F493531
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1383 | 375 | 2766 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100713753|Ga0070714_1007137532 |
| Length | 83 |
| Sequence | MTIRLSVVDHGHAPEEAAMLAEIRERTGREPLGVVKTLLYRPELFGRPFSEELDRVMRGPSDWTVGERELFAGFASHLNQCLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 109 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 257 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 1.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.87 |
| Nodule | 0 |
| Rhizoplane | 9.47 |
| Rhizosphere | 89.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100713753 | 3300005435 | Bacteria | 968 |
| 2 | JGI24743J22301_10125418 | 3300001991 | Unclassified | 565 |
| 3 | JGI24745J21846_1007725 | 3300002073 | Bacteria | 1206 |
| 4 | JGI24738J21930_10003531 | 3300002075 | Bacteria | 3936 |
| 5 | Ga0070658_10001489 | 3300005327 | Bacteria | 19888 |
| 6 | Ga0070658_10019627 | 3300005327 | Bacteria | 5412 |
| 7 | Ga0070658_10127208 | 3300005327 | Bacteria | 2121 |
| 8 | Ga0070658_10197077 | 3300005327 | Bacteria | 1698 |
| 9 | Ga0070658_10441471 | 3300005327 | Bacteria | 1121 |
| 10 | Ga0070658_10647528 | 3300005327 | Bacteria | 917 |
| 11 | Ga0070658_10669280 | 3300005327 | Bacteria | 901 |
| 12 | Ga0070658_11713297 | 3300005327 | Bacteria | 544 |
| 13 | Ga0070676_10583851 | 3300005328 | Bacteria | 804 |
| 14 | Ga0070683_100001951 | 3300005329 | Bacteria | 16161 |
| 15 | Ga0070683_100026980 | 3300005329 | Bacteria | 5177 |
| 16 | Ga0070683_100067441 | 3300005329 | Bacteria | 3333 |
| 17 | Ga0070683_100091832 | 3300005329 | Bacteria | 2851 |
| 18 | Ga0070683_100109441 | 3300005329 | Bacteria | 2606 |
| 19 | Ga0070683_100117935 | 3300005329 | Bacteria | 2506 |
| 20 | Ga0070683_100286854 | 3300005329 | Bacteria | 1566 |
| 21 | Ga0070683_100379703 | 3300005329 | Bacteria | 1346 |
| 22 | Ga0070683_100399589 | 3300005329 | Bacteria | 1310 |
| 23 | Ga0070683_101897182 | 3300005329 | Bacteria | 573 |
| 24 | Ga0070683_102253974 | 3300005329 | Unclassified | 523 |
| 25 | Ga0070690_100997447 | 3300005330 | Bacteria | 660 |
| 26 | Ga0070690_101053683 | 3300005330 | Bacteria | 643 |
| 27 | Ga0070670_100084764 | 3300005331 | Unclassified | 2723 |
| 28 | Ga0070670_100195560 | 3300005331 | Bacteria | 1757 |
| 29 | Ga0070670_102031780 | 3300005331 | Bacteria | 530 |
| 30 | Ga0070680_100001349 | 3300005336 | Bacteria | 17750 |
| 31 | Ga0070680_100052049 | 3300005336 | Bacteria | 3342 |
| 32 | Ga0070680_100073150 | 3300005336 | Bacteria | 2818 |
| 33 | Ga0070680_100108447 | 3300005336 | Bacteria | 2310 |
| 34 | Ga0070680_100130422 | 3300005336 | Bacteria | 2103 |
| 35 | Ga0070680_100151989 | 3300005336 | Bacteria | 1944 |
| 36 | Ga0070680_100166074 | 3300005336 | Bacteria | 1856 |
| 37 | Ga0070680_100778623 | 3300005336 | Bacteria | 824 |
| 38 | Ga0070680_101173267 | 3300005336 | Bacteria | 664 |
| 39 | Ga0070682_100030774 | 3300005337 | Bacteria | 3243 |
| 40 | Ga0070682_100035452 | 3300005337 | Bacteria | 3046 |
| 41 | Ga0070682_100121214 | 3300005337 | Bacteria | 1756 |
| 42 | Ga0070682_100139049 | 3300005337 | Bacteria | 1653 |
| 43 | Ga0070682_100184167 | 3300005337 | Bacteria | 1461 |
| 44 | Ga0070682_100240272 | 3300005337 | Bacteria | 1300 |
| 45 | Ga0070682_101113922 | 3300005337 | Unclassified | 662 |
| 46 | Ga0070682_101888788 | 3300005337 | Bacteria | 523 |
| 47 | Ga0070682_102086709 | 3300005337 | Bacteria | 500 |
| 48 | Ga0068868_100017179 | 3300005338 | Bacteria | 5384 |
| 49 | Ga0068868_100136367 | 3300005338 | Bacteria | 2012 |
| 50 | Ga0068868_100524354 | 3300005338 | Bacteria | 1040 |
| 51 | Ga0068868_100566173 | 3300005338 | Bacteria | 1003 |
| 52 | Ga0068868_100700373 | 3300005338 | Unclassified | 906 |
| 53 | Ga0068868_101240878 | 3300005338 | Unclassified | 690 |
| 54 | Ga0068868_101253812 | 3300005338 | Bacteria | 687 |
| 55 | Ga0070660_100001388 | 3300005339 | Bacteria | 16476 |
| 56 | Ga0070660_100012523 | 3300005339 | Bacteria | 6059 |
| 57 | Ga0070660_100030292 | 3300005339 | Bacteria | 4059 |
| 58 | Ga0070660_100053659 | 3300005339 | Bacteria | 3110 |
| 59 | Ga0070660_100076218 | 3300005339 | Bacteria | 2626 |
| 60 | Ga0070660_100083469 | 3300005339 | Bacteria | 2510 |
| 61 | Ga0070660_100822204 | 3300005339 | Unclassified | 782 |
| 62 | Ga0070660_101074029 | 3300005339 | Unclassified | 681 |
| 63 | Ga0070660_101493852 | 3300005339 | Bacteria | 574 |
| 64 | Ga0070660_101642874 | 3300005339 | Unclassified | 547 |
| 65 | Ga0070689_100283500 | 3300005340 | Bacteria | 1375 |
| 66 | Ga0070689_100420219 | 3300005340 | Bacteria | 1133 |
| 67 | Ga0070689_101943028 | 3300005340 | Bacteria | 538 |
| 68 | Ga0070691_10067355 | 3300005341 | Bacteria | 1732 |
| 69 | Ga0070691_10088321 | 3300005341 | Bacteria | 1526 |
| 70 | Ga0070687_100056835 | 3300005343 | Bacteria | 2049 |
| 71 | Ga0070687_100467840 | 3300005343 | Bacteria | 842 |
| 72 | Ga0070661_100027030 | 3300005344 | Bacteria | 4130 |
| 73 | Ga0070661_100027666 | 3300005344 | Bacteria | 4085 |
| 74 | Ga0070661_100027844 | 3300005344 | Bacteria | 4073 |
| 75 | Ga0070661_100054691 | 3300005344 | Bacteria | 2923 |
| 76 | Ga0070661_100087610 | 3300005344 | Bacteria | 2303 |
| 77 | Ga0070661_100403255 | 3300005344 | Unclassified | 1081 |
| 78 | Ga0070661_100429543 | 3300005344 | Bacteria | 1048 |
| 79 | Ga0070661_100793210 | 3300005344 | Bacteria | 777 |
| 80 | Ga0070661_101349651 | 3300005344 | Bacteria | 599 |
| 81 | Ga0070692_10453539 | 3300005345 | Bacteria | 821 |
| 82 | Ga0070692_10887001 | 3300005345 | Bacteria | 616 |
| 83 | Ga0070668_101694614 | 3300005347 | Unclassified | 580 |
| 84 | Ga0070668_101896977 | 3300005347 | Bacteria | 549 |
| 85 | Ga0070669_100318626 | 3300005353 | Bacteria | 1255 |
| 86 | Ga0070669_100672109 | 3300005353 | Bacteria | 873 |
| 87 | Ga0070675_100008991 | 3300005354 | Bacteria | 7760 |
| 88 | Ga0070675_100356217 | 3300005354 | Bacteria | 1298 |
| 89 | Ga0070675_100935608 | 3300005354 | Bacteria | 795 |
| 90 | Ga0070671_101602822 | 3300005355 | Unclassified | 577 |
| 91 | Ga0070674_100010343 | 3300005356 | Bacteria | 5635 |
| 92 | Ga0070674_100039496 | 3300005356 | Bacteria | 3187 |
| 93 | Ga0070674_100652504 | 3300005356 | Bacteria | 895 |
| 94 | Ga0070673_100009394 | 3300005364 | Bacteria | 6563 |
| 95 | Ga0070673_100209281 | 3300005364 | Bacteria | 1683 |
| 96 | Ga0070673_100806291 | 3300005364 | Bacteria | 867 |
| 97 | Ga0070673_100914804 | 3300005364 | Unclassified | 814 |
| 98 | Ga0070659_100078613 | 3300005366 | Bacteria | 2632 |
| 99 | Ga0070659_100139958 | 3300005366 | Bacteria | 1970 |
| 100 | Ga0070659_100180671 | 3300005366 | Bacteria | 1731 |
| 101 | Ga0070659_100194801 | 3300005366 | Unclassified | 1667 |
| 102 | Ga0070659_100370726 | 3300005366 | Unclassified | 1204 |
| 103 | Ga0070659_101008944 | 3300005366 | Bacteria | 731 |
| 104 | Ga0070659_101424212 | 3300005366 | Bacteria | 616 |
| 105 | Ga0070667_101409968 | 3300005367 | Bacteria | 654 |
| 106 | Ga0070667_101779080 | 3300005367 | Bacteria | 580 |
| 107 | Ga0070709_10676907 | 3300005434 | Bacteria | 801 |
| 108 | Ga0070709_10790951 | 3300005434 | Bacteria | 744 |
| 109 | Ga0070714_100207970 | 3300005435 | Bacteria | 1793 |
| 110 | Ga0070714_100655276 | 3300005435 | Bacteria | 1011 |
| 111 | Ga0070714_101198321 | 3300005435 | Unclassified | 741 |
| 112 | Ga0070714_101848088 | 3300005435 | Bacteria | 590 |
| 113 | Ga0070713_100278409 | 3300005436 | Bacteria | 1534 |
| 114 | Ga0070713_101862235 | 3300005436 | Bacteria | 584 |
| 115 | Ga0070713_102034041 | 3300005436 | Bacteria | 557 |
| 116 | Ga0070710_10053588 | 3300005437 | Bacteria | 2273 |
| 117 | Ga0070710_10775775 | 3300005437 | Bacteria | 683 |
| 118 | Ga0070701_10033887 | 3300005438 | Bacteria | 2555 |
| 119 | Ga0070701_10617660 | 3300005438 | Bacteria | 720 |
| 120 | Ga0070711_100037212 | 3300005439 | Bacteria | 3264 |
| 121 | Ga0070711_100500188 | 3300005439 | Bacteria | 1002 |
| 122 | Ga0070711_100566991 | 3300005439 | Bacteria | 944 |
| 123 | Ga0070711_100669375 | 3300005439 | Bacteria | 872 |
| 124 | Ga0070711_101079668 | 3300005439 | Bacteria | 691 |
| 125 | Ga0070711_101122254 | 3300005439 | Bacteria | 678 |
| 126 | Ga0070705_100177990 | 3300005440 | Bacteria | 1438 |
| 127 | Ga0070705_100373689 | 3300005440 | Bacteria | 1047 |
| 128 | Ga0070700_100073563 | 3300005441 | Bacteria | 2188 |
| 129 | Ga0070700_100148628 | 3300005441 | Bacteria | 1600 |
| 130 | Ga0070694_100167559 | 3300005444 | Bacteria | 1616 |
| 131 | Ga0070694_101032056 | 3300005444 | Bacteria | 684 |
| 132 | Ga0070694_101450804 | 3300005444 | Bacteria | 580 |
| 133 | Ga0070708_102251890 | 3300005445 | Bacteria | 503 |
| 134 | Ga0070663_100048212 | 3300005455 | Bacteria | 3020 |
| 135 | Ga0070663_100205400 | 3300005455 | Bacteria | 1540 |
| 136 | Ga0070663_100418922 | 3300005455 | Bacteria | 1098 |
| 137 | Ga0070663_100832814 | 3300005455 | Bacteria | 793 |
| 138 | Ga0070663_101355696 | 3300005455 | Bacteria | 629 |
| 139 | Ga0070678_100044737 | 3300005456 | Bacteria | 3163 |
| 140 | Ga0070678_100049900 | 3300005456 | Bacteria | 3023 |
| 141 | Ga0070678_100936428 | 3300005456 | Bacteria | 794 |
| 142 | Ga0070662_100014259 | 3300005457 | Bacteria | 5305 |
| 143 | Ga0070662_100479074 | 3300005457 | Bacteria | 1036 |
| 144 | Ga0070662_101570007 | 3300005457 | Bacteria | 568 |
| 145 | Ga0070681_10001836 | 3300005458 | Bacteria | 19155 |
| 146 | Ga0070681_10003067 | 3300005458 | Bacteria | 15494 |
| 147 | Ga0070681_10007348 | 3300005458 | Bacteria | 10765 |
| 148 | Ga0070681_10020001 | 3300005458 | Bacteria | 6707 |
| 149 | Ga0070681_10026240 | 3300005458 | Bacteria | 5856 |
| 150 | Ga0070681_10085484 | 3300005458 | Bacteria | 3106 |
| 151 | Ga0070681_10185838 | 3300005458 | Bacteria | 1999 |
| 152 | Ga0070681_10220322 | 3300005458 | Bacteria | 1812 |
| 153 | Ga0070681_10313158 | 3300005458 | Bacteria | 1479 |
| 154 | Ga0070681_10319676 | 3300005458 | Bacteria | 1462 |
| 155 | Ga0070681_10609120 | 3300005458 | Bacteria | 1007 |
| 156 | Ga0068867_100026233 | 3300005459 | Bacteria | 4184 |
| 157 | Ga0068867_100642815 | 3300005459 | Bacteria | 930 |
| 158 | Ga0070685_10298054 | 3300005466 | Bacteria | 1086 |
| 159 | Ga0070707_101120795 | 3300005468 | Bacteria | 753 |
| 160 | Ga0070707_101372614 | 3300005468 | Bacteria | 673 |
| 161 | Ga0070698_100073227 | 3300005471 | Bacteria | 3433 |
| 162 | Ga0070698_102033327 | 3300005471 | Unclassified | 528 |
| 163 | Ga0070699_101536124 | 3300005518 | Unclassified | 610 |
| 164 | Ga0070679_100003334 | 3300005530 | Bacteria | 14707 |
| 165 | Ga0070679_100008435 | 3300005530 | Bacteria | 9700 |
| 166 | Ga0070679_100036093 | 3300005530 | Bacteria | 4905 |
| 167 | Ga0070679_100087276 | 3300005530 | Bacteria | 3107 |
| 168 | Ga0070679_100148935 | 3300005530 | Bacteria | 2318 |
| 169 | Ga0070679_100172053 | 3300005530 | Bacteria | 2138 |
| 170 | Ga0070679_101676930 | 3300005530 | Unclassified | 583 |
| 171 | Ga0070684_100001285 | 3300005535 | Bacteria | 17978 |
| 172 | Ga0070684_100003716 | 3300005535 | Bacteria | 11515 |
| 173 | Ga0070684_100012113 | 3300005535 | Bacteria | 6898 |
| 174 | Ga0070684_100055370 | 3300005535 | Bacteria | 3457 |
| 175 | Ga0070684_100136721 | 3300005535 | Bacteria | 2214 |
| 176 | Ga0070684_100203668 | 3300005535 | Bacteria | 1803 |
| 177 | Ga0070684_100849264 | 3300005535 | Unclassified | 854 |
| 178 | Ga0070684_100888072 | 3300005535 | Unclassified | 835 |
| 179 | Ga0070684_100980948 | 3300005535 | Unclassified | 793 |
| 180 | Ga0070684_101301488 | 3300005535 | Unclassified | 684 |
| 181 | Ga0070697_100291880 | 3300005536 | Bacteria | 1401 |
| 182 | Ga0068853_100072333 | 3300005539 | Bacteria | 3004 |
| 183 | Ga0068853_100372353 | 3300005539 | Unclassified | 1333 |
| 184 | Ga0068853_100772651 | 3300005539 | Bacteria | 919 |
| 185 | Ga0068853_101567672 | 3300005539 | Unclassified | 638 |
| 186 | Ga0070672_100084528 | 3300005543 | Bacteria | 2548 |
| 187 | Ga0070672_100234309 | 3300005543 | Bacteria | 1543 |
| 188 | Ga0070686_100023828 | 3300005544 | Bacteria | 3664 |
| 189 | Ga0070686_100033726 | 3300005544 | Unclassified | 3148 |
| 190 | Ga0070686_100168446 | 3300005544 | Bacteria | 1547 |
| 191 | Ga0070686_100365870 | 3300005544 | Bacteria | 1088 |
| 192 | Ga0070695_100000704 | 3300005545 | Bacteria | 17855 |
| 193 | Ga0070696_100646864 | 3300005546 | Bacteria | 857 |
| 194 | Ga0070696_101053266 | 3300005546 | Unclassified | 682 |
| 195 | Ga0070693_100059172 | 3300005547 | Bacteria | 2220 |
| 196 | Ga0070693_100089715 | 3300005547 | Bacteria | 1851 |
| 197 | Ga0070693_100183628 | 3300005547 | Bacteria | 1348 |
| 198 | Ga0070693_100778557 | 3300005547 | Bacteria | 707 |
| 199 | Ga0070665_100002268 | 3300005548 | Bacteria | 21382 |
| 200 | Ga0070665_100432616 | 3300005548 | Bacteria | 1325 |
| 201 | Ga0070665_100977210 | 3300005548 | Bacteria | 859 |
| 202 | Ga0070704_100007494 | 3300005549 | Bacteria | 6496 |
| 203 | Ga0070704_100010813 | 3300005549 | Bacteria | 5566 |
| 204 | Ga0070704_101204834 | 3300005549 | Bacteria | 691 |
| 205 | Ga0068855_100013934 | 3300005563 | Bacteria | 9697 |
| 206 | Ga0068855_100018268 | 3300005563 | Bacteria | 8421 |
| 207 | Ga0068855_100075876 | 3300005563 | Bacteria | 3902 |
| 208 | Ga0068855_100091803 | 3300005563 | Bacteria | 3502 |
| 209 | Ga0068855_100111808 | 3300005563 | Bacteria | 3135 |
| 210 | Ga0068855_100119852 | 3300005563 | Unclassified | 3012 |
| 211 | Ga0068855_100123245 | 3300005563 | Bacteria | 2965 |
| 212 | Ga0068855_100179626 | 3300005563 | Bacteria | 2393 |
| 213 | Ga0068855_100696216 | 3300005563 | Unclassified | 1088 |
| 214 | Ga0070664_100121143 | 3300005564 | Bacteria | 2291 |
| 215 | Ga0070664_100210013 | 3300005564 | Bacteria | 1739 |
| 216 | Ga0070664_100323006 | 3300005564 | Bacteria | 1399 |
| 217 | Ga0070664_100808555 | 3300005564 | Bacteria | 877 |
| 218 | Ga0070664_101190038 | 3300005564 | Unclassified | 719 |
| 219 | Ga0070664_101310462 | 3300005564 | Bacteria | 684 |
| 220 | Ga0070664_101768640 | 3300005564 | Bacteria | 586 |
| 221 | Ga0070664_102133348 | 3300005564 | Unclassified | 532 |
| 222 | Ga0068857_100034147 | 3300005577 | Bacteria | 4500 |
| 223 | Ga0068857_100037240 | 3300005577 | Bacteria | 4309 |
| 224 | Ga0068857_100969223 | 3300005577 | Bacteria | 818 |
| 225 | Ga0068854_100010501 | 3300005578 | Bacteria | 6007 |
| 226 | Ga0068854_100135919 | 3300005578 | Bacteria | 1882 |
| 227 | Ga0068854_100299191 | 3300005578 | Bacteria | 1301 |
| 228 | Ga0068854_102141667 | 3300005578 | Bacteria | 517 |
| 229 | Ga0068856_100035794 | 3300005614 | Bacteria | 4866 |
| 230 | Ga0068856_100091200 | 3300005614 | Bacteria | 3032 |
| 231 | Ga0068856_100133227 | 3300005614 | Bacteria | 2490 |
| 232 | Ga0068856_100239559 | 3300005614 | Bacteria | 1829 |
| 233 | Ga0068856_100973636 | 3300005614 | Bacteria | 867 |
| 234 | Ga0068856_101261772 | 3300005614 | Unclassified | 755 |
| 235 | Ga0070702_100037149 | 3300005615 | Bacteria | 2704 |
| 236 | Ga0070702_100134222 | 3300005615 | Bacteria | 1568 |
| 237 | Ga0070702_100184579 | 3300005615 | Bacteria | 1368 |
| 238 | Ga0070702_100359930 | 3300005615 | Bacteria | 1028 |
| 239 | Ga0068852_100017585 | 3300005616 | Bacteria | 5614 |
| 240 | Ga0068852_100212856 | 3300005616 | Bacteria | 1834 |
| 241 | Ga0068852_100301321 | 3300005616 | Bacteria | 1551 |
| 242 | Ga0068852_101105159 | 3300005616 | Bacteria | 813 |
| 243 | Ga0068852_102004325 | 3300005616 | Bacteria | 601 |
| 244 | Ga0068859_100721324 | 3300005617 | Bacteria | 1087 |
| 245 | Ga0068859_100852052 | 3300005617 | Bacteria | 997 |
| 246 | Ga0068864_100012833 | 3300005618 | Bacteria | 6930 |
| 247 | Ga0068864_100252525 | 3300005618 | Bacteria | 1638 |
| 248 | Ga0068864_101291445 | 3300005618 | Unclassified | 730 |
| 249 | Ga0068866_10058207 | 3300005718 | Bacteria | 1995 |
| 250 | Ga0068866_10206027 | 3300005718 | Bacteria | 1178 |
| 251 | Ga0068866_10511188 | 3300005718 | Bacteria | 797 |
| 252 | Ga0068861_100163019 | 3300005719 | Unclassified | 1841 |
| 253 | Ga0068861_100225011 | 3300005719 | Bacteria | 1588 |
| 254 | Ga0068861_100515795 | 3300005719 | Bacteria | 1083 |
| 255 | Ga0068851_10003331 | 3300005834 | Bacteria | 7145 |
| 256 | Ga0068851_10227511 | 3300005834 | Bacteria | 1050 |
| 257 | Ga0068851_10399732 | 3300005834 | Bacteria | 808 |
| 258 | Ga0068870_10201678 | 3300005840 | Bacteria | 1206 |
| 259 | Ga0068870_10888730 | 3300005840 | Bacteria | 629 |
| 260 | Ga0068863_100094200 | 3300005841 | Bacteria | 2842 |
| 261 | Ga0068863_100896172 | 3300005841 | Bacteria | 887 |
| 262 | Ga0068863_102018108 | 3300005841 | Bacteria | 587 |
| 263 | Ga0068863_102363595 | 3300005841 | Bacteria | 541 |
| 264 | Ga0068858_100039528 | 3300005842 | Bacteria | 4374 |
| 265 | Ga0068858_100374615 | 3300005842 | Bacteria | 1366 |
| 266 | Ga0068858_102499786 | 3300005842 | Unclassified | 510 |
| 267 | Ga0068860_100093375 | 3300005843 | Bacteria | 2868 |
| 268 | Ga0068860_100374519 | 3300005843 | Bacteria | 1405 |
| 269 | Ga0068860_102102819 | 3300005843 | Bacteria | 586 |
| 270 | Ga0081455_10108403 | 3300005937 | Bacteria | 2212 |
| 271 | Ga0081455_10210622 | 3300005937 | Bacteria | 1448 |
| 272 | Ga0070717_10021284 | 3300006028 | Bacteria | 5109 |
| 273 | Ga0070717_10371719 | 3300006028 | Bacteria | 1281 |
| 274 | Ga0070717_10956549 | 3300006028 | Unclassified | 780 |
| 275 | Ga0070717_11404974 | 3300006028 | Unclassified | 634 |
| 276 | Ga0075365_10457332 | 3300006038 | Unclassified | 901 |
| 277 | Ga0075365_10479336 | 3300006038 | Bacteria | 879 |
| 278 | Ga0075368_10157674 | 3300006042 | Bacteria | 950 |
| 279 | Ga0075363_100998499 | 3300006048 | Bacteria | 516 |
| 280 | Ga0075364_10006439 | 3300006051 | Bacteria | 6896 |
| 281 | Ga0070716_100622316 | 3300006173 | Unclassified | 815 |
| 282 | Ga0070712_100197569 | 3300006175 | Bacteria | 1578 |
| 283 | Ga0070712_100400895 | 3300006175 | Bacteria | 1133 |
| 284 | Ga0070712_100441873 | 3300006175 | Unclassified | 1082 |
| 285 | Ga0070712_100572444 | 3300006175 | Unclassified | 954 |
| 286 | Ga0070712_101176514 | 3300006175 | Bacteria | 667 |
| 287 | Ga0070712_101975839 | 3300006175 | Bacteria | 511 |
| 288 | Ga0075367_10276034 | 3300006178 | Bacteria | 1056 |
| 289 | Ga0097621_100003405 | 3300006237 | Bacteria | 10951 |
| 290 | Ga0097621_100288211 | 3300006237 | Bacteria | 1447 |
| 291 | Ga0097621_101503434 | 3300006237 | Bacteria | 639 |
| 292 | Ga0068871_100146938 | 3300006358 | Bacteria | 2008 |
| 293 | Ga0068871_100300519 | 3300006358 | Bacteria | 1409 |
| 294 | Ga0068871_100338658 | 3300006358 | Bacteria | 1328 |
| 295 | Ga0068871_100404101 | 3300006358 | Bacteria | 1217 |
| 296 | Ga0068871_101045239 | 3300006358 | Bacteria | 762 |
| 297 | Ga0075428_100282768 | 3300006844 | Bacteria | 1785 |
| 298 | Ga0075433_10085646 | 3300006852 | Archaea | 2782 |
| 299 | Ga0075434_100000858 | 3300006871 | Bacteria | 24266 |
| 300 | Ga0075434_102497901 | 3300006871 | Bacteria | 518 |
| 301 | Ga0075429_101503651 | 3300006880 | Unclassified | 586 |
| 302 | Ga0068865_100024299 | 3300006881 | Bacteria | 3974 |
| 303 | Ga0075436_100076949 | 3300006914 | Bacteria | 2311 |
| 304 | Ga0097620_100721421 | 3300006931 | Bacteria | 1087 |
| 305 | Ga0097620_100852008 | 3300006931 | Bacteria | 997 |
| 306 | Ga0075435_100078066 | 3300007076 | Archaea | 2715 |
| 307 | Ga0075435_102044052 | 3300007076 | Unclassified | 503 |
| 308 | Ga0099794_10619220 | 3300007265 | Bacteria | 574 |
| 309 | Ga0099795_10534158 | 3300007788 | Bacteria | 551 |
| 310 | Ga0105244_10342168 | 3300009036 | Bacteria | 690 |
| 311 | Ga0105240_10025875 | 3300009093 | Bacteria | 7705 |
| 312 | Ga0105240_10077444 | 3300009093 | Bacteria | 4097 |
| 313 | Ga0105240_10082877 | 3300009093 | Bacteria | 3938 |
| 314 | Ga0105240_11501429 | 3300009093 | Unclassified | 707 |
| 315 | Ga0111539_10032383 | 3300009094 | Bacteria | 6348 |
| 316 | Ga0111539_11518875 | 3300009094 | Bacteria | 777 |
| 317 | Ga0111539_12199241 | 3300009094 | Unclassified | 640 |
| 318 | Ga0105245_10022254 | 3300009098 | Bacteria | 5563 |
| 319 | Ga0105245_10086715 | 3300009098 | Bacteria | 2872 |
| 320 | Ga0105245_10104115 | 3300009098 | Bacteria | 2631 |
| 321 | Ga0105245_10161689 | 3300009098 | Bacteria | 2125 |
| 322 | Ga0105245_10170076 | 3300009098 | Bacteria | 2075 |
| 323 | Ga0105245_10538364 | 3300009098 | Bacteria | 1188 |
| 324 | Ga0105245_10839507 | 3300009098 | Bacteria | 958 |
| 325 | Ga0105245_12067074 | 3300009098 | Unclassified | 623 |
| 326 | Ga0105245_12577262 | 3300009098 | Bacteria | 562 |
| 327 | Ga0105245_12759479 | 3300009098 | Unclassified | 544 |
| 328 | Ga0105247_10018731 | 3300009101 | Bacteria | 4156 |
| 329 | Ga0114129_10297614 | 3300009147 | Bacteria | 2152 |
| 330 | Ga0114129_11047897 | 3300009147 | Bacteria | 1024 |
| 331 | Ga0105243_10018646 | 3300009148 | Bacteria | 5258 |
| 332 | Ga0105243_10046862 | 3300009148 | Bacteria | 3402 |
| 333 | Ga0105243_10068010 | 3300009148 | Bacteria | 2870 |
| 334 | Ga0105241_10096929 | 3300009174 | Bacteria | 2337 |
| 335 | Ga0105241_10216082 | 3300009174 | Bacteria | 1609 |
| 336 | Ga0105241_10216352 | 3300009174 | Bacteria | 1608 |
| 337 | Ga0105241_10616811 | 3300009174 | Bacteria | 981 |
| 338 | Ga0105241_10933678 | 3300009174 | Bacteria | 808 |
| 339 | Ga0105241_11585590 | 3300009174 | Unclassified | 633 |
| 340 | Ga0105241_11732521 | 3300009174 | Unclassified | 608 |
| 341 | Ga0105242_10099052 | 3300009176 | Bacteria | 2467 |
| 342 | Ga0105242_10231362 | 3300009176 | Bacteria | 1657 |
| 343 | Ga0105242_10939284 | 3300009176 | Unclassified | 868 |
| 344 | Ga0105242_11995126 | 3300009176 | Bacteria | 622 |
| 345 | Ga0105242_12321364 | 3300009176 | Bacteria | 583 |
| 346 | Ga0105248_10060473 | 3300009177 | Bacteria | 4253 |
| 347 | Ga0105248_10106228 | 3300009177 | Bacteria | 3165 |
| 348 | Ga0105248_10241259 | 3300009177 | Bacteria | 2035 |
| 349 | Ga0105248_11754929 | 3300009177 | Bacteria | 704 |
| 350 | Ga0105237_10022122 | 3300009545 | Bacteria | 6524 |
| 351 | Ga0105237_10053435 | 3300009545 | Bacteria | 4052 |
| 352 | Ga0105237_10114217 | 3300009545 | Bacteria | 2693 |
| 353 | Ga0105237_10236130 | 3300009545 | Bacteria | 1829 |
| 354 | Ga0105237_11418514 | 3300009545 | Unclassified | 701 |
| 355 | Ga0105237_11876693 | 3300009545 | Bacteria | 607 |
| 356 | Ga0105238_10025380 | 3300009551 | Bacteria | 6042 |
| 357 | Ga0105238_10027162 | 3300009551 | Bacteria | 5833 |
| 358 | Ga0105238_10293335 | 3300009551 | Bacteria | 1609 |
| 359 | Ga0105238_10492830 | 3300009551 | Bacteria | 1225 |
| 360 | Ga0105238_10606715 | 3300009551 | Archaea | 1103 |
| 361 | Ga0105238_11095061 | 3300009551 | Bacteria | 819 |
| 362 | Ga0105249_10222516 | 3300009553 | Bacteria | 1858 |
| 363 | Ga0105249_11598783 | 3300009553 | Bacteria | 724 |
| 364 | Ga0105249_12187254 | 3300009553 | Unclassified | 626 |
| 365 | Ga0105239_10192707 | 3300010375 | Bacteria | 2282 |
| 366 | Ga0105239_10286560 | 3300010375 | Bacteria | 1855 |
| 367 | Ga0105239_10519527 | 3300010375 | Bacteria | 1354 |
| 368 | Ga0105239_10631160 | 3300010375 | Bacteria | 1223 |
| 369 | Ga0105239_11161824 | 3300010375 | Unclassified | 889 |
| 370 | Ga0105239_11345562 | 3300010375 | Unclassified | 824 |
| 371 | Ga0105239_11903698 | 3300010375 | Unclassified | 690 |
| 372 | Ga0105246_10031643 | 3300011119 | Bacteria | 3502 |
| 373 | Ga0105246_10064630 | 3300011119 | Bacteria | 2557 |
| 374 | Ga0105246_10120523 | 3300011119 | Bacteria | 1943 |
| 375 | Ga0105246_11283571 | 3300011119 | Unclassified | 678 |
| 376 | Ga0157343_1008960 | 3300012488 | Bacteria | 730 |
| 377 | Ga0157342_1012416 | 3300012507 | Unclassified | 897 |
| 378 | Ga0157373_10491732 | 3300013100 | Unclassified | 886 |
| 379 | Ga0157373_10733575 | 3300013100 | Bacteria | 725 |
| 380 | Ga0157373_10892259 | 3300013100 | Bacteria | 659 |
| 381 | Ga0157373_10951158 | 3300013100 | Bacteria | 639 |
| 382 | Ga0157371_10031042 | 3300013102 | Bacteria | 3850 |
| 383 | Ga0157371_10212411 | 3300013102 | Bacteria | 1389 |
| 384 | Ga0157370_10003344 | 3300013104 | Bacteria | 18884 |
| 385 | Ga0157370_10041948 | 3300013104 | Bacteria | 4411 |
| 386 | Ga0157370_10047452 | 3300013104 | Bacteria | 4117 |
| 387 | Ga0157370_10136651 | 3300013104 | Bacteria | 2284 |
| 388 | Ga0157370_10149561 | 3300013104 | Bacteria | 2173 |
| 389 | Ga0157370_10154924 | 3300013104 | Bacteria | 2132 |
| 390 | Ga0157370_10159696 | 3300013104 | Bacteria | 2098 |
| 391 | Ga0157370_10185130 | 3300013104 | Bacteria | 1934 |
| 392 | Ga0157370_10385011 | 3300013104 | Unclassified | 1292 |
| 393 | Ga0157370_10570071 | 3300013104 | Archaea | 1037 |
| 394 | Ga0157370_10968985 | 3300013104 | Bacteria | 771 |
| 395 | Ga0157370_11383849 | 3300013104 | Bacteria | 633 |
| 396 | Ga0157369_10003269 | 3300013105 | Bacteria | 19304 |
| 397 | Ga0157369_10009824 | 3300013105 | Bacteria | 10940 |
| 398 | Ga0157369_10025790 | 3300013105 | Bacteria | 6520 |
| 399 | Ga0157369_10074644 | 3300013105 | Bacteria | 3636 |
| 400 | Ga0157369_10135120 | 3300013105 | Bacteria | 2612 |
| 401 | Ga0157369_10248596 | 3300013105 | Bacteria | 1857 |
| 402 | Ga0157369_10268160 | 3300013105 | Bacteria | 1780 |
| 403 | Ga0157369_10422993 | 3300013105 | Bacteria | 1381 |
| 404 | Ga0157369_11259023 | 3300013105 | Unclassified | 754 |
| 405 | Ga0157374_10134926 | 3300013296 | Bacteria | 2392 |
| 406 | Ga0157374_10230166 | 3300013296 | Bacteria | 1820 |
| 407 | Ga0157374_10230883 | 3300013296 | Bacteria | 1817 |
| 408 | Ga0157374_10261022 | 3300013296 | Unclassified | 1706 |
| 409 | Ga0157374_10979835 | 3300013296 | Unclassified | 864 |
| 410 | Ga0157374_11020864 | 3300013296 | Bacteria | 846 |
| 411 | Ga0157374_12795005 | 3300013296 | Bacteria | 516 |
| 412 | Ga0157378_10072971 | 3300013297 | Bacteria | 3085 |
| 413 | Ga0157378_10075365 | 3300013297 | Bacteria | 3037 |
| 414 | Ga0163162_10038094 | 3300013306 | Bacteria | 4799 |
| 415 | Ga0163162_10135874 | 3300013306 | Bacteria | 2569 |
| 416 | Ga0163162_10334913 | 3300013306 | Bacteria | 1646 |
| 417 | Ga0157372_10006441 | 3300013307 | Bacteria | 12499 |
| 418 | Ga0157372_10090002 | 3300013307 | Bacteria | 3488 |
| 419 | Ga0157372_10134617 | 3300013307 | Bacteria | 2845 |
| 420 | Ga0157372_10148683 | 3300013307 | Unclassified | 2702 |
| 421 | Ga0157372_10243584 | 3300013307 | Bacteria | 2086 |
| 422 | Ga0157372_10289399 | 3300013307 | Bacteria | 1905 |
| 423 | Ga0157372_10890913 | 3300013307 | Bacteria | 1032 |
| 424 | Ga0157372_11109030 | 3300013307 | Bacteria | 915 |
| 425 | Ga0157372_11414648 | 3300013307 | Bacteria | 802 |
| 426 | Ga0157372_11818472 | 3300013307 | Unclassified | 700 |
| 427 | Ga0157372_12169421 | 3300013307 | Bacteria | 638 |
| 428 | Ga0157375_10011990 | 3300013308 | Bacteria | 7674 |
| 429 | Ga0157375_10076545 | 3300013308 | Bacteria | 3373 |
| 430 | Ga0157375_10174744 | 3300013308 | Unclassified | 2297 |
| 431 | Ga0157375_10220065 | 3300013308 | Bacteria | 2057 |
| 432 | Ga0157375_10447720 | 3300013308 | Bacteria | 1457 |
| 433 | Ga0157375_10807577 | 3300013308 | Bacteria | 1086 |
| 434 | Ga0157375_12004282 | 3300013308 | Bacteria | 688 |
| 435 | Ga0163163_10081430 | 3300014325 | Bacteria | 3239 |
| 436 | Ga0163163_10538273 | 3300014325 | Unclassified | 1230 |
| 437 | Ga0163163_11157620 | 3300014325 | Unclassified | 836 |
| 438 | Ga0163163_11501309 | 3300014325 | Bacteria | 735 |
| 439 | Ga0157380_10493321 | 3300014326 | Bacteria | 1188 |
| 440 | Ga0157380_10546455 | 3300014326 | Bacteria | 1135 |
| 441 | Ga0157380_11083316 | 3300014326 | Bacteria | 839 |
| 442 | Ga0182008_10151490 | 3300014497 | Unclassified | 1163 |
| 443 | Ga0157377_10007279 | 3300014745 | Bacteria | 5333 |
| 444 | Ga0157377_10014704 | 3300014745 | Bacteria | 3987 |
| 445 | Ga0157377_10041704 | 3300014745 | Bacteria | 2547 |
| 446 | Ga0157377_10071178 | 3300014745 | Bacteria | 2010 |
| 447 | Ga0157377_11723892 | 3300014745 | Unclassified | 506 |
| 448 | Ga0157379_10014186 | 3300014968 | Bacteria | 6988 |
| 449 | Ga0157379_10029853 | 3300014968 | Bacteria | 4849 |
| 450 | Ga0157379_10093625 | 3300014968 | Bacteria | 2696 |
| 451 | Ga0157379_12039788 | 3300014968 | Unclassified | 567 |
| 452 | Ga0157376_10032351 | 3300014969 | Bacteria | 4199 |
| 453 | Ga0157376_10061347 | 3300014969 | Bacteria | 3161 |
| 454 | Ga0157376_10380351 | 3300014969 | Bacteria | 1360 |
| 455 | Ga0163161_11498281 | 3300017792 | Bacteria | 592 |
| 456 | Ga0163161_11738404 | 3300017792 | Bacteria | 553 |
| 457 | Ga0197907_10011517 | 3300020069 | Bacteria | 1286 |
| 458 | Ga0206356_10101777 | 3300020070 | Bacteria | 1161 |
| 459 | Ga0206356_10470480 | 3300020070 | Unclassified | 681 |
| 460 | Ga0206356_11062105 | 3300020070 | Bacteria | 1732 |
| 461 | Ga0206356_11310210 | 3300020070 | Bacteria | 2579 |
| 462 | Ga0206356_11599680 | 3300020070 | Unclassified | 616 |
| 463 | Ga0206356_11629557 | 3300020070 | Bacteria | 2566 |
| 464 | Ga0206350_10411591 | 3300020080 | Unclassified | 545 |
| 465 | Ga0206354_10239396 | 3300020081 | Bacteria | 510 |
| 466 | Ga0206354_11049549 | 3300020081 | Bacteria | 1782 |
| 467 | Ga0206353_10090456 | 3300020082 | Bacteria | 13485 |
| 468 | Ga0206353_10279259 | 3300020082 | Bacteria | 1247 |
| 469 | Ga0206353_11337973 | 3300020082 | Unclassified | 571 |
| 470 | Ga0206353_11492649 | 3300020082 | Bacteria | 1389 |
| 471 | Ga0154015_1007367 | 3300020610 | Bacteria | 507 |
| 472 | Ga0213871_10217557 | 3300021441 | Bacteria | 600 |
| 473 | Ga0224712_10199035 | 3300022467 | Unclassified | 910 |
| 474 | Ga0224712_10321509 | 3300022467 | Unclassified | 727 |
| 475 | Ga0224712_10689919 | 3300022467 | Bacteria | 502 |
| 476 | Ga0207656_10071401 | 3300025321 | Bacteria | 1543 |
| 477 | Ga0207692_10115617 | 3300025898 | Bacteria | 1495 |
| 478 | Ga0207692_10164534 | 3300025898 | Bacteria | 1281 |
| 479 | Ga0207642_10702950 | 3300025899 | Bacteria | 637 |
| 480 | Ga0207710_10055769 | 3300025900 | Bacteria | 1782 |
| 481 | Ga0207688_10011714 | 3300025901 | Bacteria | 4770 |
| 482 | Ga0207688_10100342 | 3300025901 | Bacteria | 1671 |
| 483 | Ga0207688_10241397 | 3300025901 | Bacteria | 1092 |
| 484 | Ga0207680_11085041 | 3300025903 | Unclassified | 572 |
| 485 | Ga0207680_11163204 | 3300025903 | Bacteria | 551 |
| 486 | Ga0207647_10203758 | 3300025904 | Bacteria | 1144 |
| 487 | Ga0207647_10312375 | 3300025904 | Bacteria | 894 |
| 488 | Ga0207699_10513764 | 3300025906 | Bacteria | 866 |
| 489 | Ga0207699_10695624 | 3300025906 | Bacteria | 744 |
| 490 | Ga0207699_10984073 | 3300025906 | Bacteria | 623 |
| 491 | Ga0207645_10532858 | 3300025907 | Bacteria | 796 |
| 492 | Ga0207643_10127529 | 3300025908 | Bacteria | 1511 |
| 493 | Ga0207643_10185571 | 3300025908 | Bacteria | 1260 |
| 494 | Ga0207643_10200993 | 3300025908 | Bacteria | 1213 |
| 495 | Ga0207643_10279270 | 3300025908 | Bacteria | 1035 |
| 496 | Ga0207705_10046240 | 3300025909 | Bacteria | 3127 |
| 497 | Ga0207705_10262350 | 3300025909 | Unclassified | 1319 |
| 498 | Ga0207705_10305935 | 3300025909 | Bacteria | 1220 |
| 499 | Ga0207705_11159425 | 3300025909 | Bacteria | 594 |
| 500 | Ga0207705_11320053 | 3300025909 | Unclassified | 550 |
| 501 | Ga0207654_10517575 | 3300025911 | Bacteria | 844 |
| 502 | Ga0207707_10104598 | 3300025912 | Bacteria | 2474 |
| 503 | Ga0207707_10149184 | 3300025912 | Bacteria | 2044 |
| 504 | Ga0207707_10261519 | 3300025912 | Bacteria | 1502 |
| 505 | Ga0207707_10587050 | 3300025912 | Bacteria | 944 |
| 506 | Ga0207707_10880056 | 3300025912 | Bacteria | 742 |
| 507 | Ga0207707_10888772 | 3300025912 | Bacteria | 737 |
| 508 | Ga0207695_10460852 | 3300025913 | Bacteria | 1154 |
| 509 | Ga0207693_10151632 | 3300025915 | Unclassified | 1823 |
| 510 | Ga0207693_10348453 | 3300025915 | Bacteria | 1159 |
| 511 | Ga0207693_10560213 | 3300025915 | Bacteria | 891 |
| 512 | Ga0207663_10158137 | 3300025916 | Bacteria | 1596 |
| 513 | Ga0207663_10158390 | 3300025916 | Bacteria | 1595 |
| 514 | Ga0207663_10757598 | 3300025916 | Bacteria | 771 |
| 515 | Ga0207663_11572826 | 3300025916 | Bacteria | 529 |
| 516 | Ga0207663_11655469 | 3300025916 | Bacteria | 515 |
| 517 | Ga0207660_10077538 | 3300025917 | Bacteria | 2433 |
| 518 | Ga0207660_10143500 | 3300025917 | Bacteria | 1827 |
| 519 | Ga0207660_10641677 | 3300025917 | Bacteria | 865 |
| 520 | Ga0207660_10968829 | 3300025917 | Bacteria | 694 |
| 521 | Ga0207660_11234518 | 3300025917 | Unclassified | 608 |
| 522 | Ga0207662_10737774 | 3300025918 | Bacteria | 692 |
| 523 | Ga0207657_10005809 | 3300025919 | Bacteria | 12855 |
| 524 | Ga0207657_10010219 | 3300025919 | Bacteria | 9374 |
| 525 | Ga0207657_10065204 | 3300025919 | Bacteria | 3106 |
| 526 | Ga0207657_10824555 | 3300025919 | Unclassified | 716 |
| 527 | Ga0207649_10289076 | 3300025920 | Bacteria | 1195 |
| 528 | Ga0207649_10342385 | 3300025920 | Bacteria | 1104 |
| 529 | Ga0207649_10408294 | 3300025920 | Bacteria | 1018 |
| 530 | Ga0207649_10809668 | 3300025920 | Bacteria | 731 |
| 531 | Ga0207652_10181871 | 3300025921 | Bacteria | 1889 |
| 532 | Ga0207652_10207618 | 3300025921 | Bacteria | 1763 |
| 533 | Ga0207652_10359785 | 3300025921 | Bacteria | 1314 |
| 534 | Ga0207646_10190892 | 3300025922 | Unclassified | 1850 |
| 535 | Ga0207681_10291744 | 3300025923 | Bacteria | 1288 |
| 536 | Ga0207650_10105254 | 3300025925 | Bacteria | 2178 |
| 537 | Ga0207650_11429538 | 3300025925 | Bacteria | 588 |
