3300053096 | Ga0500641_0009257 | Ga0500641_0009257_1199_1891 | 230 |
| 1364 | 3300053096 | Ga0500641_0114321 | Ga0500641_0114321_449_1141 | 230 |
| 1365 | 3300053098 | Ga0500650_0070830 | Ga0500650_0070830_713_1405 | 230 |
| 1366 | 3300053103 | Ga0500555_009333 | Ga0500555_009333_137_829 | 230 |
| 1367 | 3300053105 | Ga0500557_000069 | Ga0500557_000069_6862_7554 | 230 |
| 1368 | 3300053108 | Ga0500562_009007 | Ga0500562_009007_241_933 | 230 |
| 1369 | 3300053108 | Ga0500562_011635 | Ga0500562_011635_647_1339 | 230 |
| 1370 | 3300053111 | Ga0500572_000290 | Ga0500572_000290_4243_4935 | 230 |
| 1371 | 3300053119 | Ga0500595_007010 | Ga0500595_007010_2057_2749 | 230 |
| 1372 | 3300053128 | Ga0500626_126940 | Ga0500626_126940_85_777 | 230 |
| 1373 | 3300053130 | Ga0500642_0000089 | Ga0500642_0000089_23938_24630 | 230 |
| 1374 | 3300053131 | Ga0500652_026345 | Ga0500652_026345_1047_1739 | 230 |
| 1375 | 3300053133 | Ga0500655_020696 | Ga0500655_020696_275_967 | 230 |
| 1376 | 3300053134 | Ga0500658_0090936 | Ga0500658_0090936_552_1244 | 230 |
| 1377 | 3300053136 | Ga0500559_0000274 | Ga0500559_0000274_15210_15902 | 230 |
| 1378 | 3300053139 | Ga0500568_0068050 | Ga0500568_0068050_58_750 | 230 |
| 1379 | 3300053144 | Ga0500585_074316 | Ga0500585_074316_212_904 | 230 |
| 1380 | 3300053150 | Ga0500603_029411 | Ga0500603_029411_112_804 | 230 |
| 1381 | 3300053151 | Ga0500604_0074264 | Ga0500604_0074264_20_712 | 230 |
| 1382 | 3300053155 | Ga0500620_002584 | Ga0500620_002584_978_1670 | 230 |
| 1383 | 3300053156 | Ga0500622_0020174 | Ga0500622_0020174_2429_3121 | 230 |
| 1384 | 3300053157 | Ga0500624_010469 | Ga0500624_010469_153_845 | 230 |
| 1385 | 3300053158 | Ga0500627_0006558 | Ga0500627_0006558_542_1234 | 230 |
| 1386 | 3300053158 | Ga0500627_0077332 | Ga0500627_0077332_680_1372 | 230 |
| 1387 | 3300053160 | Ga0500633_0103990 | Ga0500633_0103990_210_902 | 230 |
| 1388 | 3300053160 | Ga0500633_0113304 | Ga0500633_0113304_85_777 | 230 |
| 1389 | 3300053162 | Ga0500638_060912 | Ga0500638_060912_482_1174 | 230 |
| 1390 | 3300053163 | Ga0500639_116024 | Ga0500639_116024_241_933 | 230 |
| 1391 | 3300053177 | Ga0500636_0000263 | Ga0500636_0000263_3441_4133 | 230 |
| 1392 | 3300053178 | Ga0500637_0009969 | Ga0500637_0009969_3527_4219 | 230 |
| 1393 | 3300053178 | Ga0500637_0061988 | Ga0500637_0061988_1069_1761 | 230 |
| 1394 | 3300053725 | Ga0500576_021480 | Ga0500576_021480_711_1403 | 230 |
| 1395 | 3300053727 | Ga0500611_012241 | Ga0500611_012241_410_1102 | 230 |
| 1396 | 3300053729 | Ga0500625_033352 | Ga0500625_033352_1292_1984 | 230 |
| 1397 | 3300053730 | Ga0500645_027638 | Ga0500645_027638_472_1164 | 230 |
| 1398 | 3300053730 | Ga0500645_031956 | Ga0500645_031956_606_1298 | 230 |
| 1399 | 3300053731 | Ga0500609_005242 | Ga0500609_005242_1001_1693 | 230 |
| 1400 | 3300053732 | Ga0500656_007136 | Ga0500656_007136_151_843 | 230 |
| 1401 | 3300053735 | Ga0500596_004264 | Ga0500596_004264_1327_2019 | 230 |
| 1402 | 3300053736 | Ga0500599_002544 | Ga0500599_002544_1109_1801 | 230 |
| 1403 | 3300053737 | Ga0500601_000788 | Ga0500601_000788_789_1481 | 230 |
| 1404 | iso_pu_bacteria | 8056689827 | 8056691513 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pmu-assembly1.cif.gz_C | crystal structure of the dna-binding domain of phop | 0.9426 | 130 | 229 |
| 5x5j-assembly1.cif.gz_A | crystal structure of response regulator ader receiver domain | 0.9378 | 6 | 123 |
| 2pmu-assembly1.cif.gz_C | crystal structure of the dna-binding domain of phop | 0.9329 | 130 | 229 |
| 8hml-assembly1.cif.gz_B | co-crystal structure of the c terminal dna binding domain of saccharopolyspora erythraea glnr in complex with its conserved promoter dna in 2.95 angstrom resolution | 0.9311 | 135 | 230 |
| 7cci-assembly1.cif.gz_A | acinetobacter baumannii response regulator ader with disordered n terminus | 0.9302 | 6 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9887 | 7 | 85 | 3.40.50.2300 |
| af_Q2FY79_1_81_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9719 | 6 | 85 | 3.40.50.2300 |
| af_P71814_19_100_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9719 | 7 | 85 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9705 | 7 | 85 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9693 | 7 | 85 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1CMB6-F1-model_v4 | OmpR/PhoB-type domain-containing protein | 0.9387 | 155 | 228 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A354DKL1-F1-model_v4 | DNA-binding response regulator | 0.9358 | 6 | 90 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A419F6T0-F1-model_v4 | Response regulator | 0.9211 | 7 | 125 |
GO:0000160
|
| AF-A0A6G7PXV4-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9208 | 6 | 126 |
GO:0000155
|
| AF-A0A2N2HFV0-F1-model_v4 | Fis family transcriptional regulator | 0.9207 | 7 | 126 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar