F493515

General Info

Members Datasets Scaffolds Average Seq Length
1381 425 2762 144

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10500571|Ga0114129_105005712
Length 169
Sequence VPELELSVNGETRLVDLPVGTSLAAVLRESLGLTGTKIACNEGHCGACTVQIDGVPTLSCITLAHRVRGEVTTIEGLRDHPLIDAFVRADAVQCGFCTPGQVVSAAALVAANPDPGLDEIRHRMAGNICRCGTYPRIEEAILYWRGWSAPRRRSKAASRTCGSSSRRIP

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
109 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
110 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
203 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
207 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
224 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
225 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
226 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
232 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
233 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
234 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
238 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
261 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
264 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
267 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
268 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
273 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
274 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
275 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
276 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
277 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
278 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
279 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
280 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
311 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
317 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
318 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
319 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
320 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
321 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
322 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
339 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
372 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
373 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
389 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
390 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
391 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
394 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
395 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
396 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
397 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
398 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
399 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
400 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
404 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
405 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
411 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
414 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
425 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 12.31
Rhizosphere 87.11
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10500571 3300009147 Bacteria 1587
2 MBSR1b_contig_8196210 2162886012 Bacteria 803
3 JGI24747J21853_1041921 3300001978 Bacteria 544
4 JGI25406J46586_10034431 3300003203 Bacteria 1859
5 JGI25406J46586_10065783 3300003203 Bacteria 1154
6 JGI25407J50210_10005521 3300003373 Bacteria 3113
7 JGI25405J52794_10060577 3300003911 Bacteria 818
8 Ga0065715_10310659 3300005293 Bacteria 1021
9 Ga0070658_10027533 3300005327 Bacteria 4560
10 Ga0070658_10205359 3300005327 Bacteria 1663
11 Ga0070683_100028738 3300005329 Bacteria 5028
12 Ga0070683_100109334 3300005329 Bacteria 2607
13 Ga0070683_100144217 3300005329 Bacteria 2256
14 Ga0070690_100086906 3300005330 Bacteria 2053
15 Ga0070690_100239565 3300005330 Bacteria 1279
16 Ga0068869_100365020 3300005334 Bacteria 1180
17 Ga0070666_10186662 3300005335 Bacteria 1456
18 Ga0070680_100020146 3300005336 Bacteria 5291
19 Ga0070680_100074652 3300005336 Bacteria 2790
20 Ga0070680_100086829 3300005336 Bacteria 2586
21 Ga0070680_100220356 3300005336 Bacteria 1601
22 Ga0070680_100497855 3300005336 Bacteria 1042
23 Ga0070680_101355810 3300005336 Bacteria 616
24 Ga0070682_100011854 3300005337 Bacteria 4987
25 Ga0070682_100129367 3300005337 Bacteria 1707
26 Ga0070682_100158894 3300005337 Bacteria 1559
27 Ga0070682_100680474 3300005337 Bacteria 822
28 Ga0068868_100091207 3300005338 Bacteria 2455
29 Ga0068868_100249289 3300005338 Bacteria 1494
30 Ga0068868_100261899 3300005338 Bacteria 1458
31 Ga0068868_100347627 3300005338 Bacteria 1269
32 Ga0068868_100569146 3300005338 Bacteria 1001
33 Ga0070660_100025497 3300005339 Bacteria 4394
34 Ga0070660_100039151 3300005339 Bacteria 3602
35 Ga0070660_100093127 3300005339 Bacteria 2379
36 Ga0070660_100100614 3300005339 Bacteria 2290
37 Ga0070660_100117138 3300005339 Bacteria 2124
38 Ga0070660_100226515 3300005339 Bacteria 1520
39 Ga0070660_100253017 3300005339 Bacteria 1437
40 Ga0070660_100256025 3300005339 Bacteria 1428
41 Ga0070660_101736008 3300005339 Bacteria 532
42 Ga0070689_100220175 3300005340 Bacteria 1557
43 Ga0070691_10083346 3300005341 Bacteria 1568
44 Ga0070691_10094382 3300005341 Bacteria 1479
45 Ga0070687_100323837 3300005343 Bacteria 986
46 Ga0070687_100582966 3300005343 Bacteria 766
47 Ga0070661_100018487 3300005344 Bacteria 4954
48 Ga0070661_100044759 3300005344 Bacteria 3234
49 Ga0070692_10006261 3300005345 Bacteria 5156
50 Ga0070668_100021194 3300005347 Bacteria 4912
51 Ga0070668_100108719 3300005347 Bacteria 2206
52 Ga0070668_100472256 3300005347 Bacteria 1082
53 Ga0070668_102079980 3300005347 Bacteria 524
54 Ga0070671_100218615 3300005355 Bacteria 1616
55 Ga0070671_100340718 3300005355 Bacteria 1279
56 Ga0070671_100781158 3300005355 Bacteria 831
57 Ga0070671_101519258 3300005355 Bacteria 593
58 Ga0070674_100086170 3300005356 Bacteria 2255
59 Ga0070674_100257276 3300005356 Bacteria 1374
60 Ga0070674_100790452 3300005356 Bacteria 819
61 Ga0070673_100265748 3300005364 Bacteria 1500
62 Ga0070673_100434473 3300005364 Bacteria 1179
63 Ga0070659_100016721 3300005366 Bacteria 5511
64 Ga0070659_100094269 3300005366 Bacteria 2403
65 Ga0070659_100158398 3300005366 Bacteria 1850
66 Ga0070667_100472056 3300005367 Bacteria 1148
67 Ga0070703_10046689 3300005406 Bacteria 1370
68 Ga0070703_10047299 3300005406 Bacteria 1362
69 Ga0070703_10079077 3300005406 Bacteria 1116
70 Ga0070709_10006587 3300005434 Bacteria 6335
71 Ga0070709_10034201 3300005434 Bacteria 3080
72 Ga0070709_10099171 3300005434 Bacteria 1937
73 Ga0070709_10103968 3300005434 Bacteria 1897
74 Ga0070709_10732047 3300005434 Bacteria 772
75 Ga0070709_10838728 3300005434 Bacteria 723
76 Ga0070714_100005237 3300005435 Bacteria 9879
77 Ga0070714_100050235 3300005435 Bacteria 3551
78 Ga0070714_100051953 3300005435 Bacteria 3495
79 Ga0070714_100185886 3300005435 Bacteria 1893
80 Ga0070714_100297562 3300005435 Bacteria 1503
81 Ga0070714_101457132 3300005435 Bacteria 669
82 Ga0070713_100056532 3300005436 Bacteria 3264
83 Ga0070713_100083666 3300005436 Bacteria 2728
84 Ga0070713_100096128 3300005436 Bacteria 2557
85 Ga0070713_100144011 3300005436 Bacteria 2113
86 Ga0070713_100302409 3300005436 Bacteria 1473
87 Ga0070713_100524200 3300005436 Bacteria 1120
88 Ga0070713_101336096 3300005436 Bacteria 695
89 Ga0070713_101726315 3300005436 Bacteria 608
90 Ga0070710_10003032 3300005437 Bacteria 7987
91 Ga0070710_10009506 3300005437 Bacteria 4757
92 Ga0070710_10014447 3300005437 Bacteria 3977
93 Ga0070710_10416883 3300005437 Bacteria 903
94 Ga0070710_10441531 3300005437 Bacteria 880
95 Ga0070701_10275443 3300005438 Bacteria 1025
96 Ga0070711_100019866 3300005439 Bacteria 4319
97 Ga0070711_100044424 3300005439 Bacteria 3016
98 Ga0070711_100089644 3300005439 Bacteria 2213
99 Ga0070711_100165900 3300005439 Bacteria 1679
100 Ga0070711_100426520 3300005439 Bacteria 1081
101 Ga0070705_100011065 3300005440 Bacteria 4538
102 Ga0070705_100031123 3300005440 Bacteria 2952
103 Ga0070705_100079973 3300005440 Bacteria 2004
104 Ga0070705_100090805 3300005440 Bacteria 1902
105 Ga0070705_100221861 3300005440 Bacteria 1309
106 Ga0070705_100253019 3300005440 Bacteria 1238
107 Ga0070705_100354773 3300005440 Bacteria 1070
108 Ga0070700_100064267 3300005441 Bacteria 2324
109 Ga0070700_100177475 3300005441 Bacteria 1480
110 Ga0070700_100190919 3300005441 Bacteria 1432
111 Ga0070694_100074046 3300005444 Bacteria 2353
112 Ga0070694_100076455 3300005444 Bacteria 2318
113 Ga0070694_100268088 3300005444 Bacteria 1297
114 Ga0070708_100012205 3300005445 Bacteria 7007
115 Ga0070708_100066279 3300005445 Bacteria 3241
116 Ga0070708_100157978 3300005445 Bacteria 2112
117 Ga0070708_100227388 3300005445 Bacteria 1750
118 Ga0070663_100084260 3300005455 Bacteria 2343
119 Ga0070663_100747910 3300005455 Bacteria 834
120 Ga0070678_100116096 3300005456 Bacteria 2103
121 Ga0070678_100240151 3300005456 Bacteria 1514
122 Ga0070678_100685467 3300005456 Bacteria 922
123 Ga0070662_100197225 3300005457 Bacteria 1595
124 Ga0070662_100585723 3300005457 Bacteria 937
125 Ga0070681_10004219 3300005458 Bacteria 13620
126 Ga0070681_10014911 3300005458 Bacteria 7728
127 Ga0070681_10055054 3300005458 Bacteria 3963
128 Ga0070681_10120630 3300005458 Bacteria 2557
129 Ga0070681_10176439 3300005458 Bacteria 2059
130 Ga0070681_10178446 3300005458 Bacteria 2046
131 Ga0070681_10399397 3300005458 Bacteria 1286
132 Ga0068867_100312247 3300005459 Bacteria 1299
133 Ga0068867_102071842 3300005459 Bacteria 539
134 Ga0070685_10944697 3300005466 Bacteria 644
135 Ga0070706_100036001 3300005467 Bacteria 4571
136 Ga0070706_100098069 3300005467 Bacteria 2723
137 Ga0070706_100135165 3300005467 Bacteria 2302
138 Ga0070706_100141141 3300005467 Bacteria 2249
139 Ga0070706_100346508 3300005467 Bacteria 1385
140 Ga0070706_100538667 3300005467 Bacteria 1086
141 Ga0070706_100962745 3300005467 Bacteria 788
142 Ga0070706_101283749 3300005467 Bacteria 672
143 Ga0070707_100016804 3300005468 Bacteria 6871
144 Ga0070707_100053981 3300005468 Bacteria 3852
145 Ga0070707_100101977 3300005468 Bacteria 2781
146 Ga0070707_100149545 3300005468 Bacteria 2274
147 Ga0070707_100396327 3300005468 Bacteria 1340
148 Ga0070707_100545323 3300005468 Bacteria 1122
149 Ga0070707_100596831 3300005468 Bacteria 1067
150 Ga0070707_101196729 3300005468 Bacteria 726
151 Ga0070698_100006283 3300005471 Bacteria 12909
152 Ga0070698_100015109 3300005471 Bacteria 8163
153 Ga0070698_100100817 3300005471 Bacteria 2860
154 Ga0070698_100358243 3300005471 Bacteria 1390
155 Ga0070698_100392000 3300005471 Bacteria 1322
156 Ga0070698_100480331 3300005471 Bacteria 1180
157 Ga0070699_100025094 3300005518 Bacteria 5139
158 Ga0070699_100091440 3300005518 Bacteria 2660
159 Ga0070699_100357421 3300005518 Bacteria 1316
160 Ga0070699_100559168 3300005518 Bacteria 1042
161 Ga0070699_100603372 3300005518 Bacteria 1001
162 Ga0070699_100749852 3300005518 Bacteria 893
163 Ga0070699_101085745 3300005518 Bacteria 734
164 Ga0070679_100004023 3300005530 Bacteria 13548
165 Ga0070679_100209144 3300005530 Bacteria 1915
166 Ga0070679_100215699 3300005530 Bacteria 1881
167 Ga0070679_100436496 3300005530 Bacteria 1254
168 Ga0070679_100503592 3300005530 Bacteria 1155
169 Ga0070679_100668294 3300005530 Bacteria 981
170 Ga0070679_100735322 3300005530 Bacteria 929
171 Ga0070679_102180851 3300005530 Bacteria 504
172 Ga0070684_100002479 3300005535 Bacteria 13597
173 Ga0070684_100040856 3300005535 Bacteria 3995
174 Ga0070684_100076582 3300005535 Bacteria 2952
175 Ga0070684_100237398 3300005535 Bacteria 1665
176 Ga0070684_100247593 3300005535 Bacteria 1629
177 Ga0070684_100508510 3300005535 Bacteria 1116
178 Ga0070697_100035623 3300005536 Bacteria 4015
179 Ga0070697_100151562 3300005536 Bacteria 1954
180 Ga0070697_100921746 3300005536 Bacteria 775
181 Ga0068853_100389633 3300005539 Bacteria 1302
182 Ga0068853_102168421 3300005539 Bacteria 539
183 Ga0070672_100906604 3300005543 Bacteria 779
184 Ga0070686_100005989 3300005544 Bacteria 6746
185 Ga0070686_100151468 3300005544 Bacteria 1625
186 Ga0070695_100097687 3300005545 Bacteria 1972
187 Ga0070695_100439746 3300005545 Bacteria 997
188 Ga0070695_101142318 3300005545 Bacteria 639
189 Ga0070696_100023110 3300005546 Bacteria 4226
190 Ga0070696_100033647 3300005546 Bacteria 3523
191 Ga0070696_100195083 3300005546 Bacteria 1509
192 Ga0070696_101237586 3300005546 Bacteria 632
193 Ga0070693_100008935 3300005547 Bacteria 4969
194 Ga0070693_100018392 3300005547 Bacteria 3649
195 Ga0070693_100164666 3300005547 Bacteria 1415
196 Ga0070665_100020268 3300005548 Bacteria 6676
197 Ga0070665_100540819 3300005548 Bacteria 1177
198 Ga0070704_100019791 3300005549 Bacteria 4330
199 Ga0070704_100033533 3300005549 Bacteria 3472
200 Ga0070704_100133967 3300005549 Bacteria 1925
201 Ga0070704_100162677 3300005549 Bacteria 1766
202 Ga0070704_100279449 3300005549 Bacteria 1382
203 Ga0068855_100028306 3300005563 Bacteria 6703
204 Ga0068855_100062747 3300005563 Bacteria 4338
205 Ga0068855_100143718 3300005563 Bacteria 2717
206 Ga0068855_100179058 3300005563 Bacteria 2398
207 Ga0068855_100209484 3300005563 Bacteria 2191
208 Ga0068855_100344866 3300005563 Bacteria 1641
209 Ga0068855_100379454 3300005563 Bacteria 1552
210 Ga0068855_101537228 3300005563 Bacteria 682
211 Ga0070664_100816125 3300005564 Bacteria 873
212 Ga0068857_100051525 3300005577 Bacteria 3652
213 Ga0068857_100129177 3300005577 Bacteria 2278
214 Ga0068857_100448074 3300005577 Bacteria 1206
215 Ga0068854_100119899 3300005578 Bacteria 1995
216 Ga0068856_100017118 3300005614 Bacteria 7027
217 Ga0068856_100048316 3300005614 Bacteria 4192
218 Ga0068856_100061541 3300005614 Bacteria 3708
219 Ga0068856_100121826 3300005614 Bacteria 2610
220 Ga0068856_100122137 3300005614 Bacteria 2606
221 Ga0068856_100572685 3300005614 Bacteria 1150
222 Ga0068856_100882186 3300005614 Bacteria 913
223 Ga0068856_100890480 3300005614 Bacteria 909
224 Ga0070702_100005135 3300005615 Bacteria 6060
225 Ga0070702_100019094 3300005615 Bacteria 3568
226 Ga0070702_100698750 3300005615 Bacteria 773
227 Ga0070702_100773839 3300005615 Bacteria 740
228 Ga0070702_101682956 3300005615 Bacteria 527
229 Ga0068852_100032780 3300005616 Bacteria 4305
230 Ga0068852_100566556 3300005616 Bacteria 1137
231 Ga0068852_102115805 3300005616 Bacteria 584
232 Ga0068859_100287283 3300005617 Bacteria 1738
233 Ga0068864_100112808 3300005618 Bacteria 2423
234 Ga0068866_10472078 3300005718 Bacteria 825
235 Ga0068861_100078913 3300005719 Bacteria 2572
236 Ga0068861_100213411 3300005719 Bacteria 1627
237 Ga0068861_100280481 3300005719 Bacteria 1435
238 Ga0068861_100499391 3300005719 Bacteria 1099
239 Ga0068851_10403203 3300005834 Bacteria 805
240 Ga0068870_10211784 3300005840 Bacteria 1181
241 Ga0068863_100708604 3300005841 Bacteria 1001
242 Ga0068858_100352251 3300005842 Bacteria 1410
243 Ga0068860_100062023 3300005843 Bacteria 3552
244 Ga0068860_100909699 3300005843 Bacteria 896
245 Ga0081455_10002297 3300005937 Bacteria 22779
246 Ga0081455_10006733 3300005937 Bacteria 12270
247 Ga0081455_10020921 3300005937 Bacteria 6148
248 Ga0081455_10196193 3300005937 Bacteria 1516
249 Ga0081455_10239902 3300005937 Bacteria 1333
250 Ga0081538_10000846 3300005981 Bacteria 33031
251 Ga0081538_10040639 3300005981 Bacteria 2963
252 Ga0081538_10189688 3300005981 Bacteria 865
253 Ga0081538_10211161 3300005981 Bacteria 782
254 Ga0081540_1017827 3300005983 Bacteria 4380
255 Ga0081539_10000507 3300005985 Bacteria 80978
256 Ga0081539_10001238 3300005985 Bacteria 45456
257 Ga0081539_10023804 3300005985 Bacteria 3997
258 Ga0070717_10108601 3300006028 Bacteria 2364
259 Ga0070717_10125075 3300006028 Bacteria 2207
260 Ga0070717_10290831 3300006028 Bacteria 1451
261 Ga0070717_10305486 3300006028 Bacteria 1415
262 Ga0070717_10741650 3300006028 Bacteria 893
263 Ga0075432_10142104 3300006058 Bacteria 917
264 Ga0070715_10221757 3300006163 Bacteria 972
265 Ga0070716_100026479 3300006173 Bacteria 3106
266 Ga0070716_100267057 3300006173 Bacteria 1174
267 Ga0070716_100635326 3300006173 Bacteria 807
268 Ga0070716_101096848 3300006173 Bacteria 635
269 Ga0070716_101427467 3300006173 Bacteria 563
270 Ga0070712_100003082 3300006175 Bacteria 10296
271 Ga0070712_100004222 3300006175 Bacteria 8840
272 Ga0070712_100082246 3300006175 Bacteria 2335
273 Ga0070712_100108115 3300006175 Bacteria 2070
274 Ga0070712_100294245 3300006175 Bacteria 1312
275 Ga0070712_100846649 3300006175 Bacteria 786
276 Ga0075367_10699339 3300006178 Bacteria 645
277 Ga0097621_100010449 3300006237 Bacteria 6798
278 Ga0097621_100582823 3300006237 Bacteria 1021
279 Ga0097621_102240153 3300006237 Bacteria 523
280 Ga0068871_100006687 3300006358 Bacteria 8181
281 Ga0068871_100401595 3300006358 Bacteria 1220
282 Ga0075428_100104128 3300006844 Bacteria 3094
283 Ga0075431_100225761 3300006847 Bacteria 1909
284 Ga0075431_100524280 3300006847 Bacteria 1174
285 Ga0075433_10004067 3300006852 Bacteria 11331
286 Ga0075433_10007343 3300006852 Bacteria 8745
287 Ga0075433_10059100 3300006852 Bacteria 3354
288 Ga0075433_10060441 3300006852 Bacteria 3318
289 Ga0075433_10181655 3300006852 Bacteria 1872
290 Ga0075433_10191098 3300006852 Bacteria 1821
291 Ga0075433_10282451 3300006852 Bacteria 1470
292 Ga0075433_10306240 3300006852 Bacteria 1406
293 Ga0075433_10775967 3300006852 Bacteria 838
294 Ga0075434_100003308 3300006871 Bacteria 14404
295 Ga0075434_100003953 3300006871 Bacteria 13273
296 Ga0075434_100014330 3300006871 Bacteria 7578
297 Ga0075434_100195352 3300006871 Bacteria 2043
298 Ga0075434_100313256 3300006871 Bacteria 1590
299 Ga0075434_100370592 3300006871 Bacteria 1453
300 Ga0075434_100523235 3300006871 Bacteria 1206
301 Ga0068865_100418738 3300006881 Bacteria 1101
302 Ga0075436_100008952 3300006914 Bacteria 6852
303 Ga0075436_100363470 3300006914 Bacteria 1044
304 Ga0075436_101412613 3300006914 Bacteria 528
305 Ga0097620_100287270 3300006931 Bacteria 1738
306 Ga0075435_100000846 3300007076 Bacteria 19132
307 Ga0075435_100221037 3300007076 Bacteria 1608
308 Ga0075435_100245784 3300007076 Bacteria 1522
309 Ga0075435_100299354 3300007076 Bacteria 1375
310 Ga0105240_10008131 3300009093 Bacteria 15049
311 Ga0105240_10040896 3300009093 Bacteria 5923
312 Ga0105240_10220310 3300009093 Bacteria 2211
313 Ga0111539_10261522 3300009094 Bacteria 2014
314 Ga0111539_10354267 3300009094 Bacteria 1708
315 Ga0111539_10579765 3300009094 Bacteria 1306
316 Ga0111539_10643560 3300009094 Bacteria 1234
317 Ga0111539_11173029 3300009094 Bacteria 892
318 Ga0111539_11179011 3300009094 Bacteria 890
319 Ga0111539_11587858 3300009094 Bacteria 759
320 Ga0105245_10006942 3300009098 Bacteria 9925
321 Ga0105245_10078256 3300009098 Bacteria 3017
322 Ga0105245_10170357 3300009098 Bacteria 2073
323 Ga0105245_11129314 3300009098 Bacteria 830
324 Ga0105245_11378914 3300009098 Bacteria 755
325 Ga0114129_10027574 3300009147 Bacteria 8042
326 Ga0114129_10032758 3300009147 Bacteria 7344
327 Ga0114129_10120193 3300009147 Bacteria 3618
328 Ga0114129_10256855 3300009147 Bacteria 2344
329 Ga0114129_10416036 3300009147 Bacteria 1769
330 Ga0114129_10567095 3300009147 Bacteria 1474
331 Ga0114129_10700201 3300009147 Bacteria 1302
332 Ga0114129_11042303 3300009147 Bacteria 1027
333 Ga0114129_11265653 3300009147 Bacteria 916
334 Ga0114129_12039917 3300009147 Bacteria 693
335 Ga0105243_10058011 3300009148 Bacteria 3084
336 Ga0105243_10114589 3300009148 Bacteria 2262
337 Ga0105243_10275549 3300009148 Bacteria 1513
338 Ga0105243_10320132 3300009148 Bacteria 1413
339 Ga0105243_10725119 3300009148 Bacteria 972
340 Ga0105243_10765506 3300009148 Bacteria 948
341 Ga0105241_10260254 3300009174 Bacteria 1474
342 Ga0105241_10446374 3300009174 Bacteria 1143
343 Ga0105241_10492275 3300009174 Bacteria 1092
344 Ga0105242_10060572 3300009176 Bacteria 3111
345 Ga0105242_10087070 3300009176 Bacteria 2622
346 Ga0105242_10093210 3300009176 Bacteria 2539
347 Ga0105242_10934042 3300009176 Bacteria 870
348 Ga0105242_11697412 3300009176 Bacteria 668
349 Ga0105242_12621083 3300009176 Bacteria 553
350 Ga0105248_10267142 3300009177 Bacteria 1926
351 Ga0105248_10274145 3300009177 Bacteria 1899
352 Ga0105237_10068736 3300009545 Bacteria 3536
353 Ga0105237_10115595 3300009545 Bacteria 2676
354 Ga0105238_10207977 3300009551 Bacteria 1933
355 Ga0105238_11076443 3300009551 Bacteria 826
356 Ga0105238_12190442 3300009551 Bacteria 587
357 Ga0105249_10027922 3300009553 Bacteria 5094
358 Ga0105249_10068878 3300009553 Bacteria 3264
359 Ga0105249_10256367 3300009553 Bacteria 1736
360 Ga0105249_12688714 3300009553 Bacteria 570
361 Ga0105239_10072622 3300010375 Bacteria 3783
362 Ga0105239_10077471 3300010375 Bacteria 3658
363 Ga0105239_10126638 3300010375 Bacteria 2839
364 Ga0105239_10544536 3300010375 Bacteria 1321
365 Ga0105239_12731735 3300010375 Bacteria 576
366 Ga0105246_10571538 3300011119 Bacteria 972
367 Ga0157320_1002867 3300012481 Bacteria 1007
368 Ga0157342_1001558 3300012507 Bacteria 1728
369 Ga0157316_1001790 3300012510 Bacteria 1387
370 Ga0157373_10094937 3300013100 Bacteria 2099
371 Ga0157373_10357910 3300013100 Bacteria 1042
372 Ga0157373_10411231 3300013100 Bacteria 970
373 Ga0157371_10042431 3300013102 Bacteria 3242
374 Ga0157371_10698948 3300013102 Bacteria 759
375 Ga0157371_11524391 3300013102 Bacteria 522
376 Ga0157370_10096349 3300013104 Bacteria 2776
377 Ga0157370_10201675 3300013104 Bacteria 1845
378 Ga0157370_11137686 3300013104 Bacteria 705
379 Ga0157369_10003497 3300013105 Bacteria 18655
380 Ga0157369_10037478 3300013105 Bacteria 5308
381 Ga0157369_10647115 3300013105 Bacteria 1090
382 Ga0157369_11191326 3300013105 Bacteria 777
383 Ga0157369_11241977 3300013105 Bacteria 760
384 Ga0157369_11392307 3300013105 Bacteria 714
385 Ga0157374_10162879 3300013296 Bacteria 2173
386 Ga0157374_10171528 3300013296 Bacteria 2116
387 Ga0157374_10945873 3300013296 Bacteria 880
388 Ga0157374_10961585 3300013296 Bacteria 873
389 Ga0157374_11247376 3300013296 Bacteria 765
390 Ga0157378_10195953 3300013297 Bacteria 1908
391 Ga0157378_10196888 3300013297 Bacteria 1904
392 Ga0157378_10405741 3300013297 Bacteria 1344
393 Ga0157378_10561688 3300013297 Bacteria 1148
394 Ga0157378_12777974 3300013297 Bacteria 542
395 Ga0163162_10103595 3300013306 Bacteria 2940
396 Ga0163162_10126250 3300013306 Bacteria 2665
397 Ga0163162_10176454 3300013306 Bacteria 2262
398 Ga0163162_10226819 3300013306 Bacteria 1998
399 Ga0157372_10081506 3300013307 Bacteria 3663
400 Ga0157372_10197317 3300013307 Bacteria 2331
401 Ga0157372_10257024 3300013307 Bacteria 2028
402 Ga0157372_10298690 3300013307 Bacteria 1873
403 Ga0157372_10527467 3300013307 Bacteria 1376
404 Ga0157372_11229399 3300013307 Bacteria 865
405 Ga0157372_13121880 3300013307 Bacteria 529
406 Ga0157375_10007650 3300013308 Bacteria 9451
407 Ga0157375_10012741 3300013308 Bacteria 7464
408 Ga0157375_10142205 3300013308 Bacteria 2527
409 Ga0157375_13095999 3300013308 Bacteria 555
410 Ga0163163_10147449 3300014325 Bacteria 2397
411 Ga0163163_11265458 3300014325 Bacteria 800
412 Ga0157380_10019505 3300014326 Bacteria 5053
413 Ga0157380_10264081 3300014326 Bacteria 1565
414 Ga0182008_10018808 3300014497 Bacteria 3574
415 Ga0182008_10207442 3300014497 Bacteria 999
416 Ga0182008_10266511 3300014497 Bacteria 887
417 Ga0182008_10336185 3300014497 Bacteria 798
418 Ga0157379_10440067 3300014968 Bacteria 1202
419 Ga0157376_12230508 3300014969 Bacteria 586
420 Ga0182007_10313482 3300015262 Bacteria 579
421 Ga0163161_10026579 3300017792 Bacteria 4099
422 Ga0163161_10213108 3300017792 Bacteria 1493
423 Ga0197907_10265393 3300020069 Bacteria 1779
424 Ga0197907_10641453 3300020069 Bacteria 2010
425 Ga0197907_11423151 3300020069 Bacteria 2611
426 Ga0197907_11452201 3300020069 Bacteria 2320
427 Ga0206356_10272360 3300020070 Bacteria 3160
428 Ga0206356_11221232 3300020070 Bacteria 917
429 Ga0206356_11425914 3300020070 Bacteria 2612
430 Ga0206356_11591861 3300020070 Bacteria 2062
431 Ga0206349_1943878 3300020075 Bacteria 1145
432 Ga0206352_11058662 3300020078 Bacteria 804
433 Ga0206350_10260564 3300020080 Bacteria 690
434 Ga0206350_10959082 3300020080 Bacteria 1085
435 Ga0206350_11129946 3300020080 Bacteria 2329
436 Ga0206354_10603899 3300020081 Bacteria 559
437 Ga0206354_10699304 3300020081 Bacteria 685
438 Ga0206354_11144221 3300020081 Bacteria 739
439 Ga0206353_10052694 3300020082 Bacteria 905
440 Ga0206353_10339933 3300020082 Bacteria 3473
441 Ga0206353_10521650 3300020082 Bacteria 1431
442 Ga0224712_10025166 3300022467 Bacteria 2089
443 Ga0224712_10060436 3300022467 Bacteria 1508
444 Ga0224712_10216120 3300022467 Bacteria 876
445 Ga0224712_10300791 3300022467 Bacteria 750
446 Ga0207653_10090446 3300025885 Bacteria 1071
447 Ga0207692_10016063 3300025898 Bacteria 3305
448 Ga0207692_10034019 3300025898 Bacteria 2464
449 Ga0207692_10120747 3300025898 Bacteria 1467
450 Ga0207692_10358469 3300025898 Bacteria 901
451 Ga0207642_10368867 3300025899 Bacteria 851
452 Ga0207688_10026467 3300025901 Bacteria 3189
453 Ga0207688_10032388 3300025901 Bacteria 2889
454 Ga0207688_10093523 3300025901 Bacteria 1729
455 Ga0207680_10638132 3300025903 Bacteria 762
456 Ga0207647_10339269 3300025904 Bacteria 852
457 Ga0207685_10144143 3300025905 Bacteria 1071
458 Ga0207685_10276141 3300025905 Bacteria 823
459 Ga0207699_10020008 3300025906 Bacteria 3580
460 Ga0207699_10078590 3300025906 Bacteria 2038
461 Ga0207699_10103036 3300025906 Bacteria 1815
462 Ga0207699_10691621 3300025906 Bacteria 746
463 Ga0207699_10829343 3300025906 Bacteria 680
464 Ga0207645_10402493 3300025907 Bacteria 921
465 Ga0207643_10189172 3300025908 Bacteria 1249
466 Ga0207705_10010732 3300025909 Bacteria 6650
467 Ga0207684_10061997 3300025910 Bacteria 3175
468 Ga0207684_10076503 3300025910 Bacteria 2845
469 Ga0207684_10099479 3300025910 Bacteria 2484
470 Ga0207684_10110240 3300025910 Bacteria 2356
471 Ga0207684_10111501 3300025910 Bacteria 2341
472 Ga0207684_10335794 3300025910 Bacteria 1301
473 Ga0207684_10394306 3300025910 Bacteria 1190
474 Ga0207684_11668302 3300025910 Bacteria 514
475 Ga0207654_10366045 3300025911 Bacteria 996
476 Ga0207654_10688857 3300025911 Bacteria 734
477 Ga0207654_11034558 3300025911 Bacteria 598
478 Ga0207707_10001354 3300025912 Bacteria 22790
479 Ga0207707_10003861 3300025912 Bacteria 13289
480 Ga0207707_10042069 3300025912 Bacteria 3989
481 Ga0207707_10046668 3300025912 Bacteria 3773
482 Ga0207707_10056887 3300025912 Bacteria 3404
483 Ga0207707_10192233 3300025912 Bacteria 1780
484 Ga0207707_10394929 3300025912 Bacteria 1188
485 Ga0207707_10745913 3300025912 Bacteria 819
486 Ga0207707_11258799 3300025912 Unclassified 596
487 Ga0207695_10749663 3300025913 Bacteria 857
488 Ga0207671_10070774 3300025914 Bacteria 2601
489 Ga0207671_10098911 3300025914 Bacteria 2207
490 Ga0207671_11397149 3300025914 Bacteria 543
491 Ga0207693_10000904 3300025915 Bacteria 26637
492 Ga0207693_10009282 3300025915 Bacteria 8027
493 Ga0207693_10012860 3300025915 Bacteria 6754
494 Ga0207693_10014992 3300025915 Bacteria 6222
495 Ga0207693_10022102 3300025915 Bacteria 5059
496 Ga0207693_10027012 3300025915 Bacteria 4540
497 Ga0207693_10089272 3300025915 Bacteria 2415
498 Ga0207693_10425544 3300025915 Bacteria 1038
499 Ga0207693_10454954 3300025915 Bacteria 1000
500 Ga0207693_11460057 3300025915 Bacteria 506
501 Ga0207663_10017287 3300025916 Bacteria 4015
502 Ga0207663_10074898 3300025916 Unclassified 2195
503 Ga0207663_10101378 3300025916 Bacteria 1934
504 Ga0207663_10129839 3300025916 Bacteria 1739
505 Ga0207663_10214123 3300025916 Bacteria 1398
506 Ga0207663_10426262 3300025916 Bacteria 1019
507 Ga0207663_11218069 3300025916 Bacteria 606
508 Ga0207660_10023024 3300025917 Bacteria 4204
509 Ga0207660_10163050 3300025917 Bacteria 1721
510 Ga0207660_10637111 3300025917 Bacteria 869
511 Ga0207662_10071015 3300025918 Bacteria 2107
512 Ga0207662_11074803 3300025918 Bacteria 572
513 Ga0207657_10000184 3300025919 Bacteria 64813
514 Ga0207657_10002804 3300025919 Bacteria 18753
515 Ga0207657_10004538 3300025919 Bacteria 14672
516 Ga0207657_10007538 3300025919 Bacteria 11153
517 Ga0207657_10240309 3300025919 Bacteria 1446
518 Ga0207657_10277082 3300025919 Bacteria 1332
519 Ga0207657_10988657 3300025919 Bacteria 646
520 Ga0207649_10008900 3300025920 Bacteria 5482
521 Ga0207649_10597200 3300025920 Bacteria 849
522 Ga0207649_11423614 3300025920 Bacteria 548
523 Ga0207652_10011232 3300025921 Bacteria 7214
524 Ga0207652_10023918 3300025921 Bacteria 5066
525 Ga0207652_10289027 3300025921 Bacteria 1479
526 Ga0207652_10506977 3300025921 Bacteria 1086
527 Ga0207652_10676894 3300025921 Bacteria 922
528 Ga0207646_10028151 3300025922 Bacteria 5117
529 Ga0207646_10035768 3300025922 Bacteria 4484
530 Ga0207646_10043340 3300025922 Bacteria 4042
531 Ga0207646_10060856 3300025922 Bacteria 3371
532 Ga0207646_10431051 3300025922 Bacteria 1190
533 Ga0207646_10474276 3300025922 Bacteria 1128
534 Ga0207646_10539484 3300025922 Bacteria 1049
535 Ga0207646_11230540 3300025922 Bacteria 656
536 Ga0207681_10583127 3300025923 Bacteria 923
537 Ga0207694_10128958 3300025924 Bacteria 2026
538 Ga0207694_10583786 3300025924 Bacteria 939
539 Ga0207694_11609030 3300025924 Bacteria 547
540 Ga0207687_10131213 3300025927 Bacteria 1889
541 Ga0207687_10341865 3300025927 Bacteria 1217
542 Ga0207687_10380828 3300025927 Bacteria 1156
543 Ga0207700_10000021 3300025928 Bacteria 168335
544 Ga0207700_10053729 3300025928 Bacteria 3020
545 Ga0207700_10114392 3300025928 Bacteria 2177
546 Ga0207700_10178373 3300025928 Bacteria 1777
547 Ga0207700_10222043 3300025928 Bacteria 1602
548 Ga0207700_10252626 3300025928 Bacteria 1507
549 Ga0207700_10588705 3300025928 Bacteria 989
550 Ga0207700_10645433 3300025928 Bacteria 944
551 Ga0207664_10032332 3300025929 Bacteria 4009
552 Ga0207664_10105163 3300025929 Bacteria 2339
553 Ga0207664_10136480 3300025929 Bacteria 2070
554 Ga0207664_10186739 3300025929 Bacteria 1782
555 Ga0207664_10195761 3300025929 Bacteria 1742
556 Ga0207664_10251499 3300025929 Bacteria 1542
557 Ga0207664_10729637 3300025929 Bacteria 891
558 Ga0207664_10740329 3300025929 Bacteria 884
559 Ga0207664_10914460 3300025929 Bacteria 788
560 Ga0207644_10144007 3300025931 Bacteria 1838
561 Ga0207644_10173740 3300025931 Bacteria 1684
562 Ga0207644_10256110 3300025931 Bacteria 1398
563 Ga0207644_10288098 3300025931 Bacteria 1320
564 Ga0207644_11172042 3300025931 Bacteria 646
565 Ga0207690_11024368 3300025932 Bacteria 687
566 Ga0207690_11178670 3300025932 Bacteria 639
567 Ga0207706_10006148 3300025933 Bacteria 11150
568 Ga0207706_10019996 3300025933 Bacteria 6015
569 Ga0207706_10097474 3300025933 Bacteria 2586
570 Ga0207686_10033719 3300025934 Bacteria 3058
571 Ga0207686_10356579 3300025934 Bacteria 1102
572 Ga0207709_10096948 3300025935 Bacteria 1941
573 Ga0207709_10196011 3300025935 Bacteria 1439
574 Ga0207709_10215511 3300025935 Bacteria 1381
575 Ga0207709_10216688 3300025935 Bacteria 1378
576 Ga0207670_10963817 3300025936 Bacteria 716
577 Ga0207669_10217363 3300025937 Bacteria 1400
578 Ga0207669_10532406 3300025937 Bacteria 945
579 Ga0207704_10074766 3300025938 Bacteria 2164
580 Ga0207704_10156200 3300025938 Bacteria 1617
581 Ga0207704_10243710 3300025938 Bacteria 1345
582 Ga0207704_10300051 3300025938 Bacteria 1230
583 Ga0207665_10002447 3300025939 Bacteria 12534
584 Ga0207665_10015388 3300025939 Bacteria 5023
585 Ga0207665_10019402 3300025939 Bacteria 4470
586 Ga0207665_10163720 3300025939 Bacteria 1602
587 Ga0207665_10613651 3300025939 Bacteria 850
588 Ga0207665_10755088 3300025939 Bacteria 767
589 Ga0207665_10880596 3300025939 Bacteria 710
590 Ga0207665_10930366 3300025939 Bacteria 690
591 Ga0207691_10200980 3300025940 Bacteria 1735
592 Ga0207711_10169406 3300025941 Bacteria 1981
593 Ga0207689_10228543 3300025942 Bacteria 1538
594 Ga0207689_10358942 3300025942 Bacteria 1212
595 Ga0207689_10828605 3300025942 Bacteria 781
596 Ga0207661_10035043 3300025944 Bacteria 3908
597 Ga0207661_10206510 3300025944 Bacteria 1729
598 Ga0207661_10219198 3300025944 Bacteria 1681
599 Ga0207661_10806346 3300025944 Bacteria 864
600 Ga0207661_11033274 3300025944 Bacteria 757
601 Ga0207661_11203957 3300025944 Bacteria 697
602 Ga0207679_10808426 3300025945 Bacteria 855
603 Ga0207667_10051598 3300025949 Bacteria 4335
604 Ga0207667_10051953 3300025949 Bacteria 4319
605 Ga0207667_10136181 3300025949 Bacteria 2529
606 Ga0207667_10161367 3300025949 Bacteria 2305
607 Ga0207667_10187508 3300025949 Bacteria 2123
608 Ga0207667_10464023 3300025949 Bacteria 1286
609 Ga0207667_10513984 3300025949 Bacteria 1214
610 Ga0207667_10913419 3300025949 Bacteria 869
611 Ga0207651_10237438 3300025960 Bacteria 1484
612 Ga0207651_10586271 3300025960 Bacteria 973
613 Ga0207651_11799258 3300025960 Bacteria 551
614 Ga0207712_11244186 3300025961 Bacteria 665
615 Ga0207668_10011321 3300025972 Bacteria 5415
616 Ga0207668_10034893 3300025972 Bacteria 3345
617 Ga0207668_10857073 3300025972 Bacteria 807
618 Ga0207640_10565383 3300025981 Bacteria 958
619 Ga0207640_10998271 3300025981 Bacteria 736
620 Ga0207658_11281416 3300025986 Bacteria 670
621 Ga0207677_10031710 3300026023 Bacteria 3387
622 Ga0207677_10123174 3300026023 Bacteria 1954
623 Ga0207677_10641665 3300026023 Bacteria 936
624 Ga0207677_11047191 3300026023 Bacteria 742
625 Ga0207703_10594467 3300026035 Bacteria 1046
626 Ga0207639_10402215 3300026041 Bacteria 1234
627 Ga0207639_11127795 3300026041 Bacteria 736
628 Ga0207678_10051414 3300026067 Bacteria 3557
629 Ga0207678_10670033 3300026067 Bacteria 912
630 Ga0207678_11711526 3300026067 Bacteria 552
631 Ga0207708_10013961 3300026075 Bacteria 6000
632 Ga0207708_10104859 3300026075 Bacteria 2191
633 Ga0207708_10167539 3300026075 Bacteria 1738
634 Ga0207702_10003936 3300026078 Bacteria 13350
635 Ga0207702_10074556 3300026078 Bacteria 2929
636 Ga0207702_10102338 3300026078 Bacteria 2531
637 Ga0207702_10196393 3300026078 Bacteria 1868
638 Ga0207702_10741682 3300026078 Bacteria 969
639 Ga0207702_10943294 3300026078 Bacteria 855
640 Ga0207641_10595568 3300026088 Bacteria 1082
641 Ga0207648_10007972 3300026089 Bacteria 10331
642 Ga0207648_10117415 3300026089 Bacteria 2338
643 Ga0207676_10096950 3300026095 Bacteria 2435
644 Ga0207674_10102554 3300026116 Bacteria 2841
645 Ga0207674_10443408 3300026116 Bacteria 1255
646 Ga0207675_100002893 3300026118 Bacteria 16878
647 Ga0207675_100069684 3300026118 Bacteria 3287
648 Ga0207675_100281463 3300026118 Bacteria 1616
649 Ga0207683_10001031 3300026121 Bacteria 25414
650 Ga0207683_10010677 3300026121 Bacteria 7828
651 Ga0207683_10028491 3300026121 Bacteria 4829
652 Ga0207698_10191171 3300026142 Bacteria 1823
653 Ga0207698_10291247 3300026142 Bacteria 1515
654 Ga0207698_10377167 3300026142 Bacteria 1348
655 Ga0207698_10406284 3300026142 Bacteria 1303
656 Ga0207428_10008568 3300027907 Bacteria 9228
657 Ga0207428_10098259 3300027907 Bacteria 2266
658 Ga0207428_10155499 3300027907 Bacteria 1739
659 Ga0268266_10199771 3300028379 Bacteria 1829
660 Ga0268266_11124358 3300028379 Bacteria 760
661 Ga0268265_10528520 3300028380 Bacteria 1116
662 Ga0268264_10055175 3300028381 Bacteria 3320
663 Ga0268264_10267363 3300028381 Bacteria 1596
664 Ga0265334_10337018 3300028573 Bacteria 516
665 Ga0265318_10038049 3300028577 Bacteria 1841
666 Ga0265318_10046438 3300028577 Bacteria 1639
667 Ga0265336_10038696 3300028666 Bacteria 1463
668 Ga0265338_10031578 3300028800 Bacteria 5189
669 Ga0265338_10180982 3300028800 Bacteria 1607
670 Ga0265338_10387738 3300028800 Bacteria 998
671 Ga0265338_10443678 3300028800 Bacteria 920
672 Ga0265330_10199572 3300031235 Bacteria 846
673 Ga0265328_10126025 3300031239 Bacteria 957
674 Ga0265328_10187641 3300031239 Bacteria 783
675 Ga0265320_10202667 3300031240 Bacteria 886
676 Ga0265325_10048762 3300031241 Bacteria 2188
677 Ga0265339_10017308 3300031249 Bacteria 4272
678 Ga0265327_10019521 3300031251 Bacteria 4163
679 Ga0265327_10029963 3300031251 Bacteria 3086
680 Ga0265327_10109282 3300031251 Bacteria 1324
681 Ga0265316_10065555 3300031344 Bacteria 2812
682 Ga0307408_100309779 3300031548 Bacteria 1326
683 Ga0307408_101026743 3300031548 Bacteria 761
684 Ga0265313_10050557 3300031595 Bacteria 1993
685 Ga0265314_10048768 3300031711 Bacteria 2969
686 Ga0265342_10164349 3300031712 Bacteria 1225
687 Ga0307405_10174576 3300031731 Bacteria 1536
688 Ga0307405_10192785 3300031731 Bacteria 1473
689 Ga0307405_10871180 3300031731 Bacteria 760
690 Ga0307413_10052816 3300031824 Bacteria 2457
691 Ga0307413_10674132 3300031824 Bacteria 856
692 Ga0307410_10152033 3300031852 Bacteria 1724
693 Ga0307410_10619365 3300031852 Bacteria 905
694 Ga0307407_11058201 3300031903 Bacteria 629
695 Ga0307409_100337672 3300031995 Bacteria 1416
696 Ga0307409_100544504 3300031995 Bacteria 1138
697 Ga0307409_100660504 3300031995 Bacteria 1040
698 Ga0307409_100664432 3300031995 Bacteria 1037
699 Ga0307416_100061803 3300032002 Bacteria 3059
700 Ga0307416_100240958 3300032002 Bacteria 1752
701 Ga0307416_100931263 3300032002 Bacteria 970
702 Ga0307415_101850350 3300032126 Bacteria 585
703 Ga0373930_0049651 3300034816 Bacteria 913
704 Ga0373948_0007549 3300034817 Bacteria 1832
705 Ga0373948_0056990 3300034817 Bacteria 851
706 Ga0373950_0018240 3300034818 Bacteria 1216
707 Ga0373958_0025987 3300034819 Bacteria 1118
708 Ga0373938_0021063 3300034957 Bacteria 1319
709 Ga0373926_0064783 3300035083 Bacteria 1336
710 Ga0373929_0094118 3300035085 Bacteria 747
711 Ga0373940_0012740 3300035088 Bacteria 2019
712 Ga0373940_0149089 3300035088 Bacteria 744
713 Ga0373944_0024652 3300035089 Bacteria 1765
714 Ga0373949_0000662 3300035090 Bacteria 11210
715 Ga0373951_0000538 3300035091 Bacteria 10682
716 Ga0373952_0009778 3300035092 Bacteria 1844
717 Ga0373952_0013174 3300035092 Bacteria 1636
718 Ga0373932_0001682 3300035112 Bacteria 6033
719 Ga0373936_0047909 3300035113 Bacteria 1725
720 Ga0373939_0015150 3300035114 Bacteria 2012
721 Ga0373939_0107504 3300035114 Bacteria 967
722 Ga0373939_0386717 3300035114 Bacteria 577
723 Ga0373941_0000882 3300035115 Bacteria 6179
724 Ga0373941_0249839 3300035115 Bacteria 692
725 Ga0373945_0010260 3300035116 Bacteria 3082
726 Ga0373945_0088335 3300035116 Bacteria 1197
727 Ga0373960_0001637 3300035121 Bacteria 5002
728 Ga0373960_0007747 3300035121 Bacteria 2553
729 Ga0373943_0003220 3300035170 Bacteria 7409
730 Ga0373943_0086719 3300035170 Bacteria 1615
731 Ga0373946_0002121 3300035171 Bacteria 6956
732 Ga0373946_0015005 3300035171 Bacteria 2931
733 Ga0373961_0000784 3300035241 Bacteria 10914
734 Ga0373961_0024249 3300035241 Bacteria 1640
735 Ga0373962_0001116 3300035242 Bacteria 6253
736 Ga0373924_0039647 3300035410 Bacteria 1925
737 Ga0373931_0000222 3300035691 Bacteria 24235
738 Ga0373931_0149948 3300035691 Bacteria 1358
739 Ga0373931_0231654 3300035691 Bacteria 1116
740 Ga0373931_0269744 3300035691 Bacteria 1041
741 Ga0373935_0005754 3300035692 Bacteria 7328
742 Ga0373935_0281985 3300035692 Bacteria 1170
743 Ga0373935_0536847 3300035692 Bacteria 852
744 Ga0373927_0060280 3300035695 Bacteria 2455
745 Ga0373933_0125630 3300035724 Bacteria 1609
746 Ga0373947_0002612 3300035725 Bacteria 10814
747 Ga0373947_0004365 3300035725 Bacteria 8294
748 Ga0373937_1285774 3300036401 Bacteria 680
749 Ga0373925_0001472 3300037068 Bacteria 20286
750 Ga0373925_0010538 3300037068 Bacteria 6705
751 Ga0395899_0000775 3300037312 Bacteria 31562
752 Ga0395899_0001813 3300037312 Bacteria 17679
753 Ga0395899_0006817 3300037312 Bacteria 8845
754 Ga0395899_0012282 3300037312 Bacteria 6561
755 Ga0395899_0034532 3300037312 Bacteria 3798
756 Ga0395899_0073005 3300037312 Bacteria 2510
757 Ga0395899_0094306 3300037312 Bacteria 2166
758 Ga0395899_0096764 3300037312 Bacteria 2134
759 Ga0395899_0505838 3300037312 Bacteria 783
760 Ga0395899_0687527 3300037312 Bacteria 643
761 Ga0395900_0004133 3300037418 Bacteria 15453
762 Ga0395900_0005363 3300037418 Bacteria 13437
763 Ga0395900_0007148 3300037418 Bacteria 11569
764 Ga0395900_0020594 3300037418 Bacteria 6737
765 Ga0395900_0038826 3300037418 Bacteria 4908
766 Ga0395900_0067289 3300037418 Bacteria 3680
767 Ga0395900_0074403 3300037418 Bacteria 3492
768 Ga0395900_0099068 3300037418 Bacteria 2994
769 Ga0395900_0108894 3300037418 Bacteria 2846
770 Ga0395900_0115328 3300037418 Bacteria 2756
771 Ga0395900_0256367 3300037418 Bacteria 1748
772 Ga0395900_0273380 3300037418 Bacteria 1684
773 Ga0395900_0326597 3300037418 Bacteria 1513
774 Ga0395900_0342290 3300037418 Bacteria 1471
775 Ga0395900_0415209 3300037418 Bacteria 1307
776 Ga0395900_0468489 3300037418 Bacteria 1213
777 Ga0395900_0475561 3300037418 Bacteria 1202
778 Ga0395900_0867641 3300037418 Bacteria 827
779 Ga0395900_1027731 3300037418 Bacteria 743
780 Ga0395900_1215260 3300037418 Bacteria 669
781 Ga0395900_1466662 3300037418 Bacteria 595
782 Ga0395898_0002274 3300037466 Bacteria 23201
783 Ga0395898_0005883 3300037466 Bacteria 13185
784 Ga0395898_0006991 3300037466 Bacteria 11996
785 Ga0395898_0025659 3300037466 Bacteria 5936
786 Ga0395898_0027356 3300037466 Bacteria 5727
787 Ga0395898_0090777 3300037466 Bacteria 2939
788 Ga0395898_0101460 3300037466 Bacteria 2763
789 Ga0395898_0105496 3300037466 Bacteria 2702
790 Ga0395898_0117493 3300037466 Bacteria 2548
791 Ga0395898_0124509 3300037466 Bacteria 2469
792 Ga0395898_0125032 3300037466 Bacteria 2464
793 Ga0395898_0145487 3300037466 Bacteria 2268
794 Ga0395898_0159860 3300037466 Bacteria 2155
795 Ga0395898_0185903 3300037466 Bacteria 1985
796 Ga0395898_0202572 3300037466 Bacteria 1894
797 Ga0395898_0304489 3300037466 Bacteria 1520
798 Ga0395898_0305631 3300037466 Bacteria 1517
799 Ga0395898_0354286 3300037466 Bacteria 1399
800 Ga0395898_0434384 3300037466 Bacteria 1251
801 Ga0395898_0536135 3300037466 Unclassified 1112
802 Ga0395898_1032307 3300037466 Unclassified 757
803 Ga0395905_0002088 3300037471 Bacteria 22707
804 Ga0395905_0002224 3300037471 Bacteria 21889
805 Ga0395905_0003522 3300037471 Bacteria 16691
806 Ga0395905_0005811 3300037471 Bacteria 12535
807 Ga0395905_0006331 3300037471 Bacteria 11928
808 Ga0395905_0026503 3300037471 Bacteria 5464
809 Ga0395905_0052037 3300037471 Bacteria 3835
810 Ga0395905_0067136 3300037471 Bacteria 3359
811 Ga0395905_0111883 3300037471 Bacteria 2564
812 Ga0395905_0224743 3300037471 Bacteria 1756
813 Ga0395905_0227552 3300037471 Bacteria 1744
814 Ga0395905_0315425 3300037471 Bacteria 1452
815 Ga0395905_0616132 3300037471 Bacteria 987
816 Ga0395905_0780434 3300037471 Bacteria 858
817 Ga0395901_0001042 3300038443 Bacteria 29911
818 Ga0395901_0001441 3300038443 Bacteria 24821
819 Ga0395901_0004925 3300038443 Bacteria 13477
820 Ga0395901_0008564 3300038443 Bacteria 10336
821 Ga0395901_0013286 3300038443 Bacteria 8363
822 Ga0395901_0016741 3300038443 Bacteria 7470
823 Ga0395901_0021670 3300038443 Bacteria 6583
824 Ga0395901_0028496 3300038443 Bacteria 5742
825 Ga0395901_0036414 3300038443 Bacteria 5086
826 Ga0395901_0052123 3300038443 Bacteria 4253
827 Ga0395901_0119098 3300038443 Bacteria 2774
828 Ga0395901_0121997 3300038443 Bacteria 2739
829 Ga0395901_0149855 3300038443 Bacteria 2451
830 Ga0395901_0182602 3300038443 Bacteria 2200
831 Ga0395901_0193833 3300038443 Bacteria 2131
832 Ga0395901_0210642 3300038443 Bacteria 2034
833 Ga0395901_0225762 3300038443 Bacteria 1956
834 Ga0395901_0248212 3300038443 Bacteria 1855
835 Ga0395901_0270640 3300038443 Bacteria 1767
836 Ga0395901_0336388 3300038443 Bacteria 1560
837 Ga0395901_0351737 3300038443 Bacteria 1520
838 Ga0395901_0354905 3300038443 Bacteria 1513
839 Ga0395901_0636056 3300038443 Bacteria 1072
840 Ga0395901_1026506 3300038443 Bacteria 799
841 Ga0395901_1079464 3300038443 Bacteria 774
842 Ga0395901_1182533 3300038443 Bacteria 731
843 Ga0395901_1582920 3300038443 Bacteria 609
844 Ga0439438_046752 3300041405 Bacteria 1111
845 Ga0439439_0085880 3300041406 Bacteria 855
846 Ga0439453_0007830 3300041408 Bacteria 1705
847 Ga0439461_0114344 3300041410 Bacteria 669
848 Ga0451791_0268522 3300041451 Bacteria 1230
849 Ga0451798_0701400 3300041458 Bacteria 528
850 Ga0451798_1116539 3300041458 Bacteria 594
851 Ga0451800_0200249 3300041459 Bacteria 794
852 Ga0451807_2219213 3300041486 Bacteria 891
853 Ga0451837_1563388 3300041494 Bacteria 558
854 Ga0451849_0486907 3300041505 Bacteria 599
855 Ga0451851_1318289 3300041507 Bacteria 603
856 Ga0451853_1688329 3300041512 Bacteria 849
857 Ga0451853_4115136 3300041512 Bacteria 848
858 Ga0439441_018795 3300042001 Bacteria 1252
859 Ga0439448_0008909 3300042005 Bacteria 2946
860 Ga0439448_0027807 3300042005 Bacteria 1784
861 Ga0439450_098505 3300042008 Bacteria 740
862 Ga0439454_004201 3300042011 Bacteria 1645
863 Ga0439455_0148414 3300042012 Bacteria 667
864 Ga0450898_033844 3300042134 Bacteria 947
865 Ga0450902_022469 3300042137 Bacteria 1045
866 Ga0450902_045742 3300042137 Bacteria 748
867 Ga0450906_072593 3300042145 Bacteria 617
868 Ga0450907_007964 3300042146 Bacteria 1765
869 Ga0439446_0007985 3300042156 Bacteria 2796
870 Ga0439458_0006778 3300042157 Bacteria 2551
871 Ga0439434_0044110 3300042435 Bacteria 1373
872 Ga0439434_0191952 3300042435 Bacteria 686
873 Ga0450918_009987 3300042531 Bacteria 1659
874 Ga0451577_0359492 3300042876 Bacteria 1321
875 Ga0466965_0540201 3300044683 Bacteria 657
876 Ga0466965_0856805 3300044683 Bacteria 528
877 Ga0466966_0001800 3300044684 Bacteria 13885
878 Ga0466966_0021354 3300044684 Bacteria 4251
879 Ga0466961_0087136 3300044693 Bacteria 1973
880 Ga0466961_0285248 3300044693 Bacteria 1010
881 Ga0466963_0002420 3300044694 Bacteria 10436
882 Ga0466963_0003545 3300044694 Bacteria 8961
883 Ga0466963_0007131 3300044694 Bacteria 6660
884 Ga0466963_0022827 3300044694 Bacteria 3967
885 Ga0466963_0080686 3300044694 Bacteria 2203
886 Ga0466963_0462578 3300044694 Bacteria 895
887 Ga0466964_0006100 3300044706 Bacteria 4492
888 Ga0466964_0015541 3300044706 Bacteria 2898
889 Ga0466964_0053506 3300044706 Bacteria 1662
890 Ga0466964_0090882 3300044706 Bacteria 1328
891 Ga0466964_0221227 3300044706 Bacteria 919
892 Ga0466964_0310298 3300044706 Bacteria 798
893 Ga0466964_0316706 3300044706 Bacteria 791
894 Ga0466971_0109404 3300044719 Bacteria 1274
895 Ga0466971_0273016 3300044719 Bacteria 808
896 Ga0466968_0028460 3300044735 Bacteria 2304
897 Ga0466968_0231506 3300044735 Bacteria 873
898 Ga0466968_0275405 3300044735 Bacteria 804
899 Ga0466968_0360226 3300044735 Bacteria 708
900 Ga0466957_0082152 3300044842 Bacteria 2008
901 Ga0466957_0280248 3300044842 Bacteria 1116
902 Ga0466957_0384596 3300044842 Bacteria 957
903 Ga0466957_0630174 3300044842 Bacteria 753
904 Ga0466957_0689536 3300044842 Bacteria 720
905 Ga0466957_0709084 3300044842 Bacteria 710
906 Ga0466957_0989049 3300044842 Bacteria 604
907 Ga0466960_0102370 3300044901 Bacteria 1477
908 Ga0466960_0128683 3300044901 Bacteria 1334
909 Ga0466960_0176391 3300044901 Bacteria 1156
910 Ga0466960_0178801 3300044901 Bacteria 1149
911 Ga0466960_0302796 3300044901 Bacteria 901
912 Ga0466959_0024682 3300045049 Bacteria 4454
913 Ga0466959_0068229 3300045049 Bacteria 2577
914 Ga0466959_0107369 3300045049 Bacteria 1995
915 Ga0466959_0172560 3300045049 Bacteria 1516
916 Ga0466959_0703298 3300045049 Bacteria 677
917 Ga0451576_0248579 3300045051 Bacteria 1859
918 Ga0466958_0001786 3300045836 Bacteria 10433
919 Ga0466958_0055098 3300045836 Bacteria 2412
920 Ga0466958_0072997 3300045836 Bacteria 2102
921 Ga0466958_0132730 3300045836 Bacteria 1564
922 Ga0466958_0407692 3300045836 Bacteria 878
923 Ga0466958_0661334 3300045836 Bacteria 680
924 Ga0466958_0894434 3300045836 Bacteria 579
925 Ga0466967_0002953 3300045976 Bacteria 10866
926 Ga0466967_0005103 3300045976 Bacteria 9018
927 Ga0466967_0006225 3300045976 Bacteria 8414
928 Ga0466967_0019579 3300045976 Bacteria 5446
929 Ga0466967_0029959 3300045976 Bacteria 4561
930 Ga0466967_0052906 3300045976 Bacteria 3567
931 Ga0466967_0064554 3300045976 Bacteria 3256
932 Ga0466967_0073718 3300045976 Bacteria 3063
933 Ga0466967_0090731 3300045976 Bacteria 2776
934 Ga0466967_0228830 3300045976 Bacteria 1769
935 Ga0466967_0236110 3300045976 Bacteria 1742
936 Ga0466967_0311208 3300045976 Bacteria 1517
937 Ga0466967_0343850 3300045976 Bacteria 1443
938 Ga0466967_0420436 3300045976 Bacteria 1303
939 Ga0466967_0632414 3300045976 Bacteria 1057
940 Ga0466967_0638964 3300045976 Bacteria 1052
941 Ga0466967_0775272 3300045976 Bacteria 951
942 Ga0466967_2041482 3300045976 Bacteria 570
943 Ga0495592_0052765 3300046454 Bacteria 3018
944 Ga0495592_0086623 3300046454 Bacteria 2255
945 Ga0495603_0001374 3300046455 Bacteria 14134
946 Ga0495629_0001380 3300046459 Bacteria 19145
947 Ga0495629_0162738 3300046459 Bacteria 1550
948 Ga0495641_0000416 3300046461 Bacteria 35566
949 Ga0495641_0001029 3300046461 Bacteria 23958
950 Ga0495641_0590216 3300046461 Bacteria 508
951 Ga0495651_0010678 3300046462 Bacteria 7064
952 Ga0495651_0019841 3300046462 Bacteria 5212
953 Ga0495651_0156441 3300046462 Bacteria 1638
954 Ga0495653_0049742 3300046463 Bacteria 3227
955 Ga0495653_0115476 3300046463 Bacteria 1921
956 Ga0495653_0586019 3300046463 Bacteria 687
957 Ga0495582_0000108 3300046473 Bacteria 43115
958 Ga0495582_0004292 3300046473 Bacteria 8019
959 Ga0495582_0119658 3300046473 Bacteria 1483
960 Ga0495582_0625068 3300046473 Bacteria 623
961 Ga0495639_0000578 3300046475 Bacteria 17076
962 Ga0495639_0111567 3300046475 Bacteria 1298
963 Ga0495662_0002285 3300046476 Bacteria 9659
964 Ga0495664_0144272 3300046477 Bacteria 1444
965 Ga0495664_0538451 3300046477 Bacteria 696
966 Ga0495584_0109130 3300046491 Bacteria 1400
967 Ga0495584_0160706 3300046491 Unclassified 1142
968 Ga0495585_0244367 3300046492 Bacteria 898
969 Ga0495594_0010001 3300046499 Bacteria 4914
970 Ga0495594_0039404 3300046499 Bacteria 2584
971 Ga0495596_0048425 3300046500 Bacteria 1667
972 Ga0495596_0096486 3300046500 Bacteria 1148
973 Ga0495596_0158029 3300046500 Bacteria 881
974 Ga0495596_0178964 3300046500 Bacteria 824
975 Ga0495607_0543595 3300046501 Bacteria 511
976 Ga0495608_0016996 3300046511 Bacteria 5032
977 Ga0495608_0056447 3300046511 Bacteria 2593
978 Ga0495618_0075593 3300046514 Bacteria 2146
979 Ga0495618_0090281 3300046514 Bacteria 1959
980 Ga0495628_0084139 3300046516 Bacteria 2469
981 Ga0495628_0144793 3300046516 Bacteria 1812
982 Ga0495628_1079120 3300046516 Bacteria 549
983 Ga0495630_0002325 3300046517 Bacteria 13223
984 Ga0495630_0002755 3300046517 Bacteria 12186
985 Ga0495630_0040251 3300046517 Bacteria 3493
986 Ga0495630_0743283 3300046517 Bacteria 750
987 Ga0495637_0270655 3300046520 Unclassified 608
988 Ga0495644_0116800 3300046523 Bacteria 1014
989 Ga0495644_0153123 3300046523 Bacteria 883
990 Ga0495644_0370220 3300046523 Unclassified 565
991 Ga0495663_0116045 3300046525 Bacteria 893
992 Ga0495663_0139621 3300046525 Bacteria 822
993 Ga0495663_0192857 3300046525 Bacteria 709
994 Ga0495666_0006362 3300046526 Bacteria 5946
995 Ga0495666_0424281 3300046526 Bacteria 597
996 Ga0495652_0217355 3300046529 Bacteria 1438
997 Ga0495652_0944983 3300046529 Bacteria 566
998 Ga0495652_1038771 3300046529 Bacteria 534
999 Ga0495665_0010108 3300046531 Bacteria 5113
1000 Ga0495665_0167398 3300046531 Bacteria 1145
1001 Ga0495665_0517505 3300046531 Bacteria 600
1002 Ga0495640_0028068 3300046533 Bacteria 4054
1003 Ga0495587_0018751 3300046536 Bacteria 4291
1004 Ga0495587_0045589 3300046536 Bacteria 2606
1005 Ga0495587_0367988 3300046536 Bacteria 800
1006 Ga0495609_0027438 3300046538 Bacteria 2603
1007 Ga0495609_0165567 3300046538 Bacteria 935
1008 Ga0495609_0340896 3300046538 Bacteria 606
1009 Ga0495645_0047589 3300046543 Bacteria 3124
1010 Ga0495645_0152174 3300046543 Bacteria 1606
1011 Ga0495645_0509433 3300046543 Bacteria 751
1012 Ga0495645_0619062 3300046543 Bacteria 664
1013 Ga0495645_0880998 3300046543 Bacteria 532
1014 Ga0495622_0048156 3300046557 Bacteria 1981
1015 Ga0495667_0015780 3300046559 Bacteria 5107
1016 Ga0495667_0089097 3300046559 Bacteria 2000
1017 Ga0495667_0670070 3300046559 Bacteria 644
1018 Ga0495656_0031299 3300046615 Bacteria 2157
1019 Ga0495668_0374708 3300046616 Bacteria 782
1020 Ga0495634_0036720 3300046642 Bacteria 3350
1021 Ga0495611_0342829 3300046648 Unclassified 686
1022 Ga0495611_0448766 3300046648 Bacteria 588
1023 Ga0495635_0016702 3300046663 Bacteria 5127
1024 Ga0495635_0147723 3300046663 Bacteria 1600
1025 Ga0495635_0334855 3300046663 Bacteria 1011
1026 Ga0495659_0027110 3300046664 Bacteria 1974
1027 Ga0495659_0051141 3300046664 Bacteria 1504
1028 Ga0495659_0321799 3300046664 Bacteria 657
1029 Ga0495588_0001380 3300046674 Bacteria 10369
1030 Ga0495657_0029359 3300046675 Bacteria 3857
1031 Ga0495657_0051750 3300046675 Bacteria 2757
1032 Ga0495599_0109051 3300046678 Bacteria 1725
1033 Ga0495599_0195962 3300046678 Bacteria 1242
1034 Ga0495599_0871492 3300046678 Bacteria 511
1035 Ga0495623_0010895 3300046679 Bacteria 5887
1036 Ga0495646_0210749 3300046680 Bacteria 1054
1037 Ga0495647_0144865 3300046681 Bacteria 1015
1038 Ga0495658_0000132 3300046683 Bacteria 41217
1039 Ga0495658_0058377 3300046683 Bacteria 2207
1040 Ga0495658_0249817 3300046683 Bacteria 1115
1041 Ga0495669_0324705 3300046684 Bacteria 743
1042 Ga0495613_0056332 3300046689 Bacteria 2886
1043 Ga0495613_0412222 3300046689 Bacteria 920
1044 Ga0495613_0506201 3300046689 Bacteria 813
1045 Ga0495624_0031865 3300046690 Bacteria 3423
1046 Ga0495589_0036050 3300046794 Bacteria 2480
1047 Ga0495589_0064110 3300046794 Bacteria 1802
1048 Ga0495589_0439088 3300046794 Bacteria 598
1049 Ga0495600_0025998 3300046809 Bacteria 3775
1050 Ga0495600_0604788 3300046809 Bacteria 666
1051 Ga0495581_0023637 3300047315 Bacteria 3561
1052 Ga0495581_0039595 3300047315 Bacteria 2729
1053 Ga0495581_0742749 3300047315 Bacteria 565
1054 Ga0495604_0075813 3300047317 Bacteria 2531
1055 Ga0495604_0149274 3300047317 Bacteria 1662
1056 Ga0495604_0170526 3300047317 Bacteria 1531
1057 Ga0495636_0227759 3300047318 Bacteria 857
1058 Ga0495674_0049575 3300047319 Bacteria 3710
1059 Ga0495674_0055678 3300047319 Bacteria 3467
1060 Ga0495674_0202670 3300047319 Bacteria 1645
1061 Ga0495676_0002345 3300047321 Bacteria 16782
1062 Ga0495676_0005803 3300047321 Bacteria 11323
1063 Ga0495676_0021605 3300047321 Bacteria 5616
1064 Ga0495680_0027386 3300047322 Bacteria 4684
1065 Ga0495680_0040862 3300047322 Bacteria 3691
1066 Ga0495680_0172549 3300047322 Bacteria 1565
1067 Ga0495675_0029828 3300047444 Bacteria 3479
1068 Ga0495675_0712335 3300047444 Bacteria 561
1069 Ga0495684_0006639 3300047471 Bacteria 8972
1070 Ga0495684_0050535 3300047471 Bacteria 3174
1071 Ga0495684_0314845 3300047471 Bacteria 1120
1072 Ga0495593_0009475 3300047673 Bacteria 5648
1073 Ga0495602_0082978 3300048088 Bacteria 2687
1074 Ga0495602_0121097 3300048088 Bacteria 2105
1075 Ga0495602_0144673 3300048088 Bacteria 1877
1076 Ga0495614_0002813 3300048089 Bacteria 7742
1077 Ga0496100_0000648 3300048903 Bacteria 16518
1078 Ga0496100_0006128 3300048903 Bacteria 6540
1079 Ga0496100_0019848 3300048903 Bacteria 4019
1080 Ga0496100_0097803 3300048903 Bacteria 2016
1081 Ga0496100_0136027 3300048903 Bacteria 1736
1082 Ga0496100_0172402 3300048903 Bacteria 1559
1083 Ga0496100_0207458 3300048903 Bacteria 1431
1084 Ga0496100_0218599 3300048903 Bacteria 1397
1085 Ga0496100_0406599 3300048903 Bacteria 1038
1086 Ga0496100_0407792 3300048903 Bacteria 1036
1087 Ga0496100_0509556 3300048903 Bacteria 928
1088 Ga0496101_0004817 3300048904 Bacteria 8563
1089 Ga0496101_0005366 3300048904 Bacteria 8169
1090 Ga0496101_0060341 3300048904 Bacteria 2751
1091 Ga0496101_0128606 3300048904 Bacteria 1921
1092 Ga0496101_0159308 3300048904 Bacteria 1730
1093 Ga0496101_0199404 3300048904 Bacteria 1547
1094 Ga0496101_0717497 3300048904 Bacteria 789
1095 Ga0496101_1128857 3300048904 Bacteria 615
1096 Ga0496102_0002063 3300048905 Bacteria 17305
1097 Ga0496102_0019615 3300048905 Bacteria 5957
1098 Ga0496102_0033720 3300048905 Bacteria 4603
1099 Ga0496102_0034272 3300048905 Bacteria 4565
1100 Ga0496102_0036663 3300048905 Bacteria 4418
1101 Ga0496102_0080858 3300048905 Bacteria 2994
1102 Ga0496102_0242594 3300048905 Bacteria 1699
1103 Ga0496102_0441502 3300048905 Bacteria 1221
1104 Ga0496102_0661306 3300048905 Bacteria 968
1105 Ga0496102_1382663 3300048905 Bacteria 623
1106 Ga0496102_1533097 3300048905 Bacteria 585
1107 Ga0496103_0001730 3300048906 Bacteria 14252
1108 Ga0496103_0026988 3300048906 Bacteria 3477
1109 Ga0496103_0028177 3300048906 Bacteria 3407
1110 Ga0496103_0168115 3300048906 Bacteria 1407
1111 Ga0496103_0278356 3300048906 Bacteria 1076
1112 Ga0496103_0730039 3300048906 Bacteria 627
1113 Ga0496104_0000904 3300048907 Bacteria 25446
1114 Ga0496104_0002792 3300048907 Bacteria 15048
1115 Ga0496104_0003386 3300048907 Bacteria 13770
1116 Ga0496104_0005665 3300048907 Bacteria 10939
1117 Ga0496104_0007652 3300048907 Bacteria 9565
1118 Ga0496104_0012510 3300048907 Bacteria 7630
1119 Ga0496104_0107112 3300048907 Bacteria 2679
1120 Ga0496104_0134273 3300048907 Bacteria 2377
1121 Ga0496104_0326688 3300048907 Bacteria 1447
1122 Ga0496104_0612324 3300048907 Bacteria 999
1123 Ga0496104_0668928 3300048907 Bacteria 947
1124 Ga0496105_0000042 3300048908 Bacteria 114886
1125 Ga0496105_0000406 3300048908 Bacteria 28366
1126 Ga0496105_0014796 3300048908 Bacteria 6210
1127 Ga0496105_0019052 3300048908 Bacteria 5530
1128 Ga0496105_0023510 3300048908 Bacteria 4999
1129 Ga0496105_0065616 3300048908 Bacteria 2996
1130 Ga0496105_0201313 3300048908 Bacteria 1625
1131 Ga0496105_1095919 3300048908 Bacteria 591
1132 Ga0496106_0000263 3300048909 Bacteria 36905
1133 Ga0496106_0006450 3300048909 Bacteria 8686
1134 Ga0496106_0022784 3300048909 Bacteria 4652
1135 Ga0496106_0034403 3300048909 Bacteria 3783
1136 Ga0496106_0114580 3300048909 Bacteria 2102
1137 Ga0496106_0197010 3300048909 Bacteria 1602
1138 Ga0496106_0210947 3300048909 Bacteria 1547
1139 Ga0496106_0308969 3300048909 Bacteria 1268
1140 Ga0496106_0448970 3300048909 Bacteria 1036
1141 Ga0496107_0000712 3300048910 Bacteria 18973
1142 Ga0496107_0003430 3300048910 Bacteria 10597
1143 Ga0496107_0003441 3300048910 Bacteria 10574
1144 Ga0496107_0008672 3300048910 Bacteria 7042
1145 Ga0496107_0041638 3300048910 Bacteria 3298
1146 Ga0496107_0067610 3300048910 Bacteria 2593
1147 Ga0496107_0211213 3300048910 Bacteria 1443
1148 Ga0496107_0429161 3300048910 Bacteria 983
1149 Ga0496107_0821937 3300048910 Bacteria 680
1150 Ga0496108_0001638 3300048911 Bacteria 17745
1151 Ga0496108_0004712 3300048911 Bacteria 11004
1152 Ga0496108_0015150 3300048911 Bacteria 6290
1153 Ga0496108_0024619 3300048911 Bacteria 4957
1154 Ga0496108_0063248 3300048911 Bacteria 3116
1155 Ga0496108_0978420 3300048911 Bacteria 723
1156 Ga0496109_0002657 3300048912 Bacteria 14996
1157 Ga0496109_0002961 3300048912 Bacteria 14210
1158 Ga0496109_0005055 3300048912 Bacteria 11016
1159 Ga0496109_0006975 3300048912 Bacteria 9535
1160 Ga0496109_0012454 3300048912 Bacteria 7342
1161 Ga0496109_0040723 3300048912 Bacteria 4208
1162 Ga0496109_0047156 3300048912 Bacteria 3916
1163 Ga0496109_0073097 3300048912 Bacteria 3151
1164 Ga0496109_0087471 3300048912 Bacteria 2878
1165 Ga0496109_0121441 3300048912 Bacteria 2434
1166 Ga0496109_0146151 3300048912 Bacteria 2212
1167 Ga0496109_0235307 3300048912 Bacteria 1724
1168 Ga0496109_0344476 3300048912 Bacteria 1407
1169 Ga0496109_0432759 3300048912 Bacteria 1243
1170 Ga0496109_0777049 3300048912 Bacteria 896
1171 Ga0496109_1385440 3300048912 Bacteria 639
1172 Ga0496109_1475256 3300048912 Bacteria 615
1173 Ga0496110_0000050 3300048913 Bacteria 59023
1174 Ga0496110_0001458 3300048913 Bacteria 17154
1175 Ga0496110_0001849 3300048913 Bacteria 15623
1176 Ga0496110_0026390 3300048913 Bacteria 4971
1177 Ga0496110_0037764 3300048913 Bacteria 4199
1178 Ga0496110_0052898 3300048913 Bacteria 3568
1179 Ga0496110_0145630 3300048913 Bacteria 2142
1180 Ga0496110_0147470 3300048913 Bacteria 2129
1181 Ga0496110_0155437 3300048913 Bacteria 2072
1182 Ga0496110_0890573 3300048913 Bacteria 796
1183 Ga0496110_0979719 3300048913 Bacteria 753
1184 Ga0496110_0980582 3300048913 Bacteria 752
1185 Ga0496110_1322685 3300048913 Bacteria 630
1186 Ga0496111_0000220 3300048914 Bacteria 27215
1187 Ga0496111_0001831 3300048914 Bacteria 12514
1188 Ga0496111_0006906 3300048914 Bacteria 7407
1189 Ga0496111_0012770 3300048914 Bacteria 5697
1190 Ga0496111_0018008 3300048914 Bacteria 4887
1191 Ga0496111_0039522 3300048914 Bacteria 3383
1192 Ga0496111_0189541 3300048914 Bacteria 1529
1193 Ga0496111_0243419 3300048914 Bacteria 1335
1194 Ga0496111_0548236 3300048914 Bacteria 849
1195 Ga0496111_0663559 3300048914 Bacteria 760
1196 Ga0496111_0725546 3300048914 Bacteria 722
1197 Ga0496111_0844337 3300048914 Bacteria 661
1198 Ga0496111_1065409 3300048914 Bacteria 577
1199 Ga0496111_1248246 3300048914 Bacteria 525
1200 Ga0496112_0001403 3300048915 Bacteria 18402
1201 Ga0496112_0002855 3300048915 Bacteria 14040
1202 Ga0496112_0036631 3300048915 Bacteria 4787
1203 Ga0496112_0057166 3300048915 Bacteria 3840
1204 Ga0496112_0062190 3300048915 Bacteria 3682
1205 Ga0496112_0063249 3300048915 Bacteria 3650
1206 Ga0496112_0068230 3300048915 Bacteria 3511
1207 Ga0496112_0071756 3300048915 Bacteria 3422
1208 Ga0496112_0091440 3300048915 Bacteria 3012
1209 Ga0496112_0091871 3300048915 Bacteria 3004
1210 Ga0496112_0131316 3300048915 Bacteria 2475
1211 Ga0496112_0133272 3300048915 Bacteria 2455
1212 Ga0496112_0226470 3300048915 Bacteria 1825
1213 Ga0496112_0234547 3300048915 Bacteria 1789
1214 Ga0496112_0274169 3300048915 Bacteria 1635
1215 Ga0496112_0347247 3300048915 Bacteria 1427
1216 Ga0496112_0712151 3300048915 Bacteria 931
1217 Ga0496112_1095647 3300048915 Bacteria 715
1218 Ga0496113_0000110 3300048916 Bacteria 35203
1219 Ga0496113_0003480 3300048916 Bacteria 9435
1220 Ga0496113_0035153 3300048916 Bacteria 3663
1221 Ga0496113_0045159 3300048916 Bacteria 3266
1222 Ga0496113_0058788 3300048916 Bacteria 2894
1223 Ga0496113_0071087 3300048916 Bacteria 2647
1224 Ga0496113_0077425 3300048916 Bacteria 2543
1225 Ga0496113_0077663 3300048916 Bacteria 2539
1226 Ga0496114_0000444 3300048917 Bacteria 30383
1227 Ga0496114_0003753 3300048917 Bacteria 11706
1228 Ga0496114_0012286 3300048917 Bacteria 6851
1229 Ga0496114_0012957 3300048917 Bacteria 6680
1230 Ga0496114_0030659 3300048917 Bacteria 4425
1231 Ga0496114_0060188 3300048917 Bacteria 3174
1232 Ga0496114_0404097 3300048917 Bacteria 1209
1233 Ga0496114_0457774 3300048917 Bacteria 1129
1234 Ga0496114_0963943 3300048917 Bacteria 735
1235 Ga0496114_1410131 3300048917 Bacteria 584
1236 Ga0496115_0000415 3300048918 Bacteria 34771
1237 Ga0496115_0001670 3300048918 Bacteria 15964
1238 Ga0496115_0025304 3300048918 Bacteria 4621
1239 Ga0496115_0046506 3300048918 Bacteria 3469
1240 Ga0496115_0081441 3300048918 Bacteria 2636
1241 Ga0496115_0104624 3300048918 Bacteria 2323
1242 Ga0501291_076113 3300049514 Bacteria 659
1243 Ga0501031_0005395 3300049568 Bacteria 8322
1244 Ga0501031_0072297 3300049568 Bacteria 2246
1245 Ga0501031_0232321 3300049568 Bacteria 1200
1246 Ga0501032_0023411 3300049569 Bacteria 4267
1247 Ga0501033_0004771 3300049570 Bacteria 10834
1248 Ga0501034_0031025 3300049571 Bacteria 5432
1249 Ga0501034_0675337 3300049571 Bacteria 933
1250 Ga0501036_0013360 3300049572 Bacteria 6821
1251 Ga0501036_1047061 3300049572 Bacteria 667
1252 Ga0501037_0003648 3300049573 Bacteria 11167
1253 Ga0501038_0032198 3300049574 Bacteria 4627
1254 Ga0501038_0175546 3300049574 Bacteria 1732
1255 Ga0501039_0017450 3300049575 Bacteria 5506
1256 Ga0501039_0754646 3300049575 Bacteria 760
1257 Ga0501040_0005743 3300049576 Bacteria 8026
1258 Ga0501040_0443348 3300049576 Bacteria 934
1259 Ga0501041_0011812 3300049577 Bacteria 5169
1260 Ga0501041_0174846 3300049577 Bacteria 1344
1261 Ga0501042_0057144 3300049578 Bacteria 2784
1262 Ga0501042_0260677 3300049578 Bacteria 1251
1263 Ga0501043_0007710 3300049579 Bacteria 8523
1264 Ga0501046_0009343 3300049580 Bacteria 8482
1265 Ga0501046_0133718 3300049580 Bacteria 1880
1266 Ga0501046_0772023 3300049580 Bacteria 674
1267 Ga0501048_0053476 3300049582 Bacteria 2871
1268 Ga0501048_0383988 3300049582 Bacteria 1003
1269 Ga0501067_0003757 3300049583 Bacteria 8366
1270 Ga0501067_0073589 3300049583 Bacteria 1893
1271 Ga0501067_0122816 3300049583 Bacteria 1445
1272 Ga0501067_0275991 3300049583 Bacteria 936
1273 Ga0501068_0001136 3300049584 Bacteria 14097
1274 Ga0501068_0678600 3300049584 Bacteria 673
1275 Ga0501068_0892325 3300049584 Bacteria 585
1276 Ga0501069_0039402 3300049585 Bacteria 2610
1277 Ga0501069_0053703 3300049585 Bacteria 2244
1278 Ga0501069_0084769 3300049585 Bacteria 1787
1279 Ga0501069_0837446 3300049585 Bacteria 558
1280 Ga0501070_0008199 3300049586 Bacteria 8836
1281 Ga0501070_0013400 3300049586 Bacteria 6914
1282 Ga0501071_0265474 3300049587 Bacteria 1297
1283 Ga0501072_0051023 3300049588 Bacteria 3257
1284 Ga0501073_0010236 3300049589 Bacteria 6891
1285 Ga0501073_0063712 3300049589 Bacteria 2571
1286 Ga0501074_0004394 3300049590 Bacteria 10076
1287 Ga0501074_0006260 3300049590 Bacteria 8592
1288 Ga0501074_0095973 3300049590 Bacteria 2123
1289 Ga0501075_0055663 3300049591 Bacteria 2976
1290 Ga0501076_0295040 3300049592 Bacteria 1328
1291 Ga0501076_0483427 3300049592 Bacteria 1020
1292 Ga0501077_0016391 3300049593 Bacteria 4668
1293 Ga0501199_041683 3300049650 Bacteria 597
1294 Ga0501221_080779 3300049704 Bacteria 782
1295 Ga0501079_0039770 3300049741 Bacteria 3627
1296 Ga0501079_0097803 3300049741 Bacteria 2275
1297 Ga0501079_0215745 3300049741 Bacteria 1499
1298 Ga0501079_0310251 3300049741 Bacteria 1234
1299 Ga0501079_0752956 3300049741 Bacteria 767
1300 Ga0501080_0010664 3300049742 Bacteria 8410
1301 Ga0501080_0017932 3300049742 Bacteria 6551
1302 Ga0501080_0313441 3300049742 Bacteria 1421
1303 Ga0501080_1132710 3300049742 Bacteria 675
1304 Ga0501081_0011695 3300049743 Bacteria 5745
1305 Ga0501081_0233551 3300049743 Bacteria 1340
1306 Ga0501081_0937552 3300049743 Bacteria 653
1307 Ga0501081_0950286 3300049743 Bacteria 649
1308 Ga0501083_0003994 3300049744 Bacteria 10363
1309 Ga0501083_0008092 3300049744 Bacteria 7435
1310 Ga0501044_0102376 3300049823 Bacteria 2880
1311 Ga0501045_0008660 3300049824 Bacteria 7094
1312 Ga0501045_0286591 3300049824 Bacteria 1226
1313 nmdc:mga0yw44_16776_c1 3300050492 Bacteria 3966
1314 nmdc:mga06z11_807976_c1 3300050494 Bacteria 571
1315 nmdc:mga05p37_113901_c1 3300050507 Bacteria 3325
1316 nmdc:mga05p37_1202827_c1 3300050507 Bacteria 783
1317 nmdc:mga05p37_124341_c1 3300050507 Bacteria 3168
1318 nmdc:mga05p37_1736243_c1 3300050507 Bacteria 606
1319 nmdc:mga05p37_189208_c1 3300050507 Bacteria 2500
1320 nmdc:mga05p37_24348_c1 3300050507 Bacteria 7356
1321 nmdc:mga05p37_71385_c1 3300050507 Bacteria 4271
1322 nmdc:mga06r32_384355_c1 3300050510 Bacteria 1386
1323 nmdc:mga06r32_388253_c1 3300050510 Bacteria 1378
1324 nmdc:mga06r32_68393_c1 3300050510 Bacteria 3431
1325 nmdc:mga08y16_2126135_c1 3300050511 Bacteria 509
1326 nmdc:mga08y16_317010_c1 3300050511 Bacteria 1606
1327 nmdc:mga08y16_629797_c1 3300050511 Bacteria 1079
1328 nmdc:mga08y16_776026_c1 3300050511 Bacteria 953
1329 nmdc:mga08y16_85257_c1 3300050511 Bacteria 3292
1330 nmdc:mga0n895_1464674_c1 3300050512 Bacteria 650
1331 nmdc:mga0n895_15676_c1 3300050512 Bacteria 6922
1332 nmdc:mga0n895_16554_c1 3300050512 Bacteria 6770
1333 nmdc:mga0n895_1857899_c1 3300050512 Bacteria 562
1334 nmdc:mga0n895_26848_c1 3300050512 Bacteria 5462
1335 nmdc:mga0n895_279002_c1 3300050512 Bacteria 1694
1336 nmdc:mga0n895_339874_c1 3300050512 Bacteria 1521
1337 nmdc:mga0n895_485274_c1 3300050512 Bacteria 1246
1338 nmdc:mga0n895_70715_c1 3300050512 Bacteria 3459
1339 nmdc:mga0rr50_124982_c1 3300050513 Bacteria 2053
1340 nmdc:mga0rr50_268914_c1 3300050513 Bacteria 1420
1341 nmdc:mga0rr50_30376_c1 3300050513 Bacteria 3825
1342 nmdc:mga0rr50_35270_c1 3300050513 Bacteria 3591
1343 nmdc:mga0rr50_84258_c1 3300050513 Bacteria 2461
1344 nmdc:mga08x19_145872_c1 3300050514 Bacteria 1601
1345 nmdc:mga08x19_16014_c1 3300050514 Bacteria 4568
1346 nmdc:mga08x19_418495_c1 3300050514 Bacteria 941
1347 nmdc:mga0a205_1012034_c1 3300050515 Bacteria 678
1348 nmdc:mga0a205_259767_c1 3300050515 Bacteria 1615
1349 nmdc:mga0a205_308681_c1 3300050515 Bacteria 1454
1350 nmdc:mga0a205_426065_c1 3300050515 Bacteria 1189
1351 nmdc:mga0a205_5604_c1 3300050515 Bacteria 11312
1352 nmdc:mga0a205_701067_c1 3300050515 Bacteria 862
1353 nmdc:mga0a205_71904_c1 3300050515 Bacteria 3341
1354 Ga0495601_0189236 3300053077 Bacteria 1345
1355 Ga0495601_0194048 3300053077 Bacteria 1327
1356 Ga0495601_0209665 3300053077 Unclassified 1273
1357 Ga0495601_0221887 3300053077 Bacteria 1235
1358 Ga0495601_0571501 3300053077 Bacteria 727
1359 Ga0495612_0221722 3300053078 Bacteria 837
1360 Ga0495612_0415940 3300053078 Bacteria 612
1361 Ga0495655_0003073 3300053083 Bacteria 2713
1362 Ga0495655_0015831 3300053083 Bacteria 1612
1363 Ga0495595_0019836 3300053084 Bacteria 2920
1364 Ga0495595_0151201 3300053084 Bacteria 1142
1365 Ga0495619_0002519 3300053085 Bacteria 11984
1366 Ga0495619_0003695 3300053085 Bacteria 9864
1367 Ga0495619_0061870 3300053085 Bacteria 2492
1368 Ga0495619_0210496 3300053085 Bacteria 1346
1369 Ga0495619_0870512 3300053085 Bacteria 607
1370 Ga0501084_0026397 3300054114 Bacteria 4847
1371 Ga0501084_1255144 3300054114 Bacteria 621
1372 Ga0587111_0239817 3300060346 Bacteria 531
1373 Ga0501082_0044749 3300060353 Bacteria 3818
1374 Ga0501082_0484782 3300060353 Bacteria 1081
1375 Ga0466962_0011649 3300061719 Bacteria 4235
1376 Ga0466962_0680270 3300061719 Bacteria 527
1377 Ga0530510_0035068 3300061734 Bacteria 3615
1378 Ga0530510_0048047 3300061734 Bacteria 3084
1379 Ga0530510_0152880 3300061734 Bacteria 1705
1380 Ga0530510_0461717 3300061734 Bacteria 961
1381 Ga0530510_0793642 3300061734 Bacteria 722
1382 Ga0114129_10500571
1383 MBSR1b_contig_8196210
1384 JGI24747J21853_1041921
1385 JGI25406J46586_10034431
1386 JGI25406J46586_10065783
1387 JGI25407J50210_10005521
1388 JGI25405J52794_10060577
1389 Ga0065715_10310659
1390 Ga0070658_10027533
1391 Ga0070658_10205359
1392 Ga0070683_100028738
1393 Ga0070683_100109334
1394 Ga0070683_100144217
1395 Ga0070690_100086906
1396 Ga0070690_100239565
1397 Ga0068869_100365020
1398 Ga0070666_10186662
1399 Ga0070680_100020146
1400 Ga0070680_100074652
1401 Ga0070680_100086829
1402 Ga0070680_100220356
1403 Ga0070680_100497855
1404 Ga0070680_101355810
1405 Ga0070682_100011854
1406 Ga0070682_100129367
1407 Ga0070682_100158894
1408 Ga0070682_100680474
1409 Ga0068868_100091207
1410 Ga0068868_100249289
1411 Ga0068868_100261899
1412 Ga0068868_100347627
1413 Ga0068868_100569146
1414 Ga0070660_100025497
1415 Ga0070660_100039151
1416 Ga0070660_100093127
1417 Ga0070660_100100614
1418 Ga0070660_100117138
1419 Ga0070660_100226515
1420 Ga0070660_100253017
1421 Ga0070660_100256025
1422 Ga0070660_101736008
1423 Ga0070689_100220175
1424 Ga0070691_10083346
1425 Ga0070691_10094382
1426 Ga0070687_100323837
1427 Ga0070687_100582966
1428 Ga0070661_100018487
1429 Ga0070661_100044759
1430 Ga0070692_10006261
1431 Ga0070668_100021194
1432 Ga0070668_100108719
1433 Ga0070668_100472256
1434 Ga0070668_102079980
1435 Ga0070671_100218615
1436 Ga0070671_100340718
1437 Ga0070671_100781158
1438 Ga0070671_101519258
1439 Ga0070674_100086170
1440 Ga0070674_100257276
1441 Ga0070674_100790452
1442 Ga0070673_100265748
1443 Ga0070673_100434473
1444 Ga0070659_100016721
1445 Ga0070659_100094269
1446 Ga0070659_100158398
1447 Ga0070667_100472056
1448 Ga0070703_10046689
1449 Ga0070703_10047299
1450 Ga0070703_10079077
1451 Ga0070709_10006587
1452 Ga0070709_10034201
1453 Ga0070709_10099171
1454 Ga0070709_10103968
1455 Ga0070709_10732047
1456 Ga0070709_10838728
1457 Ga0070714_100005237
1458 Ga0070714_100050235
1459 Ga0070714_100051953
1460 Ga0070714_100185886
1461 Ga0070714_100297562
1462 Ga0070714_101457132
1463 Ga0070713_100056532
1464 Ga0070713_100083666
1465 Ga0070713_100096128
1466 Ga0070713_100144011
1467 Ga0070713_100302409
1468 Ga0070713_100524200
1469 Ga0070713_101336096
1470 Ga0070713_101726315
1471 Ga0070710_10003032
1472 Ga0070710_10009506
1473 Ga0070710_10014447
1474 Ga0070710_10416883
1475 Ga0070710_10441531
1476 Ga0070701_10275443
1477 Ga0070711_100019866
1478 Ga0070711_100044424
1479 Ga0070711_100089644
1480 Ga0070711_100165900
1481 Ga0070711_100426520
1482 Ga0070705_100011065
1483 Ga0070705_100031123
1484 Ga0070705_100079973
1485 Ga0070705_100090805
1486 Ga0070705_100221861
1487 Ga0070705_100253019
1488 Ga0070705_100354773
1489 Ga0070700_100064267
1490 Ga0070700_100177475
1491 Ga0070700_100190919
1492 Ga0070694_100074046
1493 Ga0070694_100076455
1494 Ga0070694_100268088
1495 Ga0070708_100012205
1496 Ga0070708_100066279
1497 Ga0070708_100157978
1498 Ga0070708_100227388
1499 Ga0070663_100084260
1500 Ga0070663_100747910
1501 Ga0070678_100116096
1502 Ga0070678_100240151
1503 Ga0070678_100685467
1504 Ga0070662_100197225
1505 Ga0070662_100585723
1506 Ga0070681_10004219
1507 Ga0070681_10014911
1508 Ga0070681_10055054
1509 Ga0070681_10120630
1510 Ga0070681_10176439
1511 Ga0070681_10178446
1512 Ga0070681_10399397
1513 Ga0068867_100312247
1514 Ga0068867_102071842
1515 Ga0070685_10944697
1516 Ga0070706_100036001
1517 Ga0070706_100098069
1518 Ga0070706_100135165
1519 Ga0070706_100141141
1520 Ga0070706_100346508
1521 Ga0070706_100538667
1522 Ga0070706_100962745
1523 Ga0070706_101283749
1524 Ga0070707_100016804
1525 Ga0070707_100053981
1526 Ga0070707_100101977
1527 Ga0070707_100149545
1528 Ga0070707_100396327
1529 Ga0070707_100545323
1530 Ga0070707_100596831
1531 Ga0070707_101196729
1532 Ga0070698_100006283
1533 Ga0070698_100015109
1534 Ga0070698_100100817
1535 Ga0070698_100358243
1536 Ga0070698_100392000
1537 Ga0070698_100480331
1538 Ga0070699_100025094
1539 Ga0070699_100091440
1540 Ga0070699_100357421
1541 Ga0070699_100559168
1542 Ga0070699_100603372
1543 Ga0070699_100749852
1544 Ga0070699_101085745
1545 Ga0070679_100004023
1546 Ga0070679_100209144
1547 Ga0070679_100215699
1548 Ga0070679_100436496
1549 Ga0070679_100503592
1550 Ga0070679_100668294
1551 Ga0070679_100735322
1552 Ga0070679_102180851
1553 Ga0070684_100002479
1554 Ga0070684_100040856
1555 Ga0070684_100076582
1556 Ga0070684_100237398
1557 Ga0070684_100247593
1558 Ga0070684_100508510
1559 Ga0070697_100035623
1560 Ga0070697_100151562
1561 Ga0070697_100921746
1562 Ga0068853_100389633
1563 Ga0068853_102168421
1564 Ga0070672_100906604
1565 Ga0070686_100005989
1566 Ga0070686_100151468
1567 Ga0070695_100097687
1568 Ga0070695_100439746
1569 Ga0070695_101142318
1570 Ga0070696_100023110
1571 Ga0070696_100033647
1572 Ga0070696_100195083
1573 Ga0070696_101237586
1574 Ga0070693_100008935
1575 Ga0070693_100018392
1576 Ga0070693_100164666
1577 Ga0070665_100020268
1578 Ga0070665_100540819
1579 Ga0070704_100019791
1580 Ga0070704_100033533
1581 Ga0070704_100133967
1582 Ga0070704_100162677
1583 Ga0070704_100279449
1584 Ga0068855_100028306
1585 Ga0068855_100062747
1586 Ga0068855_100143718
1587 Ga0068855_100179058
1588 Ga0068855_100209484
1589 Ga0068855_100344866
1590 Ga0068855_100379454
1591 Ga0068855_101537228
1592 Ga0070664_100816125
1593 Ga0068857_100051525
1594 Ga0068857_100129177
1595 Ga0068857_100448074
1596 Ga0068854_100119899
1597 Ga0068856_100017118
1598 Ga0068856_100048316
1599 Ga0068856_100061541
1600 Ga0068856_100121826
1601 Ga0068856_100122137
1602 Ga0068856_100572685
1603 Ga0068856_100882186
1604 Ga0068856_100890480
1605 Ga0070702_100005135
1606 Ga0070702_100019094
1607 Ga0070702_100698750
1608 Ga0070702_100773839
1609 Ga0070702_101682956
1610 Ga0068852_100032780
1611 Ga0068852_100566556
1612 Ga0068852_102115805
1613 Ga0068859_100287283
1614 Ga0068864_100112808
1615 Ga0068866_10472078
1616 Ga0068861_100078913
1617 Ga0068861_100213411
1618 Ga0068861_100280481
1619 Ga0068861_100499391
1620 Ga0068851_10403203
1621 Ga0068870_10211784
1622 Ga0068863_100708604
1623 Ga0068858_100352251
1624 Ga0068860_100062023
1625 Ga0068860_100909699
1626 Ga0081455_10002297
1627 Ga0081455_10006733
1628 Ga0081455_10020921
1629 Ga0081455_10196193
1630 Ga0081455_10239902
1631 Ga0081538_10000846
1632 Ga0081538_10040639
1633 Ga0081538_10189688
1634 Ga0081538_10211161
1635 Ga0081540_1017827
1636 Ga0081539_10000507
1637 Ga0081539_10001238
1638 Ga0081539_10023804
1639 Ga0070717_10108601
1640 Ga0070717_10125075
1641 Ga0070717_10290831
1642 Ga0070717_10305486
1643 Ga0070717_10741650
1644 Ga0075432_10142104
1645 Ga0070715_10221757
1646 Ga0070716_100026479
1647 Ga0070716_100267057
1648 Ga0070716_100635326
1649 Ga0070716_101096848
1650 Ga0070716_101427467
1651 Ga0070712_100003082
1652 Ga0070712_100004222
1653 Ga0070712_100082246
1654 Ga0070712_100108115
1655 Ga0070712_100294245
1656 Ga0070712_100846649
1657 Ga0075367_10699339
1658 Ga0097621_100010449
1659 Ga0097621_100582823
1660 Ga0097621_102240153
1661 Ga0068871_100006687
1662 Ga0068871_100401595
1663 Ga0075428_100104128
1664 Ga0075431_100225761
1665 Ga0075431_100524280
1666 Ga0075433_10004067
1667 Ga0075433_10007343
1668 Ga0075433_10059100
1669 Ga0075433_10060441
1670 Ga0075433_10181655
1671 Ga0075433_10191098
1672 Ga0075433_10282451
1673 Ga0075433_10306240
1674 Ga0075433_10775967
1675 Ga0075434_100003308
1676 Ga0075434_100003953
1677 Ga0075434_100014330
1678 Ga0075434_100195352
1679 Ga0075434_100313256
1680 Ga0075434_100370592
1681 Ga0075434_100523235
1682 Ga0068865_100418738
1683 Ga0075436_100008952
1684 Ga0075436_100363470
1685 Ga0075436_101412613
1686 Ga0097620_100287270
1687 Ga0075435_100000846
1688 Ga0075435_100221037
1689 Ga0075435_100245784
1690 Ga0075435_100299354
1691 Ga0105240_10008131
1692 Ga0105240_10040896
1693 Ga0105240_10220310
1694 Ga0111539_10261522
1695 Ga0111539_10354267
1696 Ga0111539_10579765
1697 Ga0111539_10643560
1698 Ga0111539_11173029
1699 Ga0111539_11179011
1700 Ga0111539_11587858
1701 Ga0105245_10006942
1702 Ga0105245_10078256
1703 Ga0105245_10170357
1704 Ga0105245_11129314
1705 Ga0105245_11378914
1706 Ga0114129_10027574
1707 Ga0114129_10032758
1708 Ga0114129_10120193
1709 Ga0114129_10256855
1710 Ga0114129_10416036
1711 Ga0114129_10567095
1712 Ga0114129_10700201
1713 Ga0114129_11042303
1714 Ga0114129_11265653
1715 Ga0114129_12039917
1716 Ga0105243_10058011
1717 Ga0105243_10114589
1718 Ga0105243_10275549
1719 Ga0105243_10320132
1720 Ga0105243_10725119
1721 Ga0105243_10765506
1722 Ga0105241_10260254
1723 Ga0105241_10446374
1724 Ga0105241_10492275
1725 Ga0105242_10060572
1726 Ga0105242_10087070
1727 Ga0105242_10093210
1728 Ga0105242_10934042
1729 Ga0105242_11697412
1730 Ga0105242_12621083
1731 Ga0105248_10267142
1732 Ga0105248_10274145
1733 Ga0105237_10068736
1734 Ga0105237_10115595
1735 Ga0105238_10207977
1736 Ga0105238_11076443
1737 Ga0105238_12190442
1738 Ga0105249_10027922
1739 Ga0105249_10068878
1740 Ga0105249_10256367
1741 Ga0105249_12688714
1742 Ga0105239_10072622
1743 Ga0105239_10077471
1744 Ga0105239_10126638
1745 Ga0105239_10544536
1746 Ga0105239_12731735
1747 Ga0105246_10571538
1748 Ga0157320_1002867
1749 Ga0157342_1001558
1750 Ga0157316_1001790
1751 Ga0157373_10094937
1752 Ga0157373_10357910
1753 Ga0157373_10411231
1754 Ga0157371_10042431
1755 Ga0157371_10698948
1756 Ga0157371_11524391
1757 Ga0157370_10096349
1758 Ga0157370_10201675
1759 Ga0157370_11137686
1760 Ga0157369_10003497
1761 Ga0157369_10037478
1762 Ga0157369_10647115
1763 Ga0157369_11191326
1764 Ga0157369_11241977
1765 Ga0157369_11392307
1766 Ga0157374_10162879
1767 Ga0157374_10171528
1768 Ga0157374_10945873
1769 Ga0157374_10961585
1770 Ga0157374_11247376
1771 Ga0157378_10195953
1772 Ga0157378_10196888
1773 Ga0157378_10405741
1774 Ga0157378_10561688
1775 Ga0157378_12777974
1776 Ga0163162_10103595
1777 Ga0163162_10126250
1778 Ga0163162_10176454
1779 Ga0163162_10226819
1780 Ga0157372_10081506
1781 Ga0157372_10197317
1782 Ga0157372_10257024
1783 Ga0157372_10298690
1784 Ga0157372_10527467
1785 Ga0157372_11229399
1786 Ga0157372_13121880
1787 Ga0157375_10007650
1788 Ga0157375_10012741
1789 Ga0157375_10142205
1790 Ga0157375_13095999
1791 Ga0163163_10147449
1792 Ga0163163_11265458
1793 Ga0157380_10019505
1794 Ga0157380_10264081
1795 Ga0182008_10018808
1796 Ga0182008_10207442
1797 Ga0182008_10266511
1798 Ga0182008_10336185
1799 Ga0157379_10440067
1800 Ga0157376_12230508
1801 Ga0182007_10313482
1802 Ga0163161_10026579
1803 Ga0163161_10213108
1804 Ga0197907_10265393
1805 Ga0197907_10641453
1806 Ga0197907_11423151
1807 Ga0197907_11452201
1808 Ga0206356_10272360
1809 Ga0206356_11221232
1810 Ga0206356_11425914
1811 Ga0206356_11591861
1812 Ga0206349_1943878
1813 Ga0206352_11058662
1814 Ga0206350_10260564
1815 Ga0206350_10959082
1816 Ga0206350_11129946
1817 Ga0206354_10603899
1818 Ga0206354_10699304
1819 Ga0206354_11144221
1820 Ga0206353_10052694
1821 Ga0206353_10339933
1822 Ga0206353_10521650
1823 Ga0224712_10025166
1824 Ga0224712_10060436
1825 Ga0224712_10216120
1826 Ga0224712_10300791
1827 Ga0207653_10090446
1828 Ga0207692_10016063
1829 Ga0207692_10034019
1830 Ga0207692_10120747
1831 Ga0207692_10358469
1832 Ga0207642_10368867
1833 Ga0207688_10026467
1834 Ga0207688_10032388
1835 Ga0207688_10093523
1836 Ga0207680_10638132
1837 Ga0207647_10339269
1838 Ga0207685_10144143
1839 Ga0207685_10276141
1840 Ga0207699_10020008
1841 Ga0207699_10078590
1842 Ga0207699_10103036
1843 Ga0207699_10691621
1844 Ga0207699_10829343
1845 Ga0207645_10402493
1846 Ga0207643_10189172
1847 Ga0207705_10010732
1848 Ga0207684_10061997
1849 Ga0207684_10076503
1850 Ga0207684_10099479
1851 Ga0207684_10110240
1852 Ga0207684_10111501
1853 Ga0207684_10335794
1854 Ga0207684_10394306
1855 Ga0207684_11668302
1856 Ga0207654_10366045
1857 Ga0207654_10688857
1858 Ga0207654_11034558
1859 Ga0207707_10001354
1860 Ga0207707_10003861
1861 Ga0207707_10042069
1862 Ga0207707_10046668
1863 Ga0207707_10056887
1864 Ga0207707_10192233
1865 Ga0207707_10394929
1866 Ga0207707_10745913
1867 Ga0207707_11258799
1868 Ga0207695_10749663
1869 Ga0207671_10070774
1870 Ga0207671_10098911
1871 Ga0207671_11397149
1872 Ga0207693_10000904
1873 Ga0207693_10009282
1874 Ga0207693_10012860
1875 Ga0207693_10014992
1876 Ga0207693_10022102
1877 Ga0207693_10027012
1878 Ga0207693_10089272
1879 Ga0207693_10425544
1880 Ga0207693_10454954
1881 Ga0207693_11460057
1882 Ga0207663_10017287
1883 Ga0207663_10074898
1884 Ga0207663_10101378
1885 Ga0207663_10129839
1886 Ga0207663_10214123
1887 Ga0207663_10426262
1888 Ga0207663_11218069
1889 Ga0207660_10023024
1890 Ga0207660_10163050
1891 Ga0207660_10637111
1892 Ga0207662_10071015
1893 Ga0207662_11074803
1894 Ga0207657_10000184
1895 Ga0207657_10002804
1896 Ga0207657_10004538
1897 Ga0207657_10007538
1898 Ga0207657_10240309
1899 Ga0207657_10277082
1900 Ga0207657_10988657
1901 Ga0207649_10008900
1902 Ga0207649_10597200
1903 Ga0207649_11423614
1904 Ga0207652_10011232
1905 Ga0207652_10023918
1906 Ga0207652_10289027
1907 Ga0207652_10506977
1908 Ga0207652_10676894
1909 Ga0207646_10028151
1910 Ga0207646_10035768
1911 Ga0207646_10043340
1912 Ga0207646_10060856
1913 Ga0207646_10431051
1914 Ga0207646_10474276
1915 Ga0207646_10539484
1916 Ga0207646_11230540
1917 Ga0207681_10583127
1918 Ga0207694_10128958
1919 Ga0207694_10583786
1920 Ga0207694_11609030
1921 Ga0207687_10131213
1922 Ga0207687_10341865
1923 Ga0207687_10380828
1924 Ga0207700_10000021
1925 Ga0207700_10053729
1926 Ga0207700_10114392
1927 Ga0207700_10178373
1928 Ga0207700_10222043
1929 Ga0207700_10252626
1930 Ga0207700_10588705
1931 Ga0207700_10645433
1932 Ga0207664_10032332
1933 Ga0207664_10105163
1934 Ga0207664_10136480
1935 Ga0207664_10186739
1936 Ga0207664_10195761
1937 Ga0207664_10251499
1938 Ga0207664_10729637
1939 Ga0207664_10740329
1940 Ga0207664_10914460
1941 Ga0207644_10144007
1942 Ga0207644_10173740
1943 Ga0207644_10256110
1944 Ga0207644_10288098
1945 Ga0207644_11172042
1946 Ga0207690_11024368
1947 Ga0207690_11178670
1948 Ga0207706_10006148
1949 Ga0207706_10019996
1950 Ga0207706_10097474
1951 Ga0207686_10033719
1952 Ga0207686_10356579
1953 Ga0207709_10096948
1954 Ga0207709_10196011
1955 Ga0207709_10215511
1956 Ga0207709_10216688
1957 Ga0207670_10963817
1958 Ga0207669_10217363
1959 Ga0207669_10532406
1960 Ga0207704_10074766
1961 Ga0207704_10156200
1962 Ga0207704_10243710
1963 Ga0207704_10300051
1964 Ga0207665_10002447
1965 Ga0207665_10015388
1966 Ga0207665_10019402
1967 Ga0207665_10163720
1968 Ga0207665_10613651
1969 Ga0207665_10755088
1970 Ga0207665_10880596
1971 Ga0207665_10930366
1972 Ga0207691_10200980
1973 Ga0207711_10169406
1974 Ga0207689_10228543
1975 Ga0207689_10358942
1976 Ga0207689_10828605
1977 Ga0207661_10035043
1978 Ga0207661_10206510
1979 Ga0207661_10219198
1980 Ga0207661_10806346
1981 Ga0207661_11033274
1982 Ga0207661_11203957
1983 Ga0207679_10808426
1984 Ga0207667_10051598
1985 Ga0207667_10051953
1986 Ga0207667_10136181
1987 Ga0207667_10161367
1988 Ga0207667_10187508
1989 Ga0207667_10464023
1990 Ga0207667_10513984
1991 Ga0207667_10913419
1992 Ga0207651_10237438
1993 Ga0207651_10586271
1994 Ga0207651_11799258
1995 Ga0207712_11244186
1996 Ga0207668_10011321
1997 Ga0207668_10034893
1998 Ga0207668_10857073
1999 Ga0207640_10565383
2000 Ga0207640_10998271
2001 Ga0207658_11281416
2002 Ga0207677_10031710
2003 Ga0207677_10123174
2004 Ga0207677_10641665
2005 Ga0207677_11047191
2006 Ga0207703_10594467
2007 Ga0207639_10402215
2008 Ga0207639_11127795
2009 Ga0207678_10051414
2010 Ga0207678_10670033
2011 Ga0207678_11711526
2012 Ga0207708_10013961
2013 Ga0207708_10104859
2014 Ga0207708_10167539
2015 Ga0207702_10003936
2016 Ga0207702_10074556
2017 Ga0207702_10102338
2018 Ga0207702_10196393
2019 Ga0207702_10741682
2020 Ga0207702_10943294
2021 Ga0207641_10595568
2022 Ga0207648_10007972
2023 Ga0207648_10117415
2024 Ga0207676_10096950
2025 Ga0207674_10102554
2026 Ga0207674_10443408
2027 Ga0207675_100002893
2028 Ga0207675_100069684
2029 Ga0207675_100281463
2030 Ga0207683_10001031
2031 Ga0207683_10010677
2032 Ga0207683_10028491
2033 Ga0207698_10191171
2034 Ga0207698_10291247
2035 Ga0207698_10377167
2036 Ga0207698_10406284
2037 Ga0207428_10008568
2038 Ga0207428_10098259
2039 Ga0207428_10155499
2040 Ga0268266_10199771
2041 Ga0268266_11124358
2042 Ga0268265_10528520
2043 Ga0268264_10055175
2044 Ga0268264_10267363
2045 Ga0265334_10337018
2046 Ga0265318_10038049
2047 Ga0265318_10046438
2048 Ga0265336_10038696
2049 Ga0265338_10031578
2050 Ga0265338_10180982
2051 Ga0265338_10387738
2052 Ga0265338_10443678
2053 Ga0265330_10199572
2054 Ga0265328_10126025
2055 Ga0265328_10187641
2056 Ga0265320_10202667
2057 Ga0265325_10048762
2058 Ga0265339_10017308
2059 Ga0265327_10019521
2060 Ga0265327_10029963
2061 Ga0265327_10109282
2062 Ga0265316_10065555
2063 Ga0307408_100309779
2064 Ga0307408_101026743
2065 Ga0265313_10050557
2066 Ga0265314_10048768
2067 Ga0265342_10164349
2068 Ga0307405_10174576
2069 Ga0307405_10192785
2070 Ga0307405_10871180
2071 Ga0307413_10052816
2072 Ga0307413_10674132
2073 Ga0307410_10152033
2074 Ga0307410_10619365
2075 Ga0307407_11058201
2076 Ga0307409_100337672
2077 Ga0307409_100544504
2078 Ga0307409_100660504
2079 Ga0307409_100664432
2080 Ga0307416_100061803
2081 Ga0307416_100240958
2082 Ga0307416_100931263
2083 Ga0307415_101850350
2084 Ga0373930_0049651
2085 Ga0373948_0007549
2086 Ga0373948_0056990
2087 Ga0373950_0018240
2088 Ga0373958_0025987
2089 Ga0373938_0021063
2090 Ga0373926_0064783
2091 Ga0373929_0094118
2092 Ga0373940_0012740
2093 Ga0373940_0149089
2094 Ga0373944_0024652
2095 Ga0373949_0000662
2096 Ga0373951_0000538
2097 Ga0373952_0009778
2098 Ga0373952_0013174
2099 Ga0373932_0001682
2100 Ga0373936_0047909
2101 Ga0373939_0015150
2102 Ga0373939_0107504
2103 Ga0373939_0386717
2104 Ga0373941_0000882
2105 Ga0373941_0249839
2106 Ga0373945_0010260
2107 Ga0373945_0088335
2108 Ga0373960_0001637
2109 Ga0373960_0007747
2110 Ga0373943_0003220
2111 Ga0373943_0086719
2112 Ga0373946_0002121
2113 Ga0373946_0015005
2114 Ga0373961_0000784
2115 Ga0373961_0024249
2116 Ga0373962_0001116
2117 Ga0373924_0039647
2118 Ga0373931_0000222
2119 Ga0373931_0149948
2120 Ga0373931_0231654
2121 Ga0373931_0269744
2122 Ga0373935_0005754
2123 Ga0373935_0281985
2124 Ga0373935_0536847
2125 Ga0373927_0060280
2126 Ga0373933_0125630
2127 Ga0373947_0002612
2128 Ga0373947_0004365
2129 Ga0373937_1285774
2130 Ga0373925_0001472
2131 Ga0373925_0010538
2132 Ga0395899_0000775
2133 Ga0395899_0001813
2134 Ga0395899_0006817
2135 Ga0395899_0012282
2136 Ga0395899_0034532
2137 Ga0395899_0073005
2138 Ga0395899_0094306
2139 Ga0395899_0096764
2140 Ga0395899_0505838
2141 Ga0395899_0687527
2142 Ga0395900_0004133
2143 Ga0395900_0005363
2144 Ga0395900_0007148
2145 Ga0395900_0020594
2146 Ga0395900_0038826
2147 Ga0395900_0067289
2148 Ga0395900_0074403
2149 Ga0395900_0099068
2150 Ga0395900_0108894
2151 Ga0395900_0115328
2152 Ga0395900_0256367
2153 Ga0395900_0273380
2154 Ga0395900_0326597
2155 Ga0395900_0342290
2156 Ga0395900_0415209
2157 Ga0395900_0468489
2158 Ga0395900_0475561
2159 Ga0395900_0867641
2160 Ga0395900_1027731
2161 Ga0395900_1215260
2162 Ga0395900_1466662
2163 Ga0395898_0002274
2164 Ga0395898_0005883
2165 Ga0395898_0006991
2166 Ga0395898_0025659
2167 Ga0395898_0027356
2168 Ga0395898_0090777
2169 Ga0395898_0101460
2170 Ga0395898_0105496
2171 Ga0395898_0117493
2172 Ga0395898_0124509
2173 Ga0395898_0125032
2174 Ga0395898_0145487
2175 Ga0395898_0159860
2176 Ga0395898_0185903
2177 Ga0395898_0202572
2178 Ga0395898_0304489
2179 Ga0395898_0305631
2180 Ga0395898_0354286
2181 Ga0395898_0434384
2182 Ga0395898_0536135
2183 Ga0395898_1032307
2184 Ga0395905_0002088
2185 Ga0395905_0002224
2186 Ga0395905_0003522
2187 Ga0395905_0005811
2188 Ga0395905_0006331
2189 Ga0395905_0026503
2190 Ga0395905_0052037
2191 Ga0395905_0067136
2192 Ga0395905_0111883
2193 Ga0395905_0224743
2194 Ga0395905_0227552
2195 Ga0395905_0315425
2196 Ga0395905_0616132
2197 Ga0395905_0780434
2198 Ga0395901_0001042
2199 Ga0395901_0001441
2200 Ga0395901_0004925
2201 Ga0395901_0008564
2202 Ga0395901_0013286
2203 Ga0395901_0016741
2204 Ga0395901_0021670
2205 Ga0395901_0028496
2206 Ga0395901_0036414
2207 Ga0395901_0052123
2208 Ga0395901_0119098
2209 Ga0395901_0121997
2210 Ga0395901_0149855
2211 Ga0395901_0182602
2212 Ga0395901_0193833
2213 Ga0395901_0210642
2214 Ga0395901_0225762
2215 Ga0395901_0248212
2216 Ga0395901_0270640
2217 Ga0395901_0336388
2218 Ga0395901_0351737
2219 Ga0395901_0354905
2220 Ga0395901_0636056
2221 Ga0395901_1026506
2222 Ga0395901_1079464
2223 Ga0395901_1182533
2224 Ga0395901_1582920
2225 Ga0439438_046752
2226 Ga0439439_0085880
2227 Ga0439453_0007830
2228 Ga0439461_0114344
2229 Ga0451791_0268522
2230 Ga0451798_0701400
2231 Ga0451798_1116539
2232 Ga0451800_0200249
2233 Ga0451807_2219213
2234 Ga0451837_1563388
2235 Ga0451849_0486907
2236 Ga0451851_1318289
2237 Ga0451853_1688329
2238 Ga0451853_4115136
2239 Ga0439441_018795
2240 Ga0439448_0008909
2241 Ga0439448_0027807
2242 Ga0439450_098505
2243 Ga0439454_004201
2244 Ga0439455_0148414
2245 Ga0450898_033844
2246 Ga0450902_022469
2247 Ga0450902_045742
2248 Ga0450906_072593
2249 Ga0450907_007964
2250 Ga0439446_0007985
2251 Ga0439458_0006778
2252 Ga0439434_0044110
2253 Ga0439434_0191952
2254 Ga0450918_009987
2255 Ga0451577_0359492
2256 Ga0466965_0540201
2257 Ga0466965_0856805
2258 Ga0466966_0001800
2259 Ga0466966_0021354
2260 Ga0466961_0087136
2261 Ga0466961_0285248
2262 Ga0466963_0002420
2263 Ga0466963_0003545
2264 Ga0466963_0007131
2265 Ga0466963_0022827
2266 Ga0466963_0080686
2267 Ga0466963_0462578
2268 Ga0466964_0006100
2269 Ga0466964_0015541
2270 Ga0466964_0053506
2271 Ga0466964_0090882
2272 Ga0466964_0221227
2273 Ga0466964_0310298
2274 Ga0466964_0316706
2275 Ga0466971_0109404
2276 Ga0466971_0273016
2277 Ga0466968_0028460
2278 Ga0466968_0231506
2279 Ga0466968_0275405
2280 Ga0466968_0360226
2281 Ga0466957_0082152
2282 Ga0466957_0280248
2283 Ga0466957_0384596
2284 Ga0466957_0630174
2285 Ga0466957_0689536
2286 Ga0466957_0709084
2287 Ga0466957_0989049
2288 Ga0466960_0102370
2289 Ga0466960_0128683
2290 Ga0466960_0176391
2291 Ga0466960_0178801
2292 Ga0466960_0302796
2293 Ga0466959_0024682
2294 Ga0466959_0068229
2295 Ga0466959_0107369
2296 Ga0466959_0172560
2297 Ga0466959_0703298
2298 Ga0451576_0248579
2299 Ga0466958_0001786
2300 Ga0466958_0055098
2301 Ga0466958_0072997
2302 Ga0466958_0132730
2303 Ga0466958_0407692
2304 Ga0466958_0661334
2305 Ga0466958_0894434
2306 Ga0466967_0002953
2307 Ga0466967_0005103
2308 Ga0466967_0006225
2309 Ga0466967_0019579
2310 Ga0466967_0029959
2311 Ga0466967_0052906
2312 Ga0466967_0064554
2313 Ga0466967_0073718
2314 Ga0466967_0090731
2315 Ga0466967_0228830
2316 Ga0466967_0236110
2317 Ga0466967_0311208
2318 Ga0466967_0343850
2319 Ga0466967_0420436
2320 Ga0466967_0632414
2321 Ga0466967_0638964
2322 Ga0466967_0775272
2323 Ga0466967_2041482
2324 Ga0495592_0052765
2325 Ga0495592_0086623
2326 Ga0495603_0001374
2327 Ga0495629_0001380
2328 Ga0495629_0162738
2329 Ga0495641_0000416
2330 Ga0495641_0001029
2331 Ga0495641_0590216
2332 Ga0495651_0010678
2333 Ga0495651_0019841
2334 Ga0495651_0156441
2335 Ga0495653_0049742
2336 Ga0495653_0115476
2337 Ga0495653_0586019
2338 Ga0495582_0000108
2339 Ga0495582_0004292
2340 Ga0495582_0119658
2341 Ga0495582_0625068
2342 Ga0495639_0000578
2343 Ga0495639_0111567
2344 Ga0495662_0002285
2345 Ga0495664_0144272
2346 Ga0495664_0538451
2347 Ga0495584_0109130
2348 Ga0495584_0160706
2349 Ga0495585_0244367
2350 Ga0495594_0010001
2351 Ga0495594_0039404
2352 Ga0495596_0048425
2353 Ga0495596_0096486
2354 Ga0495596_0158029
2355 Ga0495596_0178964
2356 Ga0495607_0543595
2357 Ga0495608_0016996
2358 Ga0495608_0056447
2359 Ga0495618_0075593
2360 Ga0495618_0090281
2361 Ga0495628_0084139
2362 Ga0495628_0144793
2363 Ga0495628_1079120
2364 Ga0495630_0002325
2365 Ga0495630_0002755
2366 Ga0495630_0040251
2367 Ga0495630_0743283
2368 Ga0495637_0270655
2369 Ga0495644_0116800
2370 Ga0495644_0153123
2371 Ga0495644_0370220
2372 Ga0495663_0116045
2373 Ga0495663_0139621
2374 Ga0495663_0192857
2375 Ga0495666_0006362
2376 Ga0495666_0424281
2377 Ga0495652_0217355
2378 Ga0495652_0944983
2379 Ga0495652_1038771
2380 Ga0495665_0010108
2381 Ga0495665_0167398
2382 Ga0495665_0517505
2383 Ga0495640_0028068
2384 Ga0495587_0018751
2385 Ga0495587_0045589
2386 Ga0495587_0367988
2387 Ga0495609_0027438
2388 Ga0495609_0165567
2389 Ga0495609_0340896
2390 Ga0495645_0047589
2391 Ga0495645_0152174
2392 Ga0495645_0509433
2393 Ga0495645_0619062
2394 Ga0495645_0880998
2395 Ga0495622_0048156
2396 Ga0495667_0015780
2397 Ga0495667_0089097
2398 Ga0495667_0670070
2399 Ga0495656_0031299
2400 Ga0495668_0374708
2401 Ga0495634_0036720
2402 Ga0495611_0342829
2403 Ga0495611_0448766
2404 Ga0495635_0016702
2405 Ga0495635_0147723
2406 Ga0495635_0334855
2407 Ga0495659_0027110
2408 Ga0495659_0051141
2409 Ga0495659_0321799
2410 Ga0495588_0001380
2411 Ga0495657_0029359
2412 Ga0495657_0051750
2413 Ga0495599_0109051
2414 Ga0495599_0195962
2415 Ga0495599_0871492
2416 Ga0495623_0010895
2417 Ga0495646_0210749
2418 Ga0495647_0144865
2419 Ga0495658_0000132
2420 Ga0495658_0058377
2421 Ga0495658_0249817
2422 Ga0495669_0324705
2423 Ga0495613_0056332
2424 Ga0495613_0412222
2425 Ga0495613_0506201
2426 Ga0495624_0031865
2427 Ga0495589_0036050
2428 Ga0495589_0064110
2429 Ga0495589_0439088
2430 Ga0495600_0025998
2431 Ga0495600_0604788
2432 Ga0495581_0023637
2433 Ga0495581_0039595
2434 Ga0495581_0742749
2435 Ga0495604_0075813
2436 Ga0495604_0149274
2437 Ga0495604_0170526
2438 Ga0495636_0227759
2439 Ga0495674_0049575
2440 Ga0495674_0055678
2441 Ga0495674_0202670
2442 Ga0495676_0002345
2443 Ga0495676_0005803
2444 Ga0495676_0021605
2445 Ga0495680_0027386
2446 Ga0495680_0040862
2447 Ga0495680_0172549
2448 Ga0495675_0029828
2449 Ga0495675_0712335
2450 Ga0495684_0006639
2451 Ga0495684_0050535
2452 Ga0495684_0314845
2453 Ga0495593_0009475
2454 Ga0495602_0082978
2455 Ga0495602_0121097
2456 Ga0495602_0144673
2457 Ga0495614_0002813
2458 Ga0496100_0000648
2459 Ga0496100_0006128
2460 Ga0496100_0019848
2461 Ga0496100_0097803
2462 Ga0496100_0136027
2463 Ga0496100_0172402
2464 Ga0496100_0207458
2465 Ga0496100_0218599
2466 Ga0496100_0406599
2467 Ga0496100_0407792
2468 Ga0496100_0509556
2469 Ga0496101_0004817
2470 Ga0496101_0005366
2471 Ga0496101_0060341
2472 Ga0496101_0128606
2473 Ga0496101_0159308
2474 Ga0496101_0199404
2475 Ga0496101_0717497
2476 Ga0496101_1128857
2477 Ga0496102_0002063
2478 Ga0496102_0019615
2479 Ga0496102_0033720
2480 Ga0496102_0034272
2481 Ga0496102_0036663
2482 Ga0496102_0080858
2483 Ga0496102_0242594
2484 Ga0496102_0441502
2485 Ga0496102_0661306
2486 Ga0496102_1382663
2487 Ga0496102_1533097
2488 Ga0496103_0001730
2489 Ga0496103_0026988
2490 Ga0496103_0028177
2491 Ga0496103_0168115
2492 Ga0496103_0278356
2493 Ga0496103_0730039
2494 Ga0496104_0000904
2495 Ga0496104_0002792
2496 Ga0496104_0003386
2497 Ga0496104_0005665
2498 Ga0496104_0007652
2499 Ga0496104_0012510
2500 Ga0496104_0107112
2501 Ga0496104_0134273
2502 Ga0496104_0326688
2503 Ga0496104_0612324
2504 Ga0496104_0668928
2505 Ga0496105_0000042
2506 Ga0496105_0000406
2507 Ga0496105_0014796
2508 Ga0496105_0019052
2509 Ga0496105_0023510
2510 Ga0496105_0065616
2511 Ga0496105_0201313
2512 Ga0496105_1095919
2513 Ga0496106_0000263
2514 Ga0496106_0006450
2515 Ga0496106_0022784
2516 Ga0496106_0034403
2517 Ga0496106_0114580
2518 Ga0496106_0197010
2519 Ga0496106_0210947
2520 Ga0496106_0308969
2521 Ga0496106_0448970
2522 Ga0496107_0000712
2523 Ga0496107_0003430
2524 Ga0496107_0003441
2525 Ga0496107_0008672
2526 Ga0496107_0041638
2527 Ga0496107_0067610
2528 Ga0496107_0211213
2529 Ga0496107_0429161
2530 Ga0496107_0821937
2531 Ga0496108_0001638
2532 Ga0496108_0004712
2533 Ga0496108_0015150
2534 Ga0496108_0024619
2535 Ga0496108_0063248
2536 Ga0496108_0978420
2537 Ga0496109_0002657
2538 Ga0496109_0002961
2539 Ga0496109_0005055
2540 Ga0496109_0006975
2541 Ga0496109_0012454
2542 Ga0496109_0040723
2543 Ga0496109_0047156
2544 Ga0496109_0073097
2545 Ga0496109_0087471
2546 Ga0496109_0121441
2547 Ga0496109_0146151
2548 Ga0496109_0235307
2549 Ga0496109_0344476
2550 Ga0496109_0432759
2551 Ga0496109_0777049
2552 Ga0496109_1385440
2553 Ga0496109_1475256
2554 Ga0496110_0000050
2555 Ga0496110_0001458
2556 Ga0496110_0001849
2557 Ga0496110_0026390
2558 Ga0496110_0037764
2559 Ga0496110_0052898
2560 Ga0496110_0145630
2561 Ga0496110_0147470
2562 Ga0496110_0155437
2563 Ga0496110_0890573
2564 Ga0496110_0979719
2565 Ga0496110_0980582
2566 Ga0496110_1322685
2567 Ga0496111_0000220
2568 Ga0496111_0001831
2569 Ga0496111_0006906
2570 Ga0496111_0012770
2571 Ga0496111_0018008
2572 Ga0496111_0039522
2573 Ga0496111_0189541
2574 Ga0496111_0243419
2575 Ga0496111_0548236
2576 Ga0496111_0663559
2577 Ga0496111_0725546
2578 Ga0496111_0844337
2579 Ga0496111_1065409
2580 Ga0496111_1248246
2581 Ga0496112_0001403
2582 Ga0496112_0002855
2583 Ga0496112_0036631
2584 Ga0496112_0057166
2585 Ga0496112_0062190
2586 Ga0496112_0063249
2587 Ga0496112_0068230
2588 Ga0496112_0071756
2589 Ga0496112_0091440
2590 Ga0496112_0091871
2591 Ga0496112_0131316
2592 Ga0496112_0133272
2593 Ga0496112_0226470
2594 Ga0496112_0234547
2595 Ga0496112_0274169
2596 Ga0496112_0347247
2597 Ga0496112_0712151
2598 Ga0496112_1095647
2599 Ga0496113_0000110
2600 Ga0496113_0003480
2601 Ga0496113_0035153
2602 Ga0496113_0045159
2603 Ga0496113_0058788
2604 Ga0496113_0071087
2605 Ga0496113_0077425
2606 Ga0496113_0077663
2607 Ga0496114_0000444
2608 Ga0496114_0003753
2609 Ga0496114_0012286
2610 Ga0496114_0012957
2611 Ga0496114_0030659
2612 Ga0496114_0060188
2613 Ga0496114_0404097
2614 Ga0496114_0457774
2615 Ga0496114_0963943
2616 Ga0496114_1410131
2617 Ga0496115_0000415
2618 Ga0496115_0001670
2619 Ga0496115_0025304
2620 Ga0496115_0046506
2621 Ga0496115_0081441
2622 Ga0496115_0104624
2623 Ga0501291_076113
2624 Ga0501031_0005395
2625 Ga0501031_0072297
2626 Ga0501031_0232321
2627 Ga0501032_0023411
2628 Ga0501033_0004771
2629 Ga0501034_0031025
2630 Ga0501034_0675337
2631 Ga0501036_0013360
2632 Ga0501036_1047061
2633 Ga0501037_0003648
2634 Ga0501038_0032198
2635 Ga0501038_0175546
2636 Ga0501039_0017450
2637 Ga0501039_0754646
2638 Ga0501040_0005743
2639 Ga0501040_0443348
2640 Ga0501041_0011812
2641 Ga0501041_0174846
2642 Ga0501042_0057144
2643 Ga0501042_0260677
2644 Ga0501043_0007710
2645 Ga0501046_0009343
2646 Ga0501046_0133718
2647 Ga0501046_0772023
2648 Ga0501048_0053476
2649 Ga0501048_0383988
2650 Ga0501067_0003757
2651 Ga0501067_0073589
2652 Ga0501067_0122816
2653 Ga0501067_0275991
2654 Ga0501068_0001136
2655 Ga0501068_0678600
2656 Ga0501068_0892325
2657 Ga0501069_0039402
2658 Ga0501069_0053703
2659 Ga0501069_0084769
2660 Ga0501069_0837446
2661 Ga0501070_0008199
2662 Ga0501070_0013400
2663 Ga0501071_0265474
2664 Ga0501072_0051023
2665 Ga0501073_0010236
2666 Ga0501073_0063712
2667 Ga0501074_0004394
2668 Ga0501074_0006260
2669 Ga0501074_0095973
2670 Ga0501075_0055663
2671 Ga0501076_0295040
2672 Ga0501076_0483427
2673 Ga0501077_0016391
2674 Ga0501199_041683
2675 Ga0501221_080779
2676 Ga0501079_0039770
2677 Ga0501079_0097803
2678 Ga0501079_0215745
2679 Ga0501079_0310251
2680 Ga0501079_0752956
2681 Ga0501080_0010664
2682 Ga0501080_0017932
2683 Ga0501080_0313441
2684 Ga0501080_1132710
2685 Ga0501081_0011695
2686 Ga0501081_0233551
2687 Ga0501081_0937552
2688 Ga0501081_0950286
2689 Ga0501083_0003994
2690 Ga0501083_0008092
2691 Ga0501044_0102376
2692 Ga0501045_0008660
2693 Ga0501045_0286591
2694 nmdc:mga0yw44_16776_c1
2695 nmdc:mga06z11_807976_c1
2696 nmdc:mga05p37_113901_c1
2697 nmdc:mga05p37_1202827_c1
2698 nmdc:mga05p37_124341_c1
2699 nmdc:mga05p37_1736243_c1
2700 nmdc:mga05p37_189208_c1
2701 nmdc:mga05p37_24348_c1
2702 nmdc:mga05p37_71385_c1
2703 nmdc:mga06r32_384355_c1
2704 nmdc:mga06r32_388253_c1
2705 nmdc:mga06r32_68393_c1
2706 nmdc:mga08y16_2126135_c1
2707 nmdc:mga08y16_317010_c1
2708 nmdc:mga08y16_629797_c1
2709 nmdc:mga08y16_776026_c1
2710 nmdc:mga08y16_85257_c1
2711 nmdc:mga0n895_1464674_c1
2712 nmdc:mga0n895_15676_c1
2713 nmdc:mga0n895_16554_c1
2714 nmdc:mga0n895_1857899_c1
2715 nmdc:mga0n895_26848_c1
2716 nmdc:mga0n895_279002_c1
2717 nmdc:mga0n895_339874_c1
2718 nmdc:mga0n895_485274_c1
2719 nmdc:mga0n895_70715_c1
2720 nmdc:mga0rr50_124982_c1
2721 nmdc:mga0rr50_268914_c1
2722 nmdc:mga0rr50_30376_c1
2723 nmdc:mga0rr50_35270_c1
2724 nmdc:mga0rr50_84258_c1
2725 nmdc:mga08x19_145872_c1
2726 nmdc:mga08x19_16014_c1
2727 nmdc:mga08x19_418495_c1
2728 nmdc:mga0a205_1012034_c1
2729 nmdc:mga0a205_259767_c1
2730 nmdc:mga0a205_308681_c1
2731 nmdc:mga0a205_426065_c1
2732 nmdc:mga0a205_5604_c1
2733 nmdc:mga0a205_701067_c1
2734 nmdc:mga0a205_71904_c1
2735 Ga0495601_0189236
2736 Ga0495601_0194048
2737 Ga0495601_0209665
2738 Ga0495601_0221887
2739 Ga0495601_0571501
2740 Ga0495612_0221722
2741 Ga0495612_0415940
2742 Ga0495655_0003073
2743 Ga0495655_0015831
2744 Ga0495595_0019836
2745 Ga0495595_0151201
2746 Ga0495619_0002519
2747 Ga0495619_0003695
2748 Ga0495619_0061870
2749 Ga0495619_0210496
2750 Ga0495619_0870512
2751 Ga0501084_0026397
2752 Ga0501084_1255144
2753 Ga0587111_0239817
2754 Ga0501082_0044749
2755 Ga0501082_0484782
2756 Ga0466962_0011649
2757 Ga0466962_0680270
2758 Ga0530510_0035068
2759 Ga0530510_0048047
2760 Ga0530510_0152880
2761 Ga0530510_0461717
2762 Ga0530510_0793642

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

142

0.94

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

23

98

0.92

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

71

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9756 2 141
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9696 2 141
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9664 2 140
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9657 2 141
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9641 2 141
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9832 2 72 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9744 2 70 3.10.20.30
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9733 78 141 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9727 77 141 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.971 77 141 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A538ACY4-F1-model_v4 (2Fe-2S)-binding protein 0.9998 22 143 GO:0016491
GO:0046872
GO:0051537
AF-A0A537ZX30-F1-model_v4 (2Fe-2S)-binding protein 0.9965 2 143 GO:0016491
GO:0046872
GO:0051537
AF-A0A538K606-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9959 2 143 GO:0016491
GO:0016787
GO:0046872
GO:0051537
AF-A0A537Z314-F1-model_v4 (2Fe-2S)-binding protein 0.995 2 143 GO:0016491
GO:0046872
GO:0051537
AF-A0A852ZH92-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase small subunit (CoxS/CutS family) 0.9926 2 143 GO:0016491
GO:0046872
GO:0051537

Map