| 538 | Ga0207659_10165427 | 3300025926 | Bacteria | 1741 |
| 539 | Ga0207659_10214068 | 3300025926 | Bacteria | 1546 |
| 540 | Ga0207659_10255021 | 3300025926 | Bacteria | 1425 |
| 541 | Ga0207659_10475684 | 3300025926 | Bacteria | 1055 |
| 542 | Ga0207687_10051696 | 3300025927 | Bacteria | 2865 |
| 543 | Ga0207687_10053507 | 3300025927 | Bacteria | 2820 |
| 544 | Ga0207687_10289098 | 3300025927 | Bacteria | 1317 |
| 545 | Ga0207687_10316442 | 3300025927 | Bacteria | 1262 |
| 546 | Ga0207687_10711790 | 3300025927 | Bacteria | 853 |
| 547 | Ga0207687_10922742 | 3300025927 | Bacteria | 747 |
| 548 | Ga0207687_10924638 | 3300025927 | Bacteria | 747 |
| 549 | Ga0207687_11120074 | 3300025927 | Bacteria | 676 |
| 550 | Ga0207700_10500690 | 3300025928 | Bacteria | 1075 |
| 551 | Ga0207690_10051809 | 3300025932 | Bacteria | 2746 |
| 552 | Ga0207690_10504182 | 3300025932 | Bacteria | 979 |
| 553 | Ga0207690_10544134 | 3300025932 | Bacteria | 943 |
| 554 | Ga0207690_10802974 | 3300025932 | Bacteria | 778 |
| 555 | Ga0207706_10022659 | 3300025933 | Bacteria | 5637 |
| 556 | Ga0207706_10866694 | 3300025933 | Bacteria | 764 |
| 557 | Ga0207686_10036774 | 3300025934 | Bacteria | 2950 |
| 558 | Ga0207686_10610552 | 3300025934 | Bacteria | 859 |
| 559 | Ga0207686_11121985 | 3300025934 | Bacteria | 642 |
| 560 | Ga0207709_10022698 | 3300025935 | Bacteria | 3563 |
| 561 | Ga0207709_10246864 | 3300025935 | Bacteria | 1302 |
| 562 | Ga0207709_10671966 | 3300025935 | Bacteria | 826 |
| 563 | Ga0207670_10093305 | 3300025936 | Bacteria | 2133 |
| 564 | Ga0207669_10246588 | 3300025937 | Bacteria | 1327 |
| 565 | Ga0207669_10379337 | 3300025937 | Bacteria | 1101 |
| 566 | Ga0207669_11046582 | 3300025937 | Bacteria | 687 |
| 567 | Ga0207704_10049545 | 3300025938 | Bacteria | 2528 |
| 568 | Ga0207704_11878744 | 3300025938 | Bacteria | 515 |
| 569 | Ga0207704_11987916 | 3300025938 | Unclassified | 500 |
| 570 | Ga0207691_10013765 | 3300025940 | Bacteria | 7729 |
| 571 | Ga0207691_10087697 | 3300025940 | Bacteria | 2792 |
| 572 | Ga0207711_10173210 | 3300025941 | Bacteria | 1959 |
| 573 | Ga0207711_10229545 | 3300025941 | Unclassified | 1700 |
| 574 | Ga0207711_10678382 | 3300025941 | Bacteria | 961 |
| 575 | Ga0207711_10768907 | 3300025941 | Bacteria | 897 |
| 576 | Ga0207689_10062142 | 3300025942 | Bacteria | 3071 |
| 577 | Ga0207689_10841234 | 3300025942 | Bacteria | 774 |
| 578 | Ga0207661_10001706 | 3300025944 | Bacteria | 15000 |
| 579 | Ga0207661_10183146 | 3300025944 | Bacteria | 1831 |
| 580 | Ga0207661_10319730 | 3300025944 | Bacteria | 1395 |
| 581 | Ga0207661_10401314 | 3300025944 | Bacteria | 1243 |
| 582 | Ga0207661_10611820 | 3300025944 | Bacteria | 1000 |
| 583 | Ga0207661_10709803 | 3300025944 | Unclassified | 925 |
| 584 | Ga0207661_10748454 | 3300025944 | Bacteria | 899 |
| 585 | Ga0207661_10825291 | 3300025944 | Bacteria | 853 |
| 586 | Ga0207661_11473893 | 3300025944 | Unclassified | 624 |
| 587 | Ga0207661_11874955 | 3300025944 | Unclassified | 545 |
| 588 | Ga0207679_10022416 | 3300025945 | Bacteria | 4300 |
| 589 | Ga0207679_10072923 | 3300025945 | Bacteria | 2595 |
| 590 | Ga0207679_10255360 | 3300025945 | Bacteria | 1492 |
| 591 | Ga0207679_11121883 | 3300025945 | Bacteria | 722 |
| 592 | Ga0207679_12070592 | 3300025945 | Unclassified | 517 |
| 593 | Ga0207667_10008607 | 3300025949 | Bacteria | 12105 |
| 594 | Ga0207667_10045199 | 3300025949 | Bacteria | 4665 |
| 595 | Ga0207667_10436571 | 3300025949 | Bacteria | 1331 |
| 596 | Ga0207667_10616267 | 3300025949 | Bacteria | 1093 |
| 597 | Ga0207651_10327733 | 3300025960 | Bacteria | 1282 |
| 598 | Ga0207651_10436272 | 3300025960 | Bacteria | 1121 |
| 599 | Ga0207712_10286066 | 3300025961 | Bacteria | 1347 |
| 600 | Ga0207712_10333645 | 3300025961 | Bacteria | 1255 |
| 601 | Ga0207712_11853539 | 3300025961 | Bacteria | 540 |
| 602 | Ga0207668_10101202 | 3300025972 | Bacteria | 2141 |
| 603 | Ga0207668_11408678 | 3300025972 | Unclassified | 628 |
| 604 | Ga0207640_10263204 | 3300025981 | Bacteria | 1345 |
| 605 | Ga0207640_10876844 | 3300025981 | Unclassified | 782 |
| 606 | Ga0207658_10267830 | 3300025986 | Bacteria | 1459 |
| 607 | Ga0207658_10391947 | 3300025986 | Bacteria | 1219 |
| 608 | Ga0207677_10395581 | 3300026023 | Bacteria | 1170 |
| 609 | Ga0207677_10418511 | 3300026023 | Bacteria | 1141 |
| 610 | Ga0207677_10556047 | 3300026023 | Bacteria | 1001 |
| 611 | Ga0207677_10762967 | 3300026023 | Bacteria | 863 |
| 612 | Ga0207677_10977514 | 3300026023 | Unclassified | 767 |
| 613 | Ga0207703_10066138 | 3300026035 | Bacteria | 2973 |
| 614 | Ga0207639_10140785 | 3300026041 | Bacteria | 2009 |
| 615 | Ga0207639_11045686 | 3300026041 | Bacteria | 765 |
| 616 | Ga0207678_10209584 | 3300026067 | Bacteria | 1667 |
| 617 | Ga0207678_10227929 | 3300026067 | Bacteria | 1595 |
| 618 | Ga0207678_10352289 | 3300026067 | Bacteria | 1270 |
| 619 | Ga0207678_10598248 | 3300026067 | Bacteria | 967 |
| 620 | Ga0207708_10052947 | 3300026075 | Bacteria | 3091 |
| 621 | Ga0207708_11628675 | 3300026075 | Bacteria | 567 |
| 622 | Ga0207702_10104946 | 3300026078 | Bacteria | 2502 |
| 623 | Ga0207702_10168867 | 3300026078 | Bacteria | 2004 |
| 624 | Ga0207702_10243672 | 3300026078 | Bacteria | 1685 |
| 625 | Ga0207702_10554436 | 3300026078 | Unclassified | 1125 |
| 626 | Ga0207702_10647369 | 3300026078 | Bacteria | 1039 |
| 627 | Ga0207641_10479775 | 3300026088 | Unclassified | 1205 |
| 628 | Ga0207641_10961592 | 3300026088 | Bacteria | 850 |
| 629 | Ga0207641_12360813 | 3300026088 | Bacteria | 531 |
| 630 | Ga0207648_10164158 | 3300026089 | Bacteria | 1962 |
| 631 | Ga0207648_10286888 | 3300026089 | Bacteria | 1473 |
| 632 | Ga0207676_11249644 | 3300026095 | Bacteria | 737 |
| 633 | Ga0207674_10010849 | 3300026116 | Bacteria | 10270 |
| 634 | Ga0207674_10058156 | 3300026116 | Bacteria | 3918 |
| 635 | Ga0207674_10399670 | 3300026116 | Bacteria | 1328 |
| 636 | Ga0207675_100119591 | 3300026118 | Bacteria | 2492 |
| 637 | Ga0207675_100959175 | 3300026118 | Bacteria | 873 |
| 638 | Ga0207675_101077760 | 3300026118 | Bacteria | 823 |
| 639 | Ga0207675_102002915 | 3300026118 | Unclassified | 597 |
| 640 | Ga0207683_10000104 | 3300026121 | Bacteria | 69720 |
| 641 | Ga0207683_10068273 | 3300026121 | Bacteria | 3138 |
| 642 | Ga0207683_10260264 | 3300026121 | Bacteria | 1584 |
| 643 | Ga0207683_11174899 | 3300026121 | Bacteria | 711 |
| 644 | Ga0207683_11748931 | 3300026121 | Bacteria | 571 |
| 645 | Ga0207698_10070179 | 3300026142 | Bacteria | 2775 |
| 646 | Ga0207698_10555201 | 3300026142 | Bacteria | 1126 |
| 647 | Ga0207698_11110132 | 3300026142 | Bacteria | 804 |
| 648 | Ga0209813_10160988 | 3300027866 | Bacteria | 810 |
| 649 | Ga0209974_10231220 | 3300027876 | Bacteria | 691 |
| 650 | Ga0207428_10018533 | 3300027907 | Bacteria | 5943 |
| 651 | Ga0268266_10929934 | 3300028379 | Unclassified | 841 |
| 652 | Ga0268264_10058274 | 3300028381 | Bacteria | 3233 |
| 653 | Ga0265337_1019203 | 3300028556 | Bacteria | 2159 |
| 654 | Ga0265326_10006523 | 3300028558 | Bacteria | 3618 |
| 655 | Ga0265326_10086520 | 3300028558 | Bacteria | 887 |
| 656 | Ga0265319_1002683 | 3300028563 | Bacteria | 9540 |
| 657 | Ga0265319_1005554 | 3300028563 | Bacteria | 6011 |
| 658 | Ga0265319_1028195 | 3300028563 | Bacteria | 1982 |
| 659 | Ga0265319_1096754 | 3300028563 | Unclassified | 929 |
| 660 | Ga0265334_10023543 | 3300028573 | Bacteria | 2504 |
| 661 | Ga0265334_10039158 | 3300028573 | Bacteria | 1861 |
| 662 | Ga0265334_10083003 | 3300028573 | Bacteria | 1178 |
| 663 | Ga0265318_10001858 | 3300028577 | Bacteria | 11908 |
| 664 | Ga0265318_10031552 | 3300028577 | Bacteria | 2054 |
| 665 | Ga0265318_10139262 | 3300028577 | Bacteria | 891 |
| 666 | Ga0265318_10254326 | 3300028577 | Bacteria | 641 |
| 667 | Ga0265322_10034408 | 3300028654 | Bacteria | 1443 |
| 668 | Ga0265336_10045614 | 3300028666 | Bacteria | 1333 |
| 669 | Ga0265336_10084650 | 3300028666 | Bacteria | 946 |
| 670 | Ga0265338_10001061 | 3300028800 | Bacteria | 45726 |
| 671 | Ga0265338_10018717 | 3300028800 | Bacteria | 7398 |
| 672 | Ga0265338_10019811 | 3300028800 | Bacteria | 7111 |
| 673 | Ga0265338_10035221 | 3300028800 | Bacteria | 4818 |
| 674 | Ga0265338_10052917 | 3300028800 | Bacteria | 3637 |
| 675 | Ga0265338_10098290 | 3300028800 | Bacteria | 2395 |
| 676 | Ga0265338_10379367 | 3300028800 | Bacteria | 1011 |
| 677 | Ga0265338_10547076 | 3300028800 | Bacteria | 811 |
| 678 | Ga0265324_10170008 | 3300029957 | Bacteria | 740 |
| 679 | Ga0265324_10287231 | 3300029957 | Bacteria | 559 |
| 680 | Ga0265330_10002056 | 3300031235 | Bacteria | 11141 |
| 681 | Ga0265330_10049968 | 3300031235 | Bacteria | 1835 |
| 682 | Ga0265330_10333321 | 3300031235 | Bacteria | 640 |
| 683 | Ga0265332_10003017 | 3300031238 | Bacteria | 8259 |
| 684 | Ga0265332_10171420 | 3300031238 | Bacteria | 906 |
| 685 | Ga0265328_10009562 | 3300031239 | Bacteria | 3944 |
| 686 | Ga0265328_10211154 | 3300031239 | Bacteria | 738 |
| 687 | Ga0265328_10216182 | 3300031239 | Bacteria | 730 |
| 688 | Ga0265320_10060852 | 3300031240 | Bacteria | 1801 |
| 689 | Ga0265320_10109182 | 3300031240 | Bacteria | 1268 |
| 690 | Ga0265320_10340489 | 3300031240 | Unclassified | 663 |
| 691 | Ga0265325_10001537 | 3300031241 | Bacteria | 16147 |
| 692 | Ga0265325_10042167 | 3300031241 | Bacteria | 2388 |
| 693 | Ga0265325_10055186 | 3300031241 | Bacteria | 2032 |
| 694 | Ga0265325_10183915 | 3300031241 | Bacteria | 972 |
| 695 | Ga0265329_10005298 | 3300031242 | Bacteria | 5229 |
| 696 | Ga0265329_10037332 | 3300031242 | Bacteria | 1565 |
| 697 | Ga0265340_10008001 | 3300031247 | Bacteria | 5727 |
| 698 | Ga0265340_10261865 | 3300031247 | Unclassified | 770 |
| 699 | Ga0265340_10425469 | 3300031247 | Bacteria | 585 |
| 700 | Ga0265339_10015646 | 3300031249 | Bacteria | 4542 |
| 701 | Ga0265339_10043409 | 3300031249 | Bacteria | 2486 |
| 702 | Ga0265339_10045689 | 3300031249 | Bacteria | 2410 |
| 703 | Ga0265339_10172457 | 3300031249 | Bacteria | 1082 |
| 704 | Ga0265339_10570887 | 3300031249 | Bacteria | 519 |
| 705 | Ga0265331_10021158 | 3300031250 | Bacteria | 3331 |
| 706 | Ga0265331_10089858 | 3300031250 | Bacteria | 1420 |
| 707 | Ga0265331_10273121 | 3300031250 | Bacteria | 758 |
| 708 | Ga0265327_10040578 | 3300031251 | Bacteria | 2515 |
| 709 | Ga0265327_10040629 | 3300031251 | Bacteria | 2513 |
| 710 | Ga0265327_10087608 | 3300031251 | Bacteria | 1524 |
| 711 | Ga0265327_10157122 | 3300031251 | Bacteria | 1053 |
| 712 | Ga0265327_10252675 | 3300031251 | Unclassified | 785 |
| 713 | Ga0265327_10463133 | 3300031251 | Bacteria | 547 |
| 714 | Ga0265316_10003636 | 3300031344 | Bacteria | 15532 |
| 715 | Ga0265316_10007127 | 3300031344 | Bacteria | 10571 |
| 716 | Ga0265316_10034157 | 3300031344 | Bacteria | 4133 |
| 717 | Ga0265313_10003675 | 3300031595 | Bacteria | 12254 |
| 718 | Ga0265313_10021944 | 3300031595 | Bacteria | 3478 |
| 719 | Ga0265313_10174773 | 3300031595 | Bacteria | 905 |
| 720 | Ga0265314_10017858 | 3300031711 | Bacteria | 5556 |
| 721 | Ga0265314_10032748 | 3300031711 | Bacteria | 3819 |
| 722 | Ga0265314_10081193 | 3300031711 | Bacteria | 2137 |
| 723 | Ga0265314_10388652 | 3300031711 | Bacteria | 757 |
| 724 | Ga0265342_10041539 | 3300031712 | Bacteria | 2784 |
| 725 | Ga0265342_10081407 | 3300031712 | Bacteria | 1869 |
| 726 | Ga0265342_10292845 | 3300031712 | Bacteria | 859 |
| 727 | Ga0265342_10342762 | 3300031712 | Bacteria | 779 |
| 728 | Ga0265342_10649308 | 3300031712 | Bacteria | 530 |
| 729 | Ga0265342_10674195 | 3300031712 | Unclassified | 518 |
| 730 | Ga0307416_101440127 | 3300032002 | Bacteria | 795 |
| 731 | Ga0316583_10019041 | 3300032133 | Bacteria | 2466 |
| 732 | Ga0373926_0024800 | 3300035083 | Unclassified | 2090 |
| 733 | Ga0373934_0201665 | 3300035086 | Bacteria | 819 |
| 734 | Ga0373949_0008034 | 3300035090 | Bacteria | 2312 |
| 735 | Ga0373923_0511657 | 3300035111 | Bacteria | 586 |
| 736 | Ga0373936_0037492 | 3300035113 | Bacteria | 1936 |
| 737 | Ga0373939_0032246 | 3300035114 | Bacteria | 1521 |
| 738 | Ga0373941_0210523 | 3300035115 | Bacteria | 743 |
| 739 | Ga0373945_0021394 | 3300035116 | Bacteria | 2222 |
| 740 | Ga0373953_0110947 | 3300035117 | Bacteria | 1160 |
| 741 | Ga0373953_0326604 | 3300035117 | Bacteria | 671 |
| 742 | Ga0373953_0406371 | 3300035117 | Bacteria | 600 |
| 743 | Ga0373954_0406228 | 3300035118 | Unclassified | 673 |
| 744 | Ga0373956_0070561 | 3300035119 | Bacteria | 1594 |
| 745 | Ga0373956_0145490 | 3300035119 | Bacteria | 1114 |
| 746 | Ga0373957_0055117 | 3300035120 | Bacteria | 1528 |
| 747 | Ga0373957_0145983 | 3300035120 | Bacteria | 969 |
| 748 | Ga0373957_0523056 | 3300035120 | Unclassified | 517 |
| 749 | Ga0373960_0345766 | 3300035121 | Bacteria | 563 |
| 750 | Ga0373943_0000787 | 3300035170 | Bacteria | 13889 |
| 751 | Ga0373943_0016466 | 3300035170 | Bacteria | 3371 |
| 752 | Ga0373946_0004455 | 3300035171 | Bacteria | 5019 |
| 753 | Ga0373946_0439487 | 3300035171 | Bacteria | 663 |
| 754 | Ga0373955_0750424 | 3300035172 | Bacteria | 599 |
| 755 | Ga0373924_0120225 | 3300035410 | Bacteria | 1139 |
| 756 | Ga0373924_0437613 | 3300035410 | Bacteria | 586 |
| 757 | Ga0373931_0177129 | 3300035691 | Bacteria | 1260 |
| 758 | Ga0373935_0048380 | 3300035692 | Bacteria | 2692 |
| 759 | Ga0373935_0081835 | 3300035692 | Unclassified | 2100 |
| 760 | Ga0373935_1286147 | 3300035692 | Bacteria | 546 |
| 761 | Ga0373927_0251630 | 3300035695 | Bacteria | 1161 |
| 762 | Ga0373927_0680441 | 3300035695 | Bacteria | 680 |
| 763 | Ga0373933_0083734 | 3300035724 | Bacteria | 1959 |
| 764 | Ga0373933_0182171 | 3300035724 | Bacteria | 1340 |
| 765 | Ga0373933_0365009 | 3300035724 | Bacteria | 939 |
| 766 | Ga0373933_0503859 | 3300035724 | Unclassified | 793 |
| 767 | Ga0373947_0004672 | 3300035725 | Bacteria | 8027 |
| 768 | Ga0373947_0029563 | 3300035725 | Bacteria | 3215 |
| 769 | Ga0373937_0010658 | 3300036401 | Bacteria | 8036 |
| 770 | Ga0373937_0042103 | 3300036401 | Bacteria | 4167 |
| 771 | Ga0373937_0065790 | 3300036401 | Bacteria | 3337 |
| 772 | Ga0373937_0119188 | 3300036401 | Unclassified | 2459 |
| 773 | Ga0373937_0671986 | 3300036401 | Bacteria | 982 |
| 774 | Ga0373937_0919089 | 3300036401 | Unclassified | 824 |
| 775 | Ga0373937_1346290 | 3300036401 | Bacteria | 662 |
| 776 | Ga0373937_1586204 | 3300036401 | Unclassified | 602 |
| 777 | Ga0373925_0003196 | 3300037068 | Bacteria | 12810 |
| 778 | Ga0373925_0028431 | 3300037068 | Bacteria | 4096 |
| 779 | Ga0395899_0024435 | 3300037312 | Bacteria | 4568 |
| 780 | Ga0395899_0041464 | 3300037312 | Bacteria | 3439 |
| 781 | Ga0395899_0096406 | 3300037312 | Bacteria | 2139 |
| 782 | Ga0395899_0573027 | 3300037312 | Unclassified | 723 |
| 783 | Ga0395899_0585326 | 3300037312 | Bacteria | 713 |
| 784 | Ga0395900_0037096 | 3300037418 | Bacteria | 5026 |
| 785 | Ga0395900_0053203 | 3300037418 | Bacteria | 4167 |
| 786 | Ga0395900_0074999 | 3300037418 | Bacteria | 3477 |
| 787 | Ga0395900_0133623 | 3300037418 | Bacteria | 2542 |
| 788 | Ga0395900_0266944 | 3300037418 | Bacteria | 1707 |
| 789 | Ga0395900_0366953 | 3300037418 | Bacteria | 1410 |
| 790 | Ga0395900_0872193 | 3300037418 | Bacteria | 824 |
| 791 | Ga0395900_1143795 | 3300037418 | Unclassified | 695 |
| 792 | Ga0395898_0002150 | 3300037466 | Bacteria | 24270 |
| 793 | Ga0395898_0086929 | 3300037466 | Bacteria | 3012 |
| 794 | Ga0395898_0117528 | 3300037466 | Bacteria | 2548 |
| 795 | Ga0395898_0147797 | 3300037466 | Bacteria | 2249 |
| 796 | Ga0395898_0155892 | 3300037466 | Bacteria | 2184 |
| 797 | Ga0395898_1007358 | 3300037466 | Unclassified | 769 |
| 798 | Ga0395898_1523986 | 3300037466 | Unclassified | 594 |
| 799 | Ga0395905_0077580 | 3300037471 | Bacteria | 3113 |
| 800 | Ga0395905_0210850 | 3300037471 | Bacteria | 1820 |
| 801 | Ga0395905_0533532 | 3300037471 | Unclassified | 1074 |
| 802 | Ga0395905_1215518 | 3300037471 | Bacteria | 657 |
| 803 | Ga0395905_1666119 | 3300037471 | Unclassified | 543 |
| 804 | Ga0395901_0008302 | 3300038443 | Bacteria | 10495 |
| 805 | Ga0395901_0020505 | 3300038443 | Bacteria | 6765 |
| 806 | Ga0395901_0030172 | 3300038443 | Bacteria | 5586 |
| 807 | Ga0395901_0082346 | 3300038443 | Bacteria | 3362 |
| 808 | Ga0395901_0120315 | 3300038443 | Bacteria | 2759 |
| 809 | Ga0395901_0610875 | 3300038443 | Bacteria | 1098 |
| 810 | Ga0395901_0650560 | 3300038443 | Unclassified | 1057 |
| 811 | Ga0395901_0710149 | 3300038443 | Bacteria | 1002 |
| 812 | Ga0395901_0737109 | 3300038443 | Bacteria | 979 |
| 813 | Ga0395901_0979374 | 3300038443 | Unclassified | 823 |
| 814 | Ga0395901_1260799 | 3300038443 | Bacteria | 702 |
| 815 | Ga0395901_1637585 | 3300038443 | Bacteria | 596 |
| 816 | Ga0436360_0316579 | 3300039438 | Bacteria | 2723 |
| 817 | Ga0436362_0395928 | 3300039453 | Unclassified | 1384 |
| 818 | Ga0451807_0504538 | 3300041486 | Bacteria | 2834 |
| 819 | Ga0451851_0333978 | 3300041507 | Bacteria | 1559 |
| 820 | Ga0451853_1013368 | 3300041512 | Bacteria | 832 |
| 821 | Ga0451853_3764041 | 3300041512 | Bacteria | 682 |
| 822 | Ga0453683_0274205 | 3300044673 | Bacteria | 1077 |
| 823 | Ga0466965_0140910 | 3300044683 | Bacteria | 1255 |
| 824 | Ga0466966_0006211 | 3300044684 | Bacteria | 7897 |
| 825 | Ga0466966_0160748 | 3300044684 | Bacteria | 1368 |
| 826 | Ga0466961_0007729 | 3300044693 | Bacteria | 6845 |
| 827 | Ga0466961_0205713 | 3300044693 | Bacteria | 1216 |
| 828 | Ga0466963_0005638 | 3300044694 | Bacteria | 7348 |
| 829 | Ga0466963_0006238 | 3300044694 | Bacteria | 7042 |
| 830 | Ga0466963_0019091 | 3300044694 | Bacteria | 4293 |
| 831 | Ga0466963_0019693 | 3300044694 | Bacteria | 4236 |
| 832 | Ga0466963_0058210 | 3300044694 | Bacteria | 2576 |
| 833 | Ga0466963_0139373 | 3300044694 | Bacteria | 1679 |
| 834 | Ga0466963_0466065 | 3300044694 | Bacteria | 891 |
| 835 | Ga0466964_0027755 | 3300044706 | Bacteria | 2224 |
| 836 | Ga0466964_0474982 | 3300044706 | Unclassified | 667 |
| 837 | Ga0466971_0372397 | 3300044719 | Bacteria | 693 |
| 838 | Ga0466971_0551678 | 3300044719 | Bacteria | 572 |
| 839 | Ga0466968_0080156 | 3300044735 | Bacteria | 1433 |
| 840 | Ga0466957_0158877 | 3300044842 | Bacteria | 1467 |
| 841 | Ga0466957_0167228 | 3300044842 | Bacteria | 1431 |
| 842 | Ga0466957_0597767 | 3300044842 | Unclassified | 772 |
| 843 | Ga0466957_0899937 | 3300044842 | Unclassified | 632 |
| 844 | Ga0466959_0002140 | 3300045049 | Bacteria | 12519 |
| 845 | Ga0451576_0147828 | 3300045051 | Bacteria | 2450 |
| 846 | Ga0466958_0025336 | 3300045836 | Bacteria | 3497 |
| 847 | Ga0466967_0002196 | 3300045976 | Bacteria | 12005 |
| 848 | Ga0466967_0004360 | 3300045976 | Bacteria | 9527 |
| 849 | Ga0466967_0010226 | 3300045976 | Bacteria | 7022 |
| 850 | Ga0466967_0016891 | 3300045976 | Bacteria | 5771 |
| 851 | Ga0466967_0038286 | 3300045976 | Bacteria | 4111 |
| 852 | Ga0466967_0038703 | 3300045976 | Bacteria | 4092 |
| 853 | Ga0466967_0077710 | 3300045976 | Bacteria | 2988 |
| 854 | Ga0466967_0095993 | 3300045976 | Bacteria | 2703 |
| 855 | Ga0466967_0176541 | 3300045976 | Bacteria | 2012 |
| 856 | Ga0466967_0215999 | 3300045976 | Bacteria | 1820 |
| 857 | Ga0466967_0250369 | 3300045976 | Bacteria | 1692 |
| 858 | Ga0466967_0264575 | 3300045976 | Bacteria | 1646 |
| 859 | Ga0466967_0376711 | 3300045976 | Bacteria | 1377 |
| 860 | Ga0466967_0413159 | 3300045976 | Bacteria | 1314 |
| 861 | Ga0466967_0451409 | 3300045976 | Bacteria | 1256 |
| 862 | Ga0466967_0563170 | 3300045976 | Unclassified | 1122 |
| 863 | Ga0466967_0767075 | 3300045976 | Unclassified | 957 |
| 864 | Ga0466967_1131224 | 3300045976 | Bacteria | 780 |
| 865 | Ga0466967_2458440 | 3300045976 | Unclassified | 516 |
| 866 | Ga0495592_0000207 | 3300046454 | Bacteria | 50220 |
| 867 | Ga0495592_0000668 | 3300046454 | Bacteria | 23839 |
| 868 | Ga0495592_0186252 | 3300046454 | Unclassified | 1410 |
| 869 | Ga0495592_0258596 | 3300046454 | Bacteria | 1148 |
| 870 | Ga0495592_0262056 | 3300046454 | Unclassified | 1138 |
| 871 | Ga0495603_0008162 | 3300046455 | Bacteria | 6328 |
| 872 | Ga0495603_0150319 | 3300046455 | Unclassified | 1353 |
| 873 | Ga0495603_0299018 | 3300046455 | Unclassified | 924 |
| 874 | Ga0495629_0000547 | 3300046459 | Bacteria | 30968 |
| 875 | Ga0495629_0010960 | 3300046459 | Bacteria | 6589 |
| 876 | Ga0495629_0035717 | 3300046459 | Bacteria | 3511 |
| 877 | Ga0495629_0077976 | 3300046459 | Bacteria | 2313 |
| 878 | Ga0495629_0089211 | 3300046459 | Unclassified | 2151 |
| 879 | Ga0495629_0315550 | 3300046459 | Bacteria | 1069 |
| 880 | Ga0495629_0429274 | 3300046459 | Bacteria | 896 |
| 881 | Ga0495629_0693436 | 3300046459 | Unclassified | 676 |
| 882 | Ga0495629_0695310 | 3300046459 | Unclassified | 675 |
| 883 | Ga0495641_0003620 | 3300046461 | Bacteria | 11436 |
| 884 | Ga0495641_0009743 | 3300046461 | Bacteria | 5671 |
| 885 | Ga0495641_0045391 | 3300046461 | Bacteria | 2023 |
| 886 | Ga0495641_0090268 | 3300046461 | Bacteria | 1369 |
| 887 | Ga0495641_0141586 | 3300046461 | Bacteria | 1074 |
| 888 | Ga0495641_0214047 | 3300046461 | Bacteria | 864 |
| 889 | Ga0495641_0526874 | 3300046461 | Bacteria | 539 |
| 890 | Ga0495651_0000106 | 3300046462 | Bacteria | 61363 |
| 891 | Ga0495651_0023748 | 3300046462 | Bacteria | 4766 |
| 892 | Ga0495651_0090773 | 3300046462 | Bacteria | 2291 |
| 893 | Ga0495651_0091082 | 3300046462 | Bacteria | 2286 |
| 894 | Ga0495651_0152343 | 3300046462 | Bacteria | 1665 |
| 895 | Ga0495651_0354705 | 3300046462 | Unclassified | 968 |
| 896 | Ga0495651_0441569 | 3300046462 | Bacteria | 842 |
| 897 | Ga0495651_0925000 | 3300046462 | Unclassified | 532 |
| 898 | Ga0495653_0002778 | 3300046463 | Bacteria | 13963 |
| 899 | Ga0495653_0018749 | 3300046463 | Bacteria | 5616 |
| 900 | Ga0495653_0043389 | 3300046463 | Unclassified | 3496 |
| 901 | Ga0495653_0066560 | 3300046463 | Bacteria | 2709 |
| 902 | Ga0495653_0091968 | 3300046463 | Bacteria | 2216 |
| 903 | Ga0495653_0095985 | 3300046463 | Unclassified | 2156 |
| 904 | Ga0495653_0158860 | 3300046463 | Bacteria | 1571 |
| 905 | Ga0495653_0302814 | 3300046463 | Bacteria | 1042 |
| 906 | Ga0495653_0920600 | 3300046463 | Unclassified | 520 |
| 907 | Ga0495580_0094552 | 3300046472 | Bacteria | 2079 |
| 908 | Ga0495580_0436852 | 3300046472 | Unclassified | 879 |
| 909 | Ga0495582_0012570 | 3300046473 | Bacteria | 4666 |
| 910 | Ga0495582_0012676 | 3300046473 | Bacteria | 4645 |
| 911 | Ga0495582_0013443 | 3300046473 | Unclassified | 4506 |
| 912 | Ga0495582_0025360 | 3300046473 | Bacteria | 3247 |
| 913 | Ga0495582_0117240 | 3300046473 | Unclassified | 1498 |
| 914 | Ga0495582_0596618 | 3300046473 | Bacteria | 639 |
| 915 | Ga0495605_0337285 | 3300046474 | Bacteria | 634 |
| 916 | Ga0495605_0372858 | 3300046474 | Bacteria | 596 |
| 917 | Ga0495639_0001862 | 3300046475 | Bacteria | 9337 |
| 918 | Ga0495639_0206138 | 3300046475 | Unclassified | 964 |
| 919 | Ga0495662_0002471 | 3300046476 | Bacteria | 9307 |
| 920 | Ga0495662_0009003 | 3300046476 | Bacteria | 4902 |
| 921 | Ga0495662_0089877 | 3300046476 | Bacteria | 1497 |
| 922 | Ga0495664_0014064 | 3300046477 | Bacteria | 4534 |
| 923 | Ga0495664_0040412 | 3300046477 | Bacteria | 2758 |
| 924 | Ga0495664_0227233 | 3300046477 | Unclassified | 1129 |
| 925 | Ga0495664_0462421 | 3300046477 | Bacteria | 759 |
| 926 | Ga0495664_0466513 | 3300046477 | Bacteria | 755 |
| 927 | Ga0495664_0673248 | 3300046477 | Bacteria | 612 |
| 928 | Ga0495594_0052712 | 3300046499 | Bacteria | 2240 |
| 929 | Ga0495594_0094943 | 3300046499 | Bacteria | 1674 |
| 930 | Ga0495594_0354116 | 3300046499 | Bacteria | 836 |
| 931 | Ga0495608_0000790 | 3300046511 | Bacteria | 22205 |
| 932 | Ga0495608_0033746 | 3300046511 | Bacteria | 3456 |
| 933 | Ga0495608_0046128 | 3300046511 | Bacteria | 2901 |
| 934 | Ga0495608_0067275 | 3300046511 | Bacteria | 2343 |
| 935 | Ga0495608_0241513 | 3300046511 | Bacteria | 1128 |
| 936 | Ga0495608_0564291 | 3300046511 | Unclassified | 685 |
| 937 | Ga0495618_0002764 | 3300046514 | Bacteria | 11159 |
| 938 | Ga0495618_0027059 | 3300046514 | Bacteria | 3570 |
| 939 | Ga0495618_0061319 | 3300046514 | Bacteria | 2385 |
| 940 | Ga0495618_0083349 | 3300046514 | Unclassified | 2042 |
| 941 | Ga0495618_0120553 | 3300046514 | Unclassified | 1680 |
| 942 | Ga0495618_0132252 | 3300046514 | Bacteria | 1596 |
| 943 | Ga0495618_0157836 | 3300046514 | Unclassified | 1447 |
| 944 | Ga0495618_0348909 | 3300046514 | Unclassified | 912 |
| 945 | Ga0495620_0143265 | 3300046515 | Bacteria | 934 |
| 946 | Ga0495628_0001531 | 3300046516 | Bacteria | 21192 |
| 947 | Ga0495628_0039336 | 3300046516 | Bacteria | 3783 |
| 948 | Ga0495628_0047153 | 3300046516 | Bacteria | 3420 |
| 949 | Ga0495628_0139053 | 3300046516 | Bacteria | 1854 |
| 950 | Ga0495628_0195690 | 3300046516 | Bacteria | 1525 |
| 951 | Ga0495628_0739050 | 3300046516 | Unclassified | 692 |
| 952 | Ga0495628_0740236 | 3300046516 | Bacteria | 692 |
| 953 | Ga0495628_0887327 | 3300046516 | Unclassified | 619 |
| 954 | Ga0495630_0006157 | 3300046517 | Bacteria | 8507 |
| 955 | Ga0495630_0023321 | 3300046517 | Bacteria | 4575 |
| 956 | Ga0495630_0047061 | 3300046517 | Bacteria | 3225 |
| 957 | Ga0495630_0053581 | 3300046517 | Bacteria | 3021 |
| 958 | Ga0495630_0214387 | 3300046517 | Bacteria | 1469 |
| 959 | Ga0495630_0396759 | 3300046517 | Bacteria | 1057 |
| 960 | Ga0495630_0399973 | 3300046517 | Unclassified | 1052 |
| 961 | Ga0495630_0923515 | 3300046517 | Bacteria | 664 |
| 962 | Ga0495630_1090684 | 3300046517 | Bacteria | 605 |
| 963 | Ga0495666_0003835 | 3300046526 | Bacteria | 7605 |
| 964 | Ga0495666_0025279 | 3300046526 | Bacteria | 2933 |
| 965 | Ga0495666_0388316 | 3300046526 | Bacteria | 628 |
| 966 | Ga0495652_0000466 | 3300046529 | Bacteria | 47387 |
| 967 | Ga0495652_0014303 | 3300046529 | Bacteria | 7126 |
| 968 | Ga0495652_0028447 | 3300046529 | Bacteria | 4918 |
| 969 | Ga0495652_0063555 | 3300046529 | Bacteria | 3107 |
| 970 | Ga0495652_0220784 | 3300046529 | Bacteria | 1424 |
| 971 | Ga0495652_0276761 | 3300046529 | Bacteria | 1231 |
| 972 | Ga0495652_0421946 | 3300046529 | Bacteria | 940 |
| 973 | Ga0495652_0739565 | 3300046529 | Bacteria | 659 |
| 974 | Ga0495665_0000375 | 3300046531 | Bacteria | 22517 |
| 975 | Ga0495665_0000444 | 3300046531 | Bacteria | 20931 |
| 976 | Ga0495640_0040646 | 3300046533 | Bacteria | 3255 |
| 977 | Ga0495640_0046625 | 3300046533 | Bacteria | 3001 |
| 978 | Ga0495640_0047460 | 3300046533 | Bacteria | 2972 |
| 979 | Ga0495640_0080425 | 3300046533 | Bacteria | 2167 |
| 980 | Ga0495640_0092744 | 3300046533 | Unclassified | 1991 |
| 981 | Ga0495640_0187570 | 3300046533 | Unclassified | 1315 |
| 982 | Ga0495586_0037800 | 3300046535 | Bacteria | 2591 |
| 983 | Ga0495586_0106930 | 3300046535 | Bacteria | 1556 |
| 984 | Ga0495586_0218611 | 3300046535 | Unclassified | 1082 |
| 985 | Ga0495587_0000537 | 3300046536 | Bacteria | 26275 |
| 986 | Ga0495587_0005779 | 3300046536 | Bacteria | 8057 |
| 987 | Ga0495587_0093358 | 3300046536 | Bacteria | 1737 |
| 988 | Ga0495587_0099478 | 3300046536 | Unclassified | 1676 |
| 989 | Ga0495587_0287548 | 3300046536 | Bacteria | 921 |
| 990 | Ga0495587_0775853 | 3300046536 | Unclassified | 524 |
| 991 | Ga0495621_0542750 | 3300046539 | Bacteria | 505 |
| 992 | Ga0495645_0000115 | 3300046543 | Bacteria | 54956 |
| 993 | Ga0495645_0009055 | 3300046543 | Bacteria | 6953 |
| 994 | Ga0495645_0054475 | 3300046543 | Bacteria | 2906 |
| 995 | Ga0495645_0076516 | 3300046543 | Bacteria | 2408 |
| 996 | Ga0495645_0104445 | 3300046543 | Unclassified | 2012 |
| 997 | Ga0495645_0246756 | 3300046543 | Bacteria | 1188 |
| 998 | Ga0495667_0008659 | 3300046559 | Bacteria | 6907 |
| 999 | Ga0495667_0009052 | 3300046559 | Bacteria | 6766 |
| 1000 | Ga0495667_0034897 | 3300046559 | Bacteria | 3363 |
| 1001 | Ga0495667_0066105 | 3300046559 | Bacteria | 2364 |
| 1002 | Ga0495667_0067628 | 3300046559 | Bacteria | 2334 |
| 1003 | Ga0495667_0093670 | 3300046559 | Bacteria | 1945 |
| 1004 | Ga0495667_0203753 | 3300046559 | Bacteria | 1266 |
| 1005 | Ga0495667_0318958 | 3300046559 | Bacteria | 983 |
| 1006 | Ga0495667_0338449 | 3300046559 | Bacteria | 951 |
| 1007 | Ga0495668_0780116 | 3300046616 | Unclassified | 529 |
| 1008 | Ga0495634_0028168 | 3300046642 | Bacteria | 3902 |
| 1009 | Ga0495634_0031114 | 3300046642 | Bacteria | 3678 |
| 1010 | Ga0495634_0057518 | 3300046642 | Bacteria | 2595 |
| 1011 | Ga0495634_0076155 | 3300046642 | Unclassified | 2202 |
| 1012 | Ga0495634_0093933 | 3300046642 | Unclassified | 1944 |
| 1013 | Ga0495634_0121115 | 3300046642 | Unclassified | 1675 |
| 1014 | Ga0495634_0237954 | 3300046642 | Bacteria | 1118 |
| 1015 | Ga0495635_0004142 | 3300046663 | Bacteria | 10052 |
| 1016 | Ga0495635_0012675 | 3300046663 | Bacteria | 5914 |
| 1017 | Ga0495635_0012840 | 3300046663 | Bacteria | 5867 |
| 1018 | Ga0495635_0064769 | 3300046663 | Unclassified | 2509 |
| 1019 | Ga0495635_0073127 | 3300046663 | Bacteria | 2348 |
| 1020 | Ga0495635_0092180 | 3300046663 | Bacteria | 2072 |
| 1021 | Ga0495635_0133529 | 3300046663 | Bacteria | 1692 |
| 1022 | Ga0495635_0191971 | 3300046663 | Unclassified | 1386 |
| 1023 | Ga0495635_0785152 | 3300046663 | Bacteria | 614 |
| 1024 | Ga0495588_0148967 | 3300046674 | Bacteria | 1237 |
| 1025 | Ga0495588_0282722 | 3300046674 | Bacteria | 874 |
| 1026 | Ga0495657_0043374 | 3300046675 | Bacteria | 3067 |
| 1027 | Ga0495657_0044807 | 3300046675 | Bacteria | 3006 |
| 1028 | Ga0495657_0053924 | 3300046675 | Bacteria | 2688 |
| 1029 | Ga0495657_0243905 | 3300046675 | Unclassified | 1083 |
| 1030 | Ga0495657_0669816 | 3300046675 | Bacteria | 597 |
| 1031 | Ga0495657_0721076 | 3300046675 | Unclassified | 572 |
| 1032 | Ga0495657_0871114 | 3300046675 | Unclassified | 513 |
| 1033 | Ga0495599_0000135 | 3300046678 | Bacteria | 47515 |
| 1034 | Ga0495599_0031408 | 3300046678 | Bacteria | 3333 |
| 1035 | Ga0495599_0119877 | 3300046678 | Unclassified | 1636 |
| 1036 | Ga0495599_0196627 | 3300046678 | Bacteria | 1239 |
| 1037 | Ga0495599_0263326 | 3300046678 | Bacteria | 1047 |
| 1038 | Ga0495599_0310846 | 3300046678 | Unclassified | 950 |
| 1039 | Ga0495623_0001398 | 3300046679 | Bacteria | 16404 |
| 1040 | Ga0495623_0025689 | 3300046679 | Bacteria | 3793 |
| 1041 | Ga0495623_0153615 | 3300046679 | Bacteria | 1358 |
| 1042 | Ga0495623_0513909 | 3300046679 | Unclassified | 631 |
| 1043 | Ga0495646_0005613 | 3300046680 | Bacteria | 7938 |
| 1044 | Ga0495646_0007475 | 3300046680 | Bacteria | 6943 |
| 1045 | Ga0495646_0083662 | 3300046680 | Bacteria | 1854 |
| 1046 | Ga0495646_0234093 | 3300046680 | Bacteria | 989 |
| 1047 | Ga0495646_0293611 | 3300046680 | Bacteria | 861 |
| 1048 | Ga0495646_0358455 | 3300046680 | Bacteria | 763 |
| 1049 | Ga0495646_0365613 | 3300046680 | Unclassified | 754 |
| 1050 | Ga0495646_0428169 | 3300046680 | Bacteria | 685 |
| 1051 | Ga0495646_0667415 | 3300046680 | Bacteria | 524 |
| 1052 | Ga0495647_0005673 | 3300046681 | Bacteria | 4101 |
| 1053 | Ga0495647_0012812 | 3300046681 | Bacteria | 2892 |
| 1054 | Ga0495647_0024895 | 3300046681 | Bacteria | 2182 |
| 1055 | Ga0495647_0380233 | 3300046681 | Bacteria | 646 |
| 1056 | Ga0495658_0010414 | 3300046683 | Bacteria | 4652 |
| 1057 | Ga0495658_0017287 | 3300046683 | Bacteria | 3723 |
| 1058 | Ga0495658_0114952 | 3300046683 | Bacteria | 1622 |
| 1059 | Ga0495658_0233440 | 3300046683 | Bacteria | 1154 |
| 1060 | Ga0495658_1126668 | 3300046683 | Bacteria | 500 |
| 1061 | Ga0495613_0018682 | 3300046689 | Bacteria | 5169 |
| 1062 | Ga0495613_0025707 | 3300046689 | Bacteria | 4387 |
| 1063 | Ga0495613_0037680 | 3300046689 | Bacteria | 3584 |
| 1064 | Ga0495613_0057534 | 3300046689 | Bacteria | 2854 |
| 1065 | Ga0495613_0156521 | 3300046689 | Bacteria | 1623 |
| 1066 | Ga0495613_0356401 | 3300046689 | Bacteria | 1004 |
| 1067 | Ga0495624_0009162 | 3300046690 | Bacteria | 6864 |
| 1068 | Ga0495624_0021257 | 3300046690 | Bacteria | 4306 |
| 1069 | Ga0495624_0170350 | 3300046690 | Bacteria | 1328 |
| 1070 | Ga0495624_0204055 | 3300046690 | Bacteria | 1200 |
| 1071 | Ga0495671_0282244 | 3300046692 | Bacteria | 800 |
| 1072 | Ga0495600_0018635 | 3300046809 | Bacteria | 4424 |
| 1073 | Ga0495600_0030254 | 3300046809 | Bacteria | 3507 |
| 1074 | Ga0495600_0079596 | 3300046809 | Bacteria | 2139 |
| 1075 | Ga0495600_0088266 | 3300046809 | Bacteria | 2023 |
| 1076 | Ga0495600_0356538 | 3300046809 | Bacteria | 915 |
| 1077 | Ga0495581_0002027 | 3300047315 | Bacteria | 11389 |
| 1078 | Ga0495581_0048638 | 3300047315 | Unclassified | 2448 |
| 1079 | Ga0495581_0060487 | 3300047315 | Unclassified | 2189 |
| 1080 | Ga0495581_0156756 | 3300047315 | Bacteria | 1331 |
| 1081 | Ga0495604_0000060 | 3300047317 | Bacteria | 95444 |
| 1082 | Ga0495604_0066136 | 3300047317 | Bacteria | 2751 |
| 1083 | Ga0495604_0092513 | 3300047317 | Bacteria | 2240 |
| 1084 | Ga0495604_0102046 | 3300047317 | Bacteria | 2106 |
| 1085 | Ga0495604_0154376 | 3300047317 | Unclassified | 1628 |
| 1086 | Ga0495604_0259983 | 3300047317 | Bacteria | 1180 |
| 1087 | Ga0495604_0432023 | 3300047317 | Bacteria | 863 |
| 1088 | Ga0495604_0787741 | 3300047317 | Bacteria | 599 |
| 1089 | Ga0495674_0041656 | 3300047319 | Bacteria | 4100 |
| 1090 | Ga0495674_0067597 | 3300047319 | Unclassified | 3095 |
| 1091 | Ga0495674_0092441 | 3300047319 | Bacteria | 2582 |
| 1092 | Ga0495674_0098447 | 3300047319 | Bacteria | 2490 |
| 1093 | Ga0495674_0105009 | 3300047319 | Bacteria | 2401 |
| 1094 | Ga0495674_0119166 | 3300047319 | Bacteria | 2231 |
| 1095 | Ga0495674_0187913 | 3300047319 | Unclassified | 1718 |
| 1096 | Ga0495674_0263194 | 3300047319 | Unclassified | 1416 |
| 1097 | Ga0495674_0765503 | 3300047319 | Bacteria | 753 |
| 1098 | Ga0495674_1386747 | 3300047319 | Unclassified | 524 |
| 1099 | Ga0495676_0022088 | 3300047321 | Bacteria | 5545 |
| 1100 | Ga0495676_0042004 | 3300047321 | Bacteria | 3758 |
| 1101 | Ga0495676_0054721 | 3300047321 | Bacteria | 3169 |
| 1102 | Ga0495676_0588358 | 3300047321 | Bacteria | 725 |
| 1103 | Ga0495676_0609925 | 3300047321 | Bacteria | 710 |
| 1104 | Ga0495676_1001908 | 3300047321 | Bacteria | 533 |
| 1105 | Ga0495676_1051975 | 3300047321 | Bacteria | 518 |
| 1106 | Ga0495680_0003235 | 3300047322 | Bacteria | 16170 |
| 1107 | Ga0495680_0009002 | 3300047322 | Bacteria | 9019 |
| 1108 | Ga0495680_0012003 | 3300047322 | Bacteria | 7644 |
| 1109 | Ga0495680_0037981 | 3300047322 | Bacteria | 3853 |
| 1110 | Ga0495680_0077111 | 3300047322 | Bacteria | 2525 |
| 1111 | Ga0495680_0081194 | 3300047322 | Bacteria | 2448 |
| 1112 | Ga0495680_0091647 | 3300047322 | Unclassified | 2278 |
| 1113 | Ga0495680_0194412 | 3300047322 | Bacteria | 1458 |
| 1114 | Ga0495680_0269514 | 3300047322 | Bacteria | 1202 |
| 1115 | Ga0495680_0317544 | 3300047322 | Bacteria | 1091 |
| 1116 | Ga0495680_0420778 | 3300047322 | Bacteria | 919 |
| 1117 | Ga0495675_0000223 | 3300047444 | Bacteria | 41211 |
| 1118 | Ga0495675_0028783 | 3300047444 | Bacteria | 3541 |
| 1119 | Ga0495675_0096650 | 3300047444 | Bacteria | 1852 |
| 1120 | Ga0495675_0781438 | 3300047444 | Bacteria | 530 |
| 1121 | Ga0495677_0144613 | 3300047445 | Unclassified | 914 |
| 1122 | Ga0495684_0002647 | 3300047471 | Bacteria | 14220 |
| 1123 | Ga0495684_0008307 | 3300047471 | Bacteria | 8043 |
| 1124 | Ga0495684_0011959 | 3300047471 | Bacteria | 6693 |
| 1125 | Ga0495684_0023693 | 3300047471 | Bacteria | 4720 |
| 1126 | Ga0495684_0023996 | 3300047471 | Bacteria | 4692 |
| 1127 | Ga0495684_0089894 | 3300047471 | Bacteria | 2326 |
| 1128 | Ga0495684_0510043 | 3300047471 | Bacteria | 825 |
| 1129 | Ga0495684_0689912 | 3300047471 | Bacteria | 678 |
| 1130 | Ga0495684_0921717 | 3300047471 | Unclassified | 561 |
| 1131 | Ga0495593_0004143 | 3300047673 | Bacteria | 8627 |
| 1132 | Ga0495593_0169924 | 3300047673 | Bacteria | 1099 |
| 1133 | Ga0495593_0222121 | 3300047673 | Bacteria | 948 |
| 1134 | Ga0495593_0264178 | 3300047673 | Bacteria | 861 |
| 1135 | Ga0495593_0415422 | 3300047673 | Bacteria | 673 |
| 1136 | Ga0495593_0431250 | 3300047673 | Bacteria | 659 |
| 1137 | Ga0495593_0516186 | 3300047673 | Bacteria | 599 |
| 1138 | Ga0495593_0560666 | 3300047673 | Unclassified | 573 |
| 1139 | Ga0495602_0000197 | 3300048088 | Bacteria | 56557 |
| 1140 | Ga0495602_0067881 | 3300048088 | Unclassified | 3065 |
| 1141 | Ga0495602_0105200 | 3300048088 | Bacteria | 2307 |
| 1142 | Ga0495602_0117322 | 3300048088 | Bacteria | 2149 |
| 1143 | Ga0495602_0173216 | 3300048088 | Bacteria | 1673 |
| 1144 | Ga0495602_0577871 | 3300048088 | Unclassified | 775 |
| 1145 | Ga0495602_0821964 | 3300048088 | Unclassified | 623 |
| 1146 | Ga0495602_0981989 | 3300048088 | Unclassified | 558 |
| 1147 | Ga0495614_0031997 | 3300048089 | Bacteria | 2264 |
| 1148 | Ga0495614_0042494 | 3300048089 | Bacteria | 1948 |
| 1149 | Ga0495614_0456159 | 3300048089 | Bacteria | 605 |
| 1150 | Ga0496100_0033775 | 3300048903 | Bacteria | 3203 |
| 1151 | Ga0496100_0058795 | 3300048903 | Bacteria | 2524 |
| 1152 | Ga0496100_0084221 | 3300048903 | Unclassified | 2155 |
| 1153 | Ga0496100_0086141 | 3300048903 | Bacteria | 2133 |
| 1154 | Ga0496100_0101274 | 3300048903 | Bacteria | 1986 |
| 1155 | Ga0496100_0558882 | 3300048903 | Bacteria | 886 |
| 1156 | Ga0496100_1515707 | 3300048903 | Bacteria | 530 |
| 1157 | Ga0496101_0010515 | 3300048904 | Bacteria | 6112 |
| 1158 | Ga0496101_0027631 | 3300048904 | Bacteria | 3954 |
| 1159 | Ga0496101_0041890 | 3300048904 | Bacteria | 3267 |
| 1160 | Ga0496101_0198885 | 3300048904 | Bacteria | 1549 |
| 1161 | Ga0496101_0364455 | 3300048904 | Bacteria | 1136 |
| 1162 | Ga0496101_0409599 | 3300048904 | Unclassified | 1068 |
| 1163 | Ga0496102_0001709 | 3300048905 | Bacteria | 19219 |
| 1164 | Ga0496102_0049125 | 3300048905 | Bacteria | 3837 |
| 1165 | Ga0496102_0123388 | 3300048905 | Bacteria | 2420 |
| 1166 | Ga0496102_0150901 | 3300048905 | Bacteria | 2184 |
| 1167 | Ga0496102_0196971 | 3300048905 | Bacteria | 1899 |
| 1168 | Ga0496102_1362506 | 3300048905 | Bacteria | 628 |
| 1169 | Ga0496103_0006377 | 3300048906 | Bacteria | 7048 |
| 1170 | Ga0496103_0009833 | 3300048906 | Bacteria | 5664 |
| 1171 | Ga0496103_0318981 | 3300048906 | Bacteria | 999 |
| 1172 | Ga0496103_0604147 | 3300048906 | Bacteria | 699 |
| 1173 | Ga0496103_0624531 | 3300048906 | Unclassified | 686 |
| 1174 | Ga0496104_0010202 | 3300048907 | Bacteria | 8386 |
| 1175 | Ga0496104_0012042 | 3300048907 | Bacteria | 7762 |
| 1176 | Ga0496104_0012279 | 3300048907 | Bacteria | 7699 |
| 1177 | Ga0496104_0027708 | 3300048907 | Bacteria | 5245 |
| 1178 | Ga0496104_0329420 | 3300048907 | Unclassified | 1440 |
| 1179 | Ga0496104_0365438 | 3300048907 | Bacteria | 1355 |
| 1180 | Ga0496104_0429671 | 3300048907 | Bacteria | 1233 |
| 1181 | Ga0496104_0807444 | 3300048907 | Bacteria | 844 |
| 1182 | Ga0496105_0005454 | 3300048908 | Bacteria | 9649 |
| 1183 | Ga0496105_0017346 | 3300048908 | Bacteria | 5769 |
| 1184 | Ga0496105_0026468 | 3300048908 | Bacteria | 4731 |
| 1185 | Ga0496105_0056405 | 3300048908 | Bacteria | 3242 |
| 1186 | Ga0496105_0058263 | 3300048908 | Bacteria | 3188 |
| 1187 | Ga0496105_0123719 | 3300048908 | Bacteria | 2132 |
| 1188 | Ga0496105_0141307 | 3300048908 | Bacteria | 1982 |
| 1189 | Ga0496105_0268515 | 3300048908 | Unclassified | 1378 |
| 1190 | Ga0496105_1107705 | 3300048908 | Unclassified | 587 |
| 1191 | Ga0496106_0065894 | 3300048909 | Bacteria | 2757 |
| 1192 | Ga0496106_0121079 | 3300048909 | Bacteria | 2045 |
| 1193 | Ga0496106_0401776 | 3300048909 | Bacteria | 1101 |
| 1194 | Ga0496106_0754193 | 3300048909 | Unclassified | 774 |
| 1195 | Ga0496106_0871622 | 3300048909 | Bacteria | 712 |
| 1196 | Ga0496107_0038511 | 3300048910 | Bacteria | 3429 |
| 1197 | Ga0496107_0041808 | 3300048910 | Unclassified | 3292 |
| 1198 | Ga0496107_0233542 | 3300048910 | Bacteria | 1368 |
| 1199 | Ga0496107_0283447 | 3300048910 | Bacteria | 1233 |
| 1200 | Ga0496107_1102015 | 3300048910 | Bacteria | 573 |
| 1201 | Ga0496108_0009397 | 3300048911 | Bacteria | 7916 |
| 1202 | Ga0496108_0041711 | 3300048911 | Bacteria | 3832 |
| 1203 | Ga0496108_0068322 | 3300048911 | Bacteria | 2998 |
| 1204 | Ga0496108_0073925 | 3300048911 | Bacteria | 2877 |
| 1205 | Ga0496108_0098553 | 3300048911 | Bacteria | 2491 |
| 1206 | Ga0496108_0230010 | 3300048911 | Bacteria | 1612 |
| 1207 | Ga0496108_0309487 | 3300048911 | Bacteria | 1376 |
| 1208 | Ga0496108_0375598 | 3300048911 | Bacteria | 1241 |
| 1209 | Ga0496108_0433041 | 3300048911 | Bacteria | 1149 |
| 1210 | Ga0496108_0560982 | 3300048911 | Bacteria | 996 |
| 1211 | Ga0496109_0001075 | 3300048912 | Bacteria | 22665 |
| 1212 | Ga0496109_0002814 | 3300048912 | Bacteria | 14568 |
| 1213 | Ga0496109_0007801 | 3300048912 | Bacteria | 9066 |
| 1214 | Ga0496109_0011278 | 3300048912 | Bacteria | 7676 |
| 1215 | Ga0496109_0091087 | 3300048912 | Bacteria | 2820 |
| 1216 | Ga0496109_0170707 | 3300048912 | Unclassified | 2040 |
| 1217 | Ga0496109_0183345 | 3300048912 | Bacteria | 1967 |
| 1218 | Ga0496109_0437075 | 3300048912 | Bacteria | 1236 |
| 1219 | Ga0496109_0488817 | 3300048912 | Bacteria | 1162 |
| 1220 | Ga0496109_1193862 | 3300048912 | Bacteria | 698 |
| 1221 | Ga0496110_0012910 | 3300048913 | Bacteria | 6887 |
| 1222 | Ga0496110_0018730 | 3300048913 | Bacteria | 5808 |
| 1223 | Ga0496110_0036216 | 3300048913 | Bacteria | 4284 |
| 1224 | Ga0496110_0043883 | 3300048913 | Bacteria | 3904 |
| 1225 | Ga0496110_0068768 | 3300048913 | Bacteria | 3135 |
| 1226 | Ga0496110_0166535 | 3300048913 | Bacteria | 1999 |
| 1227 | Ga0496110_0236610 | 3300048913 | Unclassified | 1662 |
| 1228 | Ga0496110_0863904 | 3300048913 | Unclassified | 810 |
| 1229 | Ga0496110_1676671 | 3300048913 | Bacteria | 546 |
| 1230 | Ga0496111_0007856 | 3300048914 | Bacteria | 7028 |
| 1231 | Ga0496111_0011735 | 3300048914 | Bacteria | 5916 |
| 1232 | Ga0496111_0014759 | 3300048914 | Bacteria | 5346 |
| 1233 | Ga0496111_0023850 | 3300048914 | Bacteria | 4299 |
| 1234 | Ga0496111_0065521 | 3300048914 | Unclassified | 2637 |
| 1235 | Ga0496111_0071782 | 3300048914 | Bacteria | 2520 |
| 1236 | Ga0496111_0596687 | 3300048914 | Unclassified | 809 |
| 1237 | Ga0496111_1255425 | 3300048914 | Unclassified | 523 |
| 1238 | Ga0496112_0011217 | 3300048915 | Bacteria | 8174 |
| 1239 | Ga0496112_0018672 | 3300048915 | Bacteria | 6535 |
| 1240 | Ga0496112_0035238 | 3300048915 | Bacteria | 4873 |
| 1241 | Ga0496112_0088077 | 3300048915 | Bacteria | 3072 |
| 1242 | Ga0496112_0113856 | 3300048915 | Bacteria | 2676 |
| 1243 | Ga0496112_0260072 | 3300048915 | Bacteria | 1685 |
| 1244 | Ga0496112_0345739 | 3300048915 | Bacteria | 1430 |
| 1245 | Ga0496112_0349827 | 3300048915 | Bacteria | 1420 |
| 1246 | Ga0496112_0449769 | 3300048915 | Unclassified | 1226 |
| 1247 | Ga0496112_0637742 | 3300048915 | Unclassified | 996 |
| 1248 | Ga0496112_0911543 | 3300048915 | Bacteria | 801 |
| 1249 | Ga0496112_1073779 | 3300048915 | Unclassified | 724 |
| 1250 | Ga0496112_1317524 | 3300048915 | Bacteria | 638 |
| 1251 | Ga0496113_0005652 | 3300048916 | Bacteria | 7827 |
| 1252 | Ga0496113_0011318 | 3300048916 | Bacteria | 5945 |
| 1253 | Ga0496113_0116694 | 3300048916 | Bacteria | 2083 |
| 1254 | Ga0496113_0485175 | 3300048916 | Bacteria | 993 |
| 1255 | Ga0496113_0648475 | 3300048916 | Bacteria | 844 |
| 1256 | Ga0496113_1545790 | 3300048916 | Bacteria | 511 |
| 1257 | Ga0496114_0001561 | 3300048917 | Bacteria | 17392 |
| 1258 | Ga0496114_0004217 | 3300048917 | Bacteria | 11138 |
| 1259 | Ga0496114_0042239 | 3300048917 | Bacteria | 3779 |
| 1260 | Ga0496114_0066953 | 3300048917 | Bacteria | 3012 |
| 1261 | Ga0496114_0158131 | 3300048917 | Bacteria | 1969 |
| 1262 | Ga0496114_0238755 | 3300048917 | Bacteria | 1598 |
| 1263 | Ga0496114_0256266 | 3300048917 | Bacteria | 1540 |
| 1264 | Ga0496114_0273571 | 3300048917 | Bacteria | 1488 |
| 1265 | Ga0496114_0287650 | 3300048917 | Bacteria | 1450 |
| 1266 | Ga0496114_0326825 | 3300048917 | Bacteria | 1356 |
| 1267 | Ga0496114_0330683 | 3300048917 | Unclassified | 1347 |
| 1268 | Ga0496114_0627832 | 3300048917 | Bacteria | 946 |
| 1269 | Ga0496114_0666167 | 3300048917 | Bacteria | 914 |
| 1270 | Ga0496114_1429214 | 3300048917 | Bacteria | 579 |
| 1271 | Ga0496115_0001106 | 3300048918 | Bacteria | 19452 |
| 1272 | Ga0496115_0020246 | 3300048918 | Bacteria | 5130 |
| 1273 | Ga0496115_0042002 | 3300048918 | Bacteria | 3642 |
| 1274 | Ga0496115_0151942 | 3300048918 | Unclassified | 1912 |
| 1275 | Ga0496115_0174157 | 3300048918 | Bacteria | 1779 |
| 1276 | Ga0496115_0348946 | 3300048918 | Unclassified | 1207 |
| 1277 | Ga0496115_0498002 | 3300048918 | Bacteria | 979 |
| 1278 | Ga0496115_0511593 | 3300048918 | Unclassified | 964 |
| 1279 | Ga0496115_0932279 | 3300048918 | Bacteria | 668 |
| 1280 | Ga0501041_0474456 | 3300049577 | Bacteria | 795 |
| 1281 | Ga0501041_0890592 | 3300049577 | Unclassified | 572 |
| 1282 | Ga0501042_0963345 | 3300049578 | Unclassified | 622 |
| 1283 | Ga0501046_0241109 | 3300049580 | Bacteria | 1333 |
| 1284 | Ga0501046_0503999 | 3300049580 | Bacteria | 867 |
| 1285 | Ga0501046_1005386 | 3300049580 | Bacteria | 579 |
| 1286 | Ga0501047_0041213 | 3300049581 | Bacteria | 4462 |
| 1287 | Ga0501047_0187843 | 3300049581 | Bacteria | 1931 |
| 1288 | Ga0501047_0797180 | 3300049581 | Bacteria | 759 |
| 1289 | Ga0501048_1373685 | 3300049582 | Bacteria | 508 |
| 1290 | Ga0501067_0099106 | 3300049583 | Bacteria | 1618 |
| 1291 | Ga0501068_0900652 | 3300049584 | Unclassified | 582 |
| 1292 | Ga0501069_0043351 | 3300049585 | Bacteria | 2490 |
| 1293 | Ga0501069_0064831 | 3300049585 | Bacteria | 2042 |
| 1294 | Ga0501069_0130208 | 3300049585 | Unclassified | 1440 |
| 1295 | Ga0501069_0272409 | 3300049585 | Bacteria | 990 |
| 1296 | Ga0501070_0000493 | 3300049586 | Bacteria | 35853 |
| 1297 | Ga0501070_0030879 | 3300049586 | Bacteria | 4488 |
| 1298 | Ga0501070_0242495 | 3300049586 | Bacteria | 1475 |
| 1299 | Ga0501070_0334311 | 3300049586 | Bacteria | 1231 |
| 1300 | Ga0501070_0986933 | 3300049586 | Bacteria | 654 |
| 1301 | Ga0501071_0881756 | 3300049587 | Unclassified | 690 |
| 1302 | Ga0501072_0600904 | 3300049588 | Bacteria | 867 |
| 1303 | Ga0501073_0289311 | 3300049589 | Bacteria | 1131 |
| 1304 | Ga0501073_0313788 | 3300049589 | Bacteria | 1082 |
| 1305 | Ga0501073_0403209 | 3300049589 | Bacteria | 945 |
| 1306 | Ga0501074_0028063 | 3300049590 | Bacteria | 4080 |
| 1307 | Ga0501074_0377106 | 3300049590 | Bacteria | 1006 |
| 1308 | Ga0501074_0434909 | 3300049590 | Bacteria | 930 |
| 1309 | Ga0501074_0866085 | 3300049590 | Bacteria | 636 |
| 1310 | Ga0501076_0109739 | 3300049592 | Bacteria | 2230 |
| 1311 | Ga0501079_0204026 | 3300049741 | Bacteria | 1544 |
| 1312 | Ga0501079_0366112 | 3300049741 | Bacteria | 1130 |
| 1313 | Ga0501079_0509055 | 3300049741 | Bacteria | 947 |
| 1314 | Ga0501080_0048512 | 3300049742 | Bacteria | 3952 |
| 1315 | Ga0501080_0099357 | 3300049742 | Bacteria | 2701 |
| 1316 | Ga0501080_1508116 | 3300049742 | Bacteria | 571 |
| 1317 | Ga0501081_0252024 | 3300049743 | Bacteria | 1289 |
| 1318 | Ga0501081_0648860 | 3300049743 | Bacteria | 791 |
| 1319 | Ga0501081_0690434 | 3300049743 | Bacteria | 766 |
| 1320 | Ga0501081_0990700 | 3300049743 | Bacteria | 635 |
| 1321 | Ga0501083_0136358 | 3300049744 | Bacteria | 1608 |
| 1322 | Ga0501035_0239093 | 3300049822 | Bacteria | 1545 |
| 1323 | Ga0501035_0334568 | 3300049822 | Bacteria | 1270 |
| 1324 | Ga0501044_0172306 | 3300049823 | Bacteria | 2135 |
| 1325 | Ga0501044_0894629 | 3300049823 | Bacteria | 763 |
| 1326 | Ga0501045_0791718 | 3300049824 | Unclassified | 698 |
| 1327 | nmdc:mga00v17_39102_c1 | 3300050491 | Bacteria | 2839 |
| 1328 | nmdc:mga0yw44_5318_c1 | 3300050492 | Bacteria | 6055 |
| 1329 | nmdc:mga0yw44_983_c1 | 3300050492 | Bacteria | 10875 |
| 1330 | nmdc:mga04h51_186253_c1 | 3300050495 | Bacteria | 810 |
| 1331 | nmdc:mga05p37_1225624_c1 | 3300050507 | Bacteria | 772 |
| 1332 | nmdc:mga09592_1108177_c1 | 3300050508 | Unclassified | 658 |
| 1333 | nmdc:mga08y16_13909_c1 | 3300050511 | Bacteria | 8469 |
| 1334 | nmdc:mga08y16_1565433_c1 | 3300050511 | Unclassified | 618 |
| 1335 | nmdc:mga0n895_442622_c1 | 3300050512 | Bacteria | 1313 |
| 1336 | nmdc:mga0n895_927009_c1 | 3300050512 | Bacteria | 855 |
| 1337 | nmdc:mga08x19_188156_c1 | 3300050514 | Bacteria | 1411 |
| 1338 | nmdc:mga08x19_199705_c1 | 3300050514 | Unclassified | 1370 |
| 1339 | nmdc:mga0a205_305914_c1 | 3300050515 | Bacteria | 1462 |
| 1340 | nmdc:mga0a205_72082_c1 | 3300050515 | Archaea | 3336 |
| 1341 | Ga0495601_0000328 | 3300053077 | Bacteria | 25250 |
| 1342 | Ga0495601_0020904 | 3300053077 | Unclassified | 4001 |
| 1343 | Ga0495601_0021737 | 3300053077 | Bacteria | 3931 |
| 1344 | Ga0495601_0059418 | 3300053077 | Bacteria | 2424 |
| 1345 | Ga0495601_0162552 | 3300053077 | Unclassified | 1459 |
| 1346 | Ga0495601_0226066 | 3300053077 | Unclassified | 1222 |
| 1347 | Ga0495601_0284219 | 3300053077 | Bacteria | 1078 |
| 1348 | Ga0495601_0690634 | 3300053077 | Bacteria | 651 |
| 1349 | Ga0495601_0921657 | 3300053077 | Unclassified | 551 |
| 1350 | Ga0495612_0059125 | 3300053078 | Bacteria | 1584 |
| 1351 | Ga0495612_0084176 | 3300053078 | Bacteria | 1339 |
| 1352 | Ga0495612_0091026 | 3300053078 | Bacteria | 1291 |
| 1353 | Ga0495612_0134008 | 3300053078 | Bacteria | 1072 |
| 1354 | Ga0495612_0134659 | 3300053078 | Unclassified | 1069 |
| 1355 | Ga0495655_0028715 | 3300053083 | Bacteria | 1331 |
| 1356 | Ga0495595_0004750 | 3300053084 | Bacteria | 5466 |
| 1357 | Ga0495595_0009591 | 3300053084 | Bacteria | 4010 |
| 1358 | Ga0495595_0025952 | 3300053084 | Bacteria | 2599 |
| 1359 | Ga0495595_0049002 | 3300053084 | Unclassified | 1952 |
| 1360 | Ga0495595_0050827 | 3300053084 | Bacteria | 1921 |
| 1361 | Ga0495595_0083823 | 3300053084 | Bacteria | 1522 |
| 1362 | Ga0495595_0234613 | 3300053084 | Bacteria | 917 |
| 1363 | Ga0495595_0279983 | 3300053084 | Bacteria | 837 |
| 1364 | Ga0495595_0526328 | 3300053084 | Bacteria | 603 |
| 1365 | Ga0495595_0538058 | 3300053084 | Unclassified | 596 |
| 1366 | Ga0495619_0000200 | 3300053085 | Bacteria | 43823 |
| 1367 | Ga0495619_0004867 | 3300053085 | Bacteria | 8524 |
| 1368 | Ga0495619_0005015 | 3300053085 | Bacteria | 8406 |
| 1369 | Ga0495619_0007341 | 3300053085 | Bacteria | 6984 |
| 1370 | Ga0495619_0031477 | 3300053085 | Bacteria | 3437 |
| 1371 | Ga0495619_0055511 | 3300053085 | Bacteria | 2623 |
| 1372 | Ga0495619_0069798 | 3300053085 | Bacteria | 2349 |
| 1373 | Ga0495619_0094194 | 3300053085 | Bacteria | 2031 |
| 1374 | Ga0495619_0141431 | 3300053085 | Bacteria | 1657 |
| 1375 | Ga0495619_0594405 | 3300053085 | Unclassified | 757 |
| 1376 | Ga0495619_0660656 | 3300053085 | Bacteria | 712 |
| 1377 | Ga0500566_0147173 | 3300053094 | Bacteria | 1243 |
| 1378 | Ga0501084_0461493 | 3300054114 | Bacteria | 1074 |
| 1379 | Ga0501084_0664575 | 3300054114 | Bacteria | 879 |
| 1380 | Ga0501084_0902441 | 3300054114 | Unclassified | 743 |
| 1381 | Ga0501082_0635668 | 3300060353 | Unclassified | 934 |
| 1382 | Ga0501082_0649943 | 3300060353 | Bacteria | 923 |
| 1383 | Ga0530510_0683139 | 3300061734 | Bacteria | 782 |
| 1384 | Ga0070714_100713753 | |||
| 1385 | JGI24743J22301_10125418 | |||
| 1386 | JGI24745J21846_1007725 | |||
| 1387 | JGI24738J21930_10003531 | |||
| 1388 | Ga0070658_10001489 | |||
| 1389 | Ga0070658_10019627 | |||
| 1390 | Ga0070658_10127208 | |||
| 1391 | Ga0070658_10197077 | |||
| 1392 | Ga0070658_10441471 | |||
| 1393 | Ga0070658_10647528 | |||
| 1394 | Ga0070658_10669280 | |||
| 1395 | Ga0070658_11713297 | |||
| 1396 | Ga0070676_10583851 | |||
| 1397 | Ga0070683_100001951 | |||
| 1398 | Ga0070683_100026980 | |||
| 1399 | Ga0070683_100067441 | |||
| 1400 | Ga0070683_100091832 | |||
| 1401 | Ga0070683_100109441 | |||
| 1402 | Ga0070683_100117935 | |||
| 1403 | Ga0070683_100286854 | |||
| 1404 | Ga0070683_100379703 | |||
| 1405 | Ga0070683_100399589 | |||
| 1406 | Ga0070683_101897182 | |||
| 1407 | Ga0070683_102253974 | |||
| 1408 | Ga0070690_100997447 | |||
| 1409 | Ga0070690_101053683 | |||
| 1410 | Ga0070670_100084764 | |||
| 1411 | Ga0070670_100195560 | |||
| 1412 | Ga0070670_102031780 | |||
| 1413 | Ga0070680_100001349 | |||
| 1414 | Ga0070680_100052049 | |||
| 1415 | Ga0070680_100073150 | |||
| 1416 | Ga0070680_100108447 | |||
| 1417 | Ga0070680_100130422 | |||
| 1418 | Ga0070680_100151989 | |||
| 1419 | Ga0070680_100166074 | |||
| 1420 | Ga0070680_100778623 | |||
| 1421 | Ga0070680_101173267 | |||
| 1422 | Ga0070682_100030774 | |||
| 1423 | Ga0070682_100035452 | |||
| 1424 | Ga0070682_100121214 | |||
| 1425 | Ga0070682_100139049 | |||
| 1426 | Ga0070682_100184167 | |||
| 1427 | Ga0070682_100240272 | |||
| 1428 | Ga0070682_101113922 | |||
| 1429 | Ga0070682_101888788 | |||
| 1430 | Ga0070682_102086709 | |||
| 1431 | Ga0068868_100017179 | |||
| 1432 | Ga0068868_100136367 | |||
| 1433 | Ga0068868_100524354 | |||
| 1434 | Ga0068868_100566173 | |||
| 1435 | Ga0068868_100700373 | |||
| 1436 | Ga0068868_101240878 | |||
| 1437 | Ga0068868_101253812 | |||
| 1438 | Ga0070660_100001388 | |||
| 1439 | Ga0070660_100012523 | |||
| 1440 | Ga0070660_100030292 | |||
| 1441 | Ga0070660_100053659 | |||
| 1442 | Ga0070660_100076218 | |||
| 1443 | Ga0070660_100083469 | |||
| 1444 | Ga0070660_100822204 | |||
| 1445 | Ga0070660_101074029 | |||
| 1446 | Ga0070660_101493852 | |||
| 1447 | Ga0070660_101642874 | |||
| 1448 | Ga0070689_100283500 | |||
| 1449 | Ga0070689_100420219 | |||
| 1450 | Ga0070689_101943028 | |||
| 1451 | Ga0070691_10067355 | |||
| 1452 | Ga0070691_10088321 | |||
| 1453 | Ga0070687_100056835 | |||
| 1454 | Ga0070687_100467840 | |||
| 1455 | Ga0070661_100027030 | |||
| 1456 | Ga0070661_100027666 | |||
| 1457 | Ga0070661_100027844 | |||
| 1458 | Ga0070661_100054691 | |||
| 1459 | Ga0070661_100087610 | |||
| 1460 | Ga0070661_100403255 | |||
| 1461 | Ga0070661_100429543 | |||
| 1462 | Ga0070661_100793210 | |||
| 1463 | Ga0070661_101349651 | |||
| 1464 | Ga0070692_10453539 | |||
| 1465 | Ga0070692_10887001 | |||
| 1466 | Ga0070668_101694614 | |||
| 1467 | Ga0070668_101896977 | |||
| 1468 | Ga0070669_100318626 | |||
| 1469 | Ga0070669_100672109 | |||
| 1470 | Ga0070675_100008991 | |||
| 1471 | Ga0070675_100356217 | |||
| 1472 | Ga0070675_100935608 | |||
| 1473 | Ga0070671_101602822 | |||
| 1474 | Ga0070674_100010343 | |||
| 1475 | Ga0070674_100039496 | |||
| 1476 | Ga0070674_100652504 | |||
| 1477 | Ga0070673_100009394 | |||
| 1478 | Ga0070673_100209281 | |||
| 1479 | Ga0070673_100806291 | |||
| 1480 | Ga0070673_100914804 | |||
| 1481 | Ga0070659_100078613 | |||
| 1482 | Ga0070659_100139958 | |||
| 1483 | Ga0070659_100180671 | |||
| 1484 | Ga0070659_100194801 | |||
| 1485 | Ga0070659_100370726 | |||
| 1486 | Ga0070659_101008944 | |||
| 1487 | Ga0070659_101424212 | |||
| 1488 | Ga0070667_101409968 | |||
| 1489 | Ga0070667_101779080 | |||
| 1490 | Ga0070709_10676907 | |||
| 1491 | Ga0070709_10790951 | |||
| 1492 | Ga0070714_100207970 | |||
| 1493 | Ga0070714_100655276 | |||
| 1494 | Ga0070714_101198321 | |||
| 1495 | Ga0070714_101848088 | |||
| 1496 | Ga0070713_100278409 | |||
| 1497 | Ga0070713_101862235 | |||
| 1498 | Ga0070713_102034041 | |||
| 1499 | Ga0070710_10053588 | |||
| 1500 | Ga0070710_10775775 | |||
| 1501 | Ga0070701_10033887 | |||
| 1502 | Ga0070701_10617660 | |||
| 1503 | Ga0070711_100037212 | |||
| 1504 | Ga0070711_100500188 | |||
| 1505 | Ga0070711_100566991 | |||
| 1506 | Ga0070711_100669375 | |||
| 1507 | Ga0070711_101079668 | |||
| 1508 | Ga0070711_101122254 | |||
| 1509 | Ga0070705_100177990 | |||
| 1510 | Ga0070705_100373689 | |||
| 1511 | Ga0070700_100073563 | |||
| 1512 | Ga0070700_100148628 | |||
| 1513 | Ga0070694_100167559 | |||
| 1514 | Ga0070694_101032056 | |||
| 1515 | Ga0070694_101450804 | |||
| 1516 | Ga0070708_102251890 | |||
| 1517 | Ga0070663_100048212 | |||
| 1518 | Ga0070663_100205400 | |||
| 1519 | Ga0070663_100418922 | |||
| 1520 | Ga0070663_100832814 | |||
| 1521 | Ga0070663_101355696 | |||
| 1522 | Ga0070678_100044737 | |||
| 1523 | Ga0070678_100049900 | |||
| 1524 | Ga0070678_100936428 | |||
| 1525 | Ga0070662_100014259 | |||
| 1526 | Ga0070662_100479074 | |||
| 1527 | Ga0070662_101570007 | |||
| 1528 | Ga0070681_10001836 | |||
| 1529 | Ga0070681_10003067 | |||
| 1530 | Ga0070681_10007348 | |||
| 1531 | Ga0070681_10020001 | |||
| 1532 | Ga0070681_10026240 | |||
| 1533 | Ga0070681_10085484 | |||
| 1534 | Ga0070681_10185838 | |||
| 1535 | Ga0070681_10220322 | |||
| 1536 | Ga0070681_10313158 | |||
| 1537 | Ga0070681_10319676 | |||
| 1538 | Ga0070681_10609120 | |||
| 1539 | Ga0068867_100026233 | |||
| 1540 | Ga0068867_100642815 | |||
| 1541 | Ga0070685_10298054 | |||
| 1542 | Ga0070707_101120795 | |||
| 1543 | Ga0070707_101372614 | |||
| 1544 | Ga0070698_100073227 | |||
| 1545 | Ga0070698_102033327 | |||
| 1546 | Ga0070699_101536124 | |||
| 1547 | Ga0070679_100003334 | |||
| 1548 | Ga0070679_100008435 | |||
| 1549 | Ga0070679_100036093 | |||
| 1550 | Ga0070679_100087276 | |||
| 1551 | Ga0070679_100148935 | |||
| 1552 | Ga0070679_100172053 | |||
| 1553 | Ga0070679_101676930 | |||
| 1554 | Ga0070684_100001285 | |||
| 1555 | Ga0070684_100003716 | |||
| 1556 | Ga0070684_100012113 | |||
| 1557 | Ga0070684_100055370 | |||
| 1558 | Ga0070684_100136721 | |||
| 1559 | Ga0070684_100203668 | |||
| 1560 | Ga0070684_100849264 | |||
| 1561 | Ga0070684_100888072 | |||
| 1562 | Ga0070684_100980948 | |||
| 1563 | Ga0070684_101301488 | |||
| 1564 | Ga0070697_100291880 | |||
| 1565 | Ga0068853_100072333 | |||
| 1566 | Ga0068853_100372353 | |||
| 1567 | Ga0068853_100772651 | |||
| 1568 | Ga0068853_101567672 | |||
| 1569 | Ga0070672_100084528 | |||
| 1570 | Ga0070672_100234309 | |||
| 1571 | Ga0070686_100023828 | |||
| 1572 | Ga0070686_100033726 | |||
| 1573 | Ga0070686_100168446 | |||
| 1574 | Ga0070686_100365870 | |||
| 1575 | Ga0070695_100000704 | |||
| 1576 | Ga0070696_100646864 | |||
| 1577 | Ga0070696_101053266 | |||
| 1578 | Ga0070693_100059172 | |||
| 1579 | Ga0070693_100089715 | |||
| 1580 | Ga0070693_100183628 | |||
| 1581 | Ga0070693_100778557 | |||
| 1582 | Ga0070665_100002268 | |||
| 1583 | Ga0070665_100432616 | |||
| 1584 | Ga0070665_100977210 | |||
| 1585 | Ga0070704_100007494 | |||
| 1586 | Ga0070704_100010813 | |||
| 1587 | Ga0070704_101204834 | |||
| 1588 | Ga0068855_100013934 | |||
| 1589 | Ga0068855_100018268 | |||
| 1590 | Ga0068855_100075876 | |||
| 1591 | Ga0068855_100091803 | |||
| 1592 | Ga0068855_100111808 | |||
| 1593 | Ga0068855_100119852 | |||
| 1594 | Ga0068855_100123245 | |||
| 1595 | Ga0068855_100179626 | |||
| 1596 | Ga0068855_100696216 | |||
| 1597 | Ga0070664_100121143 | |||
| 1598 | Ga0070664_100210013 | |||
| 1599 | Ga0070664_100323006 | |||
| 1600 | Ga0070664_100808555 | |||
| 1601 | Ga0070664_101190038 | |||
| 1602 | Ga0070664_101310462 | |||
| 1603 | Ga0070664_101768640 | |||
| 1604 | Ga0070664_102133348 | |||
| 1605 | Ga0068857_100034147 | |||
| 1606 | Ga0068857_100037240 | |||
| 1607 | Ga0068857_100969223 | |||
| 1608 | Ga0068854_100010501 | |||
| 1609 | Ga0068854_100135919 | |||
| 1610 | Ga0068854_100299191 | |||
| 1611 | Ga0068854_102141667 | |||
| 1612 | Ga0068856_100035794 | |||
| 1613 | Ga0068856_100091200 | |||
| 1614 | Ga0068856_100133227 | |||
| 1615 | Ga0068856_100239559 | |||
| 1616 | Ga0068856_100973636 | |||
| 1617 | Ga0068856_101261772 | |||
| 1618 | Ga0070702_100037149 | |||
| 1619 | Ga0070702_100134222 | |||
| 1620 | Ga0070702_100184579 | |||
| 1621 | Ga0070702_100359930 | |||
| 1622 | Ga0068852_100017585 | |||
| 1623 | Ga0068852_100212856 | |||
| 1624 | Ga0068852_100301321 | |||
| 1625 | Ga0068852_101105159 | |||
| 1626 | Ga0068852_102004325 | |||
| 1627 | Ga0068859_100721324 | |||
| 1628 | Ga0068859_100852052 | |||
| 1629 | Ga0068864_100012833 | |||
| 1630 | Ga0068864_100252525 | |||
| 1631 | Ga0068864_101291445 | |||
| 1632 | Ga0068866_10058207 | |||
| 1633 | Ga0068866_10206027 | |||
| 1634 | Ga0068866_10511188 | |||
| 1635 | Ga0068861_100163019 | |||
| 1636 | Ga0068861_100225011 | |||
| 1637 | Ga0068861_100515795 | |||
| 1638 | Ga0068851_10003331 | |||
| 1639 | Ga0068851_10227511 | |||
| 1640 | Ga0068851_10399732 | |||
| 1641 | Ga0068870_10201678 | |||
| 1642 | Ga0068870_10888730 | |||
| 1643 | Ga0068863_100094200 | |||
| 1644 | Ga0068863_100896172 | |||
| 1645 | Ga0068863_102018108 | |||
| 1646 | Ga0068863_102363595 | |||
| 1647 | Ga0068858_100039528 | |||
| 1648 | Ga0068858_100374615 | |||
| 1649 | Ga0068858_102499786 | |||
| 1650 | Ga0068860_100093375 | |||
| 1651 | Ga0068860_100374519 | |||
| 1652 | Ga0068860_102102819 | |||
| 1653 | Ga0081455_10108403 | |||
| 1654 | Ga0081455_10210622 | |||
| 1655 | Ga0070717_10021284 | |||
| 1656 | Ga0070717_10371719 | |||
| 1657 | Ga0070717_10956549 | |||
| 1658 | Ga0070717_11404974 | |||
| 1659 | Ga0075365_10457332 | |||
| 1660 | Ga0075365_10479336 | |||
| 1661 | Ga0075368_10157674 | |||
| 1662 | Ga0075363_100998499 | |||
| 1663 | Ga0075364_10006439 | |||
| 1664 | Ga0070716_100622316 | |||
| 1665 | Ga0070712_100197569 | |||
| 1666 | Ga0070712_100400895 | |||
| 1667 | Ga0070712_100441873 | |||
| 1668 | Ga0070712_100572444 | |||
| 1669 | Ga0070712_101176514 | |||
| 1670 | Ga0070712_101975839 | |||
| 1671 | Ga0075367_10276034 | |||
| 1672 | Ga0097621_100003405 | |||
| 1673 | Ga0097621_100288211 | |||
| 1674 | Ga0097621_101503434 | |||
| 1675 | Ga0068871_100146938 | |||
| 1676 | Ga0068871_100300519 | |||
| 1677 | Ga0068871_100338658 | |||
| 1678 | Ga0068871_100404101 | |||
| 1679 | Ga0068871_101045239 | |||
| 1680 | Ga0075428_100282768 | |||
| 1681 | Ga0075433_10085646 | |||
| 1682 | Ga0075434_100000858 | |||
| 1683 | Ga0075434_102497901 | |||
| 1684 | Ga0075429_101503651 | |||
| 1685 | Ga0068865_100024299 | |||
| 1686 | Ga0075436_100076949 | |||
| 1687 | Ga0097620_100721421 | |||
| 1688 | Ga0097620_100852008 | |||
| 1689 | Ga0075435_100078066 | |||
| 1690 | Ga0075435_102044052 | |||
| 1691 | Ga0099794_10619220 | |||
| 1692 | Ga0099795_10534158 | |||
| 1693 | Ga0105244_10342168 | |||
| 1694 | Ga0105240_10025875 | |||
| 1695 | Ga0105240_10077444 | |||
| 1696 | Ga0105240_10082877 | |||
| 1697 | Ga0105240_11501429 | |||
| 1698 | Ga0111539_10032383 | |||
| 1699 | Ga0111539_11518875 | |||
| 1700 | Ga0111539_12199241 | |||
| 1701 | Ga0105245_10022254 | |||
| 1702 | Ga0105245_10086715 | |||
| 1703 | Ga0105245_10104115 | |||
| 1704 | Ga0105245_10161689 | |||
| 1705 | Ga0105245_10170076 | |||
| 1706 | Ga0105245_10538364 | |||
| 1707 | Ga0105245_10839507 | |||
| 1708 | Ga0105245_12067074 | |||
| 1709 | Ga0105245_12577262 | |||
| 1710 | Ga0105245_12759479 | |||
| 1711 | Ga0105247_10018731 | |||
| 1712 | Ga0114129_10297614 | |||
| 1713 | Ga0114129_11047897 | |||
| 1714 | Ga0105243_10018646 | |||
| 1715 | Ga0105243_10046862 | |||
| 1716 | Ga0105243_10068010 | |||
| 1717 | Ga0105241_10096929 | |||
| 1718 | Ga0105241_10216082 | |||
| 1719 | Ga0105241_10216352 | |||
| 1720 | Ga0105241_10616811 | |||
| 1721 | Ga0105241_10933678 | |||
| 1722 | Ga0105241_11585590 | |||
| 1723 | Ga0105241_11732521 | |||
| 1724 | Ga0105242_10099052 | |||
| 1725 | Ga0105242_10231362 | |||
| 1726 | Ga0105242_10939284 | |||
| 1727 | Ga0105242_11995126 | |||
| 1728 | Ga0105242_12321364 | |||
| 1729 | Ga0105248_10060473 | |||
| 1730 | Ga0105248_10106228 | |||
| 1731 | Ga0105248_10241259 | |||
| 1732 | Ga0105248_11754929 | |||
| 1733 | Ga0105237_10022122 | |||
| 1734 | Ga0105237_10053435 | |||
| 1735 | Ga0105237_10114217 | |||
| 1736 | Ga0105237_10236130 | |||
| 1737 | Ga0105237_11418514 | |||
| 1738 | Ga0105237_11876693 | |||
| 1739 | Ga0105238_10025380 | |||
| 1740 | Ga0105238_10027162 | |||
| 1741 | Ga0105238_10293335 | |||
| 1742 | Ga0105238_10492830 | |||
| 1743 | Ga0105238_10606715 | |||
| 1744 | Ga0105238_11095061 | |||
| 1745 | Ga0105249_10222516 | |||
| 1746 | Ga0105249_11598783 | |||
| 1747 | Ga0105249_12187254 | |||
| 1748 | Ga0105239_10192707 | |||
| 1749 | Ga0105239_10286560 | |||
| 1750 | Ga0105239_10519527 | |||
| 1751 | Ga0105239_10631160 | |||
| 1752 | Ga0105239_11161824 | |||
| 1753 | Ga0105239_11345562 | |||
| 1754 | Ga0105239_11903698 | |||
| 1755 | Ga0105246_10031643 | |||
| 1756 | Ga0105246_10064630 | |||
| 1757 | Ga0105246_10120523 | |||
| 1758 | Ga0105246_11283571 | |||
| 1759 | Ga0157343_1008960 | |||
| 1760 | Ga0157342_1012416 | |||
| 1761 | Ga0157373_10491732 | |||
| 1762 | Ga0157373_10733575 | |||
| 1763 | Ga0157373_10892259 | |||
| 1764 | Ga0157373_10951158 | |||
| 1765 | Ga0157371_10031042 | |||
| 1766 | Ga0157371_10212411 | |||
| 1767 | Ga0157370_10003344 | |||
| 1768 | Ga0157370_10041948 | |||
| 1769 | Ga0157370_10047452 | |||
| 1770 | Ga0157370_10136651 | |||
| 1771 | Ga0157370_10149561 | |||
| 1772 | Ga0157370_10154924 | |||
| 1773 | Ga0157370_10159696 | |||
| 1774 | Ga0157370_10185130 | |||
| 1775 | Ga0157370_10385011 | |||
| 1776 | Ga0157370_10570071 | |||
| 1777 | Ga0157370_10968985 | |||
| 1778 | Ga0157370_11383849 | |||
| 1779 | Ga0157369_10003269 | |||
| 1780 | Ga0157369_10009824 | |||
| 1781 | Ga0157369_10025790 | |||
| 1782 | Ga0157369_10074644 | |||
| 1783 | Ga0157369_10135120 | |||
| 1784 | Ga0157369_10248596 | |||
| 1785 | Ga0157369_10268160 | |||
| 1786 | Ga0157369_10422993 | |||
| 1787 | Ga0157369_11259023 | |||
| 1788 | Ga0157374_10134926 | |||
| 1789 | Ga0157374_10230166 | |||
| 1790 | Ga0157374_10230883 | |||
| 1791 | Ga0157374_10261022 | |||
| 1792 | Ga0157374_10979835 | |||
| 1793 | Ga0157374_11020864 | |||
| 1794 | Ga0157374_12795005 | |||
| 1795 | Ga0157378_10072971 | |||
| 1796 | Ga0157378_10075365 | |||
| 1797 | Ga0163162_10038094 | |||
| 1798 | Ga0163162_10135874 | |||
| 1799 | Ga0163162_10334913 | |||
| 1800 | Ga0157372_10006441 | |||
| 1801 | Ga0157372_10090002 | |||
| 1802 | Ga0157372_10134617 | |||
| 1803 | Ga0157372_10148683 | |||
| 1804 | Ga0157372_10243584 | |||
| 1805 | Ga0157372_10289399 | |||
| 1806 | Ga0157372_10890913 | |||
| 1807 | Ga0157372_11109030 | |||
| 1808 | Ga0157372_11414648 | |||
| 1809 | Ga0157372_11818472 | |||
| 1810 | Ga0157372_12169421 | |||
| 1811 | Ga0157375_10011990 | |||
| 1812 | Ga0157375_10076545 | |||
| 1813 | Ga0157375_10174744 | |||
| 1814 | Ga0157375_10220065 | |||
| 1815 | Ga0157375_10447720 | |||
| 1816 | Ga0157375_10807577 | |||
| 1817 | Ga0157375_12004282 | |||
| 1818 | Ga0163163_10081430 | |||
| 1819 | Ga0163163_10538273 | |||
| 1820 | Ga0163163_11157620 | |||
| 1821 | Ga0163163_11501309 | |||
| 1822 | Ga0157380_10493321 | |||
| 1823 | Ga0157380_10546455 | |||
| 1824 | Ga0157380_11083316 | |||
| 1825 | Ga0182008_10151490 | |||
| 1826 | Ga0157377_10007279 | |||
| 1827 | Ga0157377_10014704 | |||
| 1828 | Ga0157377_10041704 | |||
| 1829 | Ga0157377_10071178 | |||
| 1830 | Ga0157377_11723892 | |||
| 1831 | Ga0157379_10014186 | |||
| 1832 | Ga0157379_10029853 | |||
| 1833 | Ga0157379_10093625 | |||
| 1834 | Ga0157379_12039788 | |||
| 1835 | Ga0157376_10032351 | |||
| 1836 | Ga0157376_10061347 | |||
| 1837 | Ga0157376_10380351 | |||
| 1838 | Ga0163161_11498281 | |||
| 1839 | Ga0163161_11738404 | |||
| 1840 | Ga0197907_10011517 | |||
| 1841 | Ga0206356_10101777 | |||
| 1842 | Ga0206356_10470480 | |||
| 1843 | Ga0206356_11062105 | |||
| 1844 | Ga0206356_11310210 | |||
| 1845 | Ga0206356_11599680 | |||
| 1846 | Ga0206356_11629557 | |||
| 1847 | Ga0206350_10411591 | |||
| 1848 | Ga0206354_10239396 | |||
| 1849 | Ga0206354_11049549 | |||
| 1850 | Ga0206353_10090456 | |||
| 1851 | Ga0206353_10279259 | |||
| 1852 | Ga0206353_11337973 | |||
| 1853 | Ga0206353_11492649 | |||
| 1854 | Ga0154015_1007367 | |||
| 1855 | Ga0213871_10217557 | |||
| 1856 | Ga0224712_10199035 | |||
| 1857 | Ga0224712_10321509 | |||
| 1858 | Ga0224712_10689919 | |||
| 1859 | Ga0207656_10071401 | |||
| 1860 | Ga0207692_10115617 | |||
| 1861 | Ga0207692_10164534 | |||
| 1862 | Ga0207642_10702950 | |||
| 1863 | Ga0207710_10055769 | |||
| 1864 | Ga0207688_10011714 | |||
| 1865 | Ga0207688_10100342 | |||
| 1866 | Ga0207688_10241397 | |||
| 1867 | Ga0207680_11085041 | |||
| 1868 | Ga0207680_11163204 | |||
| 1869 | Ga0207647_10203758 | |||
| 1870 | Ga0207647_10312375 | |||
| 1871 | Ga0207699_10513764 | |||
| 1872 | Ga0207699_10695624 | |||
| 1873 | Ga0207699_10984073 | |||
| 1874 | Ga0207645_10532858 | |||
| 1875 | Ga0207643_10127529 | |||
| 1876 | Ga0207643_10185571 | |||
| 1877 | Ga0207643_10200993 | |||
| 1878 | Ga0207643_10279270 | |||
| 1879 | Ga0207705_10046240 | |||
| 1880 | Ga0207705_10262350 | |||
| 1881 | Ga0207705_10305935 | |||
| 1882 | Ga0207705_11159425 | |||
| 1883 | Ga0207705_11320053 | |||
| 1884 | Ga0207654_10517575 | |||
| 1885 | Ga0207707_10104598 | |||
| 1886 | Ga0207707_10149184 | |||
| 1887 | Ga0207707_10261519 | |||
| 1888 | Ga0207707_10587050 | |||
| 1889 | Ga0207707_10880056 | |||
| 1890 | Ga0207707_10888772 | |||
| 1891 | Ga0207695_10460852 | |||
| 1892 | Ga0207693_10151632 | |||
| 1893 | Ga0207693_10348453 | |||
| 1894 | Ga0207693_10560213 | |||
| 1895 | Ga0207663_10158137 | |||
| 1896 | Ga0207663_10158390 | |||
| 1897 | Ga0207663_10757598 | |||
| 1898 | Ga0207663_11572826 | |||
| 1899 | Ga0207663_11655469 | |||
| 1900 | Ga0207660_10077538 | |||
| 1901 | Ga0207660_10143500 | |||
| 1902 | Ga0207660_10641677 | |||
| 1903 | Ga0207660_10968829 | |||
| 1904 | Ga0207660_11234518 | |||
| 1905 | Ga0207662_10737774 | |||
| 1906 | Ga0207657_10005809 | |||
| 1907 | Ga0207657_10010219 | |||
| 1908 | Ga0207657_10065204 | |||
| 1909 | Ga0207657_10824555 | |||
| 1910 | Ga0207649_10289076 | |||
| 1911 | Ga0207649_10342385 | |||
| 1912 | Ga0207649_10408294 | |||
| 1913 | Ga0207649_10809668 | |||
| 1914 | Ga0207652_10181871 | |||
| 1915 | Ga0207652_10207618 | |||
| 1916 | Ga0207652_10359785 | |||
| 1917 | Ga0207646_10190892 | |||
| 1918 | Ga0207681_10291744 | |||
| 1919 | Ga0207650_10105254 | |||
| 1920 | Ga0207650_11429538 | |||
| 1921 | Ga0207659_10165427 | |||
| 1922 | Ga0207659_10214068 | |||
| 1923 | Ga0207659_10255021 | |||
| 1924 | Ga0207659_10475684 | |||
| 1925 | Ga0207687_10051696 | |||
| 1926 | Ga0207687_10053507 | |||
| 1927 | Ga0207687_10289098 | |||
| 1928 | Ga0207687_10316442 | |||
| 1929 | Ga0207687_10711790 | |||
| 1930 | Ga0207687_10922742 | |||
| 1931 | Ga0207687_10924638 | |||
| 1932 | Ga0207687_11120074 | |||
| 1933 | Ga0207700_10500690 | |||
| 1934 | Ga0207690_10051809 | |||
| 1935 | Ga0207690_10504182 | |||
| 1936 | Ga0207690_10544134 | |||
| 1937 | Ga0207690_10802974 | |||
| 1938 | Ga0207706_10022659 | |||
| 1939 | Ga0207706_10866694 | |||
| 1940 | Ga0207686_10036774 | |||
| 1941 | Ga0207686_10610552 | |||
| 1942 | Ga0207686_11121985 | |||
| 1943 | Ga0207709_10022698 | |||
| 1944 | Ga0207709_10246864 | |||
| 1945 | Ga0207709_10671966 | |||
| 1946 | Ga0207670_10093305 | |||
| 1947 | Ga0207669_10246588 | |||
| 1948 | Ga0207669_10379337 | |||
| 1949 | Ga0207669_11046582 | |||
| 1950 | Ga0207704_10049545 | |||
| 1951 | Ga0207704_11878744 | |||
| 1952 | Ga0207704_11987916 | |||
| 1953 | Ga0207691_10013765 | |||
| 1954 | Ga0207691_10087697 | |||
| 1955 | Ga0207711_10173210 | |||
| 1956 | Ga0207711_10229545 | |||
| 1957 | Ga0207711_10678382 | |||
| 1958 | Ga0207711_10768907 | |||
| 1959 | Ga0207689_10062142 | |||
| 1960 | Ga0207689_10841234 | |||
| 1961 | Ga0207661_10001706 | |||
| 1962 | Ga0207661_10183146 | |||
| 1963 | Ga0207661_10319730 | |||
| 1964 | Ga0207661_10401314 | |||
| 1965 | Ga0207661_10611820 | |||
| 1966 | Ga0207661_10709803 | |||
| 1967 | Ga0207661_10748454 | |||
| 1968 | Ga0207661_10825291 | |||
| 1969 | Ga0207661_11473893 | |||
| 1970 | Ga0207661_11874955 | |||
| 1971 | Ga0207679_10022416 | |||
| 1972 | Ga0207679_10072923 | |||
| 1973 | Ga0207679_10255360 | |||
| 1974 | Ga0207679_11121883 | |||
| 1975 | Ga0207679_12070592 | |||
| 1976 | Ga0207667_10008607 | |||
| 1977 | Ga0207667_10045199 | |||
| 1978 | Ga0207667_10436571 | |||
| 1979 | Ga0207667_10616267 | |||
| 1980 | Ga0207651_10327733 | |||
| 1981 | Ga0207651_10436272 | |||
| 1982 | Ga0207712_10286066 | |||
| 1983 | Ga0207712_10333645 | |||
| 1984 | Ga0207712_11853539 | |||
| 1985 | Ga0207668_10101202 | |||
| 1986 | Ga0207668_11408678 | |||
| 1987 | Ga0207640_10263204 | |||
| 1988 | Ga0207640_10876844 | |||
| 1989 | Ga0207658_10267830 | |||
| 1990 | Ga0207658_10391947 | |||
| 1991 | Ga0207677_10395581 | |||
| 1992 | Ga0207677_10418511 | |||
| 1993 | Ga0207677_10556047 | |||
| 1994 | Ga0207677_10762967 | |||
| 1995 | Ga0207677_10977514 | |||
| 1996 | Ga0207703_10066138 | |||
| 1997 | Ga0207639_10140785 | |||
| 1998 | Ga0207639_11045686 | |||
| 1999 | Ga0207678_10209584 | |||
| 2000 | Ga0207678_10227929 | |||
| 2001 | Ga0207678_10352289 | |||
| 2002 | Ga0207678_10598248 | |||
| 2003 | Ga0207708_10052947 | |||
| 2004 | Ga0207708_11628675 | |||
| 2005 | Ga0207702_10104946 | |||
| 2006 | Ga0207702_10168867 | |||
| 2007 | Ga0207702_10243672 | |||
| 2008 | Ga0207702_10554436 | |||
| 2009 | Ga0207702_10647369 | |||
| 2010 | Ga0207641_10479775 | |||
| 2011 | Ga0207641_10961592 | |||
| 2012 | Ga0207641_12360813 | |||
| 2013 | Ga0207648_10164158 | |||
| 2014 | Ga0207648_10286888 | |||
| 2015 | Ga0207676_11249644 | |||
| 2016 | Ga0207674_10010849 | |||
| 2017 | Ga0207674_10058156 | |||
| 2018 | Ga0207674_10399670 | |||
| 2019 | Ga0207675_100119591 | |||
| 2020 | Ga0207675_100959175 | |||
| 2021 | Ga0207675_101077760 | |||
| 2022 | Ga0207675_102002915 | |||
| 2023 | Ga0207683_10000104 | |||
| 2024 | Ga0207683_10068273 | |||
| 2025 | Ga0207683_10260264 | |||
| 2026 | Ga0207683_11174899 | |||
| 2027 | Ga0207683_11748931 | |||
| 2028 | Ga0207698_10070179 | |||
| 2029 | Ga0207698_10555201 | |||
| 2030 | Ga0207698_11110132 | |||
| 2031 | Ga0209813_10160988 | |||
| 2032 | Ga0209974_10231220 | |||
| 2033 | Ga0207428_10018533 | |||
| 2034 | Ga0268266_10929934 | |||
| 2035 | Ga0268264_10058274 | |||
| 2036 | Ga0265337_1019203 | |||
| 2037 | Ga0265326_10006523 | |||
| 2038 | Ga0265326_10086520 | |||
| 2039 | Ga0265319_1002683 | |||
| 2040 | Ga0265319_1005554 | |||
| 2041 | Ga0265319_1028195 | |||
| 2042 | Ga0265319_1096754 | |||
| 2043 | Ga0265334_10023543 | |||
| 2044 | Ga0265334_10039158 | |||
| 2045 | Ga0265334_10083003 | |||
| 2046 | Ga0265318_10001858 | |||
| 2047 | Ga0265318_10031552 | |||
| 2048 | Ga0265318_10139262 | |||
| 2049 | Ga0265318_10254326 | |||
| 2050 | Ga0265322_10034408 | |||
| 2051 | Ga0265336_10045614 | |||
| 2052 | Ga0265336_10084650 | |||
| 2053 | Ga0265338_10001061 | |||
| 2054 | Ga0265338_10018717 | |||
| 2055 | Ga0265338_10019811 | |||
| 2056 | Ga0265338_10035221 | |||
| 2057 | Ga0265338_10052917 | |||
| 2058 | Ga0265338_10098290 | |||
| 2059 | Ga0265338_10379367 | |||
| 2060 | Ga0265338_10547076 | |||
| 2061 | Ga0265324_10170008 | |||
| 2062 | Ga0265324_10287231 | |||
| 2063 | Ga0265330_10002056 | |||
| 2064 | Ga0265330_10049968 | |||
| 2065 | Ga0265330_10333321 | |||
| 2066 | Ga0265332_10003017 | |||
| 2067 | Ga0265332_10171420 | |||
| 2068 | Ga0265328_10009562 | |||
| 2069 | Ga0265328_10211154 | |||
| 2070 | Ga0265328_10216182 | |||
| 2071 | Ga0265320_10060852 | |||
| 2072 | Ga0265320_10109182 | |||
| 2073 | Ga0265320_10340489 | |||
| 2074 | Ga0265325_10001537 | |||
| 2075 | Ga0265325_10042167 | |||
| 2076 | Ga0265325_10055186 | |||
| 2077 | Ga0265325_10183915 | |||
| 2078 | Ga0265329_10005298 | |||
| 2079 | Ga0265329_10037332 | |||
| 2080 | Ga0265340_10008001 | |||
| 2081 | Ga0265340_10261865 | |||
| 2082 | Ga0265340_10425469 | |||
| 2083 | Ga0265339_10015646 | |||
| 2084 | Ga0265339_10043409 | |||
| 2085 | Ga0265339_10045689 | |||
| 2086 | Ga0265339_10172457 | |||
| 2087 | Ga0265339_10570887 | |||
| 2088 | Ga0265331_10021158 | |||
| 2089 | Ga0265331_10089858 | |||
| 2090 | Ga0265331_10273121 | |||
| 2091 | Ga0265327_10040578 | |||
| 2092 | Ga0265327_10040629 | |||
| 2093 | Ga0265327_10087608 | |||
| 2094 | Ga0265327_10157122 | |||
| 2095 | Ga0265327_10252675 | |||
| 2096 | Ga0265327_10463133 | |||
| 2097 | Ga0265316_10003636 | |||
| 2098 | Ga0265316_10007127 | |||
| 2099 | Ga0265316_10034157 | |||
| 2100 | Ga0265313_10003675 | |||
| 2101 | Ga0265313_10021944 | |||
| 2102 | Ga0265313_10174773 | |||
| 2103 | Ga0265314_10017858 | |||
| 2104 | Ga0265314_10032748 | |||
| 2105 | Ga0265314_10081193 | |||
| 2106 | Ga0265314_10388652 | |||
| 2107 | Ga0265342_10041539 | |||
| 2108 | Ga0265342_10081407 | |||
| 2109 | Ga0265342_10292845 | |||
| 2110 | Ga0265342_10342762 | |||
| 2111 | Ga0265342_10649308 | |||
| 2112 | Ga0265342_10674195 | |||
| 2113 | Ga0307416_101440127 | |||
| 2114 | Ga0316583_10019041 | |||
| 2115 | Ga0373926_0024800 | |||
| 2116 | Ga0373934_0201665 | |||
| 2117 | Ga0373949_0008034 | |||
| 2118 | Ga0373923_0511657 | |||
| 2119 | Ga0373936_0037492 | |||
| 2120 | Ga0373939_0032246 | |||
| 2121 | Ga0373941_0210523 | |||
| 2122 | Ga0373945_0021394 | |||
| 2123 | Ga0373953_0110947 | |||
| 2124 | Ga0373953_0326604 | |||
| 2125 | Ga0373953_0406371 | |||
| 2126 | Ga0373954_0406228 | |||
| 2127 | Ga0373956_0070561 | |||
| 2128 | Ga0373956_0145490 | |||
| 2129 | Ga0373957_0055117 | |||
| 2130 | Ga0373957_0145983 | |||
| 2131 | Ga0373957_0523056 | |||
| 2132 | Ga0373960_0345766 | |||
| 2133 | Ga0373943_0000787 | |||
| 2134 | Ga0373943_0016466 | |||
| 2135 | Ga0373946_0004455 | |||
| 2136 | Ga0373946_0439487 | |||
| 2137 | Ga0373955_0750424 | |||
| 2138 | Ga0373924_0120225 | |||
| 2139 | Ga0373924_0437613 | |||
| 2140 | Ga0373931_0177129 | |||
| 2141 | Ga0373935_0048380 | |||
| 2142 | Ga0373935_0081835 | |||
| 2143 | Ga0373935_1286147 | |||
| 2144 | Ga0373927_0251630 | |||
| 2145 | Ga0373927_0680441 | |||
| 2146 | Ga0373933_0083734 | |||
| 2147 | Ga0373933_0182171 | |||
| 2148 | Ga0373933_0365009 | |||
| 2149 | Ga0373933_0503859 | |||
| 2150 | Ga0373947_0004672 | |||
| 2151 | Ga0373947_0029563 | |||
| 2152 | Ga0373937_0010658 | |||
| 2153 | Ga0373937_0042103 | |||
| 2154 | Ga0373937_0065790 | |||
| 2155 | Ga0373937_0119188 | |||
| 2156 | Ga0373937_0671986 | |||
| 2157 | Ga0373937_0919089 | |||
| 2158 | Ga0373937_1346290 | |||
| 2159 | Ga0373937_1586204 | |||
| 2160 | Ga0373925_0003196 | |||
| 2161 | Ga0373925_0028431 | |||
| 2162 | Ga0395899_0024435 | |||
| 2163 | Ga0395899_0041464 | |||
| 2164 | Ga0395899_0096406 | |||
| 2165 | Ga0395899_0573027 | |||
| 2166 | Ga0395899_0585326 | |||
| 2167 | Ga0395900_0037096 | |||
| 2168 | Ga0395900_0053203 | |||
| 2169 | Ga0395900_0074999 | |||
| 2170 | Ga0395900_0133623 | |||
| 2171 | Ga0395900_0266944 | |||
| 2172 | Ga0395900_0366953 | |||
| 2173 | Ga0395900_0872193 | |||
| 2174 | Ga0395900_1143795 | |||
| 2175 | Ga0395898_0002150 | |||
| 2176 | Ga0395898_0086929 | |||
| 2177 | Ga0395898_0117528 | |||
| 2178 | Ga0395898_0147797 | |||
| 2179 | Ga0395898_0155892 | |||
| 2180 | Ga0395898_1007358 | |||
| 2181 | Ga0395898_1523986 | |||
| 2182 | Ga0395905_0077580 | |||
| 2183 | Ga0395905_0210850 | |||
| 2184 | Ga0395905_0533532 | |||
| 2185 | Ga0395905_1215518 | |||
| 2186 | Ga0395905_1666119 | |||
| 2187 | Ga0395901_0008302 | |||
| 2188 | Ga0395901_0020505 | |||
| 2189 | Ga0395901_0030172 | |||
| 2190 | Ga0395901_0082346 | |||
| 2191 | Ga0395901_0120315 | |||
| 2192 | Ga0395901_0610875 | |||
| 2193 | Ga0395901_0650560 | |||
| 2194 | Ga0395901_0710149 | |||
| 2195 | Ga0395901_0737109 | |||
| 2196 | Ga0395901_0979374 | |||
| 2197 | Ga0395901_1260799 | |||
| 2198 | Ga0395901_1637585 | |||
| 2199 | Ga0436360_0316579 | |||
| 2200 | Ga0436362_0395928 | |||
| 2201 | Ga0451807_0504538 | |||
| 2202 | Ga0451851_0333978 | |||
| 2203 | Ga0451853_1013368 | |||
| 2204 | Ga0451853_3764041 | |||
| 2205 | Ga0453683_0274205 | |||
| 2206 | Ga0466965_0140910 | |||
| 2207 | Ga0466966_0006211 | |||
| 2208 | Ga0466966_0160748 | |||
| 2209 | Ga0466961_0007729 | |||
| 2210 | Ga0466961_0205713 | |||
| 2211 | Ga0466963_0005638 | |||
| 2212 | Ga0466963_0006238 | |||
| 2213 | Ga0466963_0019091 | |||
| 2214 | Ga0466963_0019693 | |||
| 2215 | Ga0466963_0058210 | |||
| 2216 | Ga0466963_0139373 | |||
| 2217 | Ga0466963_0466065 | |||
| 2218 | Ga0466964_0027755 | |||
| 2219 | Ga0466964_0474982 | |||
| 2220 | Ga0466971_0372397 | |||
| 2221 | Ga0466971_0551678 | |||
| 2222 | Ga0466968_0080156 | |||
| 2223 | Ga0466957_0158877 | |||
| 2224 | Ga0466957_0167228 | |||
| 2225 | Ga0466957_0597767 | |||
| 2226 | Ga0466957_0899937 | |||
| 2227 | Ga0466959_0002140 | |||
| 2228 | Ga0451576_0147828 | |||
| 2229 | Ga0466958_0025336 | |||
| 2230 | Ga0466967_0002196 | |||
| 2231 | Ga0466967_0004360 | |||
| 2232 | Ga0466967_0010226 | |||
| 2233 | Ga0466967_0016891 | |||
| 2234 | Ga0466967_0038286 | |||
| 2235 | Ga0466967_0038703 | |||
| 2236 | Ga0466967_0077710 | |||
| 2237 | Ga0466967_0095993 | |||
| 2238 | Ga0466967_0176541 | |||
| 2239 | Ga0466967_0215999 | |||
| 2240 | Ga0466967_0250369 | |||
| 2241 | Ga0466967_0264575 | |||
| 2242 | Ga0466967_0376711 | |||
| 2243 | Ga0466967_0413159 | |||
| 2244 | Ga0466967_0451409 | |||
| 2245 | Ga0466967_0563170 | |||
| 2246 | Ga0466967_0767075 | |||
| 2247 | Ga0466967_1131224 | |||
| 2248 | Ga0466967_2458440 | |||
| 2249 | Ga0495592_0000207 | |||
| 2250 | Ga0495592_0000668 | |||
| 2251 | Ga0495592_0186252 | |||
| 2252 | Ga0495592_0258596 | |||
| 2253 | Ga0495592_0262056 | |||
| 2254 | Ga0495603_0008162 | |||
| 2255 | Ga0495603_0150319 | |||
| 2256 | Ga0495603_0299018 | |||
| 2257 | Ga0495629_0000547 | |||
| 2258 | Ga0495629_0010960 | |||
| 2259 | Ga0495629_0035717 | |||
| 2260 | Ga0495629_0077976 | |||
| 2261 | Ga0495629_0089211 | |||
| 2262 | Ga0495629_0315550 | |||
| 2263 | Ga0495629_0429274 | |||
| 2264 | Ga0495629_0693436 | |||
| 2265 | Ga0495629_0695310 | |||
| 2266 | Ga0495641_0003620 | |||
| 2267 | Ga0495641_0009743 | |||
| 2268 | Ga0495641_0045391 | |||
| 2269 | Ga0495641_0090268 | |||
| 2270 | Ga0495641_0141586 | |||
| 2271 | Ga0495641_0214047 | |||
| 2272 | Ga0495641_0526874 | |||
| 2273 | Ga0495651_0000106 | |||
| 2274 | Ga0495651_0023748 | |||
| 2275 | Ga0495651_0090773 | |||
| 2276 | Ga0495651_0091082 | |||
| 2277 | Ga0495651_0152343 | |||
| 2278 | Ga0495651_0354705 | |||
| 2279 | Ga0495651_0441569 | |||
| 2280 | Ga0495651_0925000 | |||
| 2281 | Ga0495653_0002778 | |||
| 2282 | Ga0495653_0018749 | |||
| 2283 | Ga0495653_0043389 | |||
| 2284 | Ga0495653_0066560 | |||
| 2285 | Ga0495653_0091968 | |||
| 2286 | Ga0495653_0095985 | |||
| 2287 | Ga0495653_0158860 | |||
| 2288 | Ga0495653_0302814 | |||
| 2289 | Ga0495653_0920600 | |||
| 2290 | Ga0495580_0094552 | |||
| 2291 | Ga0495580_0436852 | |||
| 2292 | Ga0495582_0012570 | |||
| 2293 | Ga0495582_0012676 | |||
| 2294 | Ga0495582_0013443 | |||
| 2295 | Ga0495582_0025360 | |||
| 2296 | Ga0495582_0117240 | |||
| 2297 | Ga0495582_0596618 | |||
| 2298 | Ga0495605_0337285 | |||
| 2299 | Ga0495605_0372858 | |||
| 2300 | Ga0495639_0001862 | |||
| 2301 | Ga0495639_0206138 | |||
| 2302 | Ga0495662_0002471 | |||
| 2303 | Ga0495662_0009003 | |||
| 2304 | Ga0495662_0089877 | |||
| 2305 | Ga0495664_0014064 | |||
| 2306 | Ga0495664_0040412 | |||
| 2307 | Ga0495664_0227233 | |||
| 2308 | Ga0495664_0462421 | |||
| 2309 | Ga0495664_0466513 | |||
| 2310 | Ga0495664_0673248 | |||
| 2311 | Ga0495594_0052712 | |||
| 2312 | Ga0495594_0094943 | |||
| 2313 | Ga0495594_0354116 | |||
| 2314 | Ga0495608_0000790 | |||
| 2315 | Ga0495608_0033746 | |||
| 2316 | Ga0495608_0046128 | |||
| 2317 | Ga0495608_0067275 | |||
| 2318 | Ga0495608_0241513 | |||
| 2319 | Ga0495608_0564291 | |||
| 2320 | Ga0495618_0002764 | |||
| 2321 | Ga0495618_0027059 | |||
| 2322 | Ga0495618_0061319 | |||
| 2323 | Ga0495618_0083349 | |||
| 2324 | Ga0495618_0120553 | |||
| 2325 | Ga0495618_0132252 | |||
| 2326 | Ga0495618_0157836 | |||
| 2327 | Ga0495618_0348909 | |||
| 2328 | Ga0495620_0143265 | |||
| 2329 | Ga0495628_0001531 | |||
| 2330 | Ga0495628_0039336 | |||
| 2331 | Ga0495628_0047153 | |||
| 2332 | Ga0495628_0139053 | |||
| 2333 | Ga0495628_0195690 | |||
| 2334 | Ga0495628_0739050 | |||
| 2335 | Ga0495628_0740236 | |||
| 2336 | Ga0495628_0887327 | |||
| 2337 | Ga0495630_0006157 | |||
| 2338 | Ga0495630_0023321 | |||
| 2339 | Ga0495630_0047061 | |||
| 2340 | Ga0495630_0053581 | |||
| 2341 | Ga0495630_0214387 | |||
| 2342 | Ga0495630_0396759 | |||
| 2343 | Ga0495630_0399973 | |||
| 2344 | Ga0495630_0923515 | |||
| 2345 | Ga0495630_1090684 | |||
| 2346 | Ga0495666_0003835 | |||
| 2347 | Ga0495666_0025279 | |||
| 2348 | Ga0495666_0388316 | |||
| 2349 | Ga0495652_0000466 | |||
| 2350 | Ga0495652_0014303 | |||
| 2351 | Ga0495652_0028447 | |||
| 2352 | Ga0495652_0063555 | |||
| 2353 | Ga0495652_0220784 | |||
| 2354 | Ga0495652_0276761 | |||
| 2355 | Ga0495652_0421946 | |||
| 2356 | Ga0495652_0739565 | |||
| 2357 | Ga0495665_0000375 | |||
| 2358 | Ga0495665_0000444 | |||
| 2359 | Ga0495640_0040646 | |||
| 2360 | Ga0495640_0046625 | |||
| 2361 | Ga0495640_0047460 | |||
| 2362 | Ga0495640_0080425 | |||
| 2363 | Ga0495640_0092744 | |||
| 2364 | Ga0495640_0187570 | |||
| 2365 | Ga0495586_0037800 | |||
| 2366 | Ga0495586_0106930 | |||
| 2367 | Ga0495586_0218611 | |||
| 2368 | Ga0495587_0000537 | |||
| 2369 | Ga0495587_0005779 | |||
| 2370 | Ga0495587_0093358 | |||
| 2371 | Ga0495587_0099478 | |||
| 2372 | Ga0495587_0287548 | |||
| 2373 | Ga0495587_0775853 | |||
| 2374 | Ga0495621_0542750 | |||
| 2375 | Ga0495645_0000115 | |||
| 2376 | Ga0495645_0009055 | |||
| 2377 | Ga0495645_0054475 | |||
| 2378 | Ga0495645_0076516 | |||
| 2379 | Ga0495645_0104445 | |||
| 2380 | Ga0495645_0246756 | |||
| 2381 | Ga0495667_0008659 | |||
| 2382 | Ga0495667_0009052 | |||
| 2383 | Ga0495667_0034897 | |||
| 2384 | Ga0495667_0066105 | |||
| 2385 | Ga0495667_0067628 | |||
| 2386 | Ga0495667_0093670 | |||
| 2387 | Ga0495667_0203753 | |||
| 2388 | Ga0495667_0318958 | |||
| 2389 | Ga0495667_0338449 | |||
| 2390 | Ga0495668_0780116 | |||
| 2391 | Ga0495634_0028168 | |||
| 2392 | Ga0495634_0031114 | |||
| 2393 | Ga0495634_0057518 | |||
| 2394 | Ga0495634_0076155 | |||
| 2395 | Ga0495634_0093933 | |||
| 2396 | Ga0495634_0121115 | |||
| 2397 | Ga0495634_0237954 | |||
| 2398 | Ga0495635_0004142 | |||
| 2399 | Ga0495635_0012675 | |||
| 2400 | Ga0495635_0012840 | |||
| 2401 | Ga0495635_0064769 | |||
| 2402 | Ga0495635_0073127 | |||
| 2403 | Ga0495635_0092180 | |||
| 2404 | Ga0495635_0133529 | |||
| 2405 | Ga0495635_0191971 | |||
| 2406 | Ga0495635_0785152 | |||
| 2407 | Ga0495588_0148967 | |||
| 2408 | Ga0495588_0282722 | |||
| 2409 | Ga0495657_0043374 | |||
| 2410 | Ga0495657_0044807 | |||
| 2411 | Ga0495657_0053924 | |||
| 2412 | Ga0495657_0243905 | |||
| 2413 | Ga0495657_0669816 | |||
| 2414 | Ga0495657_0721076 | |||
| 2415 | Ga0495657_0871114 | |||
| 2416 | Ga0495599_0000135 | |||
| 2417 | Ga0495599_0031408 | |||
| 2418 | Ga0495599_0119877 | |||
| 2419 | Ga0495599_0196627 | |||
| 2420 | Ga0495599_0263326 | |||
| 2421 | Ga0495599_0310846 | |||
| 2422 | Ga0495623_0001398 | |||
| 2423 | Ga0495623_0025689 | |||
| 2424 | Ga0495623_0153615 | |||
| 2425 | Ga0495623_0513909 | |||
| 2426 | Ga0495646_0005613 | |||
| 2427 | Ga0495646_0007475 | |||
| 2428 | Ga0495646_0083662 | |||
| 2429 | Ga0495646_0234093 | |||
| 2430 | Ga0495646_0293611 | |||
| 2431 | Ga0495646_0358455 | |||
| 2432 | Ga0495646_0365613 | |||
| 2433 | Ga0495646_0428169 | |||
| 2434 | Ga0495646_0667415 | |||
| 2435 | Ga0495647_0005673 | |||
| 2436 | Ga0495647_0012812 | |||
| 2437 | Ga0495647_0024895 | |||
| 2438 | Ga0495647_0380233 | |||
| 2439 | Ga0495658_0010414 | |||
| 2440 | Ga0495658_0017287 | |||
| 2441 | Ga0495658_0114952 | |||
| 2442 | Ga0495658_0233440 | |||
| 2443 | Ga0495658_1126668 | |||
| 2444 | Ga0495613_0018682 | |||
| 2445 | Ga0495613_0025707 | |||
| 2446 | Ga0495613_0037680 | |||
| 2447 | Ga0495613_0057534 | |||
| 2448 | Ga0495613_0156521 | |||
| 2449 | Ga0495613_0356401 | |||
| 2450 | Ga0495624_0009162 | |||
| 2451 | Ga0495624_0021257 | |||
| 2452 | Ga0495624_0170350 | |||
| 2453 | Ga0495624_0204055 | |||
| 2454 | Ga0495671_0282244 | |||
| 2455 | Ga0495600_0018635 | |||
| 2456 | Ga0495600_0030254 | |||
| 2457 | Ga0495600_0079596 | |||
| 2458 | Ga0495600_0088266 | |||
| 2459 | Ga0495600_0356538 | |||
| 2460 | Ga0495581_0002027 | |||
| 2461 | Ga0495581_0048638 | |||
| 2462 | Ga0495581_0060487 | |||
| 2463 | Ga0495581_0156756 | |||
| 2464 | Ga0495604_0000060 | |||
| 2465 | Ga0495604_0066136 | |||
| 2466 | Ga0495604_0092513 | |||
| 2467 | Ga0495604_0102046 | |||
| 2468 | Ga0495604_0154376 | |||
| 2469 | Ga0495604_0259983 | |||
| 2470 | Ga0495604_0432023 | |||
| 2471 | Ga0495604_0787741 | |||
| 2472 | Ga0495674_0041656 | |||
| 2473 | Ga0495674_0067597 | |||
| 2474 | Ga0495674_0092441 | |||
| 2475 | Ga0495674_0098447 | |||
| 2476 | Ga0495674_0105009 | |||
| 2477 | Ga0495674_0119166 | |||
| 2478 | Ga0495674_0187913 | |||
| 2479 | Ga0495674_0263194 | |||
| 2480 | Ga0495674_0765503 | |||
| 2481 | Ga0495674_1386747 | |||
| 2482 | Ga0495676_0022088 | |||
| 2483 | Ga0495676_0042004 | |||
| 2484 | Ga0495676_0054721 | |||
| 2485 | Ga0495676_0588358 | |||
| 2486 | Ga0495676_0609925 | |||
| 2487 | Ga0495676_1001908 | |||
| 2488 | Ga0495676_1051975 | |||
| 2489 | Ga0495680_0003235 | |||
| 2490 | Ga0495680_0009002 | |||
| 2491 | Ga0495680_0012003 | |||
| 2492 | Ga0495680_0037981 | |||
| 2493 | Ga0495680_0077111 | |||
| 2494 | Ga0495680_0081194 | |||
| 2495 | Ga0495680_0091647 | |||
| 2496 | Ga0495680_0194412 | |||
| 2497 | Ga0495680_0269514 | |||
| 2498 | Ga0495680_0317544 | |||
| 2499 | Ga0495680_0420778 | |||
| 2500 | Ga0495675_0000223 | |||
| 2501 | Ga0495675_0028783 | |||
| 2502 | Ga0495675_0096650 | |||
| 2503 | Ga0495675_0781438 | |||
| 2504 | Ga0495677_0144613 | |||
| 2505 | Ga0495684_0002647 | |||
| 2506 | Ga0495684_0008307 | |||
| 2507 | Ga0495684_0011959 | |||
| 2508 | Ga0495684_0023693 | |||
| 2509 | Ga0495684_0023996 | |||
| 2510 | Ga0495684_0089894 | |||
| 2511 | Ga0495684_0510043 | |||
| 2512 | Ga0495684_0689912 | |||
| 2513 | Ga0495684_0921717 | |||
| 2514 | Ga0495593_0004143 | |||
| 2515 | Ga0495593_0169924 | |||
| 2516 | Ga0495593_0222121 | |||
| 2517 | Ga0495593_0264178 | |||
| 2518 | Ga0495593_0415422 | |||
| 2519 | Ga0495593_0431250 | |||
| 2520 | Ga0495593_0516186 | |||
| 2521 | Ga0495593_0560666 | |||
| 2522 | Ga0495602_0000197 | |||
| 2523 | Ga0495602_0067881 | |||
| 2524 | Ga0495602_0105200 | |||
| 2525 | Ga0495602_0117322 | |||
| 2526 | Ga0495602_0173216 | |||
| 2527 | Ga0495602_0577871 | |||
| 2528 | Ga0495602_0821964 | |||
| 2529 | Ga0495602_0981989 | |||
| 2530 | Ga0495614_0031997 | |||
| 2531 | Ga0495614_0042494 | |||
| 2532 | Ga0495614_0456159 | |||
| 2533 | Ga0496100_0033775 | |||
| 2534 | Ga0496100_0058795 | |||
| 2535 | Ga0496100_0084221 | |||
| 2536 | Ga0496100_0086141 | |||
| 2537 | Ga0496100_0101274 | |||
| 2538 | Ga0496100_0558882 | |||
| 2539 | Ga0496100_1515707 | |||
| 2540 | Ga0496101_0010515 | |||
| 2541 | Ga0496101_0027631 | |||
| 2542 | Ga0496101_0041890 | |||
| 2543 | Ga0496101_0198885 | |||
| 2544 | Ga0496101_0364455 | |||
| 2545 | Ga0496101_0409599 | |||
| 2546 | Ga0496102_0001709 | |||
| 2547 | Ga0496102_0049125 | |||
| 2548 | Ga0496102_0123388 | |||
| 2549 | Ga0496102_0150901 | |||
| 2550 | Ga0496102_0196971 | |||
| 2551 | Ga0496102_1362506 | |||
| 2552 | Ga0496103_0006377 | |||
| 2553 | Ga0496103_0009833 | |||
| 2554 | Ga0496103_0318981 | |||
| 2555 | Ga0496103_0604147 | |||
| 2556 | Ga0496103_0624531 | |||
| 2557 | Ga0496104_0010202 | |||
| 2558 | Ga0496104_0012042 | |||
| 2559 | Ga0496104_0012279 | |||
| 2560 | Ga0496104_0027708 | |||
| 2561 | Ga0496104_0329420 | |||
| 2562 | Ga0496104_0365438 | |||
| 2563 | Ga0496104_0429671 | |||
| 2564 | Ga0496104_0807444 | |||
| 2565 | Ga0496105_0005454 | |||
| 2566 | Ga0496105_0017346 | |||
| 2567 | Ga0496105_0026468 | |||
| 2568 | Ga0496105_0056405 | |||
| 2569 | Ga0496105_0058263 | |||
| 2570 | Ga0496105_0123719 | |||
| 2571 | Ga0496105_0141307 | |||
| 2572 | Ga0496105_0268515 | |||
| 2573 | Ga0496105_1107705 | |||
| 2574 | Ga0496106_0065894 | |||
| 2575 | Ga0496106_0121079 | |||
| 2576 | Ga0496106_0401776 | |||
| 2577 | Ga0496106_0754193 | |||
| 2578 | Ga0496106_0871622 | |||
| 2579 | Ga0496107_0038511 | |||
| 2580 | Ga0496107_0041808 | |||
| 2581 | Ga0496107_0233542 | |||
| 2582 | Ga0496107_0283447 | |||
| 2583 | Ga0496107_1102015 | |||
| 2584 | Ga0496108_0009397 | |||
| 2585 | Ga0496108_0041711 | |||
| 2586 | Ga0496108_0068322 | |||
| 2587 | Ga0496108_0073925 | |||
| 2588 | Ga0496108_0098553 | |||
| 2589 | Ga0496108_0230010 | |||
| 2590 | Ga0496108_0309487 | |||
| 2591 | Ga0496108_0375598 | |||
| 2592 | Ga0496108_0433041 | |||
| 2593 | Ga0496108_0560982 | |||
| 2594 | Ga0496109_0001075 | |||
| 2595 | Ga0496109_0002814 | |||
| 2596 | Ga0496109_0007801 | |||
| 2597 | Ga0496109_0011278 | |||
| 2598 | Ga0496109_0091087 | |||
| 2599 | Ga0496109_0170707 | |||
| 2600 | Ga0496109_0183345 | |||
| 2601 | Ga0496109_0437075 | |||
| 2602 | Ga0496109_0488817 | |||
| 2603 | Ga0496109_1193862 | |||
| 2604 | Ga0496110_0012910 | |||
| 2605 | Ga0496110_0018730 | |||
| 2606 | Ga0496110_0036216 | |||
| 2607 | Ga0496110_0043883 | |||
| 2608 | Ga0496110_0068768 | |||
| 2609 | Ga0496110_0166535 | |||
| 2610 | Ga0496110_0236610 | |||
| 2611 | Ga0496110_0863904 | |||
| 2612 | Ga0496110_1676671 | |||
| 2613 | Ga0496111_0007856 | |||
| 2614 | Ga0496111_0011735 | |||
| 2615 | Ga0496111_0014759 | |||
| 2616 | Ga0496111_0023850 | |||
| 2617 | Ga0496111_0065521 | |||
| 2618 | Ga0496111_0071782 | |||
| 2619 | Ga0496111_0596687 | |||
| 2620 | Ga0496111_1255425 | |||
| 2621 | Ga0496112_0011217 | |||
| 2622 | Ga0496112_0018672 | |||
| 2623 | Ga0496112_0035238 | |||
| 2624 | Ga0496112_0088077 | |||
| 2625 | Ga0496112_0113856 | |||
| 2626 | Ga0496112_0260072 | |||
| 2627 | Ga0496112_0345739 | |||
| 2628 | Ga0496112_0349827 | |||
| 2629 | Ga0496112_0449769 | |||
| 2630 | Ga0496112_0637742 | |||
| 2631 | Ga0496112_0911543 | |||
| 2632 | Ga0496112_1073779 | |||
| 2633 | Ga0496112_1317524 | |||
| 2634 | Ga0496113_0005652 | |||
| 2635 | Ga0496113_0011318 | |||
| 2636 | Ga0496113_0116694 | |||
| 2637 | Ga0496113_0485175 | |||
| 2638 | Ga0496113_0648475 | |||
| 2639 | Ga0496113_1545790 | |||
| 2640 | Ga0496114_0001561 | |||
| 2641 | Ga0496114_0004217 | |||
| 2642 | Ga0496114_0042239 | |||
| 2643 | Ga0496114_0066953 | |||
| 2644 | Ga0496114_0158131 | |||
| 2645 | Ga0496114_0238755 | |||
| 2646 | Ga0496114_0256266 | |||
| 2647 | Ga0496114_0273571 | |||
| 2648 | Ga0496114_0287650 | |||
| 2649 | Ga0496114_0326825 | |||
| 2650 | Ga0496114_0330683 | |||
| 2651 | Ga0496114_0627832 | |||
| 2652 | Ga0496114_0666167 | |||
| 2653 | Ga0496114_1429214 | |||
| 2654 | Ga0496115_0001106 | |||
| 2655 | Ga0496115_0020246 | |||
| 2656 | Ga0496115_0042002 | |||
| 2657 | Ga0496115_0151942 | |||
| 2658 | Ga0496115_0174157 | |||
| 2659 | Ga0496115_0348946 | |||
| 2660 | Ga0496115_0498002 | |||
| 2661 | Ga0496115_0511593 | |||
| 2662 | Ga0496115_0932279 | |||
| 2663 | Ga0501041_0474456 | |||
| 2664 | Ga0501041_0890592 | |||
| 2665 | Ga0501042_0963345 | |||
| 2666 | Ga0501046_0241109 | |||
| 2667 | Ga0501046_0503999 | |||
| 2668 | Ga0501046_1005386 | |||
| 2669 | Ga0501047_0041213 | |||
| 2670 | Ga0501047_0187843 | |||
| 2671 | Ga0501047_0797180 | |||
| 2672 | Ga0501048_1373685 | |||
| 2673 | Ga0501067_0099106 | |||
| 2674 | Ga0501068_0900652 | |||
| 2675 | Ga0501069_0043351 | |||
| 2676 | Ga0501069_0064831 | |||
| 2677 | Ga0501069_0130208 | |||
| 2678 | Ga0501069_0272409 | |||
| 2679 | Ga0501070_0000493 | |||
| 2680 | Ga0501070_0030879 | |||
| 2681 | Ga0501070_0242495 | |||
| 2682 | Ga0501070_0334311 | |||
| 2683 | Ga0501070_0986933 | |||
| 2684 | Ga0501071_0881756 | |||
| 2685 | Ga0501072_0600904 | |||
| 2686 | Ga0501073_0289311 | |||
| 2687 | Ga0501073_0313788 | |||
| 2688 | Ga0501073_0403209 | |||
| 2689 | Ga0501074_0028063 | |||
| 2690 | Ga0501074_0377106 | |||
| 2691 | Ga0501074_0434909 | |||
| 2692 | Ga0501074_0866085 | |||
| 2693 | Ga0501076_0109739 | |||
| 2694 | Ga0501079_0204026 | |||
| 2695 | Ga0501079_0366112 | |||
| 2696 | Ga0501079_0509055 | |||
| 2697 | Ga0501080_0048512 | |||
| 2698 | Ga0501080_0099357 | |||
| 2699 | Ga0501080_1508116 | |||
| 2700 | Ga0501081_0252024 | |||
| 2701 | Ga0501081_0648860 | |||
| 2702 | Ga0501081_0690434 | |||
| 2703 | Ga0501081_0990700 | |||
| 2704 | Ga0501083_0136358 | |||
| 2705 | Ga0501035_0239093 | |||
| 2706 | Ga0501035_0334568 | |||
| 2707 | Ga0501044_0172306 | |||
| 2708 | Ga0501044_0894629 | |||
| 2709 | Ga0501045_0791718 | |||
| 2710 | nmdc:mga00v17_39102_c1 | |||
| 2711 | nmdc:mga0yw44_5318_c1 | |||
| 2712 | nmdc:mga0yw44_983_c1 | |||
| 2713 | nmdc:mga04h51_186253_c1 | |||
| 2714 | nmdc:mga05p37_1225624_c1 | |||
| 2715 | nmdc:mga09592_1108177_c1 | |||
| 2716 | nmdc:mga08y16_13909_c1 | |||
| 2717 | nmdc:mga08y16_1565433_c1 | |||
| 2718 | nmdc:mga0n895_442622_c1 | |||
| 2719 | nmdc:mga0n895_927009_c1 | |||
| 2720 | nmdc:mga08x19_188156_c1 | |||
| 2721 | nmdc:mga08x19_199705_c1 | |||
| 2722 | nmdc:mga0a205_305914_c1 | |||
| 2723 | nmdc:mga0a205_72082_c1 | |||
| 2724 | Ga0495601_0000328 | |||
| 2725 | Ga0495601_0020904 | |||
| 2726 | Ga0495601_0021737 | |||
| 2727 | Ga0495601_0059418 | |||
| 2728 | Ga0495601_0162552 | |||
| 2729 | Ga0495601_0226066 | |||
| 2730 | Ga0495601_0284219 | |||
| 2731 | Ga0495601_0690634 | |||
| 2732 | Ga0495601_0921657 | |||
| 2733 | Ga0495612_0059125 | |||
| 2734 | Ga0495612_0084176 | |||
| 2735 | Ga0495612_0091026 | |||
| 2736 | Ga0495612_0134008 | |||
| 2737 | Ga0495612_0134659 | |||
| 2738 | Ga0495655_0028715 | |||
| 2739 | Ga0495595_0004750 | |||
| 2740 | Ga0495595_0009591 | |||
| 2741 | Ga0495595_0025952 | |||
| 2742 | Ga0495595_0049002 | |||
| 2743 | Ga0495595_0050827 | |||
| 2744 | Ga0495595_0083823 | |||
| 2745 | Ga0495595_0234613 | |||
| 2746 | Ga0495595_0279983 | |||
| 2747 | Ga0495595_0526328 | |||
| 2748 | Ga0495595_0538058 | |||
| 2749 | Ga0495619_0000200 | |||
| 2750 | Ga0495619_0004867 | |||
| 2751 | Ga0495619_0005015 | |||
| 2752 | Ga0495619_0007341 | |||
| 2753 | Ga0495619_0031477 | |||
| 2754 | Ga0495619_0055511 | |||
| 2755 | Ga0495619_0069798 | |||
| 2756 | Ga0495619_0094194 | |||
| 2757 | Ga0495619_0141431 | |||
| 2758 | Ga0495619_0594405 | |||
| 2759 | Ga0495619_0660656 | |||
| 2760 | Ga0500566_0147173 | |||
| 2761 | Ga0501084_0461493 | |||
| 2762 | Ga0501084_0664575 | |||
| 2763 | Ga0501084_0902441 | |||
| 2764 | Ga0501082_0635668 | |||
| 2765 | Ga0501082_0649943 | |||
| 2766 | Ga0530510_0683139 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c1q-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.4552 | 4 | 78 |
| 2vma-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.4092 | 4 | 78 |
| 3c1q-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.3986 | 4 | 78 |
| 2vma-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.3704 | 4 | 78 |
| 7pwf-assembly1.cif.gz_R | cryo-em structure of small subunit of giardia lamblia ribosome at 2.9 a resolution | 0.3288 | 8 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A8DZA0_713_830_1.20.1390.10 | Mainly Alpha;Up-down Bundle;PWI domain;PWI domain | 0.4181 | 1 | 77 | 1.20.1390.10 |
| 4ulrv01 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Ribosomal protein S17 | 0.3937 | 8 | 78 | 1.10.60.20 |
| af_A8DZA0_713_830_1.20.1390.10 | Mainly Alpha;Up-down Bundle;PWI domain;PWI domain | 0.3697 | 1 | 77 | 1.20.1390.10 |
| 4ulrv01 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Ribosomal protein S17 | 0.3676 | 8 | 78 | 1.10.60.20 |
| 3pu3B02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.3125 | 14 | 79 | 1.20.58.1360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6KBK7-F1-model_v4 | AhpD family alkylhydroperoxidase | 0.5113 | 1 | 78 |
GO:0004601
|
| AF-A0A3D1TRQ3-F1-model_v4 | Alkylhydroperoxidase AhpD family core domain-containing protein | 0.5077 | 1 | 80 |
GO:0051920
|
| AF-A0A523DV58-F1-model_v4 | Uncharacterized protein | 0.5067 | 1 | 81 |
|
| AF-A0A1H5CS07-F1-model_v4 | Uncharacterized peroxidase-related enzyme | 0.5063 | 1 | 81 |
GO:0051920
|
| AF-A0A0Q9JUP4-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.504 | 1 | 80 |
|