F493515
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1381 | 425 | 2762 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10500571|Ga0114129_105005712 |
| Length | 169 |
| Sequence | VPELELSVNGETRLVDLPVGTSLAAVLRESLGLTGTKIACNEGHCGACTVQIDGVPTLSCITLAHRVRGEVTTIEGLRDHPLIDAFVRADAVQCGFCTPGQVVSAAALVAANPDPGLDEIRHRMAGNICRCGTYPRIEEAILYWRGWSAPRRRSKAASRTCGSSSRRIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 109 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 259 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 260 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 261 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 262 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 267 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 268 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 269 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 270 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 273 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 274 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 275 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 276 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 277 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 278 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 279 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 280 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 283 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 284 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 285 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 286 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 289 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 290 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 371 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 372 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 373 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 400 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 425 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.26 |
| Metatranscriptomes | 1.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 12.31 |
| Rhizosphere | 87.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10500571 | 3300009147 | Bacteria | 1587 |
| 2 | MBSR1b_contig_8196210 | 2162886012 | Bacteria | 803 |
| 3 | JGI24747J21853_1041921 | 3300001978 | Bacteria | 544 |
| 4 | JGI25406J46586_10034431 | 3300003203 | Bacteria | 1859 |
| 5 | JGI25406J46586_10065783 | 3300003203 | Bacteria | 1154 |
| 6 | JGI25407J50210_10005521 | 3300003373 | Bacteria | 3113 |
| 7 | JGI25405J52794_10060577 | 3300003911 | Bacteria | 818 |
| 8 | Ga0065715_10310659 | 3300005293 | Bacteria | 1021 |
| 9 | Ga0070658_10027533 | 3300005327 | Bacteria | 4560 |
| 10 | Ga0070658_10205359 | 3300005327 | Bacteria | 1663 |
| 11 | Ga0070683_100028738 | 3300005329 | Bacteria | 5028 |
| 12 | Ga0070683_100109334 | 3300005329 | Bacteria | 2607 |
| 13 | Ga0070683_100144217 | 3300005329 | Bacteria | 2256 |
| 14 | Ga0070690_100086906 | 3300005330 | Bacteria | 2053 |
| 15 | Ga0070690_100239565 | 3300005330 | Bacteria | 1279 |
| 16 | Ga0068869_100365020 | 3300005334 | Bacteria | 1180 |
| 17 | Ga0070666_10186662 | 3300005335 | Bacteria | 1456 |
| 18 | Ga0070680_100020146 | 3300005336 | Bacteria | 5291 |
| 19 | Ga0070680_100074652 | 3300005336 | Bacteria | 2790 |
| 20 | Ga0070680_100086829 | 3300005336 | Bacteria | 2586 |
| 21 | Ga0070680_100220356 | 3300005336 | Bacteria | 1601 |
| 22 | Ga0070680_100497855 | 3300005336 | Bacteria | 1042 |
| 23 | Ga0070680_101355810 | 3300005336 | Bacteria | 616 |
| 24 | Ga0070682_100011854 | 3300005337 | Bacteria | 4987 |
| 25 | Ga0070682_100129367 | 3300005337 | Bacteria | 1707 |
| 26 | Ga0070682_100158894 | 3300005337 | Bacteria | 1559 |
| 27 | Ga0070682_100680474 | 3300005337 | Bacteria | 822 |
| 28 | Ga0068868_100091207 | 3300005338 | Bacteria | 2455 |
| 29 | Ga0068868_100249289 | 3300005338 | Bacteria | 1494 |
| 30 | Ga0068868_100261899 | 3300005338 | Bacteria | 1458 |
| 31 | Ga0068868_100347627 | 3300005338 | Bacteria | 1269 |
| 32 | Ga0068868_100569146 | 3300005338 | Bacteria | 1001 |
| 33 | Ga0070660_100025497 | 3300005339 | Bacteria | 4394 |
| 34 | Ga0070660_100039151 | 3300005339 | Bacteria | 3602 |
| 35 | Ga0070660_100093127 | 3300005339 | Bacteria | 2379 |
| 36 | Ga0070660_100100614 | 3300005339 | Bacteria | 2290 |
| 37 | Ga0070660_100117138 | 3300005339 | Bacteria | 2124 |
| 38 | Ga0070660_100226515 | 3300005339 | Bacteria | 1520 |
| 39 | Ga0070660_100253017 | 3300005339 | Bacteria | 1437 |
| 40 | Ga0070660_100256025 | 3300005339 | Bacteria | 1428 |
| 41 | Ga0070660_101736008 | 3300005339 | Bacteria | 532 |
| 42 | Ga0070689_100220175 | 3300005340 | Bacteria | 1557 |
| 43 | Ga0070691_10083346 | 3300005341 | Bacteria | 1568 |
| 44 | Ga0070691_10094382 | 3300005341 | Bacteria | 1479 |
| 45 | Ga0070687_100323837 | 3300005343 | Bacteria | 986 |
| 46 | Ga0070687_100582966 | 3300005343 | Bacteria | 766 |
| 47 | Ga0070661_100018487 | 3300005344 | Bacteria | 4954 |
| 48 | Ga0070661_100044759 | 3300005344 | Bacteria | 3234 |
| 49 | Ga0070692_10006261 | 3300005345 | Bacteria | 5156 |
| 50 | Ga0070668_100021194 | 3300005347 | Bacteria | 4912 |
| 51 | Ga0070668_100108719 | 3300005347 | Bacteria | 2206 |
| 52 | Ga0070668_100472256 | 3300005347 | Bacteria | 1082 |
| 53 | Ga0070668_102079980 | 3300005347 | Bacteria | 524 |
| 54 | Ga0070671_100218615 | 3300005355 | Bacteria | 1616 |
| 55 | Ga0070671_100340718 | 3300005355 | Bacteria | 1279 |
| 56 | Ga0070671_100781158 | 3300005355 | Bacteria | 831 |
| 57 | Ga0070671_101519258 | 3300005355 | Bacteria | 593 |
| 58 | Ga0070674_100086170 | 3300005356 | Bacteria | 2255 |
| 59 | Ga0070674_100257276 | 3300005356 | Bacteria | 1374 |
| 60 | Ga0070674_100790452 | 3300005356 | Bacteria | 819 |
| 61 | Ga0070673_100265748 | 3300005364 | Bacteria | 1500 |
| 62 | Ga0070673_100434473 | 3300005364 | Bacteria | 1179 |
| 63 | Ga0070659_100016721 | 3300005366 | Bacteria | 5511 |
| 64 | Ga0070659_100094269 | 3300005366 | Bacteria | 2403 |
| 65 | Ga0070659_100158398 | 3300005366 | Bacteria | 1850 |
| 66 | Ga0070667_100472056 | 3300005367 | Bacteria | 1148 |
| 67 | Ga0070703_10046689 | 3300005406 | Bacteria | 1370 |
| 68 | Ga0070703_10047299 | 3300005406 | Bacteria | 1362 |
| 69 | Ga0070703_10079077 | 3300005406 | Bacteria | 1116 |
| 70 | Ga0070709_10006587 | 3300005434 | Bacteria | 6335 |
| 71 | Ga0070709_10034201 | 3300005434 | Bacteria | 3080 |
| 72 | Ga0070709_10099171 | 3300005434 | Bacteria | 1937 |
| 73 | Ga0070709_10103968 | 3300005434 | Bacteria | 1897 |
| 74 | Ga0070709_10732047 | 3300005434 | Bacteria | 772 |
| 75 | Ga0070709_10838728 | 3300005434 | Bacteria | 723 |
| 76 | Ga0070714_100005237 | 3300005435 | Bacteria | 9879 |
| 77 | Ga0070714_100050235 | 3300005435 | Bacteria | 3551 |
| 78 | Ga0070714_100051953 | 3300005435 | Bacteria | 3495 |
| 79 | Ga0070714_100185886 | 3300005435 | Bacteria | 1893 |
| 80 | Ga0070714_100297562 | 3300005435 | Bacteria | 1503 |
| 81 | Ga0070714_101457132 | 3300005435 | Bacteria | 669 |
| 82 | Ga0070713_100056532 | 3300005436 | Bacteria | 3264 |
| 83 | Ga0070713_100083666 | 3300005436 | Bacteria | 2728 |
| 84 | Ga0070713_100096128 | 3300005436 | Bacteria | 2557 |
| 85 | Ga0070713_100144011 | 3300005436 | Bacteria | 2113 |
| 86 | Ga0070713_100302409 | 3300005436 | Bacteria | 1473 |
| 87 | Ga0070713_100524200 | 3300005436 | Bacteria | 1120 |
| 88 | Ga0070713_101336096 | 3300005436 | Bacteria | 695 |
| 89 | Ga0070713_101726315 | 3300005436 | Bacteria | 608 |
| 90 | Ga0070710_10003032 | 3300005437 | Bacteria | 7987 |
| 91 | Ga0070710_10009506 | 3300005437 | Bacteria | 4757 |
| 92 | Ga0070710_10014447 | 3300005437 | Bacteria | 3977 |
| 93 | Ga0070710_10416883 | 3300005437 | Bacteria | 903 |
| 94 | Ga0070710_10441531 | 3300005437 | Bacteria | 880 |
| 95 | Ga0070701_10275443 | 3300005438 | Bacteria | 1025 |
| 96 | Ga0070711_100019866 | 3300005439 | Bacteria | 4319 |
| 97 | Ga0070711_100044424 | 3300005439 | Bacteria | 3016 |
| 98 | Ga0070711_100089644 | 3300005439 | Bacteria | 2213 |
| 99 | Ga0070711_100165900 | 3300005439 | Bacteria | 1679 |
| 100 | Ga0070711_100426520 | 3300005439 | Bacteria | 1081 |
| 101 | Ga0070705_100011065 | 3300005440 | Bacteria | 4538 |
| 102 | Ga0070705_100031123 | 3300005440 | Bacteria | 2952 |
| 103 | Ga0070705_100079973 | 3300005440 | Bacteria | 2004 |
| 104 | Ga0070705_100090805 | 3300005440 | Bacteria | 1902 |
| 105 | Ga0070705_100221861 | 3300005440 | Bacteria | 1309 |
| 106 | Ga0070705_100253019 | 3300005440 | Bacteria | 1238 |
| 107 | Ga0070705_100354773 | 3300005440 | Bacteria | 1070 |
| 108 | Ga0070700_100064267 | 3300005441 | Bacteria | 2324 |
| 109 | Ga0070700_100177475 | 3300005441 | Bacteria | 1480 |
| 110 | Ga0070700_100190919 | 3300005441 | Bacteria | 1432 |
| 111 | Ga0070694_100074046 | 3300005444 | Bacteria | 2353 |
| 112 | Ga0070694_100076455 | 3300005444 | Bacteria | 2318 |
| 113 | Ga0070694_100268088 | 3300005444 | Bacteria | 1297 |
| 114 | Ga0070708_100012205 | 3300005445 | Bacteria | 7007 |
| 115 | Ga0070708_100066279 | 3300005445 | Bacteria | 3241 |
| 116 | Ga0070708_100157978 | 3300005445 | Bacteria | 2112 |
| 117 | Ga0070708_100227388 | 3300005445 | Bacteria | 1750 |
| 118 | Ga0070663_100084260 | 3300005455 | Bacteria | 2343 |
| 119 | Ga0070663_100747910 | 3300005455 | Bacteria | 834 |
| 120 | Ga0070678_100116096 | 3300005456 | Bacteria | 2103 |
| 121 | Ga0070678_100240151 | 3300005456 | Bacteria | 1514 |
| 122 | Ga0070678_100685467 | 3300005456 | Bacteria | 922 |
| 123 | Ga0070662_100197225 | 3300005457 | Bacteria | 1595 |
| 124 | Ga0070662_100585723 | 3300005457 | Bacteria | 937 |
| 125 | Ga0070681_10004219 | 3300005458 | Bacteria | 13620 |
| 126 | Ga0070681_10014911 | 3300005458 | Bacteria | 7728 |
| 127 | Ga0070681_10055054 | 3300005458 | Bacteria | 3963 |
| 128 | Ga0070681_10120630 | 3300005458 | Bacteria | 2557 |
| 129 | Ga0070681_10176439 | 3300005458 | Bacteria | 2059 |
| 130 | Ga0070681_10178446 | 3300005458 | Bacteria | 2046 |
| 131 | Ga0070681_10399397 | 3300005458 | Bacteria | 1286 |
| 132 | Ga0068867_100312247 | 3300005459 | Bacteria | 1299 |
| 133 | Ga0068867_102071842 | 3300005459 | Bacteria | 539 |
| 134 | Ga0070685_10944697 | 3300005466 | Bacteria | 644 |
| 135 | Ga0070706_100036001 | 3300005467 | Bacteria | 4571 |
| 136 | Ga0070706_100098069 | 3300005467 | Bacteria | 2723 |
| 137 | Ga0070706_100135165 | 3300005467 | Bacteria | 2302 |
| 138 | Ga0070706_100141141 | 3300005467 | Bacteria | 2249 |
| 139 | Ga0070706_100346508 | 3300005467 | Bacteria | 1385 |
| 140 | Ga0070706_100538667 | 3300005467 | Bacteria | 1086 |
| 141 | Ga0070706_100962745 | 3300005467 | Bacteria | 788 |
| 142 | Ga0070706_101283749 | 3300005467 | Bacteria | 672 |
| 143 | Ga0070707_100016804 | 3300005468 | Bacteria | 6871 |
| 144 | Ga0070707_100053981 | 3300005468 | Bacteria | 3852 |
| 145 | Ga0070707_100101977 | 3300005468 | Bacteria | 2781 |
| 146 | Ga0070707_100149545 | 3300005468 | Bacteria | 2274 |
| 147 | Ga0070707_100396327 | 3300005468 | Bacteria | 1340 |
| 148 | Ga0070707_100545323 | 3300005468 | Bacteria | 1122 |
| 149 | Ga0070707_100596831 | 3300005468 | Bacteria | 1067 |
| 150 | Ga0070707_101196729 | 3300005468 | Bacteria | 726 |
| 151 | Ga0070698_100006283 | 3300005471 | Bacteria | 12909 |
| 152 | Ga0070698_100015109 | 3300005471 | Bacteria | 8163 |
| 153 | Ga0070698_100100817 | 3300005471 | Bacteria | 2860 |
| 154 | Ga0070698_100358243 | 3300005471 | Bacteria | 1390 |
| 155 | Ga0070698_100392000 | 3300005471 | Bacteria | 1322 |
| 156 | Ga0070698_100480331 | 3300005471 | Bacteria | 1180 |
| 157 | Ga0070699_100025094 | 3300005518 | Bacteria | 5139 |
| 158 | Ga0070699_100091440 | 3300005518 | Bacteria | 2660 |
| 159 | Ga0070699_100357421 | 3300005518 | Bacteria | 1316 |
| 160 | Ga0070699_100559168 | 3300005518 | Bacteria | 1042 |
| 161 | Ga0070699_100603372 | 3300005518 | Bacteria | 1001 |
| 162 | Ga0070699_100749852 | 3300005518 | Bacteria | 893 |
| 163 | Ga0070699_101085745 | 3300005518 | Bacteria | 734 |
| 164 | Ga0070679_100004023 | 3300005530 | Bacteria | 13548 |
| 165 | Ga0070679_100209144 | 3300005530 | Bacteria | 1915 |
| 166 | Ga0070679_100215699 | 3300005530 | Bacteria | 1881 |
| 167 | Ga0070679_100436496 | 3300005530 | Bacteria | 1254 |
| 168 | Ga0070679_100503592 | 3300005530 | Bacteria | 1155 |
| 169 | Ga0070679_100668294 | 3300005530 | Bacteria | 981 |
| 170 | Ga0070679_100735322 | 3300005530 | Bacteria | 929 |
| 171 | Ga0070679_102180851 | 3300005530 | Bacteria | 504 |
| 172 | Ga0070684_100002479 | 3300005535 | Bacteria | 13597 |
| 173 | Ga0070684_100040856 | 3300005535 | Bacteria | 3995 |
| 174 | Ga0070684_100076582 | 3300005535 | Bacteria | 2952 |
| 175 | Ga0070684_100237398 | 3300005535 | Bacteria | 1665 |
| 176 | Ga0070684_100247593 | 3300005535 | Bacteria | 1629 |
| 177 | Ga0070684_100508510 | 3300005535 | Bacteria | 1116 |
| 178 | Ga0070697_100035623 | 3300005536 | Bacteria | 4015 |
| 179 | Ga0070697_100151562 | 3300005536 | Bacteria | 1954 |
| 180 | Ga0070697_100921746 | 3300005536 | Bacteria | 775 |
| 181 | Ga0068853_100389633 | 3300005539 | Bacteria | 1302 |
| 182 | Ga0068853_102168421 | 3300005539 | Bacteria | 539 |
| 183 | Ga0070672_100906604 | 3300005543 | Bacteria | 779 |
| 184 | Ga0070686_100005989 | 3300005544 | Bacteria | 6746 |
| 185 | Ga0070686_100151468 | 3300005544 | Bacteria | 1625 |
| 186 | Ga0070695_100097687 | 3300005545 | Bacteria | 1972 |
| 187 | Ga0070695_100439746 | 3300005545 | Bacteria | 997 |
| 188 | Ga0070695_101142318 | 3300005545 | Bacteria | 639 |
| 189 | Ga0070696_100023110 | 3300005546 | Bacteria | 4226 |
| 190 | Ga0070696_100033647 | 3300005546 | Bacteria | 3523 |
| 191 | Ga0070696_100195083 | 3300005546 | Bacteria | 1509 |
| 192 | Ga0070696_101237586 | 3300005546 | Bacteria | 632 |
| 193 | Ga0070693_100008935 | 3300005547 | Bacteria | 4969 |
| 194 | Ga0070693_100018392 | 3300005547 | Bacteria | 3649 |
| 195 | Ga0070693_100164666 | 3300005547 | Bacteria | 1415 |
| 196 | Ga0070665_100020268 | 3300005548 | Bacteria | 6676 |
| 197 | Ga0070665_100540819 | 3300005548 | Bacteria | 1177 |
| 198 | Ga0070704_100019791 | 3300005549 | Bacteria | 4330 |
| 199 | Ga0070704_100033533 | 3300005549 | Bacteria | 3472 |
| 200 | Ga0070704_100133967 | 3300005549 | Bacteria | 1925 |
| 201 | Ga0070704_100162677 | 3300005549 | Bacteria | 1766 |
| 202 | Ga0070704_100279449 | 3300005549 | Bacteria | 1382 |
| 203 | Ga0068855_100028306 | 3300005563 | Bacteria | 6703 |
| 204 | Ga0068855_100062747 | 3300005563 | Bacteria | 4338 |
| 205 | Ga0068855_100143718 | 3300005563 | Bacteria | 2717 |
| 206 | Ga0068855_100179058 | 3300005563 | Bacteria | 2398 |
| 207 | Ga0068855_100209484 | 3300005563 | Bacteria | 2191 |
| 208 | Ga0068855_100344866 | 3300005563 | Bacteria | 1641 |
| 209 | Ga0068855_100379454 | 3300005563 | Bacteria | 1552 |
| 210 | Ga0068855_101537228 | 3300005563 | Bacteria | 682 |
| 211 | Ga0070664_100816125 | 3300005564 | Bacteria | 873 |
| 212 | Ga0068857_100051525 | 3300005577 | Bacteria | 3652 |
| 213 | Ga0068857_100129177 | 3300005577 | Bacteria | 2278 |
| 214 | Ga0068857_100448074 | 3300005577 | Bacteria | 1206 |
| 215 | Ga0068854_100119899 | 3300005578 | Bacteria | 1995 |
| 216 | Ga0068856_100017118 | 3300005614 | Bacteria | 7027 |
| 217 | Ga0068856_100048316 | 3300005614 | Bacteria | 4192 |
| 218 | Ga0068856_100061541 | 3300005614 | Bacteria | 3708 |
| 219 | Ga0068856_100121826 | 3300005614 | Bacteria | 2610 |
| 220 | Ga0068856_100122137 | 3300005614 | Bacteria | 2606 |
| 221 | Ga0068856_100572685 | 3300005614 | Bacteria | 1150 |
| 222 | Ga0068856_100882186 | 3300005614 | Bacteria | 913 |
| 223 | Ga0068856_100890480 | 3300005614 | Bacteria | 909 |
| 224 | Ga0070702_100005135 | 3300005615 | Bacteria | 6060 |
| 225 | Ga0070702_100019094 | 3300005615 | Bacteria | 3568 |
| 226 | Ga0070702_100698750 | 3300005615 | Bacteria | 773 |
| 227 | Ga0070702_100773839 | 3300005615 | Bacteria | 740 |
| 228 | Ga0070702_101682956 | 3300005615 | Bacteria | 527 |
| 229 | Ga0068852_100032780 | 3300005616 | Bacteria | 4305 |
| 230 | Ga0068852_100566556 | 3300005616 | Bacteria | 1137 |
| 231 | Ga0068852_102115805 | 3300005616 | Bacteria | 584 |
| 232 | Ga0068859_100287283 | 3300005617 | Bacteria | 1738 |
| 233 | Ga0068864_100112808 | 3300005618 | Bacteria | 2423 |
| 234 | Ga0068866_10472078 | 3300005718 | Bacteria | 825 |
| 235 | Ga0068861_100078913 | 3300005719 | Bacteria | 2572 |
| 236 | Ga0068861_100213411 | 3300005719 | Bacteria | 1627 |
| 237 | Ga0068861_100280481 | 3300005719 | Bacteria | 1435 |
| 238 | Ga0068861_100499391 | 3300005719 | Bacteria | 1099 |
| 239 | Ga0068851_10403203 | 3300005834 | Bacteria | 805 |
| 240 | Ga0068870_10211784 | 3300005840 | Bacteria | 1181 |
| 241 | Ga0068863_100708604 | 3300005841 | Bacteria | 1001 |
| 242 | Ga0068858_100352251 | 3300005842 | Bacteria | 1410 |
| 243 | Ga0068860_100062023 | 3300005843 | Bacteria | 3552 |
| 244 | Ga0068860_100909699 | 3300005843 | Bacteria | 896 |
| 245 | Ga0081455_10002297 | 3300005937 | Bacteria | 22779 |
| 246 | Ga0081455_10006733 | 3300005937 | Bacteria | 12270 |
| 247 | Ga0081455_10020921 | 3300005937 | Bacteria | 6148 |
| 248 | Ga0081455_10196193 | 3300005937 | Bacteria | 1516 |
| 249 | Ga0081455_10239902 | 3300005937 | Bacteria | 1333 |
| 250 | Ga0081538_10000846 | 3300005981 | Bacteria | 33031 |
| 251 | Ga0081538_10040639 | 3300005981 | Bacteria | 2963 |
| 252 | Ga0081538_10189688 | 3300005981 | Bacteria | 865 |
| 253 | Ga0081538_10211161 | 3300005981 | Bacteria | 782 |
| 254 | Ga0081540_1017827 | 3300005983 | Bacteria | 4380 |
| 255 | Ga0081539_10000507 | 3300005985 | Bacteria | 80978 |
| 256 | Ga0081539_10001238 | 3300005985 | Bacteria | 45456 |
| 257 | Ga0081539_10023804 | 3300005985 | Bacteria | 3997 |
| 258 | Ga0070717_10108601 | 3300006028 | Bacteria | 2364 |
| 259 | Ga0070717_10125075 | 3300006028 | Bacteria | 2207 |
| 260 | Ga0070717_10290831 | 3300006028 | Bacteria | 1451 |
| 261 | Ga0070717_10305486 | 3300006028 | Bacteria | 1415 |
| 262 | Ga0070717_10741650 | 3300006028 | Bacteria | 893 |
| 263 | Ga0075432_10142104 | 3300006058 | Bacteria | 917 |
| 264 | Ga0070715_10221757 | 3300006163 | Bacteria | 972 |
| 265 | Ga0070716_100026479 | 3300006173 | Bacteria | 3106 |
| 266 | Ga0070716_100267057 | 3300006173 | Bacteria | 1174 |
| 267 | Ga0070716_100635326 | 3300006173 | Bacteria | 807 |
| 268 | Ga0070716_101096848 | 3300006173 | Bacteria | 635 |
| 269 | Ga0070716_101427467 | 3300006173 | Bacteria | 563 |
| 270 | Ga0070712_100003082 | 3300006175 | Bacteria | 10296 |
| 271 | Ga0070712_100004222 | 3300006175 | Bacteria | 8840 |
| 272 | Ga0070712_100082246 | 3300006175 | Bacteria | 2335 |
| 273 | Ga0070712_100108115 | 3300006175 | Bacteria | 2070 |
| 274 | Ga0070712_100294245 | 3300006175 | Bacteria | 1312 |
| 275 | Ga0070712_100846649 | 3300006175 | Bacteria | 786 |
| 276 | Ga0075367_10699339 | 3300006178 | Bacteria | 645 |
| 277 | Ga0097621_100010449 | 3300006237 | Bacteria | 6798 |
| 278 | Ga0097621_100582823 | 3300006237 | Bacteria | 1021 |
| 279 | Ga0097621_102240153 | 3300006237 | Bacteria | 523 |
| 280 | Ga0068871_100006687 | 3300006358 | Bacteria | 8181 |
| 281 | Ga0068871_100401595 | 3300006358 | Bacteria | 1220 |
| 282 | Ga0075428_100104128 | 3300006844 | Bacteria | 3094 |
| 283 | Ga0075431_100225761 | 3300006847 | Bacteria | 1909 |
| 284 | Ga0075431_100524280 | 3300006847 | Bacteria | 1174 |
| 285 | Ga0075433_10004067 | 3300006852 | Bacteria | 11331 |
| 286 | Ga0075433_10007343 | 3300006852 | Bacteria | 8745 |
| 287 | Ga0075433_10059100 | 3300006852 | Bacteria | 3354 |
| 288 | Ga0075433_10060441 | 3300006852 | Bacteria | 3318 |
| 289 | Ga0075433_10181655 | 3300006852 | Bacteria | 1872 |
| 290 | Ga0075433_10191098 | 3300006852 | Bacteria | 1821 |
| 291 | Ga0075433_10282451 | 3300006852 | Bacteria | 1470 |
| 292 | Ga0075433_10306240 | 3300006852 | Bacteria | 1406 |
| 293 | Ga0075433_10775967 | 3300006852 | Bacteria | 838 |
| 294 | Ga0075434_100003308 | 3300006871 | Bacteria | 14404 |
| 295 | Ga0075434_100003953 | 3300006871 | Bacteria | 13273 |
| 296 | Ga0075434_100014330 | 3300006871 | Bacteria | 7578 |
| 297 | Ga0075434_100195352 | 3300006871 | Bacteria | 2043 |
| 298 | Ga0075434_100313256 | 3300006871 | Bacteria | 1590 |
| 299 | Ga0075434_100370592 | 3300006871 | Bacteria | 1453 |
| 300 | Ga0075434_100523235 | 3300006871 | Bacteria | 1206 |
| 301 | Ga0068865_100418738 | 3300006881 | Bacteria | 1101 |
| 302 | Ga0075436_100008952 | 3300006914 | Bacteria | 6852 |
| 303 | Ga0075436_100363470 | 3300006914 | Bacteria | 1044 |
| 304 | Ga0075436_101412613 | 3300006914 | Bacteria | 528 |
| 305 | Ga0097620_100287270 | 3300006931 | Bacteria | 1738 |
| 306 | Ga0075435_100000846 | 3300007076 | Bacteria | 19132 |
| 307 | Ga0075435_100221037 | 3300007076 | Bacteria | 1608 |
| 308 | Ga0075435_100245784 | 3300007076 | Bacteria | 1522 |
| 309 | Ga0075435_100299354 | 3300007076 | Bacteria | 1375 |
| 310 | Ga0105240_10008131 | 3300009093 | Bacteria | 15049 |
| 311 | Ga0105240_10040896 | 3300009093 | Bacteria | 5923 |
| 312 | Ga0105240_10220310 | 3300009093 | Bacteria | 2211 |
| 313 | Ga0111539_10261522 | 3300009094 | Bacteria | 2014 |
| 314 | Ga0111539_10354267 | 3300009094 | Bacteria | 1708 |
| 315 | Ga0111539_10579765 | 3300009094 | Bacteria | 1306 |
| 316 | Ga0111539_10643560 | 3300009094 | Bacteria | 1234 |
| 317 | Ga0111539_11173029 | 3300009094 | Bacteria | 892 |
| 318 | Ga0111539_11179011 | 3300009094 | Bacteria | 890 |
| 319 | Ga0111539_11587858 | 3300009094 | Bacteria | 759 |
| 320 | Ga0105245_10006942 | 3300009098 | Bacteria | 9925 |
| 321 | Ga0105245_10078256 | 3300009098 | Bacteria | 3017 |
| 322 | Ga0105245_10170357 | 3300009098 | Bacteria | 2073 |
| 323 | Ga0105245_11129314 | 3300009098 | Bacteria | 830 |
| 324 | Ga0105245_11378914 | 3300009098 | Bacteria | 755 |
| 325 | Ga0114129_10027574 | 3300009147 | Bacteria | 8042 |
| 326 | Ga0114129_10032758 | 3300009147 | Bacteria | 7344 |
| 327 | Ga0114129_10120193 | 3300009147 | Bacteria | 3618 |
| 328 | Ga0114129_10256855 | 3300009147 | Bacteria | 2344 |
| 329 | Ga0114129_10416036 | 3300009147 | Bacteria | 1769 |
| 330 | Ga0114129_10567095 | 3300009147 | Bacteria | 1474 |
| 331 | Ga0114129_10700201 | 3300009147 | Bacteria | 1302 |
| 332 | Ga0114129_11042303 | 3300009147 | Bacteria | 1027 |
| 333 | Ga0114129_11265653 | 3300009147 | Bacteria | 916 |
| 334 | Ga0114129_12039917 | 3300009147 | Bacteria | 693 |
| 335 | Ga0105243_10058011 | 3300009148 | Bacteria | 3084 |
| 336 | Ga0105243_10114589 | 3300009148 | Bacteria | 2262 |
| 337 | Ga0105243_10275549 | 3300009148 | Bacteria | 1513 |
| 338 | Ga0105243_10320132 | 3300009148 | Bacteria | 1413 |
| 339 | Ga0105243_10725119 | 3300009148 | Bacteria | 972 |
| 340 | Ga0105243_10765506 | 3300009148 | Bacteria | 948 |
| 341 | Ga0105241_10260254 | 3300009174 | Bacteria | 1474 |
| 342 | Ga0105241_10446374 | 3300009174 | Bacteria | 1143 |
| 343 | Ga0105241_10492275 | 3300009174 | Bacteria | 1092 |
| 344 | Ga0105242_10060572 | 3300009176 | Bacteria | 3111 |
| 345 | Ga0105242_10087070 | 3300009176 | Bacteria | 2622 |
| 346 | Ga0105242_10093210 | 3300009176 | Bacteria | 2539 |
| 347 | Ga0105242_10934042 | 3300009176 | Bacteria | 870 |
| 348 | Ga0105242_11697412 | 3300009176 | Bacteria | 668 |
| 349 | Ga0105242_12621083 | 3300009176 | Bacteria | 553 |
| 350 | Ga0105248_10267142 | 3300009177 | Bacteria | 1926 |
| 351 | Ga0105248_10274145 | 3300009177 | Bacteria | 1899 |
| 352 | Ga0105237_10068736 | 3300009545 | Bacteria | 3536 |
| 353 | Ga0105237_10115595 | 3300009545 | Bacteria | 2676 |
| 354 | Ga0105238_10207977 | 3300009551 | Bacteria | 1933 |
| 355 | Ga0105238_11076443 | 3300009551 | Bacteria | 826 |
| 356 | Ga0105238_12190442 | 3300009551 | Bacteria | 587 |
| 357 | Ga0105249_10027922 | 3300009553 | Bacteria | 5094 |
| 358 | Ga0105249_10068878 | 3300009553 | Bacteria | 3264 |
| 359 | Ga0105249_10256367 | 3300009553 | Bacteria | 1736 |
| 360 | Ga0105249_12688714 | 3300009553 | Bacteria | 570 |
| 361 | Ga0105239_10072622 | 3300010375 | Bacteria | 3783 |
| 362 | Ga0105239_10077471 | 3300010375 | Bacteria | 3658 |
| 363 | Ga0105239_10126638 | 3300010375 | Bacteria | 2839 |
| 364 | Ga0105239_10544536 | 3300010375 | Bacteria | 1321 |
| 365 | Ga0105239_12731735 | 3300010375 | Bacteria | 576 |
| 366 | Ga0105246_10571538 | 3300011119 | Bacteria | 972 |
| 367 | Ga0157320_1002867 | 3300012481 | Bacteria | 1007 |
| 368 | Ga0157342_1001558 | 3300012507 | Bacteria | 1728 |
| 369 | Ga0157316_1001790 | 3300012510 | Bacteria | 1387 |
| 370 | Ga0157373_10094937 | 3300013100 | Bacteria | 2099 |
| 371 | Ga0157373_10357910 | 3300013100 | Bacteria | 1042 |
| 372 | Ga0157373_10411231 | 3300013100 | Bacteria | 970 |
| 373 | Ga0157371_10042431 | 3300013102 | Bacteria | 3242 |
| 374 | Ga0157371_10698948 | 3300013102 | Bacteria | 759 |
| 375 | Ga0157371_11524391 | 3300013102 | Bacteria | 522 |
| 376 | Ga0157370_10096349 | 3300013104 | Bacteria | 2776 |
| 377 | Ga0157370_10201675 | 3300013104 | Bacteria | 1845 |
| 378 | Ga0157370_11137686 | 3300013104 | Bacteria | 705 |
| 379 | Ga0157369_10003497 | 3300013105 | Bacteria | 18655 |
| 380 | Ga0157369_10037478 | 3300013105 | Bacteria | 5308 |
| 381 | Ga0157369_10647115 | 3300013105 | Bacteria | 1090 |
| 382 | Ga0157369_11191326 | 3300013105 | Bacteria | 777 |
| 383 | Ga0157369_11241977 | 3300013105 | Bacteria | 760 |
| 384 | Ga0157369_11392307 | 3300013105 | Bacteria | 714 |
| 385 | Ga0157374_10162879 | 3300013296 | Bacteria | 2173 |
| 386 | Ga0157374_10171528 | 3300013296 | Bacteria | 2116 |
| 387 | Ga0157374_10945873 | 3300013296 | Bacteria | 880 |
| 388 | Ga0157374_10961585 | 3300013296 | Bacteria | 873 |
| 389 | Ga0157374_11247376 | 3300013296 | Bacteria | 765 |
| 390 | Ga0157378_10195953 | 3300013297 | Bacteria | 1908 |
| 391 | Ga0157378_10196888 | 3300013297 | Bacteria | 1904 |
| 392 | Ga0157378_10405741 | 3300013297 | Bacteria | 1344 |
| 393 | Ga0157378_10561688 | 3300013297 | Bacteria | 1148 |
| 394 | Ga0157378_12777974 | 3300013297 | Bacteria | 542 |
| 395 | Ga0163162_10103595 | 3300013306 | Bacteria | 2940 |
| 396 | Ga0163162_10126250 | 3300013306 | Bacteria | 2665 |
| 397 | Ga0163162_10176454 | 3300013306 | Bacteria | 2262 |
| 398 | Ga0163162_10226819 | 3300013306 | Bacteria | 1998 |
| 399 | Ga0157372_10081506 | 3300013307 | Bacteria | 3663 |
| 400 | Ga0157372_10197317 | 3300013307 | Bacteria | 2331 |
| 401 | Ga0157372_10257024 | 3300013307 | Bacteria | 2028 |
| 402 | Ga0157372_10298690 | 3300013307 | Bacteria | 1873 |
| 403 | Ga0157372_10527467 | 3300013307 | Bacteria | 1376 |
| 404 | Ga0157372_11229399 | 3300013307 | Bacteria | 865 |
| 405 | Ga0157372_13121880 | 3300013307 | Bacteria | 529 |
| 406 | Ga0157375_10007650 | 3300013308 | Bacteria | 9451 |
| 407 | Ga0157375_10012741 | 3300013308 | Bacteria | 7464 |
| 408 | Ga0157375_10142205 | 3300013308 | Bacteria | 2527 |
| 409 | Ga0157375_13095999 | 3300013308 | Bacteria | 555 |
| 410 | Ga0163163_10147449 | 3300014325 | Bacteria | 2397 |
| 411 | Ga0163163_11265458 | 3300014325 | Bacteria | 800 |
| 412 | Ga0157380_10019505 | 3300014326 | Bacteria | 5053 |
| 413 | Ga0157380_10264081 | 3300014326 | Bacteria | 1565 |
| 414 | Ga0182008_10018808 | 3300014497 | Bacteria | 3574 |
| 415 | Ga0182008_10207442 | 3300014497 | Bacteria | 999 |
| 416 | Ga0182008_10266511 | 3300014497 | Bacteria | 887 |
| 417 | Ga0182008_10336185 | 3300014497 | Bacteria | 798 |
| 418 | Ga0157379_10440067 | 3300014968 | Bacteria | 1202 |
| 419 | Ga0157376_12230508 | 3300014969 | Bacteria | 586 |
| 420 | Ga0182007_10313482 | 3300015262 | Bacteria | 579 |
| 421 | Ga0163161_10026579 | 3300017792 | Bacteria | 4099 |
| 422 | Ga0163161_10213108 | 3300017792 | Bacteria | 1493 |
| 423 | Ga0197907_10265393 | 3300020069 | Bacteria | 1779 |
| 424 | Ga0197907_10641453 | 3300020069 | Bacteria | 2010 |
| 425 | Ga0197907_11423151 | 3300020069 | Bacteria | 2611 |
| 426 | Ga0197907_11452201 | 3300020069 | Bacteria | 2320 |
| 427 | Ga0206356_10272360 | 3300020070 | Bacteria | 3160 |
| 428 | Ga0206356_11221232 | 3300020070 | Bacteria | 917 |
| 429 | Ga0206356_11425914 | 3300020070 | Bacteria | 2612 |
| 430 | Ga0206356_11591861 | 3300020070 | Bacteria | 2062 |
| 431 | Ga0206349_1943878 | 3300020075 | Bacteria | 1145 |
| 432 | Ga0206352_11058662 | 3300020078 | Bacteria | 804 |
| 433 | Ga0206350_10260564 | 3300020080 | Bacteria | 690 |
| 434 | Ga0206350_10959082 | 3300020080 | Bacteria | 1085 |
| 435 | Ga0206350_11129946 | 3300020080 | Bacteria | 2329 |
| 436 | Ga0206354_10603899 | 3300020081 | Bacteria | 559 |
| 437 | Ga0206354_10699304 | 3300020081 | Bacteria | 685 |
| 438 | Ga0206354_11144221 | 3300020081 | Bacteria | 739 |
| 439 | Ga0206353_10052694 | 3300020082 | Bacteria | 905 |
| 440 | Ga0206353_10339933 | 3300020082 | Bacteria | 3473 |
| 441 | Ga0206353_10521650 | 3300020082 | Bacteria | 1431 |
| 442 | Ga0224712_10025166 | 3300022467 | Bacteria | 2089 |
| 443 | Ga0224712_10060436 | 3300022467 | Bacteria | 1508 |
| 444 | Ga0224712_10216120 | 3300022467 | Bacteria | 876 |
| 445 | Ga0224712_10300791 | 3300022467 | Bacteria | 750 |
| 446 | Ga0207653_10090446 | 3300025885 | Bacteria | 1071 |
| 447 | Ga0207692_10016063 | 3300025898 | Bacteria | 3305 |
| 448 | Ga0207692_10034019 | 3300025898 | Bacteria | 2464 |
| 449 | Ga0207692_10120747 | 3300025898 | Bacteria | 1467 |
| 450 | Ga0207692_10358469 | 3300025898 | Bacteria | 901 |
| 451 | Ga0207642_10368867 | 3300025899 | Bacteria | 851 |
| 452 | Ga0207688_10026467 | 3300025901 | Bacteria | 3189 |
| 453 | Ga0207688_10032388 | 3300025901 | Bacteria | 2889 |
| 454 | Ga0207688_10093523 | 3300025901 | Bacteria | 1729 |
| 455 | Ga0207680_10638132 | 3300025903 | Bacteria | 762 |
| 456 | Ga0207647_10339269 | 3300025904 | Bacteria | 852 |
| 457 | Ga0207685_10144143 | 3300025905 | Bacteria | 1071 |
| 458 | Ga0207685_10276141 | 3300025905 | Bacteria | 823 |
| 459 | Ga0207699_10020008 | 3300025906 | Bacteria | 3580 |
| 460 | Ga0207699_10078590 | 3300025906 | Bacteria | 2038 |
| 461 | Ga0207699_10103036 | 3300025906 | Bacteria | 1815 |
| 462 | Ga0207699_10691621 | 3300025906 | Bacteria | 746 |
| 463 | Ga0207699_10829343 | 3300025906 | Bacteria | 680 |
| 464 | Ga0207645_10402493 | 3300025907 | Bacteria | 921 |
| 465 | Ga0207643_10189172 | 3300025908 | Bacteria | 1249 |
| 466 | Ga0207705_10010732 | 3300025909 | Bacteria | 6650 |
| 467 | Ga0207684_10061997 | 3300025910 | Bacteria | 3175 |
| 468 | Ga0207684_10076503 | 3300025910 | Bacteria | 2845 |
| 469 | Ga0207684_10099479 | 3300025910 | Bacteria | 2484 |
| 470 | Ga0207684_10110240 | 3300025910 | Bacteria | 2356 |
| 471 | Ga0207684_10111501 | 3300025910 | Bacteria | 2341 |
| 472 | Ga0207684_10335794 | 3300025910 | Bacteria | 1301 |
| 473 | Ga0207684_10394306 | 3300025910 | Bacteria | 1190 |
| 474 | Ga0207684_11668302 | 3300025910 | Bacteria | 514 |
| 475 | Ga0207654_10366045 | 3300025911 | Bacteria | 996 |
| 476 | Ga0207654_10688857 | 3300025911 | Bacteria | 734 |
| 477 | Ga0207654_11034558 | 3300025911 | Bacteria | 598 |
| 478 | Ga0207707_10001354 | 3300025912 | Bacteria | 22790 |
| 479 | Ga0207707_10003861 | 3300025912 | Bacteria | 13289 |
| 480 | Ga0207707_10042069 | 3300025912 | Bacteria | 3989 |
| 481 | Ga0207707_10046668 | 3300025912 | Bacteria | 3773 |
| 482 | Ga0207707_10056887 | 3300025912 | Bacteria | 3404 |
| 483 | Ga0207707_10192233 | 3300025912 | Bacteria | 1780 |
| 484 | Ga0207707_10394929 | 3300025912 | Bacteria | 1188 |
| 485 | Ga0207707_10745913 | 3300025912 | Bacteria | 819 |
| 486 | Ga0207707_11258799 | 3300025912 | Unclassified | 596 |
| 487 | Ga0207695_10749663 | 3300025913 | Bacteria | 857 |
| 488 | Ga0207671_10070774 | 3300025914 | Bacteria | 2601 |
| 489 | Ga0207671_10098911 | 3300025914 | Bacteria | 2207 |
| 490 | Ga0207671_11397149 | 3300025914 | Bacteria | 543 |
| 491 | Ga0207693_10000904 | 3300025915 | Bacteria | 26637 |
| 492 | Ga0207693_10009282 | 3300025915 | Bacteria | 8027 |
| 493 | Ga0207693_10012860 | 3300025915 | Bacteria | 6754 |
| 494 | Ga0207693_10014992 | 3300025915 | Bacteria | 6222 |
| 495 | Ga0207693_10022102 | 3300025915 | Bacteria | 5059 |
| 496 | Ga0207693_10027012 | 3300025915 | Bacteria | 4540 |
| 497 | Ga0207693_10089272 | 3300025915 | Bacteria | 2415 |
| 498 | Ga0207693_10425544 | 3300025915 | Bacteria | 1038 |
| 499 | Ga0207693_10454954 | 3300025915 | Bacteria | 1000 |
| 500 | Ga0207693_11460057 | 3300025915 | Bacteria | 506 |
| 501 | Ga0207663_10017287 | 3300025916 | Bacteria | 4015 |
| 502 | Ga0207663_10074898 | 3300025916 | Unclassified | 2195 |
| 503 | Ga0207663_10101378 | 3300025916 | Bacteria | 1934 |
| 504 | Ga0207663_10129839 | 3300025916 | Bacteria | 1739 |
| 505 | Ga0207663_10214123 | 3300025916 | Bacteria | 1398 |
| 506 | Ga0207663_10426262 | 3300025916 | Bacteria | 1019 |
| 507 | Ga0207663_11218069 | 3300025916 | Bacteria | 606 |
| 508 | Ga0207660_10023024 | 3300025917 | Bacteria | 4204 |
| 509 | Ga0207660_10163050 | 3300025917 | Bacteria | 1721 |
| 510 | Ga0207660_10637111 | 3300025917 | Bacteria | 869 |
| 511 | Ga0207662_10071015 | 3300025918 | Bacteria | 2107 |
| 512 | Ga0207662_11074803 | 3300025918 | Bacteria | 572 |
| 513 | Ga0207657_10000184 | 3300025919 | Bacteria | 64813 |
| 514 | Ga0207657_10002804 | 3300025919 | Bacteria | 18753 |
| 515 | Ga0207657_10004538 | 3300025919 | Bacteria | 14672 |
| 516 | Ga0207657_10007538 | 3300025919 | Bacteria | 11153 |
| 517 | Ga0207657_10240309 | 3300025919 | Bacteria | 1446 |
| 518 | Ga0207657_10277082 | 3300025919 | Bacteria | 1332 |
| 519 | Ga0207657_10988657 | 3300025919 | Bacteria | 646 |
| 520 | Ga0207649_10008900 | 3300025920 | Bacteria | 5482 |
| 521 | Ga0207649_10597200 | 3300025920 | Bacteria | 849 |
| 522 | Ga0207649_11423614 | 3300025920 | Bacteria | 548 |
| 523 | Ga0207652_10011232 | 3300025921 | Bacteria | 7214 |
| 524 | Ga0207652_10023918 | 3300025921 | Bacteria | 5066 |
| 525 | Ga0207652_10289027 | 3300025921 | Bacteria | 1479 |
| 526 | Ga0207652_10506977 | 3300025921 | Bacteria | 1086 |
| 527 | Ga0207652_10676894 | 3300025921 | Bacteria | 922 |
| 528 | Ga0207646_10028151 | 3300025922 | Bacteria | 5117 |
| 529 | Ga0207646_10035768 | 3300025922 | Bacteria | 4484 |
| 530 | Ga0207646_10043340 | 3300025922 | Bacteria | 4042 |
| 531 | Ga0207646_10060856 | 3300025922 | Bacteria | 3371 |
| 532 | Ga0207646_10431051 | 3300025922 | Bacteria | 1190 |
| 533 | Ga0207646_10474276 | 3300025922 | Bacteria | 1128 |
| 534 | Ga0207646_10539484 | 3300025922 | Bacteria | 1049 |
| 535 | Ga0207646_11230540 | 3300025922 | Bacteria | 656 |
| 536 | Ga0207681_10583127 | 3300025923 | Bacteria | 923 |
| 537 | Ga0207694_10128958 | 3300025924 | Bacteria | 2026 |
| 538 | Ga0207694_10583786 | 3300025924 | Bacteria | 939 |
| 539 | Ga0207694_11609030 | 3300025924 | Bacteria | 547 |
| 540 | Ga0207687_10131213 | 3300025927 | Bacteria | 1889 |
| 541 | Ga0207687_10341865 | 3300025927 | Bacteria | 1217 |
| 542 | Ga0207687_10380828 | 3300025927 | Bacteria | 1156 |
| 543 | Ga0207700_10000021 | 3300025928 | Bacteria | 168335 |
| 544 | Ga0207700_10053729 | 3300025928 | Bacteria | 3020 |
| 545 | Ga0207700_10114392 | 3300025928 | Bacteria | 2177 |
| 546 | Ga0207700_10178373 | 3300025928 | Bacteria | 1777 |
| 547 | Ga0207700_10222043 | 3300025928 | Bacteria | 1602 |
| 548 | Ga0207700_10252626 | 3300025928 | Bacteria | 1507 |
| 549 | Ga0207700_10588705 | 3300025928 | Bacteria | 989 |
| 550 | Ga0207700_10645433 | 3300025928 | Bacteria | 944 |
| 551 | Ga0207664_10032332 | 3300025929 | Bacteria | 4009 |
| 552 | Ga0207664_10105163 | 3300025929 | Bacteria | 2339 |
| 553 | Ga0207664_10136480 | 3300025929 | Bacteria | 2070 |
| 554 | Ga0207664_10186739 | 3300025929 | Bacteria | 1782 |
| 555 | Ga0207664_10195761 | 3300025929 | Bacteria | 1742 |
| 556 | Ga0207664_10251499 | 3300025929 | Bacteria | 1542 |
| 557 | Ga0207664_10729637 | 3300025929 | Bacteria | 891 |
| 558 | Ga0207664_10740329 | 3300025929 | Bacteria | 884 |
| 559 | Ga0207664_10914460 | 3300025929 | Bacteria | 788 |
| 560 | Ga0207644_10144007 | 3300025931 | Bacteria | 1838 |
| 561 | Ga0207644_10173740 | 3300025931 | Bacteria | 1684 |
| 562 | Ga0207644_10256110 | 3300025931 | Bacteria | 1398 |
| 563 | Ga0207644_10288098 | 3300025931 | Bacteria | 1320 |
| 564 | Ga0207644_11172042 | 3300025931 | Bacteria | 646 |
| 565 | Ga0207690_11024368 | 3300025932 | Bacteria | 687 |
| 566 | Ga0207690_11178670 | 3300025932 | Bacteria | 639 |
| 567 | Ga0207706_10006148 | 3300025933 | Bacteria | 11150 |
| 568 | Ga0207706_10019996 | 3300025933 | Bacteria | 6015 |
| 569 | Ga0207706_10097474 | 3300025933 | Bacteria | 2586 |
| 570 | Ga0207686_10033719 | 3300025934 | Bacteria | 3058 |
| 571 | Ga0207686_10356579 | 3300025934 | Bacteria | 1102 |
| 572 | Ga0207709_10096948 | 3300025935 | Bacteria | 1941 |
| 573 | Ga0207709_10196011 | 3300025935 | Bacteria | 1439 |
| 574 | Ga0207709_10215511 | 3300025935 | Bacteria | 1381 |
| 575 | Ga0207709_10216688 | 3300025935 | Bacteria | 1378 |
| 576 | Ga0207670_10963817 | 3300025936 | Bacteria | 716 |
| 577 | Ga0207669_10217363 | 3300025937 | Bacteria | 1400 |
| 578 | Ga0207669_10532406 | 3300025937 | Bacteria | 945 |
| 579 | Ga0207704_10074766 | 3300025938 | Bacteria | 2164 |
| 580 | Ga0207704_10156200 | 3300025938 | Bacteria | 1617 |
| 581 | Ga0207704_10243710 | 3300025938 | Bacteria | 1345 |
| 582 | Ga0207704_10300051 | 3300025938 | Bacteria | 1230 |
| 583 | Ga0207665_10002447 | 3300025939 | Bacteria | 12534 |
| 584 | Ga0207665_10015388 | 3300025939 | Bacteria | 5023 |
| 585 | Ga0207665_10019402 | 3300025939 | Bacteria | 4470 |
| 586 | Ga0207665_10163720 | 3300025939 | Bacteria | 1602 |
| 587 | Ga0207665_10613651 | 3300025939 | Bacteria | 850 |
| 588 | Ga0207665_10755088 | 3300025939 | Bacteria | 767 |
| 589 | Ga0207665_10880596 | 3300025939 | Bacteria | 710 |
| 590 | Ga0207665_10930366 | 3300025939 | Bacteria | 690 |
| 591 | Ga0207691_10200980 | 3300025940 | Bacteria | 1735 |
| 592 | Ga0207711_10169406 | 3300025941 | Bacteria | 1981 |
| 593 | Ga0207689_10228543 | 3300025942 | Bacteria | 1538 |
| 594 | Ga0207689_10358942 | 3300025942 | Bacteria | 1212 |
| 595 | Ga0207689_10828605 | 3300025942 | Bacteria | 781 |
| 596 | Ga0207661_10035043 | 3300025944 | Bacteria | 3908 |
| 597 | Ga0207661_10206510 | 3300025944 | Bacteria | 1729 |
| 598 | Ga0207661_10219198 | 3300025944 | Bacteria | 1681 |
| 599 | Ga0207661_10806346 | 3300025944 | Bacteria | 864 |
| 600 | Ga0207661_11033274 | 3300025944 | Bacteria | 757 |
| 601 | Ga0207661_11203957 | 3300025944 | Bacteria | 697 |
| 602 | Ga0207679_10808426 | 3300025945 | Bacteria | 855 |
| 603 | Ga0207667_10051598 | 3300025949 | Bacteria | 4335 |
| 604 | Ga0207667_10051953 | 3300025949 | Bacteria | 4319 |
| 605 | Ga0207667_10136181 | 3300025949 | Bacteria | 2529 |
| 606 | Ga0207667_10161367 | 3300025949 | Bacteria | 2305 |
| 607 | Ga0207667_10187508 | 3300025949 | Bacteria | 2123 |
| 608 | Ga0207667_10464023 | 3300025949 | Bacteria | 1286 |
| 609 | Ga0207667_10513984 | 3300025949 | Bacteria | 1214 |
| 610 | Ga0207667_10913419 | 3300025949 | Bacteria | 869 |
| 611 | Ga0207651_10237438 | 3300025960 | Bacteria | 1484 |
| 612 | Ga0207651_10586271 | 3300025960 | Bacteria | 973 |
| 613 | Ga0207651_11799258 | 3300025960 | Bacteria | 551 |
| 614 | Ga0207712_11244186 | 3300025961 | Bacteria | 665 |
| 615 | Ga0207668_10011321 | 3300025972 | Bacteria | 5415 |
| 616 | Ga0207668_10034893 | 3300025972 | Bacteria | 3345 |
| 617 | Ga0207668_10857073 | 3300025972 | Bacteria | 807 |
| 618 | Ga0207640_10565383 | 3300025981 | Bacteria | 958 |
| 619 | Ga0207640_10998271 | 3300025981 | Bacteria | 736 |
| 620 | Ga0207658_11281416 | 3300025986 | Bacteria | 670 |
| 621 | Ga0207677_10031710 | 3300026023 | Bacteria | 3387 |
| 622 | Ga0207677_10123174 | 3300026023 | Bacteria | 1954 |
| 623 | Ga0207677_10641665 | 3300026023 | Bacteria | 936 |
| 624 | Ga0207677_11047191 | 3300026023 | Bacteria | 742 |
| 625 | Ga0207703_10594467 | 3300026035 | Bacteria | 1046 |
| 626 | Ga0207639_10402215 | 3300026041 | Bacteria | 1234 |
| 627 | Ga0207639_11127795 | 3300026041 | Bacteria | 736 |
| 628 | Ga0207678_10051414 | 3300026067 | Bacteria | 3557 |
| 629 | Ga0207678_10670033 | 3300026067 | Bacteria | 912 |
| 630 | Ga0207678_11711526 | 3300026067 | Bacteria | 552 |
| 631 | Ga0207708_10013961 | 3300026075 | Bacteria | 6000 |
| 632 | Ga0207708_10104859 | 3300026075 | Bacteria | 2191 |
| 633 | Ga0207708_10167539 | 3300026075 | Bacteria | 1738 |
| 634 | Ga0207702_10003936 | 3300026078 | Bacteria | 13350 |
| 635 | Ga0207702_10074556 | 3300026078 | Bacteria | 2929 |
| 636 | Ga0207702_10102338 | 3300026078 | Bacteria | 2531 |
| 637 | Ga0207702_10196393 | 3300026078 | Bacteria | 1868 |
| 638 | Ga0207702_10741682 | 3300026078 | Bacteria | 969 |
| 639 | Ga0207702_10943294 | 3300026078 | Bacteria | 855 |
| 640 | Ga0207641_10595568 | 3300026088 | Bacteria | 1082 |
| 641 | Ga0207648_10007972 | 3300026089 | Bacteria | 10331 |
| 642 | Ga0207648_10117415 | 3300026089 | Bacteria | 2338 |
| 643 | Ga0207676_10096950 | 3300026095 | Bacteria | 2435 |
| 644 | Ga0207674_10102554 | 3300026116 | Bacteria | 2841 |
| 645 | Ga0207674_10443408 | 3300026116 | Bacteria | 1255 |
| 646 | Ga0207675_100002893 | 3300026118 | Bacteria | 16878 |
| 647 | Ga0207675_100069684 | 3300026118 | Bacteria | 3287 |
| 648 | Ga0207675_100281463 | 3300026118 | Bacteria | 1616 |
| 649 | Ga0207683_10001031 | 3300026121 | Bacteria | 25414 |
| 650 | Ga0207683_10010677 | 3300026121 | Bacteria | 7828 |
| 651 | Ga0207683_10028491 | 3300026121 | Bacteria | 4829 |
| 652 | Ga0207698_10191171 | 3300026142 | Bacteria | 1823 |
| 653 | Ga0207698_10291247 | 3300026142 | Bacteria | 1515 |
| 654 | Ga0207698_10377167 | 3300026142 | Bacteria | 1348 |
| 655 | Ga0207698_10406284 | 3300026142 | Bacteria | 1303 |
| 656 | Ga0207428_10008568 | 3300027907 | Bacteria | 9228 |
| 657 | Ga0207428_10098259 | 3300027907 | Bacteria | 2266 |
| 658 | Ga0207428_10155499 | 3300027907 | Bacteria | 1739 |
| 659 | Ga0268266_10199771 | 3300028379 | Bacteria | 1829 |
| 660 | Ga0268266_11124358 | 3300028379 | Bacteria | 760 |
| 661 | Ga0268265_10528520 | 3300028380 | Bacteria | 1116 |
| 662 | Ga0268264_10055175 | 3300028381 | Bacteria | 3320 |
| 663 | Ga0268264_10267363 | 3300028381 | Bacteria | 1596 |
| 664 | Ga0265334_10337018 | 3300028573 | Bacteria | 516 |
| 665 | Ga0265318_10038049 | 3300028577 | Bacteria | 1841 |
| 666 | Ga0265318_10046438 | 3300028577 | Bacteria | 1639 |
| 667 | Ga0265336_10038696 | 3300028666 | Bacteria | 1463 |
| 668 | Ga0265338_10031578 | 3300028800 | Bacteria | 5189 |
| 669 | Ga0265338_10180982 | 3300028800 | Bacteria | 1607 |
| 670 | Ga0265338_10387738 | 3300028800 | Bacteria | 998 |
| 671 | Ga0265338_10443678 | 3300028800 | Bacteria | 920 |
| 672 | Ga0265330_10199572 | 3300031235 | Bacteria | 846 |
| 673 | Ga0265328_10126025 | 3300031239 | Bacteria | 957 |
| 674 | Ga0265328_10187641 | 3300031239 | Bacteria | 783 |
| 675 | Ga0265320_10202667 | 3300031240 | Bacteria | 886 |
| 676 | Ga0265325_10048762 | 3300031241 | Bacteria | 2188 |
| 677 | Ga0265339_10017308 | 3300031249 | Bacteria | 4272 |
| 678 | Ga0265327_10019521 | 3300031251 | Bacteria | 4163 |
| 679 | Ga0265327_10029963 | 3300031251 | Bacteria | 3086 |
| 680 | Ga0265327_10109282 | 3300031251 | Bacteria | 1324 |
| 681 | Ga0265316_10065555 | 3300031344 | Bacteria | 2812 |
| 682 | Ga0307408_100309779 | 3300031548 | Bacteria | 1326 |
| 683 | Ga0307408_101026743 | 3300031548 | Bacteria | 761 |
| 684 | Ga0265313_10050557 | 3300031595 | Bacteria | 1993 |
| 685 | Ga0265314_10048768 | 3300031711 | Bacteria | 2969 |
| 686 | Ga0265342_10164349 | 3300031712 | Bacteria | 1225 |
| 687 | Ga0307405_10174576 | 3300031731 | Bacteria | 1536 |
| 688 | Ga0307405_10192785 | 3300031731 | Bacteria | 1473 |
| 689 | Ga0307405_10871180 | 3300031731 | Bacteria | 760 |
| 690 | Ga0307413_10052816 | 3300031824 | Bacteria | 2457 |
| 691 | Ga0307413_10674132 | 3300031824 | Bacteria | 856 |
| 692 | Ga0307410_10152033 | 3300031852 | Bacteria | 1724 |
| 693 | Ga0307410_10619365 | 3300031852 | Bacteria | 905 |
| 694 | Ga0307407_11058201 | 3300031903 | Bacteria | 629 |
| 695 | Ga0307409_100337672 | 3300031995 | Bacteria | 1416 |
| 696 | Ga0307409_100544504 | 3300031995 | Bacteria | 1138 |
| 697 | Ga0307409_100660504 | 3300031995 | Bacteria | 1040 |
| 698 | Ga0307409_100664432 | 3300031995 | Bacteria | 1037 |
| 699 | Ga0307416_100061803 | 3300032002 | Bacteria | 3059 |
| 700 | Ga0307416_100240958 | 3300032002 | Bacteria | 1752 |
| 701 | Ga0307416_100931263 | 3300032002 | Bacteria | 970 |
| 702 | Ga0307415_101850350 | 3300032126 | Bacteria | 585 |
| 703 | Ga0373930_0049651 | 3300034816 | Bacteria | 913 |
| 704 | Ga0373948_0007549 | 3300034817 | Bacteria | 1832 |
| 705 | Ga0373948_0056990 | 3300034817 | Bacteria | 851 |
| 706 | Ga0373950_0018240 | 3300034818 | Bacteria | 1216 |
| 707 | Ga0373958_0025987 | 3300034819 | Bacteria | 1118 |
| 708 | Ga0373938_0021063 | 3300034957 | Bacteria | 1319 |
| 709 | Ga0373926_0064783 | 3300035083 | Bacteria | 1336 |
| 710 | Ga0373929_0094118 | 3300035085 | Bacteria | 747 |
| 711 | Ga0373940_0012740 | 3300035088 | Bacteria | 2019 |
| 712 | Ga0373940_0149089 | 3300035088 | Bacteria | 744 |
| 713 | Ga0373944_0024652 | 3300035089 | Bacteria | 1765 |
| 714 | Ga0373949_0000662 | 3300035090 | Bacteria | 11210 |
| 715 | Ga0373951_0000538 | 3300035091 | Bacteria | 10682 |
| 716 | Ga0373952_0009778 | 3300035092 | Bacteria | 1844 |
| 717 | Ga0373952_0013174 | 3300035092 | Bacteria | 1636 |
| 718 | Ga0373932_0001682 | 3300035112 | Bacteria | 6033 |
| 719 | Ga0373936_0047909 | 3300035113 | Bacteria | 1725 |
| 720 | Ga0373939_0015150 | 3300035114 | Bacteria | 2012 |
| 721 | Ga0373939_0107504 | 3300035114 | Bacteria | 967 |
| 722 | Ga0373939_0386717 | 3300035114 | Bacteria | 577 |
| 723 | Ga0373941_0000882 | 3300035115 | Bacteria | 6179 |
| 724 | Ga0373941_0249839 | 3300035115 | Bacteria | 692 |
| 725 | Ga0373945_0010260 | 3300035116 | Bacteria | 3082 |
| 726 | Ga0373945_0088335 | 3300035116 | Bacteria | 1197 |
| 727 | Ga0373960_0001637 | 3300035121 | Bacteria | 5002 |
| 728 | Ga0373960_0007747 | 3300035121 | Bacteria | 2553 |
| 729 | Ga0373943_0003220 | 3300035170 | Bacteria | 7409 |
| 730 | Ga0373943_0086719 | 3300035170 | Bacteria | 1615 |
| 731 | Ga0373946_0002121 | 3300035171 | Bacteria | 6956 |
| 732 | Ga0373946_0015005 | 3300035171 | Bacteria | 2931 |
| 733 | Ga0373961_0000784 | 3300035241 | Bacteria | 10914 |
| 734 | Ga0373961_0024249 | 3300035241 | Bacteria | 1640 |
| 735 | Ga0373962_0001116 | 3300035242 | Bacteria | 6253 |
| 736 | Ga0373924_0039647 | 3300035410 | Bacteria | 1925 |
| 737 | Ga0373931_0000222 | 3300035691 | Bacteria | 24235 |
| 738 | Ga0373931_0149948 | 3300035691 | Bacteria | 1358 |
| 739 | Ga0373931_0231654 | 3300035691 | Bacteria | 1116 |
| 740 | Ga0373931_0269744 | 3300035691 | Bacteria | 1041 |
| 741 | Ga0373935_0005754 | 3300035692 | Bacteria | 7328 |
| 742 | Ga0373935_0281985 | 3300035692 | Bacteria | 1170 |
| 743 | Ga0373935_0536847 | 3300035692 | Bacteria | 852 |
| 744 | Ga0373927_0060280 | 3300035695 | Bacteria | 2455 |
| 745 | Ga0373933_0125630 | 3300035724 | Bacteria | 1609 |
| 746 | Ga0373947_0002612 | 3300035725 | Bacteria | 10814 |
| 747 | Ga0373947_0004365 | 3300035725 | Bacteria | 8294 |
| 748 | Ga0373937_1285774 | 3300036401 | Bacteria | 680 |
| 749 | Ga0373925_0001472 | 3300037068 | Bacteria | 20286 |
| 750 | Ga0373925_0010538 | 3300037068 | Bacteria | 6705 |
| 751 | Ga0395899_0000775 | 3300037312 | Bacteria | 31562 |
| 752 | Ga0395899_0001813 | 3300037312 | Bacteria | 17679 |
| 753 | Ga0395899_0006817 | 3300037312 | Bacteria | 8845 |
| 754 | Ga0395899_0012282 | 3300037312 | Bacteria | 6561 |
| 755 | Ga0395899_0034532 | 3300037312 | Bacteria | 3798 |
| 756 | Ga0395899_0073005 | 3300037312 | Bacteria | 2510 |
| 757 | Ga0395899_0094306 | 3300037312 | Bacteria | 2166 |
| 758 | Ga0395899_0096764 | 3300037312 | Bacteria | 2134 |
| 759 | Ga0395899_0505838 | 3300037312 | Bacteria | 783 |
| 760 | Ga0395899_0687527 | 3300037312 | Bacteria | 643 |
| 761 | Ga0395900_0004133 | 3300037418 | Bacteria | 15453 |
| 762 | Ga0395900_0005363 | 3300037418 | Bacteria | 13437 |
| 763 | Ga0395900_0007148 | 3300037418 | Bacteria | 11569 |
| 764 | Ga0395900_0020594 | 3300037418 | Bacteria | 6737 |
| 765 | Ga0395900_0038826 | 3300037418 | Bacteria | 4908 |
| 766 | Ga0395900_0067289 | 3300037418 | Bacteria | 3680 |
| 767 | Ga0395900_0074403 | 3300037418 | Bacteria | 3492 |
| 768 | Ga0395900_0099068 | 3300037418 | Bacteria | 2994 |
| 769 | Ga0395900_0108894 | 3300037418 | Bacteria | 2846 |
| 770 | Ga0395900_0115328 | 3300037418 | Bacteria | 2756 |
| 771 | Ga0395900_0256367 | 3300037418 | Bacteria | 1748 |
| 772 | Ga0395900_0273380 | 3300037418 | Bacteria | 1684 |
| 773 | Ga0395900_0326597 | 3300037418 | Bacteria | 1513 |
| 774 | Ga0395900_0342290 | 3300037418 | Bacteria | 1471 |
| 775 | Ga0395900_0415209 | 3300037418 | Bacteria | 1307 |
| 776 | Ga0395900_0468489 | 3300037418 | Bacteria | 1213 |
| 777 | Ga0395900_0475561 | 3300037418 | Bacteria | 1202 |
| 778 | Ga0395900_0867641 | 3300037418 | Bacteria | 827 |
| 779 | Ga0395900_1027731 | 3300037418 | Bacteria | 743 |
| 780 | Ga0395900_1215260 | 3300037418 | Bacteria | 669 |
| 781 | Ga0395900_1466662 | 3300037418 | Bacteria | 595 |
| 782 | Ga0395898_0002274 | 3300037466 | Bacteria | 23201 |
| 783 | Ga0395898_0005883 | 3300037466 | Bacteria | 13185 |
| 784 | Ga0395898_0006991 | 3300037466 | Bacteria | 11996 |
| 785 | Ga0395898_0025659 | 3300037466 | Bacteria | 5936 |
| 786 | Ga0395898_0027356 | 3300037466 | Bacteria | 5727 |
| 787 | Ga0395898_0090777 | 3300037466 | Bacteria | 2939 |
| 788 | Ga0395898_0101460 | 3300037466 | Bacteria | 2763 |
| 789 | Ga0395898_0105496 | 3300037466 | Bacteria | 2702 |
| 790 | Ga0395898_0117493 | 3300037466 | Bacteria | 2548 |
| 791 | Ga0395898_0124509 | 3300037466 | Bacteria | 2469 |
| 792 | Ga0395898_0125032 | 3300037466 | Bacteria | 2464 |
| 793 | Ga0395898_0145487 | 3300037466 | Bacteria | 2268 |
| 794 | Ga0395898_0159860 | 3300037466 | Bacteria | 2155 |
| 795 | Ga0395898_0185903 | 3300037466 | Bacteria | 1985 |
| 796 | Ga0395898_0202572 | 3300037466 | Bacteria | 1894 |
| 797 | Ga0395898_0304489 | 3300037466 | Bacteria | 1520 |
| 798 | Ga0395898_0305631 | 3300037466 | Bacteria | 1517 |
| 799 | Ga0395898_0354286 | 3300037466 | Bacteria | 1399 |
| 800 | Ga0395898_0434384 | 3300037466 | Bacteria | 1251 |
| 801 | Ga0395898_0536135 | 3300037466 | Unclassified | 1112 |
| 802 | Ga0395898_1032307 | 3300037466 | Unclassified | 757 |
| 803 | Ga0395905_0002088 | 3300037471 | Bacteria | 22707 |
| 804 | Ga0395905_0002224 | 3300037471 | Bacteria | 21889 |
| 805 | Ga0395905_0003522 | 3300037471 | Bacteria | 16691 |
| 806 | Ga0395905_0005811 | 3300037471 | Bacteria | 12535 |
| 807 | Ga0395905_0006331 | 3300037471 | Bacteria | 11928 |
| 808 | Ga0395905_0026503 | 3300037471 | Bacteria | 5464 |
| 809 | Ga0395905_0052037 | 3300037471 | Bacteria | 3835 |
| 810 | Ga0395905_0067136 | 3300037471 | Bacteria | 3359 |
| 811 | Ga0395905_0111883 | 3300037471 | Bacteria | 2564 |
| 812 | Ga0395905_0224743 | 3300037471 | Bacteria | 1756 |
| 813 | Ga0395905_0227552 | 3300037471 | Bacteria | 1744 |
| 814 | Ga0395905_0315425 | 3300037471 | Bacteria | 1452 |
| 815 | Ga0395905_0616132 | 3300037471 | Bacteria | 987 |
| 816 | Ga0395905_0780434 | 3300037471 | Bacteria | 858 |
| 817 | Ga0395901_0001042 | 3300038443 | Bacteria | 29911 |
| 818 | Ga0395901_0001441 | 3300038443 | Bacteria | 24821 |
| 819 | Ga0395901_0004925 | 3300038443 | Bacteria | 13477 |
| 820 | Ga0395901_0008564 | 3300038443 | Bacteria | 10336 |
| 821 | Ga0395901_0013286 | 3300038443 | Bacteria | 8363 |
| 822 | Ga0395901_0016741 | 3300038443 | Bacteria | 7470 |
| 823 | Ga0395901_0021670 | 3300038443 | Bacteria | 6583 |
| 824 | Ga0395901_0028496 | 3300038443 | Bacteria | 5742 |
| 825 | Ga0395901_0036414 | 3300038443 | Bacteria | 5086 |
| 826 | Ga0395901_0052123 | 3300038443 | Bacteria | 4253 |
| 827 | Ga0395901_0119098 | 3300038443 | Bacteria | 2774 |
| 828 | Ga0395901_0121997 | 3300038443 | Bacteria | 2739 |
| 829 | Ga0395901_0149855 | 3300038443 | Bacteria | 2451 |
| 830 | Ga0395901_0182602 | 3300038443 | Bacteria | 2200 |
| 831 | Ga0395901_0193833 | 3300038443 | Bacteria | 2131 |
| 832 | Ga0395901_0210642 | 3300038443 | Bacteria | 2034 |
| 833 | Ga0395901_0225762 | 3300038443 | Bacteria | 1956 |
| 834 | Ga0395901_0248212 | 3300038443 | Bacteria | 1855 |
| 835 | Ga0395901_0270640 | 3300038443 | Bacteria | 1767 |
| 836 | Ga0395901_0336388 | 3300038443 | Bacteria | 1560 |
| 837 | Ga0395901_0351737 | 3300038443 | Bacteria | 1520 |
| 838 | Ga0395901_0354905 | 3300038443 | Bacteria | 1513 |
| 839 | Ga0395901_0636056 | 3300038443 | Bacteria | 1072 |
| 840 | Ga0395901_1026506 | 3300038443 | Bacteria | 799 |
| 841 | Ga0395901_1079464 | 3300038443 | Bacteria | 774 |
| 842 | Ga0395901_1182533 | 3300038443 | Bacteria | 731 |
| 843 | Ga0395901_1582920 | 3300038443 | Bacteria | 609 |
| 844 | Ga0439438_046752 | 3300041405 | Bacteria | 1111 |
| 845 | Ga0439439_0085880 | 3300041406 | Bacteria | 855 |
| 846 | Ga0439453_0007830 | 3300041408 | Bacteria | 1705 |
| 847 | Ga0439461_0114344 | 3300041410 | Bacteria | 669 |
| 848 | Ga0451791_0268522 | 3300041451 | Bacteria | 1230 |
| 849 | Ga0451798_0701400 | 3300041458 | Bacteria | 528 |
| 850 | Ga0451798_1116539 | 3300041458 | Bacteria | 594 |
| 851 | Ga0451800_0200249 | 3300041459 | Bacteria | 794 |
| 852 | Ga0451807_2219213 | 3300041486 | Bacteria | 891 |
| 853 | Ga0451837_1563388 | 3300041494 | Bacteria | 558 |
| 854 | Ga0451849_0486907 | 3300041505 | Bacteria | 599 |
| 855 | Ga0451851_1318289 | 3300041507 | Bacteria | 603 |
| 856 | Ga0451853_1688329 | 3300041512 | Bacteria | 849 |
| 857 | Ga0451853_4115136 | 3300041512 | Bacteria | 848 |
| 858 | Ga0439441_018795 | 3300042001 | Bacteria | 1252 |
| 859 | Ga0439448_0008909 | 3300042005 | Bacteria | 2946 |
| 860 | Ga0439448_0027807 | 3300042005 | Bacteria | 1784 |
| 861 | Ga0439450_098505 | 3300042008 | Bacteria | 740 |
| 862 | Ga0439454_004201 | 3300042011 | Bacteria | 1645 |
| 863 | Ga0439455_0148414 | 3300042012 | Bacteria | 667 |
| 864 | Ga0450898_033844 | 3300042134 | Bacteria | 947 |
| 865 | Ga0450902_022469 | 3300042137 | Bacteria | 1045 |
| 866 | Ga0450902_045742 | 3300042137 | Bacteria | 748 |
| 867 | Ga0450906_072593 | 3300042145 | Bacteria | 617 |
| 868 | Ga0450907_007964 | 3300042146 | Bacteria | 1765 |
| 869 | Ga0439446_0007985 | 3300042156 | Bacteria | 2796 |
| 870 | Ga0439458_0006778 | 3300042157 | Bacteria | 2551 |
| 871 | Ga0439434_0044110 | 3300042435 | Bacteria | 1373 |
| 872 | Ga0439434_0191952 | 3300042435 | Bacteria | 686 |
| 873 | Ga0450918_009987 | 3300042531 | Bacteria | 1659 |
| 874 | Ga0451577_0359492 | 3300042876 | Bacteria | 1321 |
| 875 | Ga0466965_0540201 | 3300044683 | Bacteria | 657 |
| 876 | Ga0466965_0856805 | 3300044683 | Bacteria | 528 |
| 877 | Ga0466966_0001800 | 3300044684 | Bacteria | 13885 |
| 878 | Ga0466966_0021354 | 3300044684 | Bacteria | 4251 |
| 879 | Ga0466961_0087136 | 3300044693 | Bacteria | 1973 |
| 880 | Ga0466961_0285248 | 3300044693 | Bacteria | 1010 |
| 881 | Ga0466963_0002420 | 3300044694 | Bacteria | 10436 |
| 882 | Ga0466963_0003545 | 3300044694 | Bacteria | 8961 |
| 883 | Ga0466963_0007131 | 3300044694 | Bacteria | 6660 |
| 884 | Ga0466963_0022827 | 3300044694 | Bacteria | 3967 |
| 885 | Ga0466963_0080686 | 3300044694 | Bacteria | 2203 |
| 886 | Ga0466963_0462578 | 3300044694 | Bacteria | 895 |
| 887 | Ga0466964_0006100 | 3300044706 | Bacteria | 4492 |
| 888 | Ga0466964_0015541 | 3300044706 | Bacteria | 2898 |
| 889 | Ga0466964_0053506 | 3300044706 | Bacteria | 1662 |
| 890 | Ga0466964_0090882 | 3300044706 | Bacteria | 1328 |
| 891 | Ga0466964_0221227 | 3300044706 | Bacteria | 919 |
| 892 | Ga0466964_0310298 | 3300044706 | Bacteria | 798 |
| 893 | Ga0466964_0316706 | 3300044706 | Bacteria | 791 |
| 894 | Ga0466971_0109404 | 3300044719 | Bacteria | 1274 |
| 895 | Ga0466971_0273016 | 3300044719 | Bacteria | 808 |
| 896 | Ga0466968_0028460 | 3300044735 | Bacteria | 2304 |
| 897 | Ga0466968_0231506 | 3300044735 | Bacteria | 873 |
| 898 | Ga0466968_0275405 | 3300044735 | Bacteria | 804 |
| 899 | Ga0466968_0360226 | 3300044735 | Bacteria | 708 |
| 900 | Ga0466957_0082152 | 3300044842 | Bacteria | 2008 |
| 901 | Ga0466957_0280248 | 3300044842 | Bacteria | 1116 |
| 902 | Ga0466957_0384596 | 3300044842 | Bacteria | 957 |
| 903 | Ga0466957_0630174 | 3300044842 | Bacteria | 753 |
| 904 | Ga0466957_0689536 | 3300044842 | Bacteria | 720 |
| 905 | Ga0466957_0709084 | 3300044842 | Bacteria | 710 |
| 906 | Ga0466957_0989049 | 3300044842 | Bacteria | 604 |
| 907 | Ga0466960_0102370 | 3300044901 | Bacteria | 1477 |
| 908 | Ga0466960_0128683 | 3300044901 | Bacteria | 1334 |
| 909 | Ga0466960_0176391 | 3300044901 | Bacteria | 1156 |
| 910 | Ga0466960_0178801 | 3300044901 | Bacteria | 1149 |
| 911 | Ga0466960_0302796 | 3300044901 | Bacteria | 901 |
| 912 | Ga0466959_0024682 | 3300045049 | Bacteria | 4454 |
| 913 | Ga0466959_0068229 | 3300045049 | Bacteria | 2577 |
| 914 | Ga0466959_0107369 | 3300045049 | Bacteria | 1995 |
| 915 | Ga0466959_0172560 | 3300045049 | Bacteria | 1516 |
| 916 | Ga0466959_0703298 | 3300045049 | Bacteria | 677 |
| 917 | Ga0451576_0248579 | 3300045051 | Bacteria | 1859 |
| 918 | Ga0466958_0001786 | 3300045836 | Bacteria | 10433 |
| 919 | Ga0466958_0055098 | 3300045836 | Bacteria | 2412 |
| 920 | Ga0466958_0072997 | 3300045836 | Bacteria | 2102 |
| 921 | Ga0466958_0132730 | 3300045836 | Bacteria | 1564 |
| 922 | Ga0466958_0407692 | 3300045836 | Bacteria | 878 |
| 923 | Ga0466958_0661334 | 3300045836 | Bacteria | 680 |
| 924 | Ga0466958_0894434 | 3300045836 | Bacteria | 579 |
| 925 | Ga0466967_0002953 | 3300045976 | Bacteria | 10866 |
| 926 | Ga0466967_0005103 | 3300045976 | Bacteria | 9018 |
| 927 | Ga0466967_0006225 | 3300045976 | Bacteria | 8414 |
| 928 | Ga0466967_0019579 | 3300045976 | Bacteria | 5446 |
| 929 | Ga0466967_0029959 | 3300045976 | Bacteria | 4561 |
| 930 | Ga0466967_0052906 | 3300045976 | Bacteria | 3567 |
| 931 | Ga0466967_0064554 | 3300045976 | Bacteria | 3256 |
| 932 | Ga0466967_0073718 | 3300045976 | Bacteria | 3063 |
| 933 | Ga0466967_0090731 | 3300045976 | Bacteria | 2776 |
| 934 | Ga0466967_0228830 | 3300045976 | Bacteria | 1769 |
| 935 | Ga0466967_0236110 | 3300045976 | Bacteria | 1742 |
| 936 | Ga0466967_0311208 | 3300045976 | Bacteria | 1517 |
| 937 | Ga0466967_0343850 | 3300045976 | Bacteria | 1443 |
| 938 | Ga0466967_0420436 | 3300045976 | Bacteria | 1303 |
| 939 | Ga0466967_0632414 | 3300045976 | Bacteria | 1057 |
| 940 | Ga0466967_0638964 | 3300045976 | Bacteria | 1052 |
| 941 | Ga0466967_0775272 | 3300045976 | Bacteria | 951 |
| 942 | Ga0466967_2041482 | 3300045976 | Bacteria | 570 |
| 943 | Ga0495592_0052765 | 3300046454 | Bacteria | 3018 |
| 944 | Ga0495592_0086623 | 3300046454 | Bacteria | 2255 |
| 945 | Ga0495603_0001374 | 3300046455 | Bacteria | 14134 |
| 946 | Ga0495629_0001380 | 3300046459 | Bacteria | 19145 |
| 947 | Ga0495629_0162738 | 3300046459 | Bacteria | 1550 |
| 948 | Ga0495641_0000416 | 3300046461 | Bacteria | 35566 |
| 949 | Ga0495641_0001029 | 3300046461 | Bacteria | 23958 |
| 950 | Ga0495641_0590216 | 3300046461 | Bacteria | 508 |
| 951 | Ga0495651_0010678 | 3300046462 | Bacteria | 7064 |
| 952 | Ga0495651_0019841 | 3300046462 | Bacteria | 5212 |
| 953 | Ga0495651_0156441 | 3300046462 | Bacteria | 1638 |
| 954 | Ga0495653_0049742 | 3300046463 | Bacteria | 3227 |
| 955 | Ga0495653_0115476 | 3300046463 | Bacteria | 1921 |
| 956 | Ga0495653_0586019 | 3300046463 | Bacteria | 687 |
| 957 | Ga0495582_0000108 | 3300046473 | Bacteria | 43115 |
| 958 | Ga0495582_0004292 | 3300046473 | Bacteria | 8019 |
| 959 | Ga0495582_0119658 | 3300046473 | Bacteria | 1483 |
| 960 | Ga0495582_0625068 | 3300046473 | Bacteria | 623 |
| 961 | Ga0495639_0000578 | 3300046475 | Bacteria | 17076 |
| 962 | Ga0495639_0111567 | 3300046475 | Bacteria | 1298 |
| 963 | Ga0495662_0002285 | 3300046476 | Bacteria | 9659 |
| 964 | Ga0495664_0144272 | 3300046477 | Bacteria | 1444 |
| 965 | Ga0495664_0538451 | 3300046477 | Bacteria | 696 |
| 966 | Ga0495584_0109130 | 3300046491 | Bacteria | 1400 |
| 967 | Ga0495584_0160706 | 3300046491 | Unclassified | 1142 |
| 968 | Ga0495585_0244367 | 3300046492 | Bacteria | 898 |
| 969 | Ga0495594_0010001 | 3300046499 | Bacteria | 4914 |
| 970 | Ga0495594_0039404 | 3300046499 | Bacteria | 2584 |
| 971 | Ga0495596_0048425 | 3300046500 | Bacteria | 1667 |
| 972 | Ga0495596_0096486 | 3300046500 | Bacteria | 1148 |
| 973 | Ga0495596_0158029 | 3300046500 | Bacteria | 881 |
| 974 | Ga0495596_0178964 | 3300046500 | Bacteria | 824 |
| 975 | Ga0495607_0543595 | 3300046501 | Bacteria | 511 |
| 976 | Ga0495608_0016996 | 3300046511 | Bacteria | 5032 |
| 977 | Ga0495608_0056447 | 3300046511 | Bacteria | 2593 |
| 978 | Ga0495618_0075593 | 3300046514 | Bacteria | 2146 |
| 979 | Ga0495618_0090281 | 3300046514 | Bacteria | 1959 |
| 980 | Ga0495628_0084139 | 3300046516 | Bacteria | 2469 |
| 981 | Ga0495628_0144793 | 3300046516 | Bacteria | 1812 |
| 982 | Ga0495628_1079120 | 3300046516 | Bacteria | 549 |
| 983 | Ga0495630_0002325 | 3300046517 | Bacteria | 13223 |
| 984 | Ga0495630_0002755 | 3300046517 | Bacteria | 12186 |
| 985 | Ga0495630_0040251 | 3300046517 | Bacteria | 3493 |
| 986 | Ga0495630_0743283 | 3300046517 | Bacteria | 750 |
| 987 | Ga0495637_0270655 | 3300046520 | Unclassified | 608 |
| 988 | Ga0495644_0116800 | 3300046523 | Bacteria | 1014 |
| 989 | Ga0495644_0153123 | 3300046523 | Bacteria | 883 |
| 990 | Ga0495644_0370220 | 3300046523 | Unclassified | 565 |
| 991 | Ga0495663_0116045 | 3300046525 | Bacteria | 893 |
| 992 | Ga0495663_0139621 | 3300046525 | Bacteria | 822 |
| 993 | Ga0495663_0192857 | 3300046525 | Bacteria | 709 |
| 994 | Ga0495666_0006362 | 3300046526 | Bacteria | 5946 |
| 995 | Ga0495666_0424281 | 3300046526 | Bacteria | 597 |
| 996 | Ga0495652_0217355 | 3300046529 | Bacteria | 1438 |
| 997 | Ga0495652_0944983 | 3300046529 | Bacteria | 566 |
| 998 | Ga0495652_1038771 | 3300046529 | Bacteria | 534 |
| 999 | Ga0495665_0010108 | 3300046531 | Bacteria | 5113 |
| 1000 | Ga0495665_0167398 | 3300046531 | Bacteria | 1145 |
| 1001 | Ga0495665_0517505 | 3300046531 | Bacteria | 600 |
| 1002 | Ga0495640_0028068 | 3300046533 | Bacteria | 4054 |
| 1003 | Ga0495587_0018751 | 3300046536 | Bacteria | 4291 |
| 1004 | Ga0495587_0045589 | 3300046536 | Bacteria | 2606 |
| 1005 | Ga0495587_0367988 | 3300046536 | Bacteria | 800 |
| 1006 | Ga0495609_0027438 | 3300046538 | Bacteria | 2603 |
| 1007 | Ga0495609_0165567 | 3300046538 | Bacteria | 935 |
| 1008 | Ga0495609_0340896 | 3300046538 | Bacteria | 606 |
| 1009 | Ga0495645_0047589 | 3300046543 | Bacteria | 3124 |
| 1010 | Ga0495645_0152174 | 3300046543 | Bacteria | 1606 |
| 1011 | Ga0495645_0509433 | 3300046543 | Bacteria | 751 |
| 1012 | Ga0495645_0619062 | 3300046543 | Bacteria | 664 |
| 1013 | Ga0495645_0880998 | 3300046543 | Bacteria | 532 |
| 1014 | Ga0495622_0048156 | 3300046557 | Bacteria | 1981 |
| 1015 | Ga0495667_0015780 | 3300046559 | Bacteria | 5107 |
| 1016 | Ga0495667_0089097 | 3300046559 | Bacteria | 2000 |
| 1017 | Ga0495667_0670070 | 3300046559 | Bacteria | 644 |
| 1018 | Ga0495656_0031299 | 3300046615 | Bacteria | 2157 |
| 1019 | Ga0495668_0374708 | 3300046616 | Bacteria | 782 |
| 1020 | Ga0495634_0036720 | 3300046642 | Bacteria | 3350 |
| 1021 | Ga0495611_0342829 | 3300046648 | Unclassified | 686 |
| 1022 | Ga0495611_0448766 | 3300046648 | Bacteria | 588 |
| 1023 | Ga0495635_0016702 | 3300046663 | Bacteria | 5127 |
| 1024 | Ga0495635_0147723 | 3300046663 | Bacteria | 1600 |
| 1025 | Ga0495635_0334855 | 3300046663 | Bacteria | 1011 |
| 1026 | Ga0495659_0027110 | 3300046664 | Bacteria | 1974 |
| 1027 | Ga0495659_0051141 | 3300046664 | Bacteria | 1504 |
| 1028 | Ga0495659_0321799 | 3300046664 | Bacteria | 657 |
| 1029 | Ga0495588_0001380 | 3300046674 | Bacteria | 10369 |
| 1030 | Ga0495657_0029359 | 3300046675 | Bacteria | 3857 |
| 1031 | Ga0495657_0051750 | 3300046675 | Bacteria | 2757 |
| 1032 | Ga0495599_0109051 | 3300046678 | Bacteria | 1725 |
| 1033 | Ga0495599_0195962 | 3300046678 | Bacteria | 1242 |
| 1034 | Ga0495599_0871492 | 3300046678 | Bacteria | 511 |
| 1035 | Ga0495623_0010895 | 3300046679 | Bacteria | 5887 |
| 1036 | Ga0495646_0210749 | 3300046680 | Bacteria | 1054 |
| 1037 | Ga0495647_0144865 | 3300046681 | Bacteria | 1015 |
| 1038 | Ga0495658_0000132 | 3300046683 | Bacteria | 41217 |
| 1039 | Ga0495658_0058377 | 3300046683 | Bacteria | 2207 |
| 1040 | Ga0495658_0249817 | 3300046683 | Bacteria | 1115 |
| 1041 | Ga0495669_0324705 | 3300046684 | Bacteria | 743 |
| 1042 | Ga0495613_0056332 | 3300046689 | Bacteria | 2886 |
| 1043 | Ga0495613_0412222 | 3300046689 | Bacteria | 920 |
| 1044 | Ga0495613_0506201 | 3300046689 | Bacteria | 813 |
| 1045 | Ga0495624_0031865 | 3300046690 | Bacteria | 3423 |
| 1046 | Ga0495589_0036050 | 3300046794 | Bacteria | 2480 |
| 1047 | Ga0495589_0064110 | 3300046794 | Bacteria | 1802 |
| 1048 | Ga0495589_0439088 | 3300046794 | Bacteria | 598 |
| 1049 | Ga0495600_0025998 | 3300046809 | Bacteria | 3775 |
| 1050 | Ga0495600_0604788 | 3300046809 | Bacteria | 666 |
| 1051 | Ga0495581_0023637 | 3300047315 | Bacteria | 3561 |
| 1052 | Ga0495581_0039595 | 3300047315 | Bacteria | 2729 |
| 1053 | Ga0495581_0742749 | 3300047315 | Bacteria | 565 |
| 1054 | Ga0495604_0075813 | 3300047317 | Bacteria | 2531 |
| 1055 | Ga0495604_0149274 | 3300047317 | Bacteria | 1662 |
| 1056 | Ga0495604_0170526 | 3300047317 | Bacteria | 1531 |
| 1057 | Ga0495636_0227759 | 3300047318 | Bacteria | 857 |
| 1058 | Ga0495674_0049575 | 3300047319 | Bacteria | 3710 |
| 1059 | Ga0495674_0055678 | 3300047319 | Bacteria | 3467 |
| 1060 | Ga0495674_0202670 | 3300047319 | Bacteria | 1645 |
| 1061 | Ga0495676_0002345 | 3300047321 | Bacteria | 16782 |
| 1062 | Ga0495676_0005803 | 3300047321 | Bacteria | 11323 |
| 1063 | Ga0495676_0021605 | 3300047321 | Bacteria | 5616 |
| 1064 | Ga0495680_0027386 | 3300047322 | Bacteria | 4684 |
| 1065 | Ga0495680_0040862 | 3300047322 | Bacteria | 3691 |
| 1066 | Ga0495680_0172549 | 3300047322 | Bacteria | 1565 |
| 1067 | Ga0495675_0029828 | 3300047444 | Bacteria | 3479 |
| 1068 | Ga0495675_0712335 | 3300047444 | Bacteria | 561 |
| 1069 | Ga0495684_0006639 | 3300047471 | Bacteria | 8972 |
| 1070 | Ga0495684_0050535 | 3300047471 | Bacteria | 3174 |
| 1071 | Ga0495684_0314845 | 3300047471 | Bacteria | 1120 |
| 1072 | Ga0495593_0009475 | 3300047673 | Bacteria | 5648 |
| 1073 | Ga0495602_0082978 | 3300048088 | Bacteria | 2687 |
| 1074 | Ga0495602_0121097 | 3300048088 | Bacteria | 2105 |
| 1075 | Ga0495602_0144673 | 3300048088 | Bacteria | 1877 |
| 1076 | Ga0495614_0002813 | 3300048089 | Bacteria | 7742 |
| 1077 | Ga0496100_0000648 | 3300048903 | Bacteria | 16518 |
| 1078 | Ga0496100_0006128 | 3300048903 | Bacteria | 6540 |
| 1079 | Ga0496100_0019848 | 3300048903 | Bacteria | 4019 |
| 1080 | Ga0496100_0097803 | 3300048903 | Bacteria | 2016 |
| 1081 | Ga0496100_0136027 | 3300048903 | Bacteria | 1736 |
| 1082 | Ga0496100_0172402 | 3300048903 | Bacteria | 1559 |
| 1083 | Ga0496100_0207458 | 3300048903 | Bacteria | 1431 |
| 1084 | Ga0496100_0218599 | 3300048903 | Bacteria | 1397 |
| 1085 | Ga0496100_0406599 | 3300048903 | Bacteria | 1038 |
| 1086 | Ga0496100_0407792 | 3300048903 | Bacteria | 1036 |
| 1087 | Ga0496100_0509556 | 3300048903 | Bacteria | 928 |
| 1088 | Ga0496101_0004817 | 3300048904 | Bacteria | 8563 |
| 1089 | Ga0496101_0005366 | 3300048904 | Bacteria | 8169 |
| 1090 | Ga0496101_0060341 | 3300048904 | Bacteria | 2751 |
| 1091 | Ga0496101_0128606 | 3300048904 | Bacteria | 1921 |
| 1092 | Ga0496101_0159308 | 3300048904 | Bacteria | 1730 |
| 1093 | Ga0496101_0199404 | 3300048904 | Bacteria | 1547 |
| 1094 | Ga0496101_0717497 | 3300048904 | Bacteria | 789 |
| 1095 | Ga0496101_1128857 | 3300048904 | Bacteria | 615 |
| 1096 | Ga0496102_0002063 | 3300048905 | Bacteria | 17305 |
| 1097 | Ga0496102_0019615 | 3300048905 | Bacteria | 5957 |
| 1098 | Ga0496102_0033720 | 3300048905 | Bacteria | 4603 |
| 1099 | Ga0496102_0034272 | 3300048905 | Bacteria | 4565 |
| 1100 | Ga0496102_0036663 | 3300048905 | Bacteria | 4418 |
| 1101 | Ga0496102_0080858 | 3300048905 | Bacteria | 2994 |
| 1102 | Ga0496102_0242594 | 3300048905 | Bacteria | 1699 |
| 1103 | Ga0496102_0441502 | 3300048905 | Bacteria | 1221 |
| 1104 | Ga0496102_0661306 | 3300048905 | Bacteria | 968 |
| 1105 | Ga0496102_1382663 | 3300048905 | Bacteria | 623 |
| 1106 | Ga0496102_1533097 | 3300048905 | Bacteria | 585 |
| 1107 | Ga0496103_0001730 | 3300048906 | Bacteria | 14252 |
| 1108 | Ga0496103_0026988 | 3300048906 | Bacteria | 3477 |
| 1109 | Ga0496103_0028177 | 3300048906 | Bacteria | 3407 |
| 1110 | Ga0496103_0168115 | 3300048906 | Bacteria | 1407 |
| 1111 | Ga0496103_0278356 | 3300048906 | Bacteria | 1076 |
| 1112 | Ga0496103_0730039 | 3300048906 | Bacteria | 627 |
| 1113 | Ga0496104_0000904 | 3300048907 | Bacteria | 25446 |
| 1114 | Ga0496104_0002792 | 3300048907 | Bacteria | 15048 |
| 1115 | Ga0496104_0003386 | 3300048907 | Bacteria | 13770 |
| 1116 | Ga0496104_0005665 | 3300048907 | Bacteria | 10939 |
| 1117 | Ga0496104_0007652 | 3300048907 | Bacteria | 9565 |
| 1118 | Ga0496104_0012510 | 3300048907 | Bacteria | 7630 |
| 1119 | Ga0496104_0107112 | 3300048907 | Bacteria | 2679 |
| 1120 | Ga0496104_0134273 | 3300048907 | Bacteria | 2377 |
| 1121 | Ga0496104_0326688 | 3300048907 | Bacteria | 1447 |
| 1122 | Ga0496104_0612324 | 3300048907 | Bacteria | 999 |
| 1123 | Ga0496104_0668928 | 3300048907 | Bacteria | 947 |
| 1124 | Ga0496105_0000042 | 3300048908 | Bacteria | 114886 |
| 1125 | Ga0496105_0000406 | 3300048908 | Bacteria | 28366 |
| 1126 | Ga0496105_0014796 | 3300048908 | Bacteria | 6210 |
| 1127 | Ga0496105_0019052 | 3300048908 | Bacteria | 5530 |
| 1128 | Ga0496105_0023510 | 3300048908 | Bacteria | 4999 |
| 1129 | Ga0496105_0065616 | 3300048908 | Bacteria | 2996 |
| 1130 | Ga0496105_0201313 | 3300048908 | Bacteria | 1625 |
| 1131 | Ga0496105_1095919 | 3300048908 | Bacteria | 591 |
| 1132 | Ga0496106_0000263 | 3300048909 | Bacteria | 36905 |
| 1133 | Ga0496106_0006450 | 3300048909 | Bacteria | 8686 |
| 1134 | Ga0496106_0022784 | 3300048909 | Bacteria | 4652 |
| 1135 | Ga0496106_0034403 | 3300048909 | Bacteria | 3783 |
| 1136 | Ga0496106_0114580 | 3300048909 | Bacteria | 2102 |
| 1137 | Ga0496106_0197010 | 3300048909 | Bacteria | 1602 |
| 1138 | Ga0496106_0210947 | 3300048909 | Bacteria | 1547 |
| 1139 | Ga0496106_0308969 | 3300048909 | Bacteria | 1268 |
| 1140 | Ga0496106_0448970 | 3300048909 | Bacteria | 1036 |
| 1141 | Ga0496107_0000712 | 3300048910 | Bacteria | 18973 |
| 1142 | Ga0496107_0003430 | 3300048910 | Bacteria | 10597 |
| 1143 | Ga0496107_0003441 | 3300048910 | Bacteria | 10574 |
| 1144 | Ga0496107_0008672 | 3300048910 | Bacteria | 7042 |
| 1145 | Ga0496107_0041638 | 3300048910 | Bacteria | 3298 |
| 1146 | Ga0496107_0067610 | 3300048910 | Bacteria | 2593 |
| 1147 | Ga0496107_0211213 | 3300048910 | Bacteria | 1443 |
| 1148 | Ga0496107_0429161 | 3300048910 | Bacteria | 983 |
| 1149 | Ga0496107_0821937 | 3300048910 | Bacteria | 680 |
| 1150 | Ga0496108_0001638 | 3300048911 | Bacteria | 17745 |
| 1151 | Ga0496108_0004712 | 3300048911 | Bacteria | 11004 |
| 1152 | Ga0496108_0015150 | 3300048911 | Bacteria | 6290 |
| 1153 | Ga0496108_0024619 | 3300048911 | Bacteria | 4957 |
| 1154 | Ga0496108_0063248 | 3300048911 | Bacteria | 3116 |
| 1155 | Ga0496108_0978420 | 3300048911 | Bacteria | 723 |
| 1156 | Ga0496109_0002657 | 3300048912 | Bacteria | 14996 |
| 1157 | Ga0496109_0002961 | 3300048912 | Bacteria | 14210 |
| 1158 | Ga0496109_0005055 | 3300048912 | Bacteria | 11016 |
| 1159 | Ga0496109_0006975 | 3300048912 | Bacteria | 9535 |
| 1160 | Ga0496109_0012454 | 3300048912 | Bacteria | 7342 |
| 1161 | Ga0496109_0040723 | 3300048912 | Bacteria | 4208 |
| 1162 | Ga0496109_0047156 | 3300048912 | Bacteria | 3916 |
| 1163 | Ga0496109_0073097 | 3300048912 | Bacteria | 3151 |
| 1164 | Ga0496109_0087471 | 3300048912 | Bacteria | 2878 |
| 1165 | Ga0496109_0121441 | 3300048912 | Bacteria | 2434 |
| 1166 | Ga0496109_0146151 | 3300048912 | Bacteria | 2212 |
| 1167 | Ga0496109_0235307 | 3300048912 | Bacteria | 1724 |
| 1168 | Ga0496109_0344476 | 3300048912 | Bacteria | 1407 |
| 1169 | Ga0496109_0432759 | 3300048912 | Bacteria | 1243 |
| 1170 | Ga0496109_0777049 | 3300048912 | Bacteria | 896 |
| 1171 | Ga0496109_1385440 | 3300048912 | Bacteria | 639 |
| 1172 | Ga0496109_1475256 | 3300048912 | Bacteria | 615 |
| 1173 | Ga0496110_0000050 | 3300048913 | Bacteria | 59023 |
| 1174 | Ga0496110_0001458 | 3300048913 | Bacteria | 17154 |
| 1175 | Ga0496110_0001849 | 3300048913 | Bacteria | 15623 |
| 1176 | Ga0496110_0026390 | 3300048913 | Bacteria | 4971 |
| 1177 | Ga0496110_0037764 | 3300048913 | Bacteria | 4199 |
| 1178 | Ga0496110_0052898 | 3300048913 | Bacteria | 3568 |
| 1179 | Ga0496110_0145630 | 3300048913 | Bacteria | 2142 |
| 1180 | Ga0496110_0147470 | 3300048913 | Bacteria | 2129 |
| 1181 | Ga0496110_0155437 | 3300048913 | Bacteria | 2072 |
| 1182 | Ga0496110_0890573 | 3300048913 | Bacteria | 796 |
| 1183 | Ga0496110_0979719 | 3300048913 | Bacteria | 753 |
| 1184 | Ga0496110_0980582 | 3300048913 | Bacteria | 752 |
| 1185 | Ga0496110_1322685 | 3300048913 | Bacteria | 630 |
| 1186 | Ga0496111_0000220 | 3300048914 | Bacteria | 27215 |
| 1187 | Ga0496111_0001831 | 3300048914 | Bacteria | 12514 |
| 1188 | Ga0496111_0006906 | 3300048914 | Bacteria | 7407 |
| 1189 | Ga0496111_0012770 | 3300048914 | Bacteria | 5697 |
| 1190 | Ga0496111_0018008 | 3300048914 | Bacteria | 4887 |
| 1191 | Ga0496111_0039522 | 3300048914 | Bacteria | 3383 |
| 1192 | Ga0496111_0189541 | 3300048914 | Bacteria | 1529 |
| 1193 | Ga0496111_0243419 | 3300048914 | Bacteria | 1335 |
| 1194 | Ga0496111_0548236 | 3300048914 | Bacteria | 849 |
| 1195 | Ga0496111_0663559 | 3300048914 | Bacteria | 760 |
| 1196 | Ga0496111_0725546 | 3300048914 | Bacteria | 722 |
| 1197 | Ga0496111_0844337 | 3300048914 | Bacteria | 661 |
| 1198 | Ga0496111_1065409 | 3300048914 | Bacteria | 577 |
| 1199 | Ga0496111_1248246 | 3300048914 | Bacteria | 525 |
| 1200 | Ga0496112_0001403 | 3300048915 | Bacteria | 18402 |
| 1201 | Ga0496112_0002855 | 3300048915 | Bacteria | 14040 |
| 1202 | Ga0496112_0036631 | 3300048915 | Bacteria | 4787 |
| 1203 | Ga0496112_0057166 | 3300048915 | Bacteria | 3840 |
| 1204 | Ga0496112_0062190 | 3300048915 | Bacteria | 3682 |
| 1205 | Ga0496112_0063249 | 3300048915 | Bacteria | 3650 |
| 1206 | Ga0496112_0068230 | 3300048915 | Bacteria | 3511 |
| 1207 | Ga0496112_0071756 | 3300048915 | Bacteria | 3422 |
| 1208 | Ga0496112_0091440 | 3300048915 | Bacteria | 3012 |
| 1209 | Ga0496112_0091871 | 3300048915 | Bacteria | 3004 |
| 1210 | Ga0496112_0131316 | 3300048915 | Bacteria | 2475 |
| 1211 | Ga0496112_0133272 | 3300048915 | Bacteria | 2455 |
| 1212 | Ga0496112_0226470 | 3300048915 | Bacteria | 1825 |
| 1213 | Ga0496112_0234547 | 3300048915 | Bacteria | 1789 |
| 1214 | Ga0496112_0274169 | 3300048915 | Bacteria | 1635 |
| 1215 | Ga0496112_0347247 | 3300048915 | Bacteria | 1427 |
| 1216 | Ga0496112_0712151 | 3300048915 | Bacteria | 931 |
| 1217 | Ga0496112_1095647 | 3300048915 | Bacteria | 715 |
| 1218 | Ga0496113_0000110 | 3300048916 | Bacteria | 35203 |
| 1219 | Ga0496113_0003480 | 3300048916 | Bacteria | 9435 |
| 1220 | Ga0496113_0035153 | 3300048916 | Bacteria | 3663 |
| 1221 | Ga0496113_0045159 | 3300048916 | Bacteria | 3266 |
| 1222 | Ga0496113_0058788 | 3300048916 | Bacteria | 2894 |
| 1223 | Ga0496113_0071087 | 3300048916 | Bacteria | 2647 |
| 1224 | Ga0496113_0077425 | 3300048916 | Bacteria | 2543 |
| 1225 | Ga0496113_0077663 | 3300048916 | Bacteria | 2539 |
| 1226 | Ga0496114_0000444 | 3300048917 | Bacteria | 30383 |
| 1227 | Ga0496114_0003753 | 3300048917 | Bacteria | 11706 |
| 1228 | Ga0496114_0012286 | 3300048917 | Bacteria | 6851 |
| 1229 | Ga0496114_0012957 | 3300048917 | Bacteria | 6680 |
| 1230 | Ga0496114_0030659 | 3300048917 | Bacteria | 4425 |
| 1231 | Ga0496114_0060188 | 3300048917 | Bacteria | 3174 |
| 1232 | Ga0496114_0404097 | 3300048917 | Bacteria | 1209 |
| 1233 | Ga0496114_0457774 | 3300048917 | Bacteria | 1129 |
| 1234 | Ga0496114_0963943 | 3300048917 | Bacteria | 735 |
| 1235 | Ga0496114_1410131 | 3300048917 | Bacteria | 584 |
| 1236 | Ga0496115_0000415 | 3300048918 | Bacteria | 34771 |
| 1237 | Ga0496115_0001670 | 3300048918 | Bacteria | 15964 |
| 1238 | Ga0496115_0025304 | 3300048918 | Bacteria | 4621 |
| 1239 | Ga0496115_0046506 | 3300048918 | Bacteria | 3469 |
| 1240 | Ga0496115_0081441 | 3300048918 | Bacteria | 2636 |
| 1241 | Ga0496115_0104624 | 3300048918 | Bacteria | 2323 |
| 1242 | Ga0501291_076113 | 3300049514 | Bacteria | 659 |
| 1243 | Ga0501031_0005395 | 3300049568 | Bacteria | 8322 |
| 1244 | Ga0501031_0072297 | 3300049568 | Bacteria | 2246 |
| 1245 | Ga0501031_0232321 | 3300049568 | Bacteria | 1200 |
| 1246 | Ga0501032_0023411 | 3300049569 | Bacteria | 4267 |
| 1247 | Ga0501033_0004771 | 3300049570 | Bacteria | 10834 |
| 1248 | Ga0501034_0031025 | 3300049571 | Bacteria | 5432 |
| 1249 | Ga0501034_0675337 | 3300049571 | Bacteria | 933 |
| 1250 | Ga0501036_0013360 | 3300049572 | Bacteria | 6821 |
| 1251 | Ga0501036_1047061 | 3300049572 | Bacteria | 667 |
| 1252 | Ga0501037_0003648 | 3300049573 | Bacteria | 11167 |
| 1253 | Ga0501038_0032198 | 3300049574 | Bacteria | 4627 |
| 1254 | Ga0501038_0175546 | 3300049574 | Bacteria | 1732 |
| 1255 | Ga0501039_0017450 | 3300049575 | Bacteria | 5506 |
| 1256 | Ga0501039_0754646 | 3300049575 | Bacteria | 760 |
| 1257 | Ga0501040_0005743 | 3300049576 | Bacteria | 8026 |
| 1258 | Ga0501040_0443348 | 3300049576 | Bacteria | 934 |
| 1259 | Ga0501041_0011812 | 3300049577 | Bacteria | 5169 |
| 1260 | Ga0501041_0174846 | 3300049577 | Bacteria | 1344 |
| 1261 | Ga0501042_0057144 | 3300049578 | Bacteria | 2784 |
| 1262 | Ga0501042_0260677 | 3300049578 | Bacteria | 1251 |
| 1263 | Ga0501043_0007710 | 3300049579 | Bacteria | 8523 |
| 1264 | Ga0501046_0009343 | 3300049580 | Bacteria | 8482 |
| 1265 | Ga0501046_0133718 | 3300049580 | Bacteria | 1880 |
| 1266 | Ga0501046_0772023 | 3300049580 | Bacteria | 674 |
| 1267 | Ga0501048_0053476 | 3300049582 | Bacteria | 2871 |
| 1268 | Ga0501048_0383988 | 3300049582 | Bacteria | 1003 |
| 1269 | Ga0501067_0003757 | 3300049583 | Bacteria | 8366 |
| 1270 | Ga0501067_0073589 | 3300049583 | Bacteria | 1893 |
| 1271 | Ga0501067_0122816 | 3300049583 | Bacteria | 1445 |
| 1272 | Ga0501067_0275991 | 3300049583 | Bacteria | 936 |
| 1273 | Ga0501068_0001136 | 3300049584 | Bacteria | 14097 |
| 1274 | Ga0501068_0678600 | 3300049584 | Bacteria | 673 |
| 1275 | Ga0501068_0892325 | 3300049584 | Bacteria | 585 |
| 1276 | Ga0501069_0039402 | 3300049585 | Bacteria | 2610 |
| 1277 | Ga0501069_0053703 | 3300049585 | Bacteria | 2244 |
| 1278 | Ga0501069_0084769 | 3300049585 | Bacteria | 1787 |
| 1279 | Ga0501069_0837446 | 3300049585 | Bacteria | 558 |
| 1280 | Ga0501070_0008199 | 3300049586 | Bacteria | 8836 |
| 1281 | Ga0501070_0013400 | 3300049586 | Bacteria | 6914 |
| 1282 | Ga0501071_0265474 | 3300049587 | Bacteria | 1297 |
| 1283 | Ga0501072_0051023 | 3300049588 | Bacteria | 3257 |
| 1284 | Ga0501073_0010236 | 3300049589 | Bacteria | 6891 |
| 1285 | Ga0501073_0063712 | 3300049589 | Bacteria | 2571 |
| 1286 | Ga0501074_0004394 | 3300049590 | Bacteria | 10076 |
| 1287 | Ga0501074_0006260 | 3300049590 | Bacteria | 8592 |
| 1288 | Ga0501074_0095973 | 3300049590 | Bacteria | 2123 |
| 1289 | Ga0501075_0055663 | 3300049591 | Bacteria | 2976 |
| 1290 | Ga0501076_0295040 | 3300049592 | Bacteria | 1328 |
| 1291 | Ga0501076_0483427 | 3300049592 | Bacteria | 1020 |
| 1292 | Ga0501077_0016391 | 3300049593 | Bacteria | 4668 |
| 1293 | Ga0501199_041683 | 3300049650 | Bacteria | 597 |
| 1294 | Ga0501221_080779 | 3300049704 | Bacteria | 782 |
| 1295 | Ga0501079_0039770 | 3300049741 | Bacteria | 3627 |
| 1296 | Ga0501079_0097803 | 3300049741 | Bacteria | 2275 |
| 1297 | Ga0501079_0215745 | 3300049741 | Bacteria | 1499 |
| 1298 | Ga0501079_0310251 | 3300049741 | Bacteria | 1234 |
| 1299 | Ga0501079_0752956 | 3300049741 | Bacteria | 767 |
| 1300 | Ga0501080_0010664 | 3300049742 | Bacteria | 8410 |
| 1301 | Ga0501080_0017932 | 3300049742 | Bacteria | 6551 |
| 1302 | Ga0501080_0313441 | 3300049742 | Bacteria | 1421 |
| 1303 | Ga0501080_1132710 | 3300049742 | Bacteria | 675 |
| 1304 | Ga0501081_0011695 | 3300049743 | Bacteria | 5745 |
| 1305 | Ga0501081_0233551 | 3300049743 | Bacteria | 1340 |
| 1306 | Ga0501081_0937552 | 3300049743 | Bacteria | 653 |
| 1307 | Ga0501081_0950286 | 3300049743 | Bacteria | 649 |
| 1308 | Ga0501083_0003994 | 3300049744 | Bacteria | 10363 |
| 1309 | Ga0501083_0008092 | 3300049744 | Bacteria | 7435 |
| 1310 | Ga0501044_0102376 | 3300049823 | Bacteria | 2880 |
| 1311 | Ga0501045_0008660 | 3300049824 | Bacteria | 7094 |
| 1312 | Ga0501045_0286591 | 3300049824 | Bacteria | 1226 |
| 1313 | nmdc:mga0yw44_16776_c1 | 3300050492 | Bacteria | 3966 |
| 1314 | nmdc:mga06z11_807976_c1 | 3300050494 | Bacteria | 571 |
| 1315 | nmdc:mga05p37_113901_c1 | 3300050507 | Bacteria | 3325 |
| 1316 | nmdc:mga05p37_1202827_c1 | 3300050507 | Bacteria | 783 |
| 1317 | nmdc:mga05p37_124341_c1 | 3300050507 | Bacteria | 3168 |
| 1318 | nmdc:mga05p37_1736243_c1 | 3300050507 | Bacteria | 606 |
| 1319 | nmdc:mga05p37_189208_c1 | 3300050507 | Bacteria | 2500 |
| 1320 | nmdc:mga05p37_24348_c1 | 3300050507 | Bacteria | 7356 |
| 1321 | nmdc:mga05p37_71385_c1 | 3300050507 | Bacteria | 4271 |
| 1322 | nmdc:mga06r32_384355_c1 | 3300050510 | Bacteria | 1386 |
| 1323 | nmdc:mga06r32_388253_c1 | 3300050510 | Bacteria | 1378 |
| 1324 | nmdc:mga06r32_68393_c1 | 3300050510 | Bacteria | 3431 |
| 1325 | nmdc:mga08y16_2126135_c1 | 3300050511 | Bacteria | 509 |
| 1326 | nmdc:mga08y16_317010_c1 | 3300050511 | Bacteria | 1606 |
| 1327 | nmdc:mga08y16_629797_c1 | 3300050511 | Bacteria | 1079 |
| 1328 | nmdc:mga08y16_776026_c1 | 3300050511 | Bacteria | 953 |
| 1329 | nmdc:mga08y16_85257_c1 | 3300050511 | Bacteria | 3292 |
| 1330 | nmdc:mga0n895_1464674_c1 | 3300050512 | Bacteria | 650 |
| 1331 | nmdc:mga0n895_15676_c1 | 3300050512 | Bacteria | 6922 |
| 1332 | nmdc:mga0n895_16554_c1 | 3300050512 | Bacteria | 6770 |
| 1333 | nmdc:mga0n895_1857899_c1 | 3300050512 | Bacteria | 562 |
| 1334 | nmdc:mga0n895_26848_c1 | 3300050512 | Bacteria | 5462 |
| 1335 | nmdc:mga0n895_279002_c1 | 3300050512 | Bacteria | 1694 |
| 1336 | nmdc:mga0n895_339874_c1 | 3300050512 | Bacteria | 1521 |
| 1337 | nmdc:mga0n895_485274_c1 | 3300050512 | Bacteria | 1246 |
| 1338 | nmdc:mga0n895_70715_c1 | 3300050512 | Bacteria | 3459 |
| 1339 | nmdc:mga0rr50_124982_c1 | 3300050513 | Bacteria | 2053 |
| 1340 | nmdc:mga0rr50_268914_c1 | 3300050513 | Bacteria | 1420 |
| 1341 | nmdc:mga0rr50_30376_c1 | 3300050513 | Bacteria | 3825 |
| 1342 | nmdc:mga0rr50_35270_c1 | 3300050513 | Bacteria | 3591 |
| 1343 | nmdc:mga0rr50_84258_c1 | 3300050513 | Bacteria | 2461 |
| 1344 | nmdc:mga08x19_145872_c1 | 3300050514 | Bacteria | 1601 |
| 1345 | nmdc:mga08x19_16014_c1 | 3300050514 | Bacteria | 4568 |
| 1346 | nmdc:mga08x19_418495_c1 | 3300050514 | Bacteria | 941 |
| 1347 | nmdc:mga0a205_1012034_c1 | 3300050515 | Bacteria | 678 |
| 1348 | nmdc:mga0a205_259767_c1 | 3300050515 | Bacteria | 1615 |
| 1349 | nmdc:mga0a205_308681_c1 | 3300050515 | Bacteria | 1454 |
| 1350 | nmdc:mga0a205_426065_c1 | 3300050515 | Bacteria | 1189 |
| 1351 | nmdc:mga0a205_5604_c1 | 3300050515 | Bacteria | 11312 |
| 1352 | nmdc:mga0a205_701067_c1 | 3300050515 | Bacteria | 862 |
| 1353 | nmdc:mga0a205_71904_c1 | 3300050515 | Bacteria | 3341 |
| 1354 | Ga0495601_0189236 | 3300053077 | Bacteria | 1345 |
| 1355 | Ga0495601_0194048 | 3300053077 | Bacteria | 1327 |
| 1356 | Ga0495601_0209665 | 3300053077 | Unclassified | 1273 |
| 1357 | Ga0495601_0221887 | 3300053077 | Bacteria | 1235 |
| 1358 | Ga0495601_0571501 | 3300053077 | Bacteria | 727 |
| 1359 | Ga0495612_0221722 | 3300053078 | Bacteria | 837 |
| 1360 | Ga0495612_0415940 | 3300053078 | Bacteria | 612 |
| 1361 | Ga0495655_0003073 | 3300053083 | Bacteria | 2713 |
| 1362 | Ga0495655_0015831 | 3300053083 | Bacteria | 1612 |
| 1363 | Ga0495595_0019836 | 3300053084 | Bacteria | 2920 |
| 1364 | Ga0495595_0151201 | 3300053084 | Bacteria | 1142 |
| 1365 | Ga0495619_0002519 | 3300053085 | Bacteria | 11984 |
| 1366 | Ga0495619_0003695 | 3300053085 | Bacteria | 9864 |
| 1367 | Ga0495619_0061870 | 3300053085 | Bacteria | 2492 |
| 1368 | Ga0495619_0210496 | 3300053085 | Bacteria | 1346 |
| 1369 | Ga0495619_0870512 | 3300053085 | Bacteria | 607 |
| 1370 | Ga0501084_0026397 | 3300054114 | Bacteria | 4847 |
| 1371 | Ga0501084_1255144 | 3300054114 | Bacteria | 621 |
| 1372 | Ga0587111_0239817 | 3300060346 | Bacteria | 531 |
| 1373 | Ga0501082_0044749 | 3300060353 | Bacteria | 3818 |
| 1374 | Ga0501082_0484782 | 3300060353 | Bacteria | 1081 |
| 1375 | Ga0466962_0011649 | 3300061719 | Bacteria | 4235 |
| 1376 | Ga0466962_0680270 | 3300061719 | Bacteria | 527 |
| 1377 | Ga0530510_0035068 | 3300061734 | Bacteria | 3615 |
| 1378 | Ga0530510_0048047 | 3300061734 | Bacteria | 3084 |
| 1379 | Ga0530510_0152880 | 3300061734 | Bacteria | 1705 |
| 1380 | Ga0530510_0461717 | 3300061734 | Bacteria | 961 |
| 1381 | Ga0530510_0793642 | 3300061734 | Bacteria | 722 |
| 1382 | Ga0114129_10500571 | |||
| 1383 | MBSR1b_contig_8196210 | |||
| 1384 | JGI24747J21853_1041921 | |||
| 1385 | JGI25406J46586_10034431 | |||
| 1386 | JGI25406J46586_10065783 | |||
| 1387 | JGI25407J50210_10005521 | |||
| 1388 | JGI25405J52794_10060577 | |||
| 1389 | Ga0065715_10310659 | |||
| 1390 | Ga0070658_10027533 | |||
| 1391 | Ga0070658_10205359 | |||
| 1392 | Ga0070683_100028738 | |||
| 1393 | Ga0070683_100109334 | |||
| 1394 | Ga0070683_100144217 | |||
| 1395 | Ga0070690_100086906 | |||
| 1396 | Ga0070690_100239565 | |||
| 1397 | Ga0068869_100365020 | |||
| 1398 | Ga0070666_10186662 | |||
| 1399 | Ga0070680_100020146 | |||
| 1400 | Ga0070680_100074652 | |||
| 1401 | Ga0070680_100086829 | |||
| 1402 | Ga0070680_100220356 | |||
| 1403 | Ga0070680_100497855 | |||
| 1404 | Ga0070680_101355810 | |||
| 1405 | Ga0070682_100011854 | |||
| 1406 | Ga0070682_100129367 | |||
| 1407 | Ga0070682_100158894 | |||
| 1408 | Ga0070682_100680474 | |||
| 1409 | Ga0068868_100091207 | |||
| 1410 | Ga0068868_100249289 | |||
| 1411 | Ga0068868_100261899 | |||
| 1412 | Ga0068868_100347627 | |||
| 1413 | Ga0068868_100569146 | |||
| 1414 | Ga0070660_100025497 | |||
| 1415 | Ga0070660_100039151 | |||
| 1416 | Ga0070660_100093127 | |||
| 1417 | Ga0070660_100100614 | |||
| 1418 | Ga0070660_100117138 | |||
| 1419 | Ga0070660_100226515 | |||
| 1420 | Ga0070660_100253017 | |||
| 1421 | Ga0070660_100256025 | |||
| 1422 | Ga0070660_101736008 | |||
| 1423 | Ga0070689_100220175 | |||
| 1424 | Ga0070691_10083346 | |||
| 1425 | Ga0070691_10094382 | |||
| 1426 | Ga0070687_100323837 | |||
| 1427 | Ga0070687_100582966 | |||
| 1428 | Ga0070661_100018487 | |||
| 1429 | Ga0070661_100044759 | |||
| 1430 | Ga0070692_10006261 | |||
| 1431 | Ga0070668_100021194 | |||
| 1432 | Ga0070668_100108719 | |||
| 1433 | Ga0070668_100472256 | |||
| 1434 | Ga0070668_102079980 | |||
| 1435 | Ga0070671_100218615 | |||
| 1436 | Ga0070671_100340718 | |||
| 1437 | Ga0070671_100781158 | |||
| 1438 | Ga0070671_101519258 | |||
| 1439 | Ga0070674_100086170 | |||
| 1440 | Ga0070674_100257276 | |||
| 1441 | Ga0070674_100790452 | |||
| 1442 | Ga0070673_100265748 | |||
| 1443 | Ga0070673_100434473 | |||
| 1444 | Ga0070659_100016721 | |||
| 1445 | Ga0070659_100094269 | |||
| 1446 | Ga0070659_100158398 | |||
| 1447 | Ga0070667_100472056 | |||
| 1448 | Ga0070703_10046689 | |||
| 1449 | Ga0070703_10047299 | |||
| 1450 | Ga0070703_10079077 | |||
| 1451 | Ga0070709_10006587 | |||
| 1452 | Ga0070709_10034201 | |||
| 1453 | Ga0070709_10099171 | |||
| 1454 | Ga0070709_10103968 | |||
| 1455 | Ga0070709_10732047 | |||
| 1456 | Ga0070709_10838728 | |||
| 1457 | Ga0070714_100005237 | |||
| 1458 | Ga0070714_100050235 | |||
| 1459 | Ga0070714_100051953 | |||
| 1460 | Ga0070714_100185886 | |||
| 1461 | Ga0070714_100297562 | |||
| 1462 | Ga0070714_101457132 | |||
| 1463 | Ga0070713_100056532 | |||
| 1464 | Ga0070713_100083666 | |||
| 1465 | Ga0070713_100096128 | |||
| 1466 | Ga0070713_100144011 | |||
| 1467 | Ga0070713_100302409 | |||
| 1468 | Ga0070713_100524200 | |||
| 1469 | Ga0070713_101336096 | |||
| 1470 | Ga0070713_101726315 | |||
| 1471 | Ga0070710_10003032 | |||
| 1472 | Ga0070710_10009506 | |||
| 1473 | Ga0070710_10014447 | |||
| 1474 | Ga0070710_10416883 | |||
| 1475 | Ga0070710_10441531 | |||
| 1476 | Ga0070701_10275443 | |||
| 1477 | Ga0070711_100019866 | |||
| 1478 | Ga0070711_100044424 | |||
| 1479 | Ga0070711_100089644 | |||
| 1480 | Ga0070711_100165900 | |||
| 1481 | Ga0070711_100426520 | |||
| 1482 | Ga0070705_100011065 | |||
| 1483 | Ga0070705_100031123 | |||
| 1484 | Ga0070705_100079973 | |||
| 1485 | Ga0070705_100090805 | |||
| 1486 | Ga0070705_100221861 | |||
| 1487 | Ga0070705_100253019 | |||
| 1488 | Ga0070705_100354773 | |||
| 1489 | Ga0070700_100064267 | |||
| 1490 | Ga0070700_100177475 | |||
| 1491 | Ga0070700_100190919 | |||
| 1492 | Ga0070694_100074046 | |||
| 1493 | Ga0070694_100076455 | |||
| 1494 | Ga0070694_100268088 | |||
| 1495 | Ga0070708_100012205 | |||
| 1496 | Ga0070708_100066279 | |||
| 1497 | Ga0070708_100157978 | |||
| 1498 | Ga0070708_100227388 | |||
| 1499 | Ga0070663_100084260 | |||
| 1500 | Ga0070663_100747910 | |||
| 1501 | Ga0070678_100116096 | |||
| 1502 | Ga0070678_100240151 | |||
| 1503 | Ga0070678_100685467 | |||
| 1504 | Ga0070662_100197225 | |||
| 1505 | Ga0070662_100585723 | |||
| 1506 | Ga0070681_10004219 | |||
| 1507 | Ga0070681_10014911 | |||
| 1508 | Ga0070681_10055054 | |||
| 1509 | Ga0070681_10120630 | |||
| 1510 | Ga0070681_10176439 | |||
| 1511 | Ga0070681_10178446 | |||
| 1512 | Ga0070681_10399397 | |||
| 1513 | Ga0068867_100312247 | |||
| 1514 | Ga0068867_102071842 | |||
| 1515 | Ga0070685_10944697 | |||
| 1516 | Ga0070706_100036001 | |||
| 1517 | Ga0070706_100098069 | |||
| 1518 | Ga0070706_100135165 | |||
| 1519 | Ga0070706_100141141 | |||
| 1520 | Ga0070706_100346508 | |||
| 1521 | Ga0070706_100538667 | |||
| 1522 | Ga0070706_100962745 | |||
| 1523 | Ga0070706_101283749 | |||
| 1524 | Ga0070707_100016804 | |||
| 1525 | Ga0070707_100053981 | |||
| 1526 | Ga0070707_100101977 | |||
| 1527 | Ga0070707_100149545 | |||
| 1528 | Ga0070707_100396327 | |||
| 1529 | Ga0070707_100545323 | |||
| 1530 | Ga0070707_100596831 | |||
| 1531 | Ga0070707_101196729 | |||
| 1532 | Ga0070698_100006283 | |||
| 1533 | Ga0070698_100015109 | |||
| 1534 | Ga0070698_100100817 | |||
| 1535 | Ga0070698_100358243 | |||
| 1536 | Ga0070698_100392000 | |||
| 1537 | Ga0070698_100480331 | |||
| 1538 | Ga0070699_100025094 | |||
| 1539 | Ga0070699_100091440 | |||
| 1540 | Ga0070699_100357421 | |||
| 1541 | Ga0070699_100559168 | |||
| 1542 | Ga0070699_100603372 | |||
| 1543 | Ga0070699_100749852 | |||
| 1544 | Ga0070699_101085745 | |||
| 1545 | Ga0070679_100004023 | |||
| 1546 | Ga0070679_100209144 | |||
| 1547 | Ga0070679_100215699 | |||
| 1548 | Ga0070679_100436496 | |||
| 1549 | Ga0070679_100503592 | |||
| 1550 | Ga0070679_100668294 | |||
| 1551 | Ga0070679_100735322 | |||
| 1552 | Ga0070679_102180851 | |||
| 1553 | Ga0070684_100002479 | |||
| 1554 | Ga0070684_100040856 | |||
| 1555 | Ga0070684_100076582 | |||
| 1556 | Ga0070684_100237398 | |||
| 1557 | Ga0070684_100247593 | |||
| 1558 | Ga0070684_100508510 | |||
| 1559 | Ga0070697_100035623 | |||
| 1560 | Ga0070697_100151562 | |||
| 1561 | Ga0070697_100921746 | |||
| 1562 | Ga0068853_100389633 | |||
| 1563 | Ga0068853_102168421 | |||
| 1564 | Ga0070672_100906604 | |||
| 1565 | Ga0070686_100005989 | |||
| 1566 | Ga0070686_100151468 | |||
| 1567 | Ga0070695_100097687 | |||
| 1568 | Ga0070695_100439746 | |||
| 1569 | Ga0070695_101142318 | |||
| 1570 | Ga0070696_100023110 | |||
| 1571 | Ga0070696_100033647 | |||
| 1572 | Ga0070696_100195083 | |||
| 1573 | Ga0070696_101237586 | |||
| 1574 | Ga0070693_100008935 | |||
| 1575 | Ga0070693_100018392 | |||
| 1576 | Ga0070693_100164666 | |||
| 1577 | Ga0070665_100020268 | |||
| 1578 | Ga0070665_100540819 | |||
| 1579 | Ga0070704_100019791 | |||
| 1580 | Ga0070704_100033533 | |||
| 1581 | Ga0070704_100133967 | |||
| 1582 | Ga0070704_100162677 | |||
| 1583 | Ga0070704_100279449 | |||
| 1584 | Ga0068855_100028306 | |||
| 1585 | Ga0068855_100062747 | |||
| 1586 | Ga0068855_100143718 | |||
| 1587 | Ga0068855_100179058 | |||
| 1588 | Ga0068855_100209484 | |||
| 1589 | Ga0068855_100344866 | |||
| 1590 | Ga0068855_100379454 | |||
| 1591 | Ga0068855_101537228 | |||
| 1592 | Ga0070664_100816125 | |||
| 1593 | Ga0068857_100051525 | |||
| 1594 | Ga0068857_100129177 | |||
| 1595 | Ga0068857_100448074 | |||
| 1596 | Ga0068854_100119899 | |||
| 1597 | Ga0068856_100017118 | |||
| 1598 | Ga0068856_100048316 | |||
| 1599 | Ga0068856_100061541 | |||
| 1600 | Ga0068856_100121826 | |||
| 1601 | Ga0068856_100122137 | |||
| 1602 | Ga0068856_100572685 | |||
| 1603 | Ga0068856_100882186 | |||
| 1604 | Ga0068856_100890480 | |||
| 1605 | Ga0070702_100005135 | |||
| 1606 | Ga0070702_100019094 | |||
| 1607 | Ga0070702_100698750 | |||
| 1608 | Ga0070702_100773839 | |||
| 1609 | Ga0070702_101682956 | |||
| 1610 | Ga0068852_100032780 | |||
| 1611 | Ga0068852_100566556 | |||
| 1612 | Ga0068852_102115805 | |||
| 1613 | Ga0068859_100287283 | |||
| 1614 | Ga0068864_100112808 | |||
| 1615 | Ga0068866_10472078 | |||
| 1616 | Ga0068861_100078913 | |||
| 1617 | Ga0068861_100213411 | |||
| 1618 | Ga0068861_100280481 | |||
| 1619 | Ga0068861_100499391 | |||
| 1620 | Ga0068851_10403203 | |||
| 1621 | Ga0068870_10211784 | |||
| 1622 | Ga0068863_100708604 | |||
| 1623 | Ga0068858_100352251 | |||
| 1624 | Ga0068860_100062023 | |||
| 1625 | Ga0068860_100909699 | |||
| 1626 | Ga0081455_10002297 | |||
| 1627 | Ga0081455_10006733 | |||
| 1628 | Ga0081455_10020921 | |||
| 1629 | Ga0081455_10196193 | |||
| 1630 | Ga0081455_10239902 | |||
| 1631 | Ga0081538_10000846 | |||
| 1632 | Ga0081538_10040639 | |||
| 1633 | Ga0081538_10189688 | |||
| 1634 | Ga0081538_10211161 | |||
| 1635 | Ga0081540_1017827 | |||
| 1636 | Ga0081539_10000507 | |||
| 1637 | Ga0081539_10001238 | |||
| 1638 | Ga0081539_10023804 | |||
| 1639 | Ga0070717_10108601 | |||
| 1640 | Ga0070717_10125075 | |||
| 1641 | Ga0070717_10290831 | |||
| 1642 | Ga0070717_10305486 | |||
| 1643 | Ga0070717_10741650 | |||
| 1644 | Ga0075432_10142104 | |||
| 1645 | Ga0070715_10221757 | |||
| 1646 | Ga0070716_100026479 | |||
| 1647 | Ga0070716_100267057 | |||
| 1648 | Ga0070716_100635326 | |||
| 1649 | Ga0070716_101096848 | |||
| 1650 | Ga0070716_101427467 | |||
| 1651 | Ga0070712_100003082 | |||
| 1652 | Ga0070712_100004222 | |||
| 1653 | Ga0070712_100082246 | |||
| 1654 | Ga0070712_100108115 | |||
| 1655 | Ga0070712_100294245 | |||
| 1656 | Ga0070712_100846649 | |||
| 1657 | Ga0075367_10699339 | |||
| 1658 | Ga0097621_100010449 | |||
| 1659 | Ga0097621_100582823 | |||
| 1660 | Ga0097621_102240153 | |||
| 1661 | Ga0068871_100006687 | |||
| 1662 | Ga0068871_100401595 | |||
| 1663 | Ga0075428_100104128 | |||
| 1664 | Ga0075431_100225761 | |||
| 1665 | Ga0075431_100524280 | |||
| 1666 | Ga0075433_10004067 | |||
| 1667 | Ga0075433_10007343 | |||
| 1668 | Ga0075433_10059100 | |||
| 1669 | Ga0075433_10060441 | |||
| 1670 | Ga0075433_10181655 | |||
| 1671 | Ga0075433_10191098 | |||
| 1672 | Ga0075433_10282451 | |||
| 1673 | Ga0075433_10306240 | |||
| 1674 | Ga0075433_10775967 | |||
| 1675 | Ga0075434_100003308 | |||
| 1676 | Ga0075434_100003953 | |||
| 1677 | Ga0075434_100014330 | |||
| 1678 | Ga0075434_100195352 | |||
| 1679 | Ga0075434_100313256 | |||
| 1680 | Ga0075434_100370592 | |||
| 1681 | Ga0075434_100523235 | |||
| 1682 | Ga0068865_100418738 | |||
| 1683 | Ga0075436_100008952 | |||
| 1684 | Ga0075436_100363470 | |||
| 1685 | Ga0075436_101412613 | |||
| 1686 | Ga0097620_100287270 | |||
| 1687 | Ga0075435_100000846 | |||
| 1688 | Ga0075435_100221037 | |||
| 1689 | Ga0075435_100245784 | |||
| 1690 | Ga0075435_100299354 | |||
| 1691 | Ga0105240_10008131 | |||
| 1692 | Ga0105240_10040896 | |||
| 1693 | Ga0105240_10220310 | |||
| 1694 | Ga0111539_10261522 | |||
| 1695 | Ga0111539_10354267 | |||
| 1696 | Ga0111539_10579765 | |||
| 1697 | Ga0111539_10643560 | |||
| 1698 | Ga0111539_11173029 | |||
| 1699 | Ga0111539_11179011 | |||
| 1700 | Ga0111539_11587858 | |||
| 1701 | Ga0105245_10006942 | |||
| 1702 | Ga0105245_10078256 | |||
| 1703 | Ga0105245_10170357 | |||
| 1704 | Ga0105245_11129314 | |||
| 1705 | Ga0105245_11378914 | |||
| 1706 | Ga0114129_10027574 | |||
| 1707 | Ga0114129_10032758 | |||
| 1708 | Ga0114129_10120193 | |||
| 1709 | Ga0114129_10256855 | |||
| 1710 | Ga0114129_10416036 | |||
| 1711 | Ga0114129_10567095 | |||
| 1712 | Ga0114129_10700201 | |||
| 1713 | Ga0114129_11042303 | |||
| 1714 | Ga0114129_11265653 | |||
| 1715 | Ga0114129_12039917 | |||
| 1716 | Ga0105243_10058011 | |||
| 1717 | Ga0105243_10114589 | |||
| 1718 | Ga0105243_10275549 | |||
| 1719 | Ga0105243_10320132 | |||
| 1720 | Ga0105243_10725119 | |||
| 1721 | Ga0105243_10765506 | |||
| 1722 | Ga0105241_10260254 | |||
| 1723 | Ga0105241_10446374 | |||
| 1724 | Ga0105241_10492275 | |||
| 1725 | Ga0105242_10060572 | |||
| 1726 | Ga0105242_10087070 | |||
| 1727 | Ga0105242_10093210 | |||
| 1728 | Ga0105242_10934042 | |||
| 1729 | Ga0105242_11697412 | |||
| 1730 | Ga0105242_12621083 | |||
| 1731 | Ga0105248_10267142 | |||
| 1732 | Ga0105248_10274145 | |||
| 1733 | Ga0105237_10068736 | |||
| 1734 | Ga0105237_10115595 | |||
| 1735 | Ga0105238_10207977 | |||
| 1736 | Ga0105238_11076443 | |||
| 1737 | Ga0105238_12190442 | |||
| 1738 | Ga0105249_10027922 | |||
| 1739 | Ga0105249_10068878 | |||
| 1740 | Ga0105249_10256367 | |||
| 1741 | Ga0105249_12688714 | |||
| 1742 | Ga0105239_10072622 | |||
| 1743 | Ga0105239_10077471 | |||
| 1744 | Ga0105239_10126638 | |||
| 1745 | Ga0105239_10544536 | |||
| 1746 | Ga0105239_12731735 | |||
| 1747 | Ga0105246_10571538 | |||
| 1748 | Ga0157320_1002867 | |||
| 1749 | Ga0157342_1001558 | |||
| 1750 | Ga0157316_1001790 | |||
| 1751 | Ga0157373_10094937 | |||
| 1752 | Ga0157373_10357910 | |||
| 1753 | Ga0157373_10411231 | |||
| 1754 | Ga0157371_10042431 | |||
| 1755 | Ga0157371_10698948 | |||
| 1756 | Ga0157371_11524391 | |||
| 1757 | Ga0157370_10096349 | |||
| 1758 | Ga0157370_10201675 | |||
| 1759 | Ga0157370_11137686 | |||
| 1760 | Ga0157369_10003497 | |||
| 1761 | Ga0157369_10037478 | |||
| 1762 | Ga0157369_10647115 | |||
| 1763 | Ga0157369_11191326 | |||
| 1764 | Ga0157369_11241977 | |||
| 1765 | Ga0157369_11392307 | |||
| 1766 | Ga0157374_10162879 | |||
| 1767 | Ga0157374_10171528 | |||
| 1768 | Ga0157374_10945873 | |||
| 1769 | Ga0157374_10961585 | |||
| 1770 | Ga0157374_11247376 | |||
| 1771 | Ga0157378_10195953 | |||
| 1772 | Ga0157378_10196888 | |||
| 1773 | Ga0157378_10405741 | |||
| 1774 | Ga0157378_10561688 | |||
| 1775 | Ga0157378_12777974 | |||
| 1776 | Ga0163162_10103595 | |||
| 1777 | Ga0163162_10126250 | |||
| 1778 | Ga0163162_10176454 | |||
| 1779 | Ga0163162_10226819 | |||
| 1780 | Ga0157372_10081506 | |||
| 1781 | Ga0157372_10197317 | |||
| 1782 | Ga0157372_10257024 | |||
| 1783 | Ga0157372_10298690 | |||
| 1784 | Ga0157372_10527467 | |||
| 1785 | Ga0157372_11229399 | |||
| 1786 | Ga0157372_13121880 | |||
| 1787 | Ga0157375_10007650 | |||
| 1788 | Ga0157375_10012741 | |||
| 1789 | Ga0157375_10142205 | |||
| 1790 | Ga0157375_13095999 | |||
| 1791 | Ga0163163_10147449 | |||
| 1792 | Ga0163163_11265458 | |||
| 1793 | Ga0157380_10019505 | |||
| 1794 | Ga0157380_10264081 | |||
| 1795 | Ga0182008_10018808 | |||
| 1796 | Ga0182008_10207442 | |||
| 1797 | Ga0182008_10266511 | |||
| 1798 | Ga0182008_10336185 | |||
| 1799 | Ga0157379_10440067 | |||
| 1800 | Ga0157376_12230508 | |||
| 1801 | Ga0182007_10313482 | |||
| 1802 | Ga0163161_10026579 | |||
| 1803 | Ga0163161_10213108 | |||
| 1804 | Ga0197907_10265393 | |||
| 1805 | Ga0197907_10641453 | |||
| 1806 | Ga0197907_11423151 | |||
| 1807 | Ga0197907_11452201 | |||
| 1808 | Ga0206356_10272360 | |||
| 1809 | Ga0206356_11221232 | |||
| 1810 | Ga0206356_11425914 | |||
| 1811 | Ga0206356_11591861 | |||
| 1812 | Ga0206349_1943878 | |||
| 1813 | Ga0206352_11058662 | |||
| 1814 | Ga0206350_10260564 | |||
| 1815 | Ga0206350_10959082 | |||
| 1816 | Ga0206350_11129946 | |||
| 1817 | Ga0206354_10603899 | |||
| 1818 | Ga0206354_10699304 | |||
| 1819 | Ga0206354_11144221 | |||
| 1820 | Ga0206353_10052694 | |||
| 1821 | Ga0206353_10339933 | |||
| 1822 | Ga0206353_10521650 | |||
| 1823 | Ga0224712_10025166 | |||
| 1824 | Ga0224712_10060436 | |||
| 1825 | Ga0224712_10216120 | |||
| 1826 | Ga0224712_10300791 | |||
| 1827 | Ga0207653_10090446 | |||
| 1828 | Ga0207692_10016063 | |||
| 1829 | Ga0207692_10034019 | |||
| 1830 | Ga0207692_10120747 | |||
| 1831 | Ga0207692_10358469 | |||
| 1832 | Ga0207642_10368867 | |||
| 1833 | Ga0207688_10026467 | |||
| 1834 | Ga0207688_10032388 | |||
| 1835 | Ga0207688_10093523 | |||
| 1836 | Ga0207680_10638132 | |||
| 1837 | Ga0207647_10339269 | |||
| 1838 | Ga0207685_10144143 | |||
| 1839 | Ga0207685_10276141 | |||
| 1840 | Ga0207699_10020008 | |||
| 1841 | Ga0207699_10078590 | |||
| 1842 | Ga0207699_10103036 | |||
| 1843 | Ga0207699_10691621 | |||
| 1844 | Ga0207699_10829343 | |||
| 1845 | Ga0207645_10402493 | |||
| 1846 | Ga0207643_10189172 | |||
| 1847 | Ga0207705_10010732 | |||
| 1848 | Ga0207684_10061997 | |||
| 1849 | Ga0207684_10076503 | |||
| 1850 | Ga0207684_10099479 | |||
| 1851 | Ga0207684_10110240 | |||
| 1852 | Ga0207684_10111501 | |||
| 1853 | Ga0207684_10335794 | |||
| 1854 | Ga0207684_10394306 | |||
| 1855 | Ga0207684_11668302 | |||
| 1856 | Ga0207654_10366045 | |||
| 1857 | Ga0207654_10688857 | |||
| 1858 | Ga0207654_11034558 | |||
| 1859 | Ga0207707_10001354 | |||
| 1860 | Ga0207707_10003861 | |||
| 1861 | Ga0207707_10042069 | |||
| 1862 | Ga0207707_10046668 | |||
| 1863 | Ga0207707_10056887 | |||
| 1864 | Ga0207707_10192233 | |||
| 1865 | Ga0207707_10394929 | |||
| 1866 | Ga0207707_10745913 | |||
| 1867 | Ga0207707_11258799 | |||
| 1868 | Ga0207695_10749663 | |||
| 1869 | Ga0207671_10070774 | |||
| 1870 | Ga0207671_10098911 | |||
| 1871 | Ga0207671_11397149 | |||
| 1872 | Ga0207693_10000904 | |||
| 1873 | Ga0207693_10009282 | |||
| 1874 | Ga0207693_10012860 | |||
| 1875 | Ga0207693_10014992 | |||
| 1876 | Ga0207693_10022102 | |||
| 1877 | Ga0207693_10027012 | |||
| 1878 | Ga0207693_10089272 | |||
| 1879 | Ga0207693_10425544 | |||
| 1880 | Ga0207693_10454954 | |||
| 1881 | Ga0207693_11460057 | |||
| 1882 | Ga0207663_10017287 | |||
| 1883 | Ga0207663_10074898 | |||
| 1884 | Ga0207663_10101378 | |||
| 1885 | Ga0207663_10129839 | |||
| 1886 | Ga0207663_10214123 | |||
| 1887 | Ga0207663_10426262 | |||
| 1888 | Ga0207663_11218069 | |||
| 1889 | Ga0207660_10023024 | |||
| 1890 | Ga0207660_10163050 | |||
| 1891 | Ga0207660_10637111 | |||
| 1892 | Ga0207662_10071015 | |||
| 1893 | Ga0207662_11074803 | |||
| 1894 | Ga0207657_10000184 | |||
| 1895 | Ga0207657_10002804 | |||
| 1896 | Ga0207657_10004538 | |||
| 1897 | Ga0207657_10007538 | |||
| 1898 | Ga0207657_10240309 | |||
| 1899 | Ga0207657_10277082 | |||
| 1900 | Ga0207657_10988657 | |||
| 1901 | Ga0207649_10008900 | |||
| 1902 | Ga0207649_10597200 | |||
| 1903 | Ga0207649_11423614 | |||
| 1904 | Ga0207652_10011232 | |||
| 1905 | Ga0207652_10023918 | |||
| 1906 | Ga0207652_10289027 | |||
| 1907 | Ga0207652_10506977 | |||
| 1908 | Ga0207652_10676894 | |||
| 1909 | Ga0207646_10028151 | |||
| 1910 | Ga0207646_10035768 | |||
| 1911 | Ga0207646_10043340 | |||
| 1912 | Ga0207646_10060856 | |||
| 1913 | Ga0207646_10431051 | |||
| 1914 | Ga0207646_10474276 | |||
| 1915 | Ga0207646_10539484 | |||
| 1916 | Ga0207646_11230540 | |||
| 1917 | Ga0207681_10583127 | |||
| 1918 | Ga0207694_10128958 | |||
| 1919 | Ga0207694_10583786 | |||
| 1920 | Ga0207694_11609030 | |||
| 1921 | Ga0207687_10131213 | |||
| 1922 | Ga0207687_10341865 | |||
| 1923 | Ga0207687_10380828 | |||
| 1924 | Ga0207700_10000021 | |||
| 1925 | Ga0207700_10053729 | |||
| 1926 | Ga0207700_10114392 | |||
| 1927 | Ga0207700_10178373 | |||
| 1928 | Ga0207700_10222043 | |||
| 1929 | Ga0207700_10252626 | |||
| 1930 | Ga0207700_10588705 | |||
| 1931 | Ga0207700_10645433 | |||
| 1932 | Ga0207664_10032332 | |||
| 1933 | Ga0207664_10105163 | |||
| 1934 | Ga0207664_10136480 | |||
| 1935 | Ga0207664_10186739 | |||
| 1936 | Ga0207664_10195761 | |||
| 1937 | Ga0207664_10251499 | |||
| 1938 | Ga0207664_10729637 | |||
| 1939 | Ga0207664_10740329 | |||
| 1940 | Ga0207664_10914460 | |||
| 1941 | Ga0207644_10144007 | |||
| 1942 | Ga0207644_10173740 | |||
| 1943 | Ga0207644_10256110 | |||
| 1944 | Ga0207644_10288098 | |||
| 1945 | Ga0207644_11172042 | |||
| 1946 | Ga0207690_11024368 | |||
| 1947 | Ga0207690_11178670 | |||
| 1948 | Ga0207706_10006148 | |||
| 1949 | Ga0207706_10019996 | |||
| 1950 | Ga0207706_10097474 | |||
| 1951 | Ga0207686_10033719 | |||
| 1952 | Ga0207686_10356579 | |||
| 1953 | Ga0207709_10096948 | |||
| 1954 | Ga0207709_10196011 | |||
| 1955 | Ga0207709_10215511 | |||
| 1956 | Ga0207709_10216688 | |||
| 1957 | Ga0207670_10963817 | |||
| 1958 | Ga0207669_10217363 | |||
| 1959 | Ga0207669_10532406 | |||
| 1960 | Ga0207704_10074766 | |||
| 1961 | Ga0207704_10156200 | |||
| 1962 | Ga0207704_10243710 | |||
| 1963 | Ga0207704_10300051 | |||
| 1964 | Ga0207665_10002447 | |||
| 1965 | Ga0207665_10015388 | |||
| 1966 | Ga0207665_10019402 | |||
| 1967 | Ga0207665_10163720 | |||
| 1968 | Ga0207665_10613651 | |||
| 1969 | Ga0207665_10755088 | |||
| 1970 | Ga0207665_10880596 | |||
| 1971 | Ga0207665_10930366 | |||
| 1972 | Ga0207691_10200980 | |||
| 1973 | Ga0207711_10169406 | |||
| 1974 | Ga0207689_10228543 | |||
| 1975 | Ga0207689_10358942 | |||
| 1976 | Ga0207689_10828605 | |||
| 1977 | Ga0207661_10035043 | |||
| 1978 | Ga0207661_10206510 | |||
| 1979 | Ga0207661_10219198 | |||
| 1980 | Ga0207661_10806346 | |||
| 1981 | Ga0207661_11033274 | |||
| 1982 | Ga0207661_11203957 | |||
| 1983 | Ga0207679_10808426 | |||
| 1984 | Ga0207667_10051598 | |||
| 1985 | Ga0207667_10051953 | |||
| 1986 | Ga0207667_10136181 | |||
| 1987 | Ga0207667_10161367 | |||
| 1988 | Ga0207667_10187508 | |||
| 1989 | Ga0207667_10464023 | |||
| 1990 | Ga0207667_10513984 | |||
| 1991 | Ga0207667_10913419 | |||
| 1992 | Ga0207651_10237438 | |||
| 1993 | Ga0207651_10586271 | |||
| 1994 | Ga0207651_11799258 | |||
| 1995 | Ga0207712_11244186 | |||
| 1996 | Ga0207668_10011321 | |||
| 1997 | Ga0207668_10034893 | |||
| 1998 | Ga0207668_10857073 | |||
| 1999 | Ga0207640_10565383 | |||
| 2000 | Ga0207640_10998271 | |||
| 2001 | Ga0207658_11281416 | |||
| 2002 | Ga0207677_10031710 | |||
| 2003 | Ga0207677_10123174 | |||
| 2004 | Ga0207677_10641665 | |||
| 2005 | Ga0207677_11047191 | |||
| 2006 | Ga0207703_10594467 | |||
| 2007 | Ga0207639_10402215 | |||
| 2008 | Ga0207639_11127795 | |||
| 2009 | Ga0207678_10051414 | |||
| 2010 | Ga0207678_10670033 | |||
| 2011 | Ga0207678_11711526 | |||
| 2012 | Ga0207708_10013961 | |||
| 2013 | Ga0207708_10104859 | |||
| 2014 | Ga0207708_10167539 | |||
| 2015 | Ga0207702_10003936 | |||
| 2016 | Ga0207702_10074556 | |||
| 2017 | Ga0207702_10102338 | |||
| 2018 | Ga0207702_10196393 | |||
| 2019 | Ga0207702_10741682 | |||
| 2020 | Ga0207702_10943294 | |||
| 2021 | Ga0207641_10595568 | |||
| 2022 | Ga0207648_10007972 | |||
| 2023 | Ga0207648_10117415 | |||
| 2024 | Ga0207676_10096950 | |||
| 2025 | Ga0207674_10102554 | |||
| 2026 | Ga0207674_10443408 | |||
| 2027 | Ga0207675_100002893 | |||
| 2028 | Ga0207675_100069684 | |||
| 2029 | Ga0207675_100281463 | |||
| 2030 | Ga0207683_10001031 | |||
| 2031 | Ga0207683_10010677 | |||
| 2032 | Ga0207683_10028491 | |||
| 2033 | Ga0207698_10191171 | |||
| 2034 | Ga0207698_10291247 | |||
| 2035 | Ga0207698_10377167 | |||
| 2036 | Ga0207698_10406284 | |||
| 2037 | Ga0207428_10008568 | |||
| 2038 | Ga0207428_10098259 | |||
| 2039 | Ga0207428_10155499 | |||
| 2040 | Ga0268266_10199771 | |||
| 2041 | Ga0268266_11124358 | |||
| 2042 | Ga0268265_10528520 | |||
| 2043 | Ga0268264_10055175 | |||
| 2044 | Ga0268264_10267363 | |||
| 2045 | Ga0265334_10337018 | |||
| 2046 | Ga0265318_10038049 | |||
| 2047 | Ga0265318_10046438 | |||
| 2048 | Ga0265336_10038696 | |||
| 2049 | Ga0265338_10031578 | |||
| 2050 | Ga0265338_10180982 | |||
| 2051 | Ga0265338_10387738 | |||
| 2052 | Ga0265338_10443678 | |||
| 2053 | Ga0265330_10199572 | |||
| 2054 | Ga0265328_10126025 | |||
| 2055 | Ga0265328_10187641 | |||
| 2056 | Ga0265320_10202667 | |||
| 2057 | Ga0265325_10048762 | |||
| 2058 | Ga0265339_10017308 | |||
| 2059 | Ga0265327_10019521 | |||
| 2060 | Ga0265327_10029963 | |||
| 2061 | Ga0265327_10109282 | |||
| 2062 | Ga0265316_10065555 | |||
| 2063 | Ga0307408_100309779 | |||
| 2064 | Ga0307408_101026743 | |||
| 2065 | Ga0265313_10050557 | |||
| 2066 | Ga0265314_10048768 | |||
| 2067 | Ga0265342_10164349 | |||
| 2068 | Ga0307405_10174576 | |||
| 2069 | Ga0307405_10192785 | |||
| 2070 | Ga0307405_10871180 | |||
| 2071 | Ga0307413_10052816 | |||
| 2072 | Ga0307413_10674132 | |||
| 2073 | Ga0307410_10152033 | |||
| 2074 | Ga0307410_10619365 | |||
| 2075 | Ga0307407_11058201 | |||
| 2076 | Ga0307409_100337672 | |||
| 2077 | Ga0307409_100544504 | |||
| 2078 | Ga0307409_100660504 | |||
| 2079 | Ga0307409_100664432 | |||
| 2080 | Ga0307416_100061803 | |||
| 2081 | Ga0307416_100240958 | |||
| 2082 | Ga0307416_100931263 | |||
| 2083 | Ga0307415_101850350 | |||
| 2084 | Ga0373930_0049651 | |||
| 2085 | Ga0373948_0007549 | |||
| 2086 | Ga0373948_0056990 | |||
| 2087 | Ga0373950_0018240 | |||
| 2088 | Ga0373958_0025987 | |||
| 2089 | Ga0373938_0021063 | |||
| 2090 | Ga0373926_0064783 | |||
| 2091 | Ga0373929_0094118 | |||
| 2092 | Ga0373940_0012740 | |||
| 2093 | Ga0373940_0149089 | |||
| 2094 | Ga0373944_0024652 | |||
| 2095 | Ga0373949_0000662 | |||
| 2096 | Ga0373951_0000538 | |||
| 2097 | Ga0373952_0009778 | |||
| 2098 | Ga0373952_0013174 | |||
| 2099 | Ga0373932_0001682 | |||
| 2100 | Ga0373936_0047909 | |||
| 2101 | Ga0373939_0015150 | |||
| 2102 | Ga0373939_0107504 | |||
| 2103 | Ga0373939_0386717 | |||
| 2104 | Ga0373941_0000882 | |||
| 2105 | Ga0373941_0249839 | |||
| 2106 | Ga0373945_0010260 | |||
| 2107 | Ga0373945_0088335 | |||
| 2108 | Ga0373960_0001637 | |||
| 2109 | Ga0373960_0007747 | |||
| 2110 | Ga0373943_0003220 | |||
| 2111 | Ga0373943_0086719 | |||
| 2112 | Ga0373946_0002121 | |||
| 2113 | Ga0373946_0015005 | |||
| 2114 | Ga0373961_0000784 | |||
| 2115 | Ga0373961_0024249 | |||
| 2116 | Ga0373962_0001116 | |||
| 2117 | Ga0373924_0039647 | |||
| 2118 | Ga0373931_0000222 | |||
| 2119 | Ga0373931_0149948 | |||
| 2120 | Ga0373931_0231654 | |||
| 2121 | Ga0373931_0269744 | |||
| 2122 | Ga0373935_0005754 | |||
| 2123 | Ga0373935_0281985 | |||
| 2124 | Ga0373935_0536847 | |||
| 2125 | Ga0373927_0060280 | |||
| 2126 | Ga0373933_0125630 | |||
| 2127 | Ga0373947_0002612 | |||
| 2128 | Ga0373947_0004365 | |||
| 2129 | Ga0373937_1285774 | |||
| 2130 | Ga0373925_0001472 | |||
| 2131 | Ga0373925_0010538 | |||
| 2132 | Ga0395899_0000775 | |||
| 2133 | Ga0395899_0001813 | |||
| 2134 | Ga0395899_0006817 | |||
| 2135 | Ga0395899_0012282 | |||
| 2136 | Ga0395899_0034532 | |||
| 2137 | Ga0395899_0073005 | |||
| 2138 | Ga0395899_0094306 | |||
| 2139 | Ga0395899_0096764 | |||
| 2140 | Ga0395899_0505838 | |||
| 2141 | Ga0395899_0687527 | |||
| 2142 | Ga0395900_0004133 | |||
| 2143 | Ga0395900_0005363 | |||
| 2144 | Ga0395900_0007148 | |||
| 2145 | Ga0395900_0020594 | |||
| 2146 | Ga0395900_0038826 | |||
| 2147 | Ga0395900_0067289 | |||
| 2148 | Ga0395900_0074403 | |||
| 2149 | Ga0395900_0099068 | |||
| 2150 | Ga0395900_0108894 | |||
| 2151 | Ga0395900_0115328 | |||
| 2152 | Ga0395900_0256367 | |||
| 2153 | Ga0395900_0273380 | |||
| 2154 | Ga0395900_0326597 | |||
| 2155 | Ga0395900_0342290 | |||
| 2156 | Ga0395900_0415209 | |||
| 2157 | Ga0395900_0468489 | |||
| 2158 | Ga0395900_0475561 | |||
| 2159 | Ga0395900_0867641 | |||
| 2160 | Ga0395900_1027731 | |||
| 2161 | Ga0395900_1215260 | |||
| 2162 | Ga0395900_1466662 | |||
| 2163 | Ga0395898_0002274 | |||
| 2164 | Ga0395898_0005883 | |||
| 2165 | Ga0395898_0006991 | |||
| 2166 | Ga0395898_0025659 | |||
| 2167 | Ga0395898_0027356 | |||
| 2168 | Ga0395898_0090777 | |||
| 2169 | Ga0395898_0101460 | |||
| 2170 | Ga0395898_0105496 | |||
| 2171 | Ga0395898_0117493 | |||
| 2172 | Ga0395898_0124509 | |||
| 2173 | Ga0395898_0125032 | |||
| 2174 | Ga0395898_0145487 | |||
| 2175 | Ga0395898_0159860 | |||
| 2176 | Ga0395898_0185903 | |||
| 2177 | Ga0395898_0202572 | |||
| 2178 | Ga0395898_0304489 | |||
| 2179 | Ga0395898_0305631 | |||
| 2180 | Ga0395898_0354286 | |||
| 2181 | Ga0395898_0434384 | |||
| 2182 | Ga0395898_0536135 | |||
| 2183 | Ga0395898_1032307 | |||
| 2184 | Ga0395905_0002088 | |||
| 2185 | Ga0395905_0002224 | |||
| 2186 | Ga0395905_0003522 | |||
| 2187 | Ga0395905_0005811 | |||
| 2188 | Ga0395905_0006331 | |||
| 2189 | Ga0395905_0026503 | |||
| 2190 | Ga0395905_0052037 | |||
| 2191 | Ga0395905_0067136 | |||
| 2192 | Ga0395905_0111883 | |||
| 2193 | Ga0395905_0224743 | |||
| 2194 | Ga0395905_0227552 | |||
| 2195 | Ga0395905_0315425 | |||
| 2196 | Ga0395905_0616132 | |||
| 2197 | Ga0395905_0780434 | |||
| 2198 | Ga0395901_0001042 | |||
| 2199 | Ga0395901_0001441 | |||
| 2200 | Ga0395901_0004925 | |||
| 2201 | Ga0395901_0008564 | |||
| 2202 | Ga0395901_0013286 | |||
| 2203 | Ga0395901_0016741 | |||
| 2204 | Ga0395901_0021670 | |||
| 2205 | Ga0395901_0028496 | |||
| 2206 | Ga0395901_0036414 | |||
| 2207 | Ga0395901_0052123 | |||
| 2208 | Ga0395901_0119098 | |||
| 2209 | Ga0395901_0121997 | |||
| 2210 | Ga0395901_0149855 | |||
| 2211 | Ga0395901_0182602 | |||
| 2212 | Ga0395901_0193833 | |||
| 2213 | Ga0395901_0210642 | |||
| 2214 | Ga0395901_0225762 | |||
| 2215 | Ga0395901_0248212 | |||
| 2216 | Ga0395901_0270640 | |||
| 2217 | Ga0395901_0336388 | |||
| 2218 | Ga0395901_0351737 | |||
| 2219 | Ga0395901_0354905 | |||
| 2220 | Ga0395901_0636056 | |||
| 2221 | Ga0395901_1026506 | |||
| 2222 | Ga0395901_1079464 | |||
| 2223 | Ga0395901_1182533 | |||
| 2224 | Ga0395901_1582920 | |||
| 2225 | Ga0439438_046752 | |||
| 2226 | Ga0439439_0085880 | |||
| 2227 | Ga0439453_0007830 | |||
| 2228 | Ga0439461_0114344 | |||
| 2229 | Ga0451791_0268522 | |||
| 2230 | Ga0451798_0701400 | |||
| 2231 | Ga0451798_1116539 | |||
| 2232 | Ga0451800_0200249 | |||
| 2233 | Ga0451807_2219213 | |||
| 2234 | Ga0451837_1563388 | |||
| 2235 | Ga0451849_0486907 | |||
| 2236 | Ga0451851_1318289 | |||
| 2237 | Ga0451853_1688329 | |||
| 2238 | Ga0451853_4115136 | |||
| 2239 | Ga0439441_018795 | |||
| 2240 | Ga0439448_0008909 | |||
| 2241 | Ga0439448_0027807 | |||
| 2242 | Ga0439450_098505 | |||
| 2243 | Ga0439454_004201 | |||
| 2244 | Ga0439455_0148414 | |||
| 2245 | Ga0450898_033844 | |||
| 2246 | Ga0450902_022469 | |||
| 2247 | Ga0450902_045742 | |||
| 2248 | Ga0450906_072593 | |||
| 2249 | Ga0450907_007964 | |||
| 2250 | Ga0439446_0007985 | |||
| 2251 | Ga0439458_0006778 | |||
| 2252 | Ga0439434_0044110 | |||
| 2253 | Ga0439434_0191952 | |||
| 2254 | Ga0450918_009987 | |||
| 2255 | Ga0451577_0359492 | |||
| 2256 | Ga0466965_0540201 | |||
| 2257 | Ga0466965_0856805 | |||
| 2258 | Ga0466966_0001800 | |||
| 2259 | Ga0466966_0021354 | |||
| 2260 | Ga0466961_0087136 | |||
| 2261 | Ga0466961_0285248 | |||
| 2262 | Ga0466963_0002420 | |||
| 2263 | Ga0466963_0003545 | |||
| 2264 | Ga0466963_0007131 | |||
| 2265 | Ga0466963_0022827 | |||
| 2266 | Ga0466963_0080686 | |||
| 2267 | Ga0466963_0462578 | |||
| 2268 | Ga0466964_0006100 | |||
| 2269 | Ga0466964_0015541 | |||
| 2270 | Ga0466964_0053506 | |||
| 2271 | Ga0466964_0090882 | |||
| 2272 | Ga0466964_0221227 | |||
| 2273 | Ga0466964_0310298 | |||
| 2274 | Ga0466964_0316706 | |||
| 2275 | Ga0466971_0109404 | |||
| 2276 | Ga0466971_0273016 | |||
| 2277 | Ga0466968_0028460 | |||
| 2278 | Ga0466968_0231506 | |||
| 2279 | Ga0466968_0275405 | |||
| 2280 | Ga0466968_0360226 | |||
| 2281 | Ga0466957_0082152 | |||
| 2282 | Ga0466957_0280248 | |||
| 2283 | Ga0466957_0384596 | |||
| 2284 | Ga0466957_0630174 | |||
| 2285 | Ga0466957_0689536 | |||
| 2286 | Ga0466957_0709084 | |||
| 2287 | Ga0466957_0989049 | |||
| 2288 | Ga0466960_0102370 | |||
| 2289 | Ga0466960_0128683 | |||
| 2290 | Ga0466960_0176391 | |||
| 2291 | Ga0466960_0178801 | |||
| 2292 | Ga0466960_0302796 | |||
| 2293 | Ga0466959_0024682 | |||
| 2294 | Ga0466959_0068229 | |||
| 2295 | Ga0466959_0107369 | |||
| 2296 | Ga0466959_0172560 | |||
| 2297 | Ga0466959_0703298 | |||
| 2298 | Ga0451576_0248579 | |||
| 2299 | Ga0466958_0001786 | |||
| 2300 | Ga0466958_0055098 | |||
| 2301 | Ga0466958_0072997 | |||
| 2302 | Ga0466958_0132730 | |||
| 2303 | Ga0466958_0407692 | |||
| 2304 | Ga0466958_0661334 | |||
| 2305 | Ga0466958_0894434 | |||
| 2306 | Ga0466967_0002953 | |||
| 2307 | Ga0466967_0005103 | |||
| 2308 | Ga0466967_0006225 | |||
| 2309 | Ga0466967_0019579 | |||
| 2310 | Ga0466967_0029959 | |||
| 2311 | Ga0466967_0052906 | |||
| 2312 | Ga0466967_0064554 | |||
| 2313 | Ga0466967_0073718 | |||
| 2314 | Ga0466967_0090731 | |||
| 2315 | Ga0466967_0228830 | |||
| 2316 | Ga0466967_0236110 | |||
| 2317 | Ga0466967_0311208 | |||
| 2318 | Ga0466967_0343850 | |||
| 2319 | Ga0466967_0420436 | |||
| 2320 | Ga0466967_0632414 | |||
| 2321 | Ga0466967_0638964 | |||
| 2322 | Ga0466967_0775272 | |||
| 2323 | Ga0466967_2041482 | |||
| 2324 | Ga0495592_0052765 | |||
| 2325 | Ga0495592_0086623 | |||
| 2326 | Ga0495603_0001374 | |||
| 2327 | Ga0495629_0001380 | |||
| 2328 | Ga0495629_0162738 | |||
| 2329 | Ga0495641_0000416 | |||
| 2330 | Ga0495641_0001029 | |||
| 2331 | Ga0495641_0590216 | |||
| 2332 | Ga0495651_0010678 | |||
| 2333 | Ga0495651_0019841 | |||
| 2334 | Ga0495651_0156441 | |||
| 2335 | Ga0495653_0049742 | |||
| 2336 | Ga0495653_0115476 | |||
| 2337 | Ga0495653_0586019 | |||
| 2338 | Ga0495582_0000108 | |||
| 2339 | Ga0495582_0004292 | |||
| 2340 | Ga0495582_0119658 | |||
| 2341 | Ga0495582_0625068 | |||
| 2342 | Ga0495639_0000578 | |||
| 2343 | Ga0495639_0111567 | |||
| 2344 | Ga0495662_0002285 | |||
| 2345 | Ga0495664_0144272 | |||
| 2346 | Ga0495664_0538451 | |||
| 2347 | Ga0495584_0109130 | |||
| 2348 | Ga0495584_0160706 | |||
| 2349 | Ga0495585_0244367 | |||
| 2350 | Ga0495594_0010001 | |||
| 2351 | Ga0495594_0039404 | |||
| 2352 | Ga0495596_0048425 | |||
| 2353 | Ga0495596_0096486 | |||
| 2354 | Ga0495596_0158029 | |||
| 2355 | Ga0495596_0178964 | |||
| 2356 | Ga0495607_0543595 | |||
| 2357 | Ga0495608_0016996 | |||
| 2358 | Ga0495608_0056447 | |||
| 2359 | Ga0495618_0075593 | |||
| 2360 | Ga0495618_0090281 | |||
| 2361 | Ga0495628_0084139 | |||
| 2362 | Ga0495628_0144793 | |||
| 2363 | Ga0495628_1079120 | |||
| 2364 | Ga0495630_0002325 | |||
| 2365 | Ga0495630_0002755 | |||
| 2366 | Ga0495630_0040251 | |||
| 2367 | Ga0495630_0743283 | |||
| 2368 | Ga0495637_0270655 | |||
| 2369 | Ga0495644_0116800 | |||
| 2370 | Ga0495644_0153123 | |||
| 2371 | Ga0495644_0370220 | |||
| 2372 | Ga0495663_0116045 | |||
| 2373 | Ga0495663_0139621 | |||
| 2374 | Ga0495663_0192857 | |||
| 2375 | Ga0495666_0006362 | |||
| 2376 | Ga0495666_0424281 | |||
| 2377 | Ga0495652_0217355 | |||
| 2378 | Ga0495652_0944983 | |||
| 2379 | Ga0495652_1038771 | |||
| 2380 | Ga0495665_0010108 | |||
| 2381 | Ga0495665_0167398 | |||
| 2382 | Ga0495665_0517505 | |||
| 2383 | Ga0495640_0028068 | |||
| 2384 | Ga0495587_0018751 | |||
| 2385 | Ga0495587_0045589 | |||
| 2386 | Ga0495587_0367988 | |||
| 2387 | Ga0495609_0027438 | |||
| 2388 | Ga0495609_0165567 | |||
| 2389 | Ga0495609_0340896 | |||
| 2390 | Ga0495645_0047589 | |||
| 2391 | Ga0495645_0152174 | |||
| 2392 | Ga0495645_0509433 | |||
| 2393 | Ga0495645_0619062 | |||
| 2394 | Ga0495645_0880998 | |||
| 2395 | Ga0495622_0048156 | |||
| 2396 | Ga0495667_0015780 | |||
| 2397 | Ga0495667_0089097 | |||
| 2398 | Ga0495667_0670070 | |||
| 2399 | Ga0495656_0031299 | |||
| 2400 | Ga0495668_0374708 | |||
| 2401 | Ga0495634_0036720 | |||
| 2402 | Ga0495611_0342829 | |||
| 2403 | Ga0495611_0448766 | |||
| 2404 | Ga0495635_0016702 | |||
| 2405 | Ga0495635_0147723 | |||
| 2406 | Ga0495635_0334855 | |||
| 2407 | Ga0495659_0027110 | |||
| 2408 | Ga0495659_0051141 | |||
| 2409 | Ga0495659_0321799 | |||
| 2410 | Ga0495588_0001380 | |||
| 2411 | Ga0495657_0029359 | |||
| 2412 | Ga0495657_0051750 | |||
| 2413 | Ga0495599_0109051 | |||
| 2414 | Ga0495599_0195962 | |||
| 2415 | Ga0495599_0871492 | |||
| 2416 | Ga0495623_0010895 | |||
| 2417 | Ga0495646_0210749 | |||
| 2418 | Ga0495647_0144865 | |||
| 2419 | Ga0495658_0000132 | |||
| 2420 | Ga0495658_0058377 | |||
| 2421 | Ga0495658_0249817 | |||
| 2422 | Ga0495669_0324705 | |||
| 2423 | Ga0495613_0056332 | |||
| 2424 | Ga0495613_0412222 | |||
| 2425 | Ga0495613_0506201 | |||
| 2426 | Ga0495624_0031865 | |||
| 2427 | Ga0495589_0036050 | |||
| 2428 | Ga0495589_0064110 | |||
| 2429 | Ga0495589_0439088 | |||
| 2430 | Ga0495600_0025998 | |||
| 2431 | Ga0495600_0604788 | |||
| 2432 | Ga0495581_0023637 | |||
| 2433 | Ga0495581_0039595 | |||
| 2434 | Ga0495581_0742749 | |||
| 2435 | Ga0495604_0075813 | |||
| 2436 | Ga0495604_0149274 | |||
| 2437 | Ga0495604_0170526 | |||
| 2438 | Ga0495636_0227759 | |||
| 2439 | Ga0495674_0049575 | |||
| 2440 | Ga0495674_0055678 | |||
| 2441 | Ga0495674_0202670 | |||
| 2442 | Ga0495676_0002345 | |||
| 2443 | Ga0495676_0005803 | |||
| 2444 | Ga0495676_0021605 | |||
| 2445 | Ga0495680_0027386 | |||
| 2446 | Ga0495680_0040862 | |||
| 2447 | Ga0495680_0172549 | |||
| 2448 | Ga0495675_0029828 | |||
| 2449 | Ga0495675_0712335 | |||
| 2450 | Ga0495684_0006639 | |||
| 2451 | Ga0495684_0050535 | |||
| 2452 | Ga0495684_0314845 | |||
| 2453 | Ga0495593_0009475 | |||
| 2454 | Ga0495602_0082978 | |||
| 2455 | Ga0495602_0121097 | |||
| 2456 | Ga0495602_0144673 | |||
| 2457 | Ga0495614_0002813 | |||
| 2458 | Ga0496100_0000648 | |||
| 2459 | Ga0496100_0006128 | |||
| 2460 | Ga0496100_0019848 | |||
| 2461 | Ga0496100_0097803 | |||
| 2462 | Ga0496100_0136027 | |||
| 2463 | Ga0496100_0172402 | |||
| 2464 | Ga0496100_0207458 | |||
| 2465 | Ga0496100_0218599 | |||
| 2466 | Ga0496100_0406599 | |||
| 2467 | Ga0496100_0407792 | |||
| 2468 | Ga0496100_0509556 | |||
| 2469 | Ga0496101_0004817 | |||
| 2470 | Ga0496101_0005366 | |||
| 2471 | Ga0496101_0060341 | |||
| 2472 | Ga0496101_0128606 | |||
| 2473 | Ga0496101_0159308 | |||
| 2474 | Ga0496101_0199404 | |||
| 2475 | Ga0496101_0717497 | |||
| 2476 | Ga0496101_1128857 | |||
| 2477 | Ga0496102_0002063 | |||
| 2478 | Ga0496102_0019615 | |||
| 2479 | Ga0496102_0033720 | |||
| 2480 | Ga0496102_0034272 | |||
| 2481 | Ga0496102_0036663 | |||
| 2482 | Ga0496102_0080858 | |||
| 2483 | Ga0496102_0242594 | |||
| 2484 | Ga0496102_0441502 | |||
| 2485 | Ga0496102_0661306 | |||
| 2486 | Ga0496102_1382663 | |||
| 2487 | Ga0496102_1533097 | |||
| 2488 | Ga0496103_0001730 | |||
| 2489 | Ga0496103_0026988 | |||
| 2490 | Ga0496103_0028177 | |||
| 2491 | Ga0496103_0168115 | |||
| 2492 | Ga0496103_0278356 | |||
| 2493 | Ga0496103_0730039 | |||
| 2494 | Ga0496104_0000904 | |||
| 2495 | Ga0496104_0002792 | |||
| 2496 | Ga0496104_0003386 | |||
| 2497 | Ga0496104_0005665 | |||
| 2498 | Ga0496104_0007652 | |||
| 2499 | Ga0496104_0012510 | |||
| 2500 | Ga0496104_0107112 | |||
| 2501 | Ga0496104_0134273 | |||
| 2502 | Ga0496104_0326688 | |||
| 2503 | Ga0496104_0612324 | |||
| 2504 | Ga0496104_0668928 | |||
| 2505 | Ga0496105_0000042 | |||
| 2506 | Ga0496105_0000406 | |||
| 2507 | Ga0496105_0014796 | |||
| 2508 | Ga0496105_0019052 | |||
| 2509 | Ga0496105_0023510 | |||
| 2510 | Ga0496105_0065616 | |||
| 2511 | Ga0496105_0201313 | |||
| 2512 | Ga0496105_1095919 | |||
| 2513 | Ga0496106_0000263 | |||
| 2514 | Ga0496106_0006450 | |||
| 2515 | Ga0496106_0022784 | |||
| 2516 | Ga0496106_0034403 | |||
| 2517 | Ga0496106_0114580 | |||
| 2518 | Ga0496106_0197010 | |||
| 2519 | Ga0496106_0210947 | |||
| 2520 | Ga0496106_0308969 | |||
| 2521 | Ga0496106_0448970 | |||
| 2522 | Ga0496107_0000712 | |||
| 2523 | Ga0496107_0003430 | |||
| 2524 | Ga0496107_0003441 | |||
| 2525 | Ga0496107_0008672 | |||
| 2526 | Ga0496107_0041638 | |||
| 2527 | Ga0496107_0067610 | |||
| 2528 | Ga0496107_0211213 | |||
| 2529 | Ga0496107_0429161 | |||
| 2530 | Ga0496107_0821937 | |||
| 2531 | Ga0496108_0001638 | |||
| 2532 | Ga0496108_0004712 | |||
| 2533 | Ga0496108_0015150 | |||
| 2534 | Ga0496108_0024619 | |||
| 2535 | Ga0496108_0063248 | |||
| 2536 | Ga0496108_0978420 | |||
| 2537 | Ga0496109_0002657 | |||
| 2538 | Ga0496109_0002961 | |||
| 2539 | Ga0496109_0005055 | |||
| 2540 | Ga0496109_0006975 | |||
| 2541 | Ga0496109_0012454 | |||
| 2542 | Ga0496109_0040723 | |||
| 2543 | Ga0496109_0047156 | |||
| 2544 | Ga0496109_0073097 | |||
| 2545 | Ga0496109_0087471 | |||
| 2546 | Ga0496109_0121441 | |||
| 2547 | Ga0496109_0146151 | |||
| 2548 | Ga0496109_0235307 | |||
| 2549 | Ga0496109_0344476 | |||
| 2550 | Ga0496109_0432759 | |||
| 2551 | Ga0496109_0777049 | |||
| 2552 | Ga0496109_1385440 | |||
| 2553 | Ga0496109_1475256 | |||
| 2554 | Ga0496110_0000050 | |||
| 2555 | Ga0496110_0001458 | |||
| 2556 | Ga0496110_0001849 | |||
| 2557 | Ga0496110_0026390 | |||
| 2558 | Ga0496110_0037764 | |||
| 2559 | Ga0496110_0052898 | |||
| 2560 | Ga0496110_0145630 | |||
| 2561 | Ga0496110_0147470 | |||
| 2562 | Ga0496110_0155437 | |||
| 2563 | Ga0496110_0890573 | |||
| 2564 | Ga0496110_0979719 | |||
| 2565 | Ga0496110_0980582 | |||
| 2566 | Ga0496110_1322685 | |||
| 2567 | Ga0496111_0000220 | |||
| 2568 | Ga0496111_0001831 | |||
| 2569 | Ga0496111_0006906 | |||
| 2570 | Ga0496111_0012770 | |||
| 2571 | Ga0496111_0018008 | |||
| 2572 | Ga0496111_0039522 | |||
| 2573 | Ga0496111_0189541 | |||
| 2574 | Ga0496111_0243419 | |||
| 2575 | Ga0496111_0548236 | |||
| 2576 | Ga0496111_0663559 | |||
| 2577 | Ga0496111_0725546 | |||
| 2578 | Ga0496111_0844337 | |||
| 2579 | Ga0496111_1065409 | |||
| 2580 | Ga0496111_1248246 | |||
| 2581 | Ga0496112_0001403 | |||
| 2582 | Ga0496112_0002855 | |||
| 2583 | Ga0496112_0036631 | |||
| 2584 | Ga0496112_0057166 | |||
| 2585 | Ga0496112_0062190 | |||
| 2586 | Ga0496112_0063249 | |||
| 2587 | Ga0496112_0068230 | |||
| 2588 | Ga0496112_0071756 | |||
| 2589 | Ga0496112_0091440 | |||
| 2590 | Ga0496112_0091871 | |||
| 2591 | Ga0496112_0131316 | |||
| 2592 | Ga0496112_0133272 | |||
| 2593 | Ga0496112_0226470 | |||
| 2594 | Ga0496112_0234547 | |||
| 2595 | Ga0496112_0274169 | |||
| 2596 | Ga0496112_0347247 | |||
| 2597 | Ga0496112_0712151 | |||
| 2598 | Ga0496112_1095647 | |||
| 2599 | Ga0496113_0000110 | |||
| 2600 | Ga0496113_0003480 | |||
| 2601 | Ga0496113_0035153 | |||
| 2602 | Ga0496113_0045159 | |||
| 2603 | Ga0496113_0058788 | |||
| 2604 | Ga0496113_0071087 | |||
| 2605 | Ga0496113_0077425 | |||
| 2606 | Ga0496113_0077663 | |||
| 2607 | Ga0496114_0000444 | |||
| 2608 | Ga0496114_0003753 | |||
| 2609 | Ga0496114_0012286 | |||
| 2610 | Ga0496114_0012957 | |||
| 2611 | Ga0496114_0030659 | |||
| 2612 | Ga0496114_0060188 | |||
| 2613 | Ga0496114_0404097 | |||
| 2614 | Ga0496114_0457774 | |||
| 2615 | Ga0496114_0963943 | |||
| 2616 | Ga0496114_1410131 | |||
| 2617 | Ga0496115_0000415 | |||
| 2618 | Ga0496115_0001670 | |||
| 2619 | Ga0496115_0025304 | |||
| 2620 | Ga0496115_0046506 | |||
| 2621 | Ga0496115_0081441 | |||
| 2622 | Ga0496115_0104624 | |||
| 2623 | Ga0501291_076113 | |||
| 2624 | Ga0501031_0005395 | |||
| 2625 | Ga0501031_0072297 | |||
| 2626 | Ga0501031_0232321 | |||
| 2627 | Ga0501032_0023411 | |||
| 2628 | Ga0501033_0004771 | |||
| 2629 | Ga0501034_0031025 | |||
| 2630 | Ga0501034_0675337 | |||
| 2631 | Ga0501036_0013360 | |||
| 2632 | Ga0501036_1047061 | |||
| 2633 | Ga0501037_0003648 | |||
| 2634 | Ga0501038_0032198 | |||
| 2635 | Ga0501038_0175546 | |||
| 2636 | Ga0501039_0017450 | |||
| 2637 | Ga0501039_0754646 | |||
| 2638 | Ga0501040_0005743 | |||
| 2639 | Ga0501040_0443348 | |||
| 2640 | Ga0501041_0011812 | |||
| 2641 | Ga0501041_0174846 | |||
| 2642 | Ga0501042_0057144 | |||
| 2643 | Ga0501042_0260677 | |||
| 2644 | Ga0501043_0007710 | |||
| 2645 | Ga0501046_0009343 | |||
| 2646 | Ga0501046_0133718 | |||
| 2647 | Ga0501046_0772023 | |||
| 2648 | Ga0501048_0053476 | |||
| 2649 | Ga0501048_0383988 | |||
| 2650 | Ga0501067_0003757 | |||
| 2651 | Ga0501067_0073589 | |||
| 2652 | Ga0501067_0122816 | |||
| 2653 | Ga0501067_0275991 | |||
| 2654 | Ga0501068_0001136 | |||
| 2655 | Ga0501068_0678600 | |||
| 2656 | Ga0501068_0892325 | |||
| 2657 | Ga0501069_0039402 | |||
| 2658 | Ga0501069_0053703 | |||
| 2659 | Ga0501069_0084769 | |||
| 2660 | Ga0501069_0837446 | |||
| 2661 | Ga0501070_0008199 | |||
| 2662 | Ga0501070_0013400 | |||
| 2663 | Ga0501071_0265474 | |||
| 2664 | Ga0501072_0051023 | |||
| 2665 | Ga0501073_0010236 | |||
| 2666 | Ga0501073_0063712 | |||
| 2667 | Ga0501074_0004394 | |||
| 2668 | Ga0501074_0006260 | |||
| 2669 | Ga0501074_0095973 | |||
| 2670 | Ga0501075_0055663 | |||
| 2671 | Ga0501076_0295040 | |||
| 2672 | Ga0501076_0483427 | |||
| 2673 | Ga0501077_0016391 | |||
| 2674 | Ga0501199_041683 | |||
| 2675 | Ga0501221_080779 | |||
| 2676 | Ga0501079_0039770 | |||
| 2677 | Ga0501079_0097803 | |||
| 2678 | Ga0501079_0215745 | |||
| 2679 | Ga0501079_0310251 | |||
| 2680 | Ga0501079_0752956 | |||
| 2681 | Ga0501080_0010664 | |||
| 2682 | Ga0501080_0017932 | |||
| 2683 | Ga0501080_0313441 | |||
| 2684 | Ga0501080_1132710 | |||
| 2685 | Ga0501081_0011695 | |||
| 2686 | Ga0501081_0233551 | |||
| 2687 | Ga0501081_0937552 | |||
| 2688 | Ga0501081_0950286 | |||
| 2689 | Ga0501083_0003994 | |||
| 2690 | Ga0501083_0008092 | |||
| 2691 | Ga0501044_0102376 | |||
| 2692 | Ga0501045_0008660 | |||
| 2693 | Ga0501045_0286591 | |||
| 2694 | nmdc:mga0yw44_16776_c1 | |||
| 2695 | nmdc:mga06z11_807976_c1 | |||
| 2696 | nmdc:mga05p37_113901_c1 | |||
| 2697 | nmdc:mga05p37_1202827_c1 | |||
| 2698 | nmdc:mga05p37_124341_c1 | |||
| 2699 | nmdc:mga05p37_1736243_c1 | |||
| 2700 | nmdc:mga05p37_189208_c1 | |||
| 2701 | nmdc:mga05p37_24348_c1 | |||
| 2702 | nmdc:mga05p37_71385_c1 | |||
| 2703 | nmdc:mga06r32_384355_c1 | |||
| 2704 | nmdc:mga06r32_388253_c1 | |||
| 2705 | nmdc:mga06r32_68393_c1 | |||
| 2706 | nmdc:mga08y16_2126135_c1 | |||
| 2707 | nmdc:mga08y16_317010_c1 | |||
| 2708 | nmdc:mga08y16_629797_c1 | |||
| 2709 | nmdc:mga08y16_776026_c1 | |||
| 2710 | nmdc:mga08y16_85257_c1 | |||
| 2711 | nmdc:mga0n895_1464674_c1 | |||
| 2712 | nmdc:mga0n895_15676_c1 | |||
| 2713 | nmdc:mga0n895_16554_c1 | |||
| 2714 | nmdc:mga0n895_1857899_c1 | |||
| 2715 | nmdc:mga0n895_26848_c1 | |||
| 2716 | nmdc:mga0n895_279002_c1 | |||
| 2717 | nmdc:mga0n895_339874_c1 | |||
| 2718 | nmdc:mga0n895_485274_c1 | |||
| 2719 | nmdc:mga0n895_70715_c1 | |||
| 2720 | nmdc:mga0rr50_124982_c1 | |||
| 2721 | nmdc:mga0rr50_268914_c1 | |||
| 2722 | nmdc:mga0rr50_30376_c1 | |||
| 2723 | nmdc:mga0rr50_35270_c1 | |||
| 2724 | nmdc:mga0rr50_84258_c1 | |||
| 2725 | nmdc:mga08x19_145872_c1 | |||
| 2726 | nmdc:mga08x19_16014_c1 | |||
| 2727 | nmdc:mga08x19_418495_c1 | |||
| 2728 | nmdc:mga0a205_1012034_c1 | |||
| 2729 | nmdc:mga0a205_259767_c1 | |||
| 2730 | nmdc:mga0a205_308681_c1 | |||
| 2731 | nmdc:mga0a205_426065_c1 | |||
| 2732 | nmdc:mga0a205_5604_c1 | |||
| 2733 | nmdc:mga0a205_701067_c1 | |||
| 2734 | nmdc:mga0a205_71904_c1 | |||
| 2735 | Ga0495601_0189236 | |||
| 2736 | Ga0495601_0194048 | |||
| 2737 | Ga0495601_0209665 | |||
| 2738 | Ga0495601_0221887 | |||
| 2739 | Ga0495601_0571501 | |||
| 2740 | Ga0495612_0221722 | |||
| 2741 | Ga0495612_0415940 | |||
| 2742 | Ga0495655_0003073 | |||
| 2743 | Ga0495655_0015831 | |||
| 2744 | Ga0495595_0019836 | |||
| 2745 | Ga0495595_0151201 | |||
| 2746 | Ga0495619_0002519 | |||
| 2747 | Ga0495619_0003695 | |||
| 2748 | Ga0495619_0061870 | |||
| 2749 | Ga0495619_0210496 | |||
| 2750 | Ga0495619_0870512 | |||
| 2751 | Ga0501084_0026397 | |||
| 2752 | Ga0501084_1255144 | |||
| 2753 | Ga0587111_0239817 | |||
| 2754 | Ga0501082_0044749 | |||
| 2755 | Ga0501082_0484782 | |||
| 2756 | Ga0466962_0011649 | |||
| 2757 | Ga0466962_0680270 | |||
| 2758 | Ga0530510_0035068 | |||
| 2759 | Ga0530510_0048047 | |||
| 2760 | Ga0530510_0152880 | |||
| 2761 | Ga0530510_0461717 | |||
| 2762 | Ga0530510_0793642 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9756 | 2 | 141 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9696 | 2 | 141 |
| 1t3q-assembly1.cif.gz_D | crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 | 0.9664 | 2 | 140 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9657 | 2 | 141 |
| 5y6q-assembly1.cif.gz_A | crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 | 0.9641 | 2 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9832 | 2 | 72 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9744 | 2 | 70 | 3.10.20.30 |
| 3hrdH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9733 | 78 | 141 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9727 | 77 | 141 | 1.10.150.120 |
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.971 | 77 | 141 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538ACY4-F1-model_v4 | (2Fe-2S)-binding protein | 0.9998 | 22 | 143 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A537ZX30-F1-model_v4 | (2Fe-2S)-binding protein | 0.9965 | 2 | 143 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A538K606-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9959 | 2 | 143 |
GO:0016491
GO:0016787 GO:0046872 GO:0051537 |
| AF-A0A537Z314-F1-model_v4 | (2Fe-2S)-binding protein | 0.995 | 2 | 143 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A852ZH92-F1-model_v4 | Aerobic-type carbon monoxide dehydrogenase small subunit (CoxS/CutS family) | 0.9926 | 2 | 143 |
GO:0016491
GO:0046872 GO:0051537 |