F493421

General Info

Members Datasets Scaffolds Average Seq Length
1371 381 1371 352

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0146740|Ga0495674_0146740_710_1945
Length 404
Sequence MVAPYTLELPSDRRRPKHRLGITDAAGEAGLRPAPERARLGPDDLSTKGRRMPRRVVLLVGTRKGCFVMESDIDRRDWQIRGPYCDGWPVYHAIYDGESGAIYAAAASEWHGTGIWRSGDLGENWQMSSEGLGYGENAELKLSKVSGLSAAHGRVLAGAEAAGVFESRDGGATWSLKSTLDGQPGRELWNIPENQPPGHLGMPAIMAHPTEPEHFWVVIQGMGIFETTDDAATWTPRNNGLRAAWPREHEDVGFCVHKLVMSPLDTDRMYQQNHVGMHRSDDGGHSWVEVTEGLPTEFGFAAATHPHDRDSFYVIPLDPGHGRFMPDGHASVWRTSDAGSSLPRQDAYLGVLREGMAIDDLDVPGLYFGTSTGQLFASPDEGESWNEIASYLPAIASVEVAVVD

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
244 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
245 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
248 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
249 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
381 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.07
Nodule 0
Rhizoplane 13.13
Rhizosphere 86.73
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10002884 3300002077 Bacteria 3515
2 JGI24742J22300_10005646 3300002244 Bacteria 2057
3 JGI25404J52841_10019399 3300003659 Bacteria 1473
4 Ga0070658_10003443 3300005327 Bacteria 13010
5 Ga0070658_10011810 3300005327 Bacteria 7009
6 Ga0070658_10015018 3300005327 Bacteria 6199
7 Ga0070658_10073886 3300005327 Bacteria 2796
8 Ga0070658_10080506 3300005327 Bacteria 2675
9 Ga0070658_10185514 3300005327 Bacteria 1752
10 Ga0070683_100002682 3300005329 Bacteria 14230
11 Ga0070683_100018913 3300005329 Bacteria 6112
12 Ga0070683_100019430 3300005329 Bacteria 6034
13 Ga0070683_100059336 3300005329 Bacteria 3554
14 Ga0070683_100202020 3300005329 Bacteria 1887
15 Ga0070683_100341656 3300005329 Bacteria 1425
16 Ga0070683_100368282 3300005329 Bacteria 1368
17 Ga0070683_100443520 3300005329 Bacteria 1239
18 Ga0070690_100029743 3300005330 Bacteria 3391
19 Ga0070690_100086932 3300005330 Bacteria 2053
20 Ga0070670_100196243 3300005331 Unclassified 1753
21 Ga0068869_100085644 3300005334 Bacteria 2361
22 Ga0068869_100140308 3300005334 Unclassified 1866
23 Ga0070680_100010728 3300005336 Bacteria 7074
24 Ga0070680_100011868 3300005336 Bacteria 6757
25 Ga0070680_100046131 3300005336 Bacteria 3544
26 Ga0070680_100111784 3300005336 Bacteria 2274
27 Ga0070680_100176877 3300005336 Bacteria 1796
28 Ga0070680_100303575 3300005336 Bacteria 1354
29 Ga0070680_100355603 3300005336 Unclassified 1246
30 Ga0070682_100005203 3300005337 Bacteria 7237
31 Ga0070682_100005908 3300005337 Bacteria 6841
32 Ga0070682_100038562 3300005337 Bacteria 2930
33 Ga0070682_100087443 3300005337 Bacteria 2032
34 Ga0070682_100162347 3300005337 Bacteria 1544
35 Ga0068868_100005641 3300005338 Bacteria 8811
36 Ga0068868_100011526 3300005338 Bacteria 6440
37 Ga0068868_100012174 3300005338 Bacteria 6283
38 Ga0068868_100047501 3300005338 Bacteria 3365
39 Ga0068868_100059303 3300005338 Bacteria 3027
40 Ga0068868_100162712 3300005338 Bacteria 1844
41 Ga0070660_100000759 3300005339 Bacteria 21431
42 Ga0070660_100007876 3300005339 Bacteria 7430
43 Ga0070660_100016340 3300005339 Bacteria 5386
44 Ga0070660_100050468 3300005339 Bacteria 3201
45 Ga0070660_100117567 3300005339 Bacteria 2120
46 Ga0070660_100123015 3300005339 Unclassified 2071
47 Ga0070660_100129479 3300005339 Bacteria 2019
48 Ga0070689_100013742 3300005340 Bacteria 5865
49 Ga0070689_100087756 3300005340 Bacteria 2447
50 Ga0070689_100126327 3300005340 Bacteria 2047
51 Ga0070689_100196789 3300005340 Bacteria 1644
52 Ga0070691_10020246 3300005341 Bacteria 3074
53 Ga0070691_10029838 3300005341 Bacteria 2553
54 Ga0070691_10035697 3300005341 Bacteria 2341
55 Ga0070687_100057512 3300005343 Bacteria 2040
56 Ga0070661_100013378 3300005344 Bacteria 5759
57 Ga0070661_100036123 3300005344 Bacteria 3592
58 Ga0070661_100066423 3300005344 Bacteria 2650
59 Ga0070661_100245207 3300005344 Bacteria 1381
60 Ga0070692_10017715 3300005345 Bacteria 3412
61 Ga0070692_10125904 3300005345 Bacteria 1435
62 Ga0070668_100089427 3300005347 Bacteria 2425
63 Ga0070668_100095597 3300005347 Bacteria 2347
64 Ga0070668_100236709 3300005347 Bacteria 1511
65 Ga0070669_100116168 3300005353 Bacteria 2036
66 Ga0070675_100065652 3300005354 Bacteria 3001
67 Ga0070675_100107472 3300005354 Bacteria 2356
68 Ga0070671_100043832 3300005355 Bacteria 3718
69 Ga0070671_100050442 3300005355 Bacteria 3461
70 Ga0070671_100142501 3300005355 Bacteria 2023
71 Ga0070674_100043947 3300005356 Bacteria 3042
72 Ga0070674_100044931 3300005356 Bacteria 3015
73 Ga0070674_100172688 3300005356 Unclassified 1650
74 Ga0070674_100175630 3300005356 Bacteria 1636
75 Ga0070673_100031989 3300005364 Bacteria 3955
76 Ga0070673_100092634 3300005364 Unclassified 2473
77 Ga0070673_100389175 3300005364 Bacteria 1245
78 Ga0070688_100008183 3300005365 Bacteria 5665
79 Ga0070688_100011865 3300005365 Bacteria 4861
80 Ga0070688_100023454 3300005365 Bacteria 3630
81 Ga0070688_100158982 3300005365 Unclassified 1551
82 Ga0070688_100177876 3300005365 Bacteria 1473
83 Ga0070659_100000080 3300005366 Bacteria 73366
84 Ga0070659_100063820 3300005366 Bacteria 2914
85 Ga0070659_100085643 3300005366 Bacteria 2520
86 Ga0070659_100155318 3300005366 Bacteria 1868
87 Ga0070667_100041251 3300005367 Bacteria 3872
88 Ga0070667_100212058 3300005367 Bacteria 1721
89 Ga0070709_10007139 3300005434 Bacteria 6116
90 Ga0070714_100000036 3300005435 Bacteria 126916
91 Ga0070714_100003258 3300005435 Bacteria 12085
92 Ga0070714_100048134 3300005435 Bacteria 3625
93 Ga0070714_100051384 3300005435 Bacteria 3513
94 Ga0070714_100096340 3300005435 Bacteria 2600
95 Ga0070714_100142940 3300005435 Bacteria 2150
96 Ga0070714_100153236 3300005435 Bacteria 2079
97 Ga0070714_100477661 3300005435 Bacteria 1187
98 Ga0070713_100011491 3300005436 Bacteria 6450
99 Ga0070713_100058244 3300005436 Bacteria 3221
100 Ga0070713_100226647 3300005436 Bacteria 1697
101 Ga0070710_10001541 3300005437 Bacteria 10892
102 Ga0070710_10007082 3300005437 Bacteria 5414
103 Ga0070710_10191720 3300005437 Unclassified 1286
104 Ga0070701_10002326 3300005438 Bacteria 7291
105 Ga0070701_10014128 3300005438 Bacteria 3653
106 Ga0070701_10061840 3300005438 Bacteria 1976
107 Ga0070711_100003182 3300005439 Bacteria 9527
108 Ga0070711_100040213 3300005439 Bacteria 3152
109 Ga0070711_100168059 3300005439 Bacteria 1669
110 Ga0070711_100225247 3300005439 Bacteria 1459
111 Ga0070705_100011226 3300005440 Bacteria 4512
112 Ga0070705_100029624 3300005440 Bacteria 3014
113 Ga0070700_100001522 3300005441 Bacteria 11542
114 Ga0070700_100011512 3300005441 Bacteria 4901
115 Ga0070700_100024380 3300005441 Bacteria 3551
116 Ga0070694_100036445 3300005444 Bacteria 3258
117 Ga0070694_100054439 3300005444 Bacteria 2711
118 Ga0070694_100306185 3300005444 Bacteria 1219
119 Ga0070708_100007570 3300005445 Bacteria 8693
120 Ga0070663_100007368 3300005455 Bacteria 6693
121 Ga0070663_100088073 3300005455 Bacteria 2295
122 Ga0070678_100001885 3300005456 Bacteria 11318
123 Ga0070678_100003794 3300005456 Bacteria 8477
124 Ga0070678_100144887 3300005456 Bacteria 1905
125 Ga0070678_100234039 3300005456 Bacteria 1533
126 Ga0070678_100368691 3300005456 Unclassified 1239
127 Ga0070681_10000518 3300005458 Bacteria 31531
128 Ga0070681_10004042 3300005458 Bacteria 13843
129 Ga0070681_10005563 3300005458 Bacteria 12170
130 Ga0070681_10012878 3300005458 Bacteria 8306
131 Ga0070681_10044026 3300005458 Bacteria 4467
132 Ga0070681_10048436 3300005458 Bacteria 4246
133 Ga0070681_10106009 3300005458 Bacteria 2752
134 Ga0070681_10116269 3300005458 Unclassified 2612
135 Ga0070681_10122641 3300005458 Bacteria 2532
136 Ga0070681_10138901 3300005458 Bacteria 2360
137 Ga0068867_100002812 3300005459 Bacteria 12234
138 Ga0068867_100047283 3300005459 Bacteria 3163
139 Ga0068867_100060000 3300005459 Bacteria 2821
140 Ga0068867_100147885 3300005459 Bacteria 1843
141 Ga0070685_10034706 3300005466 Bacteria 2842
142 Ga0070685_10047068 3300005466 Bacteria 2479
143 Ga0070706_100097488 3300005467 Bacteria 2731
144 Ga0070706_100099647 3300005467 Bacteria 2699
145 Ga0070706_100158513 3300005467 Bacteria 2113
146 Ga0070706_100244060 3300005467 Bacteria 1677
147 Ga0070707_100026524 3300005468 Bacteria 5502
148 Ga0070707_100144453 3300005468 Bacteria 2316
149 Ga0070698_100100234 3300005471 Unclassified 2869
150 Ga0070698_100207210 3300005471 Unclassified 1896
151 Ga0070698_100241519 3300005471 Bacteria 1739
152 Ga0070699_100085358 3300005518 Bacteria 2755
153 Ga0070699_100303905 3300005518 Unclassified 1431
154 Ga0070679_100001323 3300005530 Bacteria 21818
155 Ga0070679_100043990 3300005530 Bacteria 4447
156 Ga0070679_100171905 3300005530 Bacteria 2139
157 Ga0070679_100246426 3300005530 Bacteria 1743
158 Ga0070684_100003157 3300005535 Bacteria 12310
159 Ga0070684_100003716 3300005535 Bacteria 11515
160 Ga0070684_100051855 3300005535 Bacteria 3566
161 Ga0070684_100138512 3300005535 Bacteria 2199
162 Ga0070684_100177061 3300005535 Bacteria 1938
163 Ga0070684_100304808 3300005535 Bacteria 1462
164 Ga0070684_100328482 3300005535 Bacteria 1405
165 Ga0070684_100351580 3300005535 Bacteria 1356
166 Ga0070697_100015513 3300005536 Bacteria 5981
167 Ga0068853_100010897 3300005539 Bacteria 7365
168 Ga0068853_100130271 3300005539 Bacteria 2251
169 Ga0068853_100196714 3300005539 Bacteria 1834
170 Ga0068853_100241152 3300005539 Bacteria 1657
171 Ga0070672_100005975 3300005543 Bacteria 8125
172 Ga0070686_100004420 3300005544 Bacteria 7758
173 Ga0070686_100015313 3300005544 Bacteria 4438
174 Ga0070686_100057069 3300005544 Bacteria 2507
175 Ga0070686_100089851 3300005544 Bacteria 2052
176 Ga0070695_100028559 3300005545 Bacteria 3462
177 Ga0070695_100215728 3300005545 Bacteria 1380
178 Ga0070696_100005547 3300005546 Bacteria 8423
179 Ga0070696_100022477 3300005546 Bacteria 4285
180 Ga0070696_100142854 3300005546 Bacteria 1751
181 Ga0070696_100203906 3300005546 Bacteria 1477
182 Ga0070693_100002841 3300005547 Bacteria 7977
183 Ga0070693_100016564 3300005547 Bacteria 3818
184 Ga0070693_100026239 3300005547 Unclassified 3144
185 Ga0070693_100179703 3300005547 Bacteria 1361
186 Ga0070665_100021998 3300005548 Bacteria 6414
187 Ga0070665_100105506 3300005548 Bacteria 2820
188 Ga0070665_100214940 3300005548 Bacteria 1924
189 Ga0070704_100018433 3300005549 Bacteria 4464
190 Ga0070704_100065782 3300005549 Bacteria 2611
191 Ga0068855_100014421 3300005563 Bacteria 9514
192 Ga0068855_100019419 3300005563 Bacteria 8166
193 Ga0068855_100019598 3300005563 Bacteria 8125
194 Ga0068855_100095467 3300005563 Bacteria 3427
195 Ga0068855_100108032 3300005563 Bacteria 3196
196 Ga0068855_100126656 3300005563 Bacteria 2920
197 Ga0068855_100134549 3300005563 Bacteria 2820
198 Ga0068855_100409364 3300005563 Unclassified 1485
199 Ga0068855_100436688 3300005563 Bacteria 1430
200 Ga0070664_100113394 3300005564 Bacteria 2368
201 Ga0070664_100345432 3300005564 Bacteria 1352
202 Ga0068857_100006214 3300005577 Bacteria 10213
203 Ga0068857_100011530 3300005577 Bacteria 7690
204 Ga0068857_100075633 3300005577 Bacteria 3002
205 Ga0068854_100045419 3300005578 Bacteria 3123
206 Ga0068854_100108576 3300005578 Bacteria 2090
207 Ga0068854_100250098 3300005578 Unclassified 1415
208 Ga0068856_100019097 3300005614 Bacteria 6653
209 Ga0068856_100044239 3300005614 Bacteria 4381
210 Ga0068856_100069339 3300005614 Bacteria 3486
211 Ga0068856_100071873 3300005614 Bacteria 3425
212 Ga0068856_100142078 3300005614 Bacteria 2408
213 Ga0070702_100006871 3300005615 Bacteria 5417
214 Ga0070702_100015335 3300005615 Bacteria 3911
215 Ga0070702_100035391 3300005615 Unclassified 2759
216 Ga0070702_100039812 3300005615 Bacteria 2625
217 Ga0070702_100079399 3300005615 Bacteria 1961
218 Ga0068852_100042171 3300005616 Bacteria 3862
219 Ga0068852_100072866 3300005616 Bacteria 3020
220 Ga0068852_100297503 3300005616 Bacteria 1561
221 Ga0068859_100025360 3300005617 Bacteria 5948
222 Ga0068859_100044009 3300005617 Bacteria 4487
223 Ga0068864_100014184 3300005618 Bacteria 6615
224 Ga0068866_10004917 3300005718 Bacteria 5494
225 Ga0068866_10086979 3300005718 Bacteria 1693
226 Ga0068861_100131528 3300005719 Bacteria 2031
227 Ga0068870_10022453 3300005840 Bacteria 3101
228 Ga0068863_100105335 3300005841 Bacteria 2683
229 Ga0068863_100148724 3300005841 Bacteria 2241
230 Ga0068858_100040878 3300005842 Bacteria 4300
231 Ga0068858_100108478 3300005842 Bacteria 2592
232 Ga0068858_100342533 3300005842 Bacteria 1431
233 Ga0068860_100135494 3300005843 Bacteria 2364
234 Ga0068862_100253726 3300005844 Bacteria 1604
235 Ga0081455_10020753 3300005937 Bacteria 6177
236 Ga0081455_10023080 3300005937 Bacteria 5796
237 Ga0081455_10058043 3300005937 Bacteria 3277
238 Ga0081538_10062371 3300005981 Bacteria 2126
239 Ga0081540_1002691 3300005983 Bacteria 14453
240 Ga0081540_1015448 3300005983 Bacteria 4835
241 Ga0081540_1016680 3300005983 Bacteria 4582
242 Ga0081539_10031156 3300005985 Bacteria 3294
243 Ga0070717_10000006 3300006028 Bacteria 353403
244 Ga0070717_10007976 3300006028 Bacteria 7885
245 Ga0070717_10032371 3300006028 Bacteria 4213
246 Ga0070717_10042733 3300006028 Bacteria 3697
247 Ga0070717_10047365 3300006028 Bacteria 3522
248 Ga0070717_10084014 3300006028 Bacteria 2678
249 Ga0075365_10220905 3300006038 Unclassified 1329
250 Ga0075432_10018462 3300006058 Bacteria 2379
251 Ga0070715_10009629 3300006163 Bacteria 3413
252 Ga0070715_10012087 3300006163 Bacteria 3128
253 Ga0070715_10025627 3300006163 Bacteria 2338
254 Ga0070716_100004482 3300006173 Bacteria 6680
255 Ga0070716_100061862 3300006173 Bacteria 2168
256 Ga0070712_100078499 3300006175 Bacteria 2383
257 Ga0070712_100177010 3300006175 Bacteria 1659
258 Ga0097621_100053182 3300006237 Bacteria 3300
259 Ga0097621_100260383 3300006237 Bacteria 1521
260 Ga0097621_100268824 3300006237 Bacteria 1498
261 Ga0068871_100013932 3300006358 Bacteria 5978
262 Ga0068871_100052867 3300006358 Unclassified 3291
263 Ga0068871_100102089 3300006358 Bacteria 2404
264 Ga0075428_100273315 3300006844 Bacteria 1818
265 Ga0075428_100380798 3300006844 Bacteria 1513
266 Ga0075431_100021201 3300006847 Bacteria 6640
267 Ga0075433_10032954 3300006852 Bacteria 4439
268 Ga0075434_100001958 3300006871 Bacteria 17851
269 Ga0075434_100013173 3300006871 Bacteria 7856
270 Ga0075434_100015804 3300006871 Bacteria 7246
271 Ga0075434_100030670 3300006871 Bacteria 5296
272 Ga0075434_100415876 3300006871 Bacteria 1366
273 Ga0068865_100002447 3300006881 Bacteria 10981
274 Ga0068865_100012987 3300006881 Bacteria 5251
275 Ga0068865_100014363 3300006881 Bacteria 5031
276 Ga0068865_100022585 3300006881 Bacteria 4106
277 Ga0075436_100007259 3300006914 Bacteria 7583
278 Ga0075436_100025415 3300006914 Bacteria 4076
279 Ga0075436_100028376 3300006914 Bacteria 3850
280 Ga0075436_100130757 3300006914 Bacteria 1760
281 Ga0097620_100025360 3300006931 Bacteria 5948
282 Ga0097620_100044009 3300006931 Bacteria 4487
283 Ga0075435_100004915 3300007076 Bacteria 9267
284 Ga0075435_100008824 3300007076 Bacteria 7262
285 Ga0075435_100010843 3300007076 Bacteria 6674
286 Ga0075435_100137004 3300007076 Bacteria 2051
287 Ga0075435_100318621 3300007076 Bacteria 1331
288 Ga0105240_10017534 3300009093 Bacteria 9647
289 Ga0105240_10031933 3300009093 Bacteria 6822
290 Ga0105240_10108444 3300009093 Bacteria 3364
291 Ga0105240_10309329 3300009093 Bacteria 1805
292 Ga0111539_10003876 3300009094 Bacteria 19693
293 Ga0111539_10217044 3300009094 Bacteria 2228
294 Ga0111539_10252483 3300009094 Bacteria 2053
295 Ga0105245_10010713 3300009098 Bacteria 7977
296 Ga0105245_10021635 3300009098 Bacteria 5644
297 Ga0105245_10022996 3300009098 Bacteria 5469
298 Ga0105245_10067558 3300009098 Bacteria 3238
299 Ga0105245_10067593 3300009098 Bacteria 3237
300 Ga0105245_10076089 3300009098 Bacteria 3057
301 Ga0105245_10105372 3300009098 Bacteria 2615
302 Ga0105245_10132349 3300009098 Unclassified 2340
303 Ga0105245_10255762 3300009098 Unclassified 1703
304 Ga0105245_10344290 3300009098 Bacteria 1475
305 Ga0105247_10009486 3300009101 Bacteria 5903
306 Ga0105247_10031126 3300009101 Bacteria 3237
307 Ga0105247_10301659 3300009101 Bacteria 1112
308 Ga0114129_10002432 3300009147 Bacteria 25835
309 Ga0114129_10082542 3300009147 Bacteria 4465
310 Ga0114129_10122685 3300009147 Bacteria 3575
311 Ga0114129_10260979 3300009147 Unclassified 2322
312 Ga0105243_10003824 3300009148 Bacteria 12041
313 Ga0105243_10028730 3300009148 Bacteria 4271
314 Ga0105243_10066543 3300009148 Bacteria 2898
315 Ga0105243_10068593 3300009148 Bacteria 2858
316 Ga0105243_10100357 3300009148 Bacteria 2401
317 Ga0105243_10119321 3300009148 Bacteria 2221
318 Ga0105243_10128346 3300009148 Bacteria 2148
319 Ga0105243_10185032 3300009148 Bacteria 1815
320 Ga0105243_10225870 3300009148 Unclassified 1658
321 Ga0105243_10317989 3300009148 Bacteria 1417
322 Ga0105241_10007740 3300009174 Bacteria 7899
323 Ga0105241_10206493 3300009174 Bacteria 1644
324 Ga0105241_10249202 3300009174 Bacteria 1505
325 Ga0105242_10003423 3300009176 Bacteria 12337
326 Ga0105242_10071317 3300009176 Bacteria 2882
327 Ga0105242_10077163 3300009176 Bacteria 2779
328 Ga0105242_10151211 3300009176 Bacteria 2024
329 Ga0105242_10288935 3300009176 Unclassified 1492
330 Ga0105248_10012945 3300009177 Bacteria 9195
331 Ga0105248_10039933 3300009177 Bacteria 5260
332 Ga0105248_10110364 3300009177 Bacteria 3101
333 Ga0105248_10450087 3300009177 Bacteria 1451
334 Ga0105237_10220125 3300009545 Bacteria 1898
335 Ga0105238_10006133 3300009551 Bacteria 11931
336 Ga0105238_10026354 3300009551 Bacteria 5926
337 Ga0105238_10123948 3300009551 Bacteria 2563
338 Ga0105249_10001792 3300009553 Bacteria 18700
339 Ga0105249_10106700 3300009553 Bacteria 2643
340 Ga0105249_10116847 3300009553 Bacteria 2529
341 Ga0105249_10140071 3300009553 Bacteria 2319
342 Ga0105249_10311229 3300009553 Bacteria 1583
343 Ga0105239_10006563 3300010375 Bacteria 13473
344 Ga0105239_10036872 3300010375 Bacteria 5364
345 Ga0105239_10134732 3300010375 Bacteria 2750
346 Ga0105239_10139468 3300010375 Bacteria 2701
347 Ga0105239_10150823 3300010375 Bacteria 2594
348 Ga0105239_10162379 3300010375 Bacteria 2497
349 Ga0105239_10232752 3300010375 Unclassified 2067
350 Ga0105239_10421419 3300010375 Bacteria 1512
351 Ga0105239_10537819 3300010375 Bacteria 1330
352 Ga0105246_10008947 3300011119 Bacteria 6164
353 Ga0105246_10143123 3300011119 Bacteria 1801
354 Ga0105246_10271088 3300011119 Unclassified 1357
355 Ga0157371_10110462 3300013102 Bacteria 1951
356 Ga0157370_10022667 3300013104 Bacteria 6249
357 Ga0157370_10023626 3300013104 Bacteria 6101
358 Ga0157370_10048491 3300013104 Bacteria 4068
359 Ga0157370_10061797 3300013104 Bacteria 3554
360 Ga0157370_10122530 3300013104 Bacteria 2428
361 Ga0157370_10388171 3300013104 Bacteria 1286
362 Ga0157369_10002142 3300013105 Bacteria 23816
363 Ga0157369_10010968 3300013105 Bacteria 10315
364 Ga0157369_10079013 3300013105 Bacteria 3524
365 Ga0157374_10012233 3300013296 Bacteria 7459
366 Ga0157374_10014245 3300013296 Bacteria 6954
367 Ga0157374_10027317 3300013296 Bacteria 5145
368 Ga0157374_10060575 3300013296 Bacteria 3542
369 Ga0157378_10004712 3300013297 Bacteria 11959
370 Ga0157378_10059956 3300013297 Bacteria 3396
371 Ga0157378_10079526 3300013297 Bacteria 2960
372 Ga0157378_10106202 3300013297 Bacteria 2568
373 Ga0157378_10202299 3300013297 Bacteria 1879
374 Ga0157378_10207458 3300013297 Unclassified 1856
375 Ga0163162_10005507 3300013306 Bacteria 12239
376 Ga0163162_10283621 3300013306 Bacteria 1788
377 Ga0157372_10048986 3300013307 Bacteria 4697
378 Ga0157372_10116594 3300013307 Bacteria 3062
379 Ga0157372_10205252 3300013307 Bacteria 2283
380 Ga0157375_10100991 3300013308 Bacteria 2967
381 Ga0157375_10130990 3300013308 Bacteria 2627
382 Ga0157375_10190020 3300013308 Bacteria 2208
383 Ga0157375_10328291 3300013308 Bacteria 1695
384 Ga0157375_10436488 3300013308 Bacteria 1475
385 Ga0163163_10055085 3300014325 Bacteria 3930
386 Ga0163163_10113274 3300014325 Bacteria 2742
387 Ga0163163_10213174 3300014325 Bacteria 1980
388 Ga0157380_10008142 3300014326 Bacteria 7468
389 Ga0157380_10076617 3300014326 Bacteria 2722
390 Ga0157380_10151368 3300014326 Bacteria 2006
391 Ga0157380_10175687 3300014326 Bacteria 1876
392 Ga0157380_10208905 3300014326 Bacteria 1738
393 Ga0157380_10259385 3300014326 Bacteria 1578
394 Ga0182008_10003096 3300014497 Bacteria 10204
395 Ga0182008_10084527 3300014497 Bacteria 1563
396 Ga0157377_10031183 3300014745 Unclassified 2895
397 Ga0157379_10020906 3300014968 Bacteria 5791
398 Ga0157379_10132872 3300014968 Bacteria 2241
399 Ga0157379_10176821 3300014968 Unclassified 1927
400 Ga0157376_10041867 3300014969 Bacteria 3753
401 Ga0157376_10064957 3300014969 Bacteria 3079
402 Ga0157376_10071467 3300014969 Bacteria 2949
403 Ga0157376_10268485 3300014969 Bacteria 1601
404 Ga0157376_10283216 3300014969 Bacteria 1562
405 Ga0182007_10012378 3300015262 Bacteria 3283
406 Ga0163161_10029345 3300017792 Bacteria 3910
407 Ga0163161_10087553 3300017792 Bacteria 2301
408 Ga0197907_10413493 3300020069 Bacteria 1447
409 Ga0197907_10465623 3300020069 Bacteria 1788
410 Ga0197907_10844542 3300020069 Unclassified 1212
411 Ga0197907_11502165 3300020069 Bacteria 4151
412 Ga0206356_10826571 3300020070 Bacteria 2590
413 Ga0206356_11372788 3300020070 Bacteria 2370
414 Ga0206356_11574989 3300020070 Bacteria 2416
415 Ga0206356_11749891 3300020070 Bacteria 1282
416 Ga0206349_1949934 3300020075 Bacteria 1934
417 Ga0206352_10699679 3300020078 Unclassified 1117
418 Ga0206350_10429191 3300020080 Bacteria 1237
419 Ga0206354_10258447 3300020081 Bacteria 2878
420 Ga0206354_10308263 3300020081 Bacteria 4394
421 Ga0206354_10684124 3300020081 Bacteria 5166
422 Ga0206354_11005081 3300020081 Bacteria 3994
423 Ga0206353_10083848 3300020082 Bacteria 2907
424 Ga0206353_10462240 3300020082 Bacteria 3480
425 Ga0206353_10676388 3300020082 Bacteria 1710
426 Ga0206353_11523222 3300020082 Bacteria 6379
427 Ga0206353_11844595 3300020082 Bacteria 1606
428 Ga0224712_10024379 3300022467 Bacteria 2112
429 Ga0224712_10033194 3300022467 Bacteria 1887
430 Ga0224712_10054154 3300022467 Bacteria 1573
431 Ga0224712_10113876 3300022467 Unclassified 1163
432 Ga0207692_10025531 3300025898 Bacteria 2761
433 Ga0207692_10055044 3300025898 Bacteria 2034
434 Ga0207642_10016714 3300025899 Bacteria 2772
435 Ga0207642_10056390 3300025899 Bacteria 1802
436 Ga0207710_10028513 3300025900 Bacteria 2424
437 Ga0207710_10063304 3300025900 Bacteria 1682
438 Ga0207710_10142515 3300025900 Bacteria 1158
439 Ga0207688_10002129 3300025901 Bacteria 10635
440 Ga0207688_10050763 3300025901 Unclassified 2323
441 Ga0207685_10006238 3300025905 Bacteria 3229
442 Ga0207699_10009410 3300025906 Bacteria 4864
443 Ga0207705_10013650 3300025909 Bacteria 5860
444 Ga0207705_10034989 3300025909 Bacteria 3593
445 Ga0207705_10141276 3300025909 Bacteria 1798
446 Ga0207705_10157196 3300025909 Bacteria 1706
447 Ga0207705_10181804 3300025909 Unclassified 1587
448 Ga0207705_10320279 3300025909 Bacteria 1191
449 Ga0207684_10236421 3300025910 Unclassified 1576
450 Ga0207684_10247160 3300025910 Bacteria 1539
451 Ga0207684_10395095 3300025910 Unclassified 1189
452 Ga0207707_10001608 3300025912 Bacteria 20814
453 Ga0207707_10009696 3300025912 Bacteria 8354
454 Ga0207707_10077434 3300025912 Bacteria 2903
455 Ga0207707_10133409 3300025912 Bacteria 2172
456 Ga0207707_10140418 3300025912 Bacteria 2112
457 Ga0207707_10323822 3300025912 Bacteria 1330
458 Ga0207695_10164148 3300025913 Bacteria 2150
459 Ga0207671_10052810 3300025914 Bacteria 3012
460 Ga0207671_10087507 3300025914 Bacteria 2343
461 Ga0207693_10006088 3300025915 Bacteria 9990
462 Ga0207693_10011416 3300025915 Bacteria 7192
463 Ga0207693_10047628 3300025915 Bacteria 3368
464 Ga0207693_10062134 3300025915 Bacteria 2926
465 Ga0207693_10092812 3300025915 Bacteria 2366
466 Ga0207693_10096857 3300025915 Unclassified 2313
467 Ga0207663_10001265 3300025916 Bacteria 11722
468 Ga0207663_10005939 3300025916 Bacteria 6197
469 Ga0207663_10057651 3300025916 Bacteria 2448
470 Ga0207663_10240745 3300025916 Bacteria 1327
471 Ga0207660_10008961 3300025917 Bacteria 6475
472 Ga0207660_10018008 3300025917 Bacteria 4704
473 Ga0207660_10054691 3300025917 Bacteria 2850
474 Ga0207660_10056829 3300025917 Bacteria 2801
475 Ga0207660_10062611 3300025917 Bacteria 2680
476 Ga0207660_10185996 3300025917 Bacteria 1616
477 Ga0207662_10023043 3300025918 Bacteria 3574
478 Ga0207657_10000054 3300025919 Bacteria 106767
479 Ga0207657_10000634 3300025919 Bacteria 37262
480 Ga0207657_10025770 3300025919 Bacteria 5416
481 Ga0207657_10029456 3300025919 Bacteria 4997
482 Ga0207657_10032356 3300025919 Bacteria 4726
483 Ga0207657_10100735 3300025919 Bacteria 2398
484 Ga0207657_10101424 3300025919 Unclassified 2389
485 Ga0207657_10174614 3300025919 Bacteria 1739
486 Ga0207657_10305723 3300025919 Bacteria 1259
487 Ga0207649_10024067 3300025920 Bacteria 3535
488 Ga0207649_10031156 3300025920 Unclassified 3167
489 Ga0207649_10039292 3300025920 Bacteria 2868
490 Ga0207649_10056943 3300025920 Bacteria 2442
491 Ga0207652_10011117 3300025921 Bacteria 7255
492 Ga0207652_10049343 3300025921 Bacteria 3603
493 Ga0207652_10077052 3300025921 Bacteria 2909
494 Ga0207652_10141597 3300025921 Bacteria 2151
495 Ga0207646_10020445 3300025922 Bacteria 6133
496 Ga0207646_10024163 3300025922 Bacteria 5570
497 Ga0207681_10003168 3300025923 Bacteria 10332
498 Ga0207681_10085496 3300025923 Bacteria 2239
499 Ga0207681_10122434 3300025923 Bacteria 1910
500 Ga0207694_10027888 3300025924 Bacteria 4303
501 Ga0207694_10215776 3300025924 Bacteria 1564
502 Ga0207650_10184737 3300025925 Bacteria 1663
503 Ga0207659_10065167 3300025926 Unclassified 2639
504 Ga0207659_10094951 3300025926 Bacteria 2235
505 Ga0207659_10162006 3300025926 Bacteria 1757
506 Ga0207659_10354707 3300025926 Bacteria 1218
507 Ga0207687_10002883 3300025927 Bacteria 11674
508 Ga0207687_10016177 3300025927 Bacteria 4897
509 Ga0207687_10033035 3300025927 Bacteria 3508
510 Ga0207687_10036029 3300025927 Bacteria 3369
511 Ga0207687_10043412 3300025927 Bacteria 3098
512 Ga0207687_10070358 3300025927 Bacteria 2498
513 Ga0207687_10085567 3300025927 Bacteria 2287
514 Ga0207687_10086506 3300025927 Bacteria 2276
515 Ga0207687_10175577 3300025927 Bacteria 1656
516 Ga0207687_10219302 3300025927 Bacteria 1497
517 Ga0207700_10013406 3300025928 Bacteria 5332
518 Ga0207700_10143507 3300025928 Bacteria 1965
519 Ga0207700_10164335 3300025928 Bacteria 1846
520 Ga0207700_10220250 3300025928 Bacteria 1608
521 Ga0207700_10224896 3300025928 Bacteria 1593
522 Ga0207700_10233911 3300025928 Bacteria 1563
523 Ga0207664_10000025 3300025929 Bacteria 196804
524 Ga0207664_10001134 3300025929 Bacteria 17735
525 Ga0207664_10012867 3300025929 Bacteria 5995
526 Ga0207664_10020210 3300025929 Bacteria 4933
527 Ga0207664_10081322 3300025929 Bacteria 2636
528 Ga0207664_10094481 3300025929 Bacteria 2457
529 Ga0207664_10098413 3300025929 Bacteria 2412
530 Ga0207664_10112820 3300025929 Bacteria 2263
531 Ga0207664_10115711 3300025929 Bacteria 2236
532 Ga0207664_10157829 3300025929 Unclassified 1932
533 Ga0207664_10159922 3300025929 Bacteria 1920
534 Ga0207664_10352047 3300025929 Bacteria 1304
535 Ga0207644_10053241 3300025931 Bacteria 2912
536 Ga0207644_10164373 3300025931 Bacteria 1728
537 Ga0207690_10000126 3300025932 Bacteria 63035
538 Ga0207690_10062330 3300025932 Bacteria 2538
539 Ga0207706_10292913 3300025933 Bacteria 1419
540 Ga0207686_10055329 3300025934 Bacteria 2489
541 Ga0207686_10057027 3300025934 Bacteria 2458
542 Ga0207709_10002377 3300025935 Bacteria 11868
543 Ga0207709_10027570 3300025935 Bacteria 3274
544 Ga0207709_10074225 3300025935 Bacteria 2170
545 Ga0207709_10151080 3300025935 Bacteria 1609
546 Ga0207709_10263122 3300025935 Unclassified 1266
547 Ga0207670_10107998 3300025936 Bacteria 2000
548 Ga0207669_10029874 3300025937 Bacteria 3020
549 Ga0207669_10296743 3300025937 Unclassified 1226
550 Ga0207704_10002110 3300025938 Bacteria 8920
551 Ga0207704_10029230 3300025938 Bacteria 3069
552 Ga0207704_10083955 3300025938 Bacteria 2069
553 Ga0207665_10000671 3300025939 Bacteria 23062
554 Ga0207665_10047629 3300025939 Bacteria 2875
555 Ga0207665_10084889 3300025939 Unclassified 2185
556 Ga0207691_10005009 3300025940 Bacteria 12774
557 Ga0207691_10138800 3300025940 Bacteria 2143
558 Ga0207711_10043125 3300025941 Bacteria 3846
559 Ga0207711_10188004 3300025941 Bacteria 1881
560 Ga0207711_10284621 3300025941 Bacteria 1523
561 Ga0207711_10346898 3300025941 Bacteria 1374
562 Ga0207689_10092850 3300025942 Bacteria 2479
563 Ga0207689_10153100 3300025942 Bacteria 1901
564 Ga0207661_10006480 3300025944 Bacteria 8277
565 Ga0207661_10007239 3300025944 Bacteria 7889
566 Ga0207661_10007446 3300025944 Bacteria 7791
567 Ga0207661_10075679 3300025944 Bacteria 2763
568 Ga0207661_10086391 3300025944 Bacteria 2603
569 Ga0207661_10150442 3300025944 Unclassified 2012
570 Ga0207679_10271027 3300025945 Unclassified 1452
571 Ga0207667_10014735 3300025949 Bacteria 8897
572 Ga0207667_10028354 3300025949 Bacteria 6081
573 Ga0207667_10141856 3300025949 Bacteria 2474
574 Ga0207667_10285976 3300025949 Bacteria 1685
575 Ga0207667_10307145 3300025949 Bacteria 1620
576 Ga0207667_10562850 3300025949 Bacteria 1152
577 Ga0207651_10138993 3300025960 Unclassified 1873
578 Ga0207712_10049053 3300025961 Bacteria 2940
579 Ga0207712_10155757 3300025961 Bacteria 1770
580 Ga0207712_10219454 3300025961 Bacteria 1519
581 Ga0207668_10083758 3300025972 Bacteria 2322
582 Ga0207668_10112248 3300025972 Bacteria 2047
583 Ga0207640_10108438 3300025981 Unclassified 1962
584 Ga0207640_10110815 3300025981 Bacteria 1945
585 Ga0207640_10140746 3300025981 Bacteria 1758
586 Ga0207640_10150097 3300025981 Bacteria 1711
587 Ga0207640_10293785 3300025981 Bacteria 1282
588 Ga0207658_10006900 3300025986 Bacteria 7732
589 Ga0207677_10041071 3300026023 Bacteria 3055
590 Ga0207677_10060840 3300026023 Unclassified 2612
591 Ga0207677_10095658 3300026023 Bacteria 2171
592 Ga0207703_10054226 3300026035 Bacteria 3260
593 Ga0207678_10028844 3300026067 Unclassified 4845
594 Ga0207678_10089986 3300026067 Bacteria 2623
595 Ga0207708_10001783 3300026075 Bacteria 15882
596 Ga0207708_10002859 3300026075 Bacteria 12710
597 Ga0207708_10007059 3300026075 Bacteria 8299
598 Ga0207708_10022225 3300026075 Bacteria 4789
599 Ga0207702_10006756 3300026078 Bacteria 9845
600 Ga0207702_10029006 3300026078 Unclassified 4602
601 Ga0207702_10043354 3300026078 Bacteria 3777
602 Ga0207702_10117296 3300026078 Bacteria 2377
603 Ga0207702_10233586 3300026078 Bacteria 1720
604 Ga0207641_10193806 3300026088 Bacteria 1869
605 Ga0207641_10447615 3300026088 Bacteria 1248
606 Ga0207648_10002707 3300026089 Bacteria 18858
607 Ga0207648_10003572 3300026089 Bacteria 16269
608 Ga0207648_10011420 3300026089 Bacteria 8366
609 Ga0207648_10147193 3300026089 Bacteria 2078
610 Ga0207648_10366063 3300026089 Bacteria 1301
611 Ga0207674_10004356 3300026116 Bacteria 17074
612 Ga0207674_10006573 3300026116 Bacteria 13664
613 Ga0207674_10010846 3300026116 Bacteria 10272
614 Ga0207674_10114503 3300026116 Bacteria 2669
615 Ga0207674_10165715 3300026116 Bacteria 2164
616 Ga0207675_100007251 3300026118 Bacteria 10482
617 Ga0207675_100024268 3300026118 Bacteria 5638
618 Ga0207675_100086010 3300026118 Bacteria 2952
619 Ga0207675_100287015 3300026118 Bacteria 1600
620 Ga0207683_10000699 3300026121 Bacteria 30634
621 Ga0207683_10001830 3300026121 Bacteria 18789
622 Ga0207683_10020326 3300026121 Bacteria 5677
623 Ga0207683_10028456 3300026121 Bacteria 4832
624 Ga0207683_10054512 3300026121 Bacteria 3506
625 Ga0207683_10059861 3300026121 Bacteria 3346
626 Ga0207683_10095111 3300026121 Bacteria 2656
627 Ga0207683_10156213 3300026121 Bacteria 2060
628 Ga0207698_10058506 3300026142 Bacteria 2987
629 Ga0207698_10262924 3300026142 Bacteria 1586
630 Ga0207698_10277723 3300026142 Bacteria 1548
631 Ga0207428_10012892 3300027907 Bacteria 7329
632 Ga0207428_10023615 3300027907 Bacteria 5168
633 Ga0207428_10047915 3300027907 Bacteria 3431
634 Ga0207428_10066624 3300027907 Unclassified 2837
635 Ga0207428_10161924 3300027907 Bacteria 1698
636 Ga0268266_10093455 3300028379 Bacteria 2639
637 Ga0268264_10222192 3300028381 Bacteria 1739
638 Ga0265326_10004431 3300028558 Bacteria 4499
639 Ga0265319_1000776 3300028563 Bacteria 20769
640 Ga0265319_1039859 3300028563 Bacteria 1590
641 Ga0265334_10002745 3300028573 Bacteria 8136
642 Ga0265334_10061592 3300028573 Bacteria 1414
643 Ga0265318_10003154 3300028577 Bacteria 8431
644 Ga0265318_10004647 3300028577 Bacteria 6607
645 Ga0265323_10052375 3300028653 Bacteria 1444
646 Ga0265336_10019559 3300028666 Bacteria 2184
647 Ga0265336_10026432 3300028666 Bacteria 1823
648 Ga0265338_10004855 3300028800 Bacteria 17927
649 Ga0265338_10011051 3300028800 Bacteria 10473
650 Ga0265338_10015278 3300028800 Bacteria 8452
651 Ga0265338_10017007 3300028800 Bacteria 7866
652 Ga0265338_10050405 3300028800 Bacteria 3764
653 Ga0265338_10160824 3300028800 Bacteria 1734
654 Ga0265324_10032519 3300029957 Unclassified 1822
655 Ga0265332_10008679 3300031238 Unclassified 4556
656 Ga0265332_10015422 3300031238 Bacteria 3372
657 Ga0265328_10024800 3300031239 Bacteria 2262
658 Ga0265325_10067502 3300031241 Bacteria 1802
659 Ga0265340_10003923 3300031247 Bacteria 8377
660 Ga0265340_10097559 3300031247 Bacteria 1368
661 Ga0265339_10002601 3300031249 Bacteria 12877
662 Ga0265339_10042298 3300031249 Bacteria 2522
663 Ga0265339_10133517 3300031249 Unclassified 1267
664 Ga0265331_10032605 3300031250 Bacteria 2580
665 Ga0265331_10115920 3300031250 Unclassified 1227
666 Ga0265327_10008410 3300031251 Bacteria 7691
667 Ga0265327_10021309 3300031251 Bacteria 3914
668 Ga0265327_10030642 3300031251 Bacteria 3036
669 Ga0265327_10068147 3300031251 Bacteria 1791
670 Ga0265327_10072863 3300031251 Bacteria 1715
671 Ga0265316_10022315 3300031344 Bacteria 5339
672 Ga0265316_10068157 3300031344 Bacteria 2750
673 Ga0265316_10069891 3300031344 Bacteria 2709
674 Ga0307408_100119125 3300031548 Bacteria 2042
675 Ga0265313_10005872 3300031595 Bacteria 8903
676 Ga0265313_10012800 3300031595 Bacteria 5090
677 Ga0265313_10030584 3300031595 Unclassified 2770
678 Ga0265314_10019069 3300031711 Bacteria 5322
679 Ga0265314_10024769 3300031711 Bacteria 4541
680 Ga0265314_10076599 3300031711 Bacteria 2221
681 Ga0265314_10104756 3300031711 Bacteria 1811
682 Ga0265314_10158755 3300031711 Unclassified 1378
683 Ga0265342_10060378 3300031712 Bacteria 2236
684 Ga0265342_10082671 3300031712 Bacteria 1852
685 Ga0307405_10092653 3300031731 Bacteria 2005
686 Ga0307410_10133577 3300031852 Bacteria 1826
687 Ga0307406_10195892 3300031901 Bacteria 1483
688 Ga0307409_100106203 3300031995 Bacteria 2343
689 Ga0307411_10181397 3300032005 Bacteria 1598
690 Ga0307415_100057706 3300032126 Bacteria 2669
691 Ga0373938_0028531 3300034957 Bacteria 1181
692 Ga0373944_0006456 3300035089 Bacteria 3116
693 Ga0373949_0012758 3300035090 Bacteria 1861
694 Ga0373932_0011944 3300035112 Bacteria 2132
695 Ga0373945_0001307 3300035116 Bacteria 7556
696 Ga0373945_0005948 3300035116 Bacteria 3918
697 Ga0373945_0006781 3300035116 Bacteria 3701
698 Ga0373945_0012851 3300035116 Bacteria 2787
699 Ga0373956_0060749 3300035119 Unclassified 1712
700 Ga0373943_0001876 3300035170 Bacteria 9505
701 Ga0373943_0004986 3300035170 Bacteria 5993
702 Ga0373943_0009984 3300035170 Bacteria 4256
703 Ga0373943_0034010 3300035170 Bacteria 2430
704 Ga0373943_0055277 3300035170 Bacteria 1966
705 Ga0373946_0004447 3300035171 Bacteria 5023
706 Ga0373946_0061295 3300035171 Unclassified 1601
707 Ga0373955_0179860 3300035172 Bacteria 1254
708 Ga0373942_0019666 3300035207 Bacteria 1688
709 Ga0373961_0006199 3300035241 Bacteria 2874
710 Ga0373961_0016909 3300035241 Unclassified 1884
711 Ga0373962_0043643 3300035242 Bacteria 1271
712 Ga0373924_0022475 3300035410 Bacteria 2466
713 Ga0373931_0023272 3300035691 Bacteria 3126
714 Ga0373935_0023556 3300035692 Bacteria 3784
715 Ga0373935_0047919 3300035692 Bacteria 2704
716 Ga0373927_0015218 3300035695 Bacteria 5084
717 Ga0373927_0021786 3300035695 Bacteria 4200
718 Ga0373933_0072322 3300035724 Bacteria 2100
719 Ga0373947_0000849 3300035725 Bacteria 18428
720 Ga0373947_0001085 3300035725 Bacteria 16678
721 Ga0373947_0005562 3300035725 Bacteria 7344
722 Ga0373937_0090959 3300036401 Bacteria 2827
723 Ga0373937_0245990 3300036401 Bacteria 1685
724 Ga0373925_0006097 3300037068 Bacteria 8917
725 Ga0373925_0010210 3300037068 Bacteria 6816
726 Ga0373925_0061700 3300037068 Bacteria 2816
727 Ga0373925_0321590 3300037068 Bacteria 1252
728 Ga0395899_0006013 3300037312 Bacteria 9421
729 Ga0395899_0010325 3300037312 Bacteria 7159
730 Ga0395899_0019784 3300037312 Bacteria 5109
731 Ga0395899_0044895 3300037312 Bacteria 3292
732 Ga0395899_0048736 3300037312 Unclassified 3151
733 Ga0395899_0144673 3300037312 Bacteria 1689
734 Ga0395900_0002119 3300037418 Bacteria 22208
735 Ga0395900_0005086 3300037418 Bacteria 13803
736 Ga0395900_0040417 3300037418 Bacteria 4806
737 Ga0395900_0055281 3300037418 Bacteria 4088
738 Ga0395900_0071158 3300037418 Bacteria 3575
739 Ga0395900_0079235 3300037418 Bacteria 3375
740 Ga0395900_0082546 3300037418 Bacteria 3302
741 Ga0395900_0098108 3300037418 Bacteria 3010
742 Ga0395900_0123245 3300037418 Bacteria 2658
743 Ga0395900_0141996 3300037418 Bacteria 2458
744 Ga0395900_0183978 3300037418 Bacteria 2122
745 Ga0395900_0220606 3300037418 Bacteria 1911
746 Ga0395900_0262876 3300037418 Bacteria 1723
747 Ga0395900_0348820 3300037418 Bacteria 1454
748 Ga0395898_0002058 3300037466 Bacteria 25043
749 Ga0395898_0004841 3300037466 Bacteria 14635
750 Ga0395898_0015334 3300037466 Bacteria 7859
751 Ga0395898_0015934 3300037466 Bacteria 7703
752 Ga0395898_0036109 3300037466 Bacteria 4909
753 Ga0395898_0041701 3300037466 Bacteria 4532
754 Ga0395898_0049577 3300037466 Bacteria 4113
755 Ga0395898_0050847 3300037466 Bacteria 4054
756 Ga0395898_0052076 3300037466 Bacteria 4000
757 Ga0395898_0060561 3300037466 Bacteria 3678
758 Ga0395898_0065331 3300037466 Bacteria 3527
759 Ga0395898_0112177 3300037466 Bacteria 2613
760 Ga0395905_0006168 3300037471 Bacteria 12099
761 Ga0395905_0011128 3300037471 Bacteria 8701
762 Ga0395905_0011152 3300037471 Bacteria 8690
763 Ga0395905_0025839 3300037471 Bacteria 5535
764 Ga0395905_0027947 3300037471 Bacteria 5319
765 Ga0395905_0042323 3300037471 Bacteria 4274
766 Ga0395905_0088822 3300037471 Bacteria 2896
767 Ga0395905_0131753 3300037471 Bacteria 2351
768 Ga0395901_0002976 3300038443 Bacteria 17087
769 Ga0395901_0004555 3300038443 Bacteria 13988
770 Ga0395901_0005934 3300038443 Bacteria 12369
771 Ga0395901_0012209 3300038443 Bacteria 8718
772 Ga0395901_0012661 3300038443 Bacteria 8557
773 Ga0395901_0027505 3300038443 Bacteria 5844
774 Ga0395901_0048813 3300038443 Bacteria 4396
775 Ga0395901_0137165 3300038443 Bacteria 2571
776 Ga0395901_0166982 3300038443 Bacteria 2310
777 Ga0395901_0257376 3300038443 Bacteria 1817
778 Ga0395901_0269273 3300038443 Unclassified 1772
779 Ga0436360_0119211 3300039438 Bacteria 4043
780 Ga0439439_0000233 3300041406 Bacteria 8702
781 Ga0439433_0001227 3300041999 Bacteria 5284
782 Ga0439442_007793 3300042002 Unclassified 2160
783 Ga0439448_0054022 3300042005 Bacteria 1319
784 Ga0439451_007714 3300042009 Bacteria 2187
785 Ga0439462_0000620 3300042015 Bacteria 7102
786 Ga0439458_0006053 3300042157 Bacteria 2703
787 Ga0439434_0027177 3300042435 Unclassified 1730
788 Ga0466966_0078134 3300044684 Bacteria 2064
789 Ga0466966_0205185 3300044684 Bacteria 1192
790 Ga0466961_0005636 3300044693 Bacteria 7913
791 Ga0466963_0000006 3300044694 Bacteria 89515
792 Ga0466963_0004258 3300044694 Bacteria 8304
793 Ga0466963_0005430 3300044694 Bacteria 7466
794 Ga0466963_0006926 3300044694 Bacteria 6744
795 Ga0466963_0009099 3300044694 Bacteria 5970
796 Ga0466963_0009206 3300044694 Bacteria 5943
797 Ga0466963_0012811 3300044694 Bacteria 5138
798 Ga0466963_0022065 3300044694 Bacteria 4027
799 Ga0466963_0030683 3300044694 Bacteria 3470
800 Ga0466963_0121817 3300044694 Bacteria 1796
801 Ga0466963_0217383 3300044694 Bacteria 1338
802 Ga0466964_0047928 3300044706 Bacteria 1746
803 Ga0466964_0049322 3300044706 Bacteria 1723
804 Ga0466971_0012360 3300044719 Bacteria 3739
805 Ga0466971_0013595 3300044719 Bacteria 3577
806 Ga0466971_0070273 3300044719 Unclassified 1589
807 Ga0466968_0000363 3300044735 Bacteria 14711
808 Ga0466968_0024836 3300044735 Bacteria 2451
809 Ga0466957_0010894 3300044842 Bacteria 5230
810 Ga0466957_0042190 3300044842 Bacteria 2759
811 Ga0466957_0101098 3300044842 Bacteria 1818
812 Ga0466957_0302408 3300044842 Bacteria 1075
813 Ga0466960_0006327 3300044901 Bacteria 4747
814 Ga0466959_0005026 3300045049 Bacteria 8982
815 Ga0466959_0058838 3300045049 Bacteria 2799
816 Ga0466959_0104658 3300045049 Bacteria 2024
817 Ga0466959_0142998 3300045049 Bacteria 1689
818 Ga0451576_0016035 3300045051 Bacteria 8279
819 Ga0451576_0449104 3300045051 Bacteria 1353
820 Ga0466958_0005672 3300045836 Bacteria 6743
821 Ga0466958_0008410 3300045836 Bacteria 5723
822 Ga0466958_0010574 3300045836 Bacteria 5171
823 Ga0466958_0029730 3300045836 Bacteria 3242
824 Ga0466958_0037298 3300045836 Bacteria 2913
825 Ga0466958_0083110 3300045836 Bacteria 1973
826 Ga0466958_0095450 3300045836 Bacteria 1844
827 Ga0466958_0169116 3300045836 Bacteria 1384
828 Ga0466958_0246825 3300045836 Bacteria 1141
829 Ga0466967_0000151 3300045976 Bacteria 27361
830 Ga0466967_0004410 3300045976 Bacteria 9482
831 Ga0466967_0015391 3300045976 Bacteria 5993
832 Ga0466967_0020616 3300045976 Bacteria 5333
833 Ga0466967_0025102 3300045976 Bacteria 4909
834 Ga0466967_0028487 3300045976 Bacteria 4662
835 Ga0466967_0031713 3300045976 Bacteria 4453
836 Ga0466967_0032263 3300045976 Bacteria 4420
837 Ga0466967_0037850 3300045976 Bacteria 4133
838 Ga0466967_0040602 3300045976 Bacteria 4007
839 Ga0466967_0053109 3300045976 Bacteria 3560
840 Ga0466967_0103306 3300045976 Bacteria 2608
841 Ga0466967_0104521 3300045976 Bacteria 2593
842 Ga0466967_0140405 3300045976 Unclassified 2250
843 Ga0466967_0164524 3300045976 Bacteria 2084
844 Ga0466967_0167800 3300045976 Bacteria 2063
845 Ga0466967_0174473 3300045976 Bacteria 2024
846 Ga0466967_0204882 3300045976 Bacteria 1869
847 Ga0466967_0208154 3300045976 Bacteria 1854
848 Ga0466967_0299659 3300045976 Bacteria 1546
849 Ga0495592_0092780 3300046454 Bacteria 2163
850 Ga0495603_0000747 3300046455 Bacteria 18566
851 Ga0495603_0024054 3300046455 Bacteria 3684
852 Ga0495603_0074717 3300046455 Unclassified 1990
853 Ga0495603_0086668 3300046455 Bacteria 1833
854 Ga0495603_0093115 3300046455 Unclassified 1761
855 Ga0495603_0155901 3300046455 Bacteria 1325
856 Ga0495603_0192524 3300046455 Unclassified 1179
857 Ga0495629_0027827 3300046459 Bacteria 4015
858 Ga0495629_0028291 3300046459 Bacteria 3979
859 Ga0495641_0000806 3300046461 Bacteria 26604
860 Ga0495641_0001759 3300046461 Bacteria 18009
861 Ga0495641_0003765 3300046461 Bacteria 11150
862 Ga0495641_0073720 3300046461 Bacteria 1531
863 Ga0495651_0040320 3300046462 Bacteria 3632
864 Ga0495651_0075929 3300046462 Bacteria 2546
865 Ga0495651_0088568 3300046462 Bacteria 2326
866 Ga0495653_0005235 3300046463 Bacteria 10547
867 Ga0495653_0014560 3300046463 Bacteria 6419
868 Ga0495653_0030186 3300046463 Bacteria 4320
869 Ga0495653_0113793 3300046463 Bacteria 1940
870 Ga0495580_0066821 3300046472 Bacteria 2516
871 Ga0495582_0000316 3300046473 Bacteria 26568
872 Ga0495582_0002392 3300046473 Bacteria 10485
873 Ga0495582_0060948 3300046473 Bacteria 2082
874 Ga0495605_0041597 3300046474 Bacteria 2289
875 Ga0495639_0001521 3300046475 Bacteria 10350
876 Ga0495639_0002167 3300046475 Bacteria 8650
877 Ga0495639_0042740 3300046475 Bacteria 2045
878 Ga0495639_0139098 3300046475 Bacteria 1166
879 Ga0495662_0013547 3300046476 Bacteria 3969
880 Ga0495662_0032603 3300046476 Bacteria 2517
881 Ga0495662_0036169 3300046476 Unclassified 2383
882 Ga0495664_0063511 3300046477 Bacteria 2201
883 Ga0495584_0035302 3300046491 Bacteria 2528
884 Ga0495594_0002313 3300046499 Bacteria 9919
885 Ga0495596_0030208 3300046500 Bacteria 2170
886 Ga0495608_0006095 3300046511 Bacteria 8553
887 Ga0495608_0056012 3300046511 Bacteria 2605
888 Ga0495608_0060253 3300046511 Unclassified 2498
889 Ga0495608_0094051 3300046511 Bacteria 1936
890 Ga0495608_0096853 3300046511 Bacteria 1905
891 Ga0495618_0004507 3300046514 Bacteria 8560
892 Ga0495618_0019626 3300046514 Bacteria 4161
893 Ga0495628_0024213 3300046516 Bacteria 4971
894 Ga0495628_0072630 3300046516 Bacteria 2681
895 Ga0495630_0003907 3300046517 Bacteria 10421
896 Ga0495630_0026133 3300046517 Bacteria 4321
897 Ga0495630_0044270 3300046517 Bacteria 3326
898 Ga0495630_0126727 3300046517 Bacteria 1938
899 Ga0495630_0245077 3300046517 Unclassified 1369
900 Ga0495631_0104143 3300046518 Bacteria 1221
901 Ga0495666_0003513 3300046526 Bacteria 7909
902 Ga0495666_0009326 3300046526 Bacteria 4909
903 Ga0495652_0046019 3300046529 Bacteria 3747
904 Ga0495652_0116556 3300046529 Bacteria 2138
905 Ga0495665_0000308 3300046531 Bacteria 24739
906 Ga0495665_0001485 3300046531 Bacteria 12559
907 Ga0495665_0014212 3300046531 Bacteria 4295
908 Ga0495640_0003074 3300046533 Bacteria 13442
909 Ga0495640_0022519 3300046533 Bacteria 4602
910 Ga0495586_0010916 3300046535 Bacteria 4826
911 Ga0495587_0042987 3300046536 Bacteria 2692
912 Ga0495587_0043290 3300046536 Bacteria 2681
913 Ga0495645_0155427 3300046543 Bacteria 1585
914 Ga0495633_0114384 3300046558 Bacteria 1251
915 Ga0495667_0006817 3300046559 Bacteria 7753
916 Ga0495667_0012635 3300046559 Bacteria 5724
917 Ga0495667_0053600 3300046559 Bacteria 2656
918 Ga0495667_0061790 3300046559 Bacteria 2455
919 Ga0495656_0016105 3300046615 Bacteria 2833
920 Ga0495634_0003097 3300046642 Bacteria 13519
921 Ga0495634_0014856 3300046642 Bacteria 5599
922 Ga0495634_0031690 3300046642 Unclassified 3640
923 Ga0495634_0204666 3300046642 Bacteria 1224
924 Ga0495635_0022878 3300046663 Bacteria 4356
925 Ga0495635_0060165 3300046663 Bacteria 2611
926 Ga0495635_0067755 3300046663 Bacteria 2448
927 Ga0495635_0080722 3300046663 Bacteria 2226
928 Ga0495588_0000321 3300046674 Bacteria 32004
929 Ga0495588_0017098 3300046674 Bacteria 3515
930 Ga0495657_0025955 3300046675 Bacteria 4156
931 Ga0495657_0122511 3300046675 Bacteria 1636
932 Ga0495599_0193359 3300046678 Bacteria 1251
933 Ga0495623_0007303 3300046679 Bacteria 7171
934 Ga0495647_0004021 3300046681 Bacteria 4744
935 Ga0495647_0012909 3300046681 Bacteria 2884
936 Ga0495658_0008016 3300046683 Bacteria 5231
937 Ga0495658_0029703 3300046683 Bacteria 2962
938 Ga0495658_0034717 3300046683 Bacteria 2769
939 Ga0495658_0041059 3300046683 Unclassified 2575
940 Ga0495658_0080700 3300046683 Bacteria 1908
941 Ga0495658_0108505 3300046683 Bacteria 1666
942 Ga0495613_0005558 3300046689 Bacteria 9465
943 Ga0495613_0008886 3300046689 Bacteria 7453
944 Ga0495613_0043999 3300046689 Bacteria 3304
945 Ga0495613_0045132 3300046689 Bacteria 3260
946 Ga0495613_0086610 3300046689 Bacteria 2271
947 Ga0495624_0011613 3300046690 Bacteria 6050
948 Ga0495624_0071156 3300046690 Bacteria 2164
949 Ga0495670_0122634 3300046691 Bacteria 1351
950 Ga0495670_0144593 3300046691 Bacteria 1245
951 Ga0495589_0096842 3300046794 Bacteria 1430
952 Ga0495589_0127306 3300046794 Bacteria 1224
953 Ga0495581_0000733 3300047315 Bacteria 17360
954 Ga0495581_0001437 3300047315 Bacteria 13221
955 Ga0495581_0003775 3300047315 Bacteria 8717
956 Ga0495581_0032656 3300047315 Bacteria 3014
957 Ga0495581_0068099 3300047315 Bacteria 2058
958 Ga0495604_0018043 3300047317 Bacteria 5647
959 Ga0495604_0233277 3300047317 Unclassified 1261
960 Ga0495674_0004046 3300047319 Bacteria 14189
961 Ga0495674_0010079 3300047319 Bacteria 8956
962 Ga0495674_0029902 3300047319 Bacteria 4956
963 Ga0495674_0043869 3300047319 Bacteria 3977
964 Ga0495674_0050028 3300047319 Bacteria 3689
965 Ga0495674_0146740 3300047319 Bacteria 1980
966 Ga0495674_0169732 3300047319 Bacteria 1821
967 Ga0495674_0301701 3300047319 Bacteria 1308
968 Ga0495676_0002697 3300047321 Bacteria 15910
969 Ga0495676_0002980 3300047321 Bacteria 15304
970 Ga0495676_0016250 3300047321 Bacteria 6609
971 Ga0495676_0017412 3300047321 Bacteria 6355
972 Ga0495676_0037163 3300047321 Bacteria 4057
973 Ga0495676_0083518 3300047321 Bacteria 2413
974 Ga0495676_0108687 3300047321 Bacteria 2040
975 Ga0495676_0115359 3300047321 Bacteria 1964
976 Ga0495680_0000393 3300047322 Bacteria 48867
977 Ga0495680_0012939 3300047322 Bacteria 7310
978 Ga0495680_0016132 3300047322 Bacteria 6423
979 Ga0495680_0121685 3300047322 Unclassified 1926
980 Ga0495680_0176706 3300047322 Unclassified 1543
981 Ga0495675_0058945 3300047444 Bacteria 2434
982 Ga0495675_0092568 3300047444 Bacteria 1897
983 Ga0495684_0002922 3300047471 Bacteria 13450
984 Ga0495684_0018569 3300047471 Bacteria 5357
985 Ga0495684_0066717 3300047471 Bacteria 2736
986 Ga0495684_0070731 3300047471 Bacteria 2652
987 Ga0495684_0091375 3300047471 Bacteria 2306
988 Ga0495593_0005440 3300047673 Bacteria 7524
989 Ga0495602_0114418 3300048088 Bacteria 2184
990 Ga0495602_0130574 3300048088 Bacteria 2005
991 Ga0495602_0195071 3300048088 Bacteria 1549
992 Ga0495602_0287342 3300048088 Bacteria 1209
993 Ga0495614_0007485 3300048089 Bacteria 4861
994 Ga0495614_0039952 3300048089 Unclassified 2014
995 Ga0495614_0088080 3300048089 Bacteria 1349
996 Ga0496100_0001463 3300048903 Bacteria 11564
997 Ga0496100_0001838 3300048903 Bacteria 10605
998 Ga0496100_0013914 3300048903 Bacteria 4656
999 Ga0496100_0034267 3300048903 Bacteria 3184
1000 Ga0496100_0057468 3300048903 Bacteria 2548
1001 Ga0496100_0064548 3300048903 Bacteria 2423
1002 Ga0496100_0103101 3300048903 Bacteria 1969
1003 Ga0496100_0172339 3300048903 Bacteria 1559
1004 Ga0496101_0001319 3300048904 Bacteria 14841
1005 Ga0496101_0003443 3300048904 Bacteria 9876
1006 Ga0496101_0005954 3300048904 Bacteria 7814
1007 Ga0496101_0008890 3300048904 Bacteria 6577
1008 Ga0496101_0010095 3300048904 Bacteria 6225
1009 Ga0496101_0011879 3300048904 Bacteria 5797
1010 Ga0496101_0014879 3300048904 Bacteria 5236
1011 Ga0496101_0018246 3300048904 Bacteria 4768
1012 Ga0496101_0019640 3300048904 Bacteria 4617
1013 Ga0496101_0066628 3300048904 Bacteria 2627
1014 Ga0496101_0089983 3300048904 Unclassified 2282
1015 Ga0496101_0096503 3300048904 Bacteria 2206
1016 Ga0496101_0198658 3300048904 Unclassified 1550
1017 Ga0496102_0002028 3300048905 Bacteria 17499
1018 Ga0496102_0002197 3300048905 Bacteria 16755
1019 Ga0496102_0009883 3300048905 Bacteria 8204
1020 Ga0496102_0012042 3300048905 Bacteria 7475
1021 Ga0496102_0021038 3300048905 Bacteria 5769
1022 Ga0496102_0030802 3300048905 Bacteria 4804
1023 Ga0496102_0034991 3300048905 Bacteria 4521
1024 Ga0496102_0037399 3300048905 Bacteria 4379
1025 Ga0496102_0038224 3300048905 Bacteria 4330
1026 Ga0496102_0063890 3300048905 Bacteria 3371
1027 Ga0496102_0100349 3300048905 Bacteria 2688
1028 Ga0496102_0102547 3300048905 Bacteria 2660
1029 Ga0496102_0123627 3300048905 Bacteria 2418
1030 Ga0496102_0195539 3300048905 Unclassified 1906
1031 Ga0496102_0251595 3300048905 Bacteria 1666
1032 Ga0496103_0002459 3300048906 Bacteria 11640
1033 Ga0496103_0005119 3300048906 Bacteria 7892
1034 Ga0496103_0028176 3300048906 Bacteria 3407
1035 Ga0496103_0042072 3300048906 Bacteria 2810
1036 Ga0496103_0050758 3300048906 Bacteria 2566
1037 Ga0496103_0109477 3300048906 Unclassified 1754
1038 Ga0496104_0000776 3300048907 Bacteria 27305
1039 Ga0496104_0002034 3300048907 Bacteria 17569
1040 Ga0496104_0006694 3300048907 Bacteria 10142
1041 Ga0496104_0009484 3300048907 Bacteria 8662
1042 Ga0496104_0027989 3300048907 Bacteria 5220
1043 Ga0496104_0050038 3300048907 Bacteria 3942
1044 Ga0496104_0060150 3300048907 Bacteria 3599
1045 Ga0496104_0132863 3300048907 Bacteria 2391
1046 Ga0496104_0157545 3300048907 Bacteria 2179
1047 Ga0496104_0157816 3300048907 Unclassified 2177
1048 Ga0496104_0175203 3300048907 Bacteria 2055
1049 Ga0496104_0232332 3300048907 Bacteria 1756
1050 Ga0496104_0250590 3300048907 Bacteria 1683
1051 Ga0496104_0311629 3300048907 Unclassified 1487
1052 Ga0496104_0318953 3300048907 Bacteria 1467
1053 Ga0496104_0388000 3300048907 Bacteria 1309
1054 Ga0496105_0000050 3300048908 Bacteria 93402
1055 Ga0496105_0000249 3300048908 Bacteria 36253
1056 Ga0496105_0005070 3300048908 Bacteria 9978
1057 Ga0496105_0005525 3300048908 Bacteria 9592
1058 Ga0496105_0021711 3300048908 Bacteria 5195
1059 Ga0496105_0027226 3300048908 Bacteria 4668
1060 Ga0496105_0074654 3300048908 Bacteria 2801
1061 Ga0496105_0093458 3300048908 Bacteria 2483
1062 Ga0496105_0118081 3300048908 Bacteria 2188
1063 Ga0496105_0315547 3300048908 Bacteria 1254
1064 Ga0496106_0001631 3300048909 Bacteria 16842
1065 Ga0496106_0002042 3300048909 Bacteria 15175
1066 Ga0496106_0004053 3300048909 Bacteria 10936
1067 Ga0496106_0005239 3300048909 Bacteria 9608
1068 Ga0496106_0010325 3300048909 Bacteria 6902
1069 Ga0496106_0012413 3300048909 Bacteria 6290
1070 Ga0496106_0028124 3300048909 Bacteria 4187
1071 Ga0496106_0038625 3300048909 Bacteria 3574
1072 Ga0496106_0041946 3300048909 Bacteria 3430
1073 Ga0496106_0047440 3300048909 Bacteria 3233
1074 Ga0496106_0100766 3300048909 Bacteria 2240
1075 Ga0496106_0134997 3300048909 Unclassified 1937
1076 Ga0496107_0000545 3300048910 Bacteria 21061
1077 Ga0496107_0002007 3300048910 Bacteria 12981
1078 Ga0496107_0006988 3300048910 Bacteria 7775
1079 Ga0496107_0012651 3300048910 Bacteria 5892
1080 Ga0496107_0013425 3300048910 Bacteria 5726
1081 Ga0496107_0014162 3300048910 Bacteria 5583
1082 Ga0496107_0037931 3300048910 Bacteria 3458
1083 Ga0496107_0041450 3300048910 Bacteria 3305
1084 Ga0496107_0042859 3300048910 Bacteria 3251
1085 Ga0496108_0000403 3300048911 Bacteria 35617
1086 Ga0496108_0000716 3300048911 Bacteria 25781
1087 Ga0496108_0001800 3300048911 Bacteria 17082
1088 Ga0496108_0002434 3300048911 Bacteria 14874
1089 Ga0496108_0007848 3300048911 Bacteria 8652
1090 Ga0496108_0009997 3300048911 Bacteria 7690
1091 Ga0496108_0047867 3300048911 Bacteria 3574
1092 Ga0496108_0064846 3300048911 Unclassified 3078
1093 Ga0496108_0071258 3300048911 Bacteria 2932
1094 Ga0496108_0090483 3300048911 Bacteria 2601
1095 Ga0496108_0154491 3300048911 Bacteria 1981
1096 Ga0496108_0201702 3300048911 Bacteria 1726
1097 Ga0496108_0203356 3300048911 Bacteria 1719
1098 Ga0496109_0001324 3300048912 Bacteria 20434
1099 Ga0496109_0001790 3300048912 Bacteria 17860
1100 Ga0496109_0002493 3300048912 Bacteria 15427
1101 Ga0496109_0002927 3300048912 Bacteria 14270
1102 Ga0496109_0003464 3300048912 Bacteria 13180
1103 Ga0496109_0004184 3300048912 Bacteria 12038
1104 Ga0496109_0035256 3300048912 Bacteria 4512
1105 Ga0496109_0045380 3300048912 Bacteria 3987
1106 Ga0496109_0080601 3300048912 Unclassified 2999
1107 Ga0496109_0083202 3300048912 Bacteria 2951
1108 Ga0496109_0147298 3300048912 Unclassified 2203
1109 Ga0496109_0194649 3300048912 Bacteria 1905
1110 Ga0496109_0270308 3300048912 Bacteria 1601
1111 Ga0496110_0000558 3300048913 Bacteria 25445
1112 Ga0496110_0001093 3300048913 Bacteria 19108
1113 Ga0496110_0004541 3300048913 Bacteria 10773
1114 Ga0496110_0017237 3300048913 Bacteria 6040
1115 Ga0496110_0030818 3300048913 Bacteria 4625
1116 Ga0496110_0059548 3300048913 Bacteria 3367
1117 Ga0496110_0060428 3300048913 Bacteria 3342
1118 Ga0496110_0079358 3300048913 Bacteria 2922
1119 Ga0496110_0091182 3300048913 Bacteria 2726
1120 Ga0496110_0100503 3300048913 Bacteria 2592
1121 Ga0496110_0137870 3300048913 Bacteria 2205
1122 Ga0496110_0570068 3300048913 Unclassified 1028
1123 Ga0496111_0000179 3300048914 Bacteria 28769
1124 Ga0496111_0003419 3300048914 Bacteria 9822
1125 Ga0496111_0003808 3300048914 Bacteria 9410
1126 Ga0496111_0005179 3300048914 Bacteria 8311
1127 Ga0496111_0014563 3300048914 Bacteria 5376
1128 Ga0496111_0016396 3300048914 Bacteria 5103
1129 Ga0496111_0022906 3300048914 Bacteria 4378
1130 Ga0496111_0030321 3300048914 Bacteria 3846
1131 Ga0496111_0109252 3300048914 Bacteria 2036
1132 Ga0496111_0110935 3300048914 Bacteria 2020
1133 Ga0496111_0186611 3300048914 Bacteria 1541
1134 Ga0496112_0008702 3300048915 Bacteria 9101
1135 Ga0496112_0015407 3300048915 Bacteria 7134
1136 Ga0496112_0025795 3300048915 Bacteria 5646
1137 Ga0496112_0028928 3300048915 Bacteria 5355
1138 Ga0496112_0031012 3300048915 Bacteria 5180
1139 Ga0496112_0042535 3300048915 Bacteria 4444
1140 Ga0496112_0108985 3300048915 Bacteria 2740
1141 Ga0496112_0109809 3300048915 Unclassified 2728
1142 Ga0496112_0113533 3300048915 Bacteria 2680
1143 Ga0496112_0201869 3300048915 Bacteria 1947
1144 Ga0496112_0216337 3300048915 Bacteria 1872
1145 Ga0496112_0242627 3300048915 Unclassified 1754
1146 Ga0496112_0491056 3300048915 Unclassified 1164
1147 Ga0496113_0000413 3300048916 Bacteria 20710
1148 Ga0496113_0000452 3300048916 Bacteria 19933
1149 Ga0496113_0030876 3300048916 Bacteria 3883
1150 Ga0496113_0124353 3300048916 Bacteria 2019
1151 Ga0496113_0142609 3300048916 Bacteria 1886
1152 Ga0496113_0165287 3300048916 Bacteria 1751
1153 Ga0496113_0210068 3300048916 Bacteria 1549
1154 Ga0496114_0003284 3300048917 Bacteria 12414
1155 Ga0496114_0004568 3300048917 Bacteria 10751
1156 Ga0496114_0005710 3300048917 Bacteria 9757
1157 Ga0496114_0007644 3300048917 Bacteria 8548
1158 Ga0496114_0011972 3300048917 Bacteria 6940
1159 Ga0496114_0012699 3300048917 Bacteria 6745
1160 Ga0496114_0013327 3300048917 Bacteria 6590
1161 Ga0496114_0035891 3300048917 Bacteria 4096
1162 Ga0496114_0037833 3300048917 Bacteria 3992
1163 Ga0496114_0059492 3300048917 Bacteria 3192
1164 Ga0496114_0077885 3300048917 Bacteria 2796
1165 Ga0496114_0125549 3300048917 Bacteria 2212
1166 Ga0496114_0134960 3300048917 Bacteria 2133
1167 Ga0496114_0172138 3300048917 Bacteria 1887
1168 Ga0496114_0172182 3300048917 Unclassified 1887
1169 Ga0496115_0006577 3300048918 Bacteria 8518
1170 Ga0496115_0006641 3300048918 Bacteria 8488
1171 Ga0496115_0009303 3300048918 Bacteria 7302
1172 Ga0496115_0040254 3300048918 Bacteria 3714
1173 Ga0496115_0081242 3300048918 Bacteria 2640
1174 Ga0496115_0082242 3300048918 Bacteria 2623
1175 Ga0496115_0084967 3300048918 Bacteria 2580
1176 Ga0496126_0115479 3300048929 Bacteria 2334
1177 Ga0501031_0000740 3300049568 Bacteria 19598
1178 Ga0501031_0021577 3300049568 Bacteria 4198
1179 Ga0501031_0038228 3300049568 Bacteria 3132
1180 Ga0501031_0152233 3300049568 Bacteria 1512
1181 Ga0501032_0011883 3300049569 Bacteria 6236
1182 Ga0501033_0068498 3300049570 Bacteria 2609
1183 Ga0501033_0134424 3300049570 Bacteria 1790
1184 Ga0501033_0174724 3300049570 Bacteria 1542
1185 Ga0501034_0006312 3300049571 Bacteria 12761
1186 Ga0501034_0091417 3300049571 Bacteria 3041
1187 Ga0501034_0169105 3300049571 Bacteria 2154
1188 Ga0501036_0033834 3300049572 Bacteria 4323
1189 Ga0501036_0034240 3300049572 Bacteria 4296
1190 Ga0501036_0054401 3300049572 Bacteria 3390
1191 Ga0501036_0187002 3300049572 Bacteria 1743
1192 Ga0501037_0051496 3300049573 Bacteria 3012
1193 Ga0501037_0118948 3300049573 Bacteria 1900
1194 Ga0501038_0017811 3300049574 Bacteria 6418
1195 Ga0501039_0014271 3300049575 Bacteria 6082
1196 Ga0501039_0045732 3300049575 Bacteria 3382
1197 Ga0501039_0060380 3300049575 Bacteria 2936
1198 Ga0501039_0104493 3300049575 Bacteria 2211
1199 Ga0501039_0226851 3300049575 Unclassified 1468
1200 Ga0501040_0028718 3300049576 Bacteria 3750
1201 Ga0501040_0036298 3300049576 Bacteria 3344
1202 Ga0501040_0091443 3300049576 Bacteria 2115
1203 Ga0501040_0117606 3300049576 Bacteria 1863
1204 Ga0501041_0009853 3300049577 Bacteria 5626
1205 Ga0501041_0167483 3300049577 Unclassified 1374
1206 Ga0501042_0000668 3300049578 Bacteria 18449
1207 Ga0501042_0012127 3300049578 Bacteria 5832
1208 Ga0501042_0063071 3300049578 Bacteria 2648
1209 Ga0501042_0114281 3300049578 Bacteria 1944
1210 Ga0501042_0168670 3300049578 Bacteria 1580
1211 Ga0501042_0286175 3300049578 Bacteria 1190
1212 Ga0501043_0009045 3300049579 Bacteria 7837
1213 Ga0501043_0087464 3300049579 Bacteria 2449
1214 Ga0501043_0138485 3300049579 Bacteria 1906
1215 Ga0501043_0178660 3300049579 Bacteria 1654
1216 Ga0501043_0181787 3300049579 Bacteria 1638
1217 Ga0501046_0017581 3300049580 Bacteria 5963
1218 Ga0501046_0043766 3300049580 Bacteria 3563
1219 Ga0501046_0062402 3300049580 Bacteria 2912
1220 Ga0501046_0109467 3300049580 Bacteria 2112
1221 Ga0501046_0201467 3300049580 Bacteria 1481
1222 Ga0501047_0177679 3300049581 Unclassified 1996
1223 Ga0501048_0004258 3300049582 Bacteria 10904
1224 Ga0501048_0004552 3300049582 Bacteria 10547
1225 Ga0501048_0122263 3300049582 Bacteria 1839
1226 Ga0501048_0133068 3300049582 Bacteria 1757
1227 Ga0501067_0000414 3300049583 Bacteria 23279
1228 Ga0501067_0001281 3300049583 Bacteria 13636
1229 Ga0501067_0030495 3300049583 Bacteria 2990
1230 Ga0501067_0118107 3300049583 Bacteria 1475
1231 Ga0501068_0000406 3300049584 Bacteria 21790
1232 Ga0501068_0016027 3300049584 Bacteria 4317
1233 Ga0501068_0069292 3300049584 Bacteria 2150
1234 Ga0501069_0000177 3300049585 Bacteria 28717
1235 Ga0501069_0002079 3300049585 Bacteria 10074
1236 Ga0501069_0062810 3300049585 Bacteria 2074
1237 Ga0501069_0069693 3300049585 Bacteria 1969
1238 Ga0501070_0023584 3300049586 Bacteria 5155
1239 Ga0501070_0046789 3300049586 Bacteria 3597
1240 Ga0501070_0070360 3300049586 Bacteria 2897
1241 Ga0501070_0072383 3300049586 Bacteria 2853
1242 Ga0501070_0154480 3300049586 Bacteria 1893
1243 Ga0501070_0294739 3300049586 Bacteria 1322
1244 Ga0501071_0003379 3300049587 Bacteria 9968
1245 Ga0501071_0019482 3300049587 Bacteria 4708
1246 Ga0501071_0024150 3300049587 Bacteria 4250
1247 Ga0501071_0029991 3300049587 Bacteria 3844
1248 Ga0501071_0043464 3300049587 Bacteria 3221
1249 Ga0501071_0142305 3300049587 Bacteria 1786
1250 Ga0501071_0153776 3300049587 Bacteria 1717
1251 Ga0501072_0002616 3300049588 Bacteria 13483
1252 Ga0501072_0009939 3300049588 Bacteria 7234
1253 Ga0501072_0023633 3300049588 Bacteria 4774
1254 Ga0501072_0072011 3300049588 Bacteria 2731
1255 Ga0501072_0124411 3300049588 Bacteria 2054
1256 Ga0501072_0143332 3300049588 Unclassified 1905
1257 Ga0501073_0028115 3300049589 Bacteria 4017
1258 Ga0501073_0041253 3300049589 Bacteria 3261
1259 Ga0501073_0091672 3300049589 Unclassified 2112
1260 Ga0501073_0153558 3300049589 Bacteria 1596
1261 Ga0501074_0015063 3300049590 Bacteria 5626
1262 Ga0501074_0030399 3300049590 Bacteria 3914
1263 Ga0501074_0035860 3300049590 Bacteria 3593
1264 Ga0501074_0050290 3300049590 Bacteria 3009
1265 Ga0501074_0057087 3300049590 Bacteria 2812
1266 Ga0501074_0087881 3300049590 Bacteria 2226
1267 Ga0501074_0161966 3300049590 Bacteria 1598
1268 Ga0501074_0185814 3300049590 Bacteria 1482
1269 Ga0501074_0220916 3300049590 Bacteria 1349
1270 Ga0501075_0002962 3300049591 Bacteria 11366
1271 Ga0501075_0011316 3300049591 Bacteria 6312
1272 Ga0501075_0037036 3300049591 Bacteria 3642
1273 Ga0501075_0043575 3300049591 Bacteria 3365
1274 Ga0501075_0110391 3300049591 Bacteria 2091
1275 Ga0501075_0181280 3300049591 Bacteria 1606
1276 Ga0501075_0187805 3300049591 Bacteria 1576
1277 Ga0501076_0010903 3300049592 Bacteria 6760
1278 Ga0501076_0017096 3300049592 Bacteria 5508
1279 Ga0501076_0058438 3300049592 Bacteria 3065
1280 Ga0501076_0173454 3300049592 Bacteria 1758
1281 Ga0501076_0196317 3300049592 Bacteria 1647
1282 Ga0501076_0402438 3300049592 Bacteria 1126
1283 Ga0501077_0003762 3300049593 Bacteria 9132
1284 Ga0501077_0022527 3300049593 Bacteria 3990
1285 Ga0501077_0093193 3300049593 Bacteria 1909
1286 Ga0501079_0031994 3300049741 Bacteria 4043
1287 Ga0501079_0048852 3300049741 Bacteria 3265
1288 Ga0501079_0098535 3300049741 Bacteria 2266
1289 Ga0501079_0245241 3300049741 Bacteria 1400
1290 Ga0501079_0264720 3300049741 Bacteria 1344
1291 Ga0501080_0001785 3300049742 Bacteria 18436
1292 Ga0501080_0002437 3300049742 Bacteria 16255
1293 Ga0501080_0033454 3300049742 Bacteria 4798
1294 Ga0501080_0059964 3300049742 Bacteria 3541
1295 Ga0501080_0065754 3300049742 Bacteria 3372
1296 Ga0501080_0409535 3300049742 Bacteria 1219
1297 Ga0501081_0013013 3300049743 Bacteria 5472
1298 Ga0501081_0025770 3300049743 Bacteria 3959
1299 Ga0501081_0030650 3300049743 Bacteria 3642
1300 Ga0501081_0165079 3300049743 Bacteria 1597
1301 Ga0501081_0180591 3300049743 Bacteria 1526
1302 Ga0501083_0019905 3300049744 Bacteria 4670
1303 Ga0501083_0025198 3300049744 Bacteria 4118
1304 Ga0501083_0150236 3300049744 Bacteria 1525
1305 Ga0501035_0039172 3300049822 Bacteria 4290
1306 Ga0501035_0081862 3300049822 Bacteria 2849
1307 Ga0501044_0218080 3300049823 Bacteria 1859
1308 Ga0501045_0017057 3300049824 Bacteria 5156
1309 Ga0501045_0037735 3300049824 Bacteria 3513
1310 Ga0501045_0040451 3300049824 Bacteria 3392
1311 Ga0501045_0046796 3300049824 Bacteria 3150
1312 Ga0501045_0057654 3300049824 Bacteria 2842
1313 Ga0501045_0067469 3300049824 Bacteria 2627
1314 Ga0501045_0075657 3300049824 Bacteria 2480
1315 Ga0501045_0109713 3300049824 Bacteria 2045
1316 nmdc:mga05p37_116071_c1 3300050507 Bacteria 3290
1317 nmdc:mga05p37_172461_c1 3300050507 Unclassified 2637
1318 nmdc:mga05p37_8517_c1 3300050507 Bacteria 12121
1319 nmdc:mga05p37_93319_c1 3300050507 Bacteria 3709
1320 nmdc:mga09592_7671_c1 3300050508 Bacteria 8772
1321 nmdc:mga08y16_123250_c1 3300050511 Unclassified 2697
1322 nmdc:mga08y16_168278_c1 3300050511 Bacteria 2277
1323 nmdc:mga08y16_25095_c1 3300050511 Bacteria 6287
1324 nmdc:mga08y16_302823_c1 3300050511 Unclassified 1647
1325 nmdc:mga08y16_40720_c1 3300050511 Bacteria 4869
1326 nmdc:mga08y16_9028_c1 3300050511 Bacteria 10468
1327 nmdc:mga0n895_160971_c1 3300050512 Bacteria 2276
1328 nmdc:mga0n895_213161_c1 3300050512 Bacteria 1961
1329 nmdc:mga0n895_401910_c1 3300050512 Bacteria 1385
1330 nmdc:mga0n895_43470_c1 3300050512 Bacteria 4378
1331 nmdc:mga0n895_44397_c1 3300050512 Bacteria 4334
1332 nmdc:mga0n895_52992_c1 3300050512 Bacteria 3984
1333 nmdc:mga0n895_59411_c1 3300050512 Bacteria 3772
1334 nmdc:mga0n895_685_c1 3300050512 Bacteria 23780
1335 nmdc:mga0rr50_345306_c1 3300050513 Bacteria 1251
1336 nmdc:mga0rr50_72907_c1 3300050513 Bacteria 2624
1337 nmdc:mga08x19_128590_c1 3300050514 Bacteria 1702
1338 nmdc:mga08x19_5360_c1 3300050514 Bacteria 7583
1339 nmdc:mga08x19_93625_c1 3300050514 Bacteria 1986
1340 nmdc:mga0a205_122740_c1 3300050515 Bacteria 2497
1341 nmdc:mga0a205_41861_c1 3300050515 Bacteria 4413
1342 Ga0495601_0002246 3300053077 Bacteria 10881
1343 Ga0495601_0020968 3300053077 Bacteria 3996
1344 Ga0495601_0031741 3300053077 Bacteria 3284
1345 Ga0495601_0045071 3300053077 Bacteria 2772
1346 Ga0495601_0065382 3300053077 Unclassified 2314
1347 Ga0495612_0009364 3300053078 Bacteria 3978
1348 Ga0495595_0002243 3300053084 Bacteria 7518
1349 Ga0495595_0024985 3300053084 Bacteria 2642
1350 Ga0495619_0020674 3300053085 Bacteria 4196
1351 Ga0495619_0035187 3300053085 Bacteria 3257
1352 Ga0495619_0059040 3300053085 Bacteria 2548
1353 Ga0495619_0066812 3300053085 Bacteria 2400
1354 Ga0495619_0071264 3300053085 Bacteria 2326
1355 Ga0501084_0013069 3300054114 Bacteria 6869
1356 Ga0501084_0018159 3300054114 Bacteria 5856
1357 Ga0501084_0035499 3300054114 Bacteria 4167
1358 Ga0501084_0052581 3300054114 Bacteria 3407
1359 Ga0501084_0057405 3300054114 Bacteria 3257
1360 Ga0501084_0065720 3300054114 Bacteria 3035
1361 Ga0590075_006978 3300059424 Bacteria 2677
1362 Ga0590075_007586 3300059424 Bacteria 2582
1363 Ga0587083_0025450 3300059505 Bacteria 1135
1364 Ga0501082_0052963 3300060353 Bacteria 3498
1365 Ga0501082_0060438 3300060353 Bacteria 3263
1366 Ga0501082_0098941 3300060353 Unclassified 2522
1367 Ga0501082_0118959 3300060353 Bacteria 2289
1368 Ga0501082_0369280 3300060353 Bacteria 1251
1369 Ga0466962_0033581 3300061719 Bacteria 2455
1370 Ga0530510_0021443 3300061734 Bacteria 4596
1371 Ga0530510_0056867 3300061734 Bacteria 2826

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0570068 Ga0496110_0570068_23_898 277
2 3300026088 Ga0207641_10447615 Ga0207641_104476152 309
3 3300049583 Ga0501067_0118107 Ga0501067_0118107_452_1447 313
4 3300044842 Ga0466957_0302408 Ga0466957_0302408_69_1016 314
5 3300046475 Ga0495639_0042740 Ga0495639_0042740_1061_2029 314
6 3300048914 Ga0496111_0186611 Ga0496111_0186611_559_1509 316
7 3300049570 Ga0501033_0068498 Ga0501033_0068498_1628_2578 316
8 3300049579 Ga0501043_0138485 Ga0501043_0138485_17_967 316
9 3300048905 Ga0496102_0251595 Ga0496102_0251595_543_1625 317
10 3300048911 Ga0496108_0201702 Ga0496108_0201702_577_1659 317
11 3300048915 Ga0496112_0113533 Ga0496112_0113533_432_1514 317
12 3300048916 Ga0496113_0210068 Ga0496113_0210068_139_1221 317
13 3300049578 Ga0501042_0114281 Ga0501042_0114281_806_1876 317
14 3300049741 Ga0501079_0031994 Ga0501079_0031994_105_1175 317
15 3300049742 Ga0501080_0059964 Ga0501080_0059964_1302_2372 317
16 3300060353 Ga0501082_0118959 Ga0501082_0118959_526_1596 317
17 3300035090 Ga0373949_0012758 Ga0373949_0012758_28_993 320
18 3300035207 Ga0373942_0019666 Ga0373942_0019666_44_1009 320
19 3300044694 Ga0466963_0217383 Ga0466963_0217383_305_1270 320
20 3300026089 Ga0207648_10366063 Ga0207648_103660631 321
21 3300046455 Ga0495603_0093115 Ga0495603_0093115_34_999 321
22 3300046689 Ga0495613_0008886 Ga0495613_0008886_13_978 321
23 3300005356 Ga0070674_100044931 Ga0070674_1000449314 324
24 3300005578 Ga0068854_100108576 Ga0068854_1001085764 324
25 3300005615 Ga0070702_100079399 Ga0070702_1000793994 324
26 3300009177 Ga0105248_10110364 Ga0105248_101103644 324
27 3300013308 Ga0157375_10328291 Ga0157375_103282912 324
28 3300025919 Ga0207657_10305723 Ga0207657_103057232 324
29 3300025944 Ga0207661_10150442 Ga0207661_101504421 324
30 3300025981 Ga0207640_10110815 Ga0207640_101108153 324
31 3300037418 Ga0395900_0348820 Ga0395900_0348820_147_1184 324
32 3300048904 Ga0496101_0005954 Ga0496101_0005954_3473_4555 324
33 3300048905 Ga0496102_0100349 Ga0496102_0100349_772_1854 324
34 3300048909 Ga0496106_0001631 Ga0496106_0001631_10482_11564 324
35 3300048910 Ga0496107_0006988 Ga0496107_0006988_1202_2284 324
36 3300048917 Ga0496114_0134960 Ga0496114_0134960_397_1479 324
37 3300048918 Ga0496115_0084967 Ga0496115_0084967_262_1344 324
38 3300049587 Ga0501071_0019482 Ga0501071_0019482_1253_2335 325
39 3300060353 Ga0501082_0369280 Ga0501082_0369280_60_1142 325
40 3300005329 Ga0070683_100202020 Ga0070683_1002020201 326
41 3300005337 Ga0070682_100162347 Ga0070682_1001623472 326
42 3300005340 Ga0070689_100196789 Ga0070689_1001967892 326
43 3300005365 Ga0070688_100023454 Ga0070688_1000234543 326
44 3300005439 Ga0070711_100168059 Ga0070711_1001680592 326
45 3300005539 Ga0068853_100241152 Ga0068853_1002411523 326
46 3300005547 Ga0070693_100179703 Ga0070693_1001797032 326
47 3300005563 Ga0068855_100409364 Ga0068855_1004093642 326
48 3300005842 Ga0068858_100342533 Ga0068858_1003425331 326
49 3300006871 Ga0075434_100013173 Ga0075434_1000131736 326
50 3300010375 Ga0105239_10036872 Ga0105239_100368727 326
51 3300013297 Ga0157378_10202299 Ga0157378_102022993 326
52 3300013306 Ga0163162_10283621 Ga0163162_102836212 326
53 3300014969 Ga0157376_10041867 Ga0157376_100418673 326
54 3300025917 Ga0207660_10185996 Ga0207660_101859963 326
55 3300025921 Ga0207652_10077052 Ga0207652_100770523 326
56 3300025936 Ga0207670_10107998 Ga0207670_101079982 326
57 3300026121 Ga0207683_10156213 Ga0207683_101562131 326
58 3300048911 Ga0496108_0071258 Ga0496108_0071258_89_1171 326
59 3300048912 Ga0496109_0080601 Ga0496109_0080601_176_1258 326
60 3300048912 Ga0496109_0147298 Ga0496109_0147298_891_1973 326
61 3300050512 nmdc:mga0n895_59411_c1 nmdc:mga0n895_59411_c1_1841_2923 326
62 3300005340 Ga0070689_100126327 Ga0070689_1001263272 329
63 3300009174 Ga0105241_10249202 Ga0105241_102492022 329
64 3300048905 Ga0496102_0195539 Ga0496102_0195539_589_1617 329
65 3300048915 Ga0496112_0031012 Ga0496112_0031012_1996_3024 329
66 3300049572 Ga0501036_0054401 Ga0501036_0054401_22_1053 329
67 3300013307 Ga0157372_10116594 Ga0157372_101165942 330
68 3300034957 Ga0373938_0028531 Ga0373938_0028531_17_1009 330
69 3300006844 Ga0075428_100380798 Ga0075428_1003807982 331
70 3300009148 Ga0105243_10128346 Ga0105243_101283463 331
71 3300009553 Ga0105249_10140071 Ga0105249_101400713 331
72 3300013104 Ga0157370_10061797 Ga0157370_100617973 332
73 3300025929 Ga0207664_10094481 Ga0207664_100944813 332
74 3300045976 Ga0466967_0031713 Ga0466967_0031713_2697_3755 332
75 3300009098 Ga0105245_10022996 Ga0105245_100229966 333
76 3300009148 Ga0105243_10066543 Ga0105243_100665431 333
77 3300009176 Ga0105242_10288935 Ga0105242_102889352 333
78 3300009177 Ga0105248_10450087 Ga0105248_104500871 333
79 3300009551 Ga0105238_10026354 Ga0105238_100263548 333
80 3300010375 Ga0105239_10232752 Ga0105239_102327522 333
81 3300014745 Ga0157377_10031183 Ga0157377_100311833 333
82 3300049588 Ga0501072_0072011 Ga0501072_0072011_299_1357 333
83 3300049590 Ga0501074_0161966 Ga0501074_0161966_310_1368 333
84 3300049591 Ga0501075_0110391 Ga0501075_0110391_41_1099 333
85 3300049741 Ga0501079_0245241 Ga0501079_0245241_135_1193 333
86 3300005535 Ga0070684_100351580 Ga0070684_1003515802 334
87 3300006028 Ga0070717_10007976 Ga0070717_100079767 334
88 3300010375 Ga0105239_10139468 Ga0105239_101394683 334
89 3300011119 Ga0105246_10271088 Ga0105246_102710881 334
90 3300046463 Ga0495653_0030186 Ga0495653_0030186_1846_2922 334
91 3300046511 Ga0495608_0094051 Ga0495608_0094051_806_1882 334
92 3300046559 Ga0495667_0053600 Ga0495667_0053600_1517_2593 334
93 3300046663 Ga0495635_0060165 Ga0495635_0060165_1055_2131 334
94 3300049592 Ga0501076_0173454 Ga0501076_0173454_512_1570 334
95 3300053085 Ga0495619_0071264 Ga0495619_0071264_1057_2133 334
96 3300005329 Ga0070683_100443520 Ga0070683_1004435201 335
97 3300005458 Ga0070681_10004042 Ga0070681_1000404212 335
98 3300005530 Ga0070679_100001323 Ga0070679_10000132310 335
99 3300005577 Ga0068857_100011530 Ga0068857_1000115306 335
100 3300006844 Ga0075428_100273315 Ga0075428_1002733152 335
101 3300025912 Ga0207707_10001608 Ga0207707_1000160810 335
102 3300025917 Ga0207660_10008961 Ga0207660_100089613 335
103 3300025920 Ga0207649_10056943 Ga0207649_100569434 335
104 3300025927 Ga0207687_10016177 Ga0207687_100161774 335
105 3300025928 Ga0207700_10164335 Ga0207700_101643352 335
106 3300025981 Ga0207640_10150097 Ga0207640_101500972 335
107 3300026075 Ga0207708_10007059 Ga0207708_100070597 335
108 3300026116 Ga0207674_10004356 Ga0207674_100043565 335
109 3300035116 Ga0373945_0005948 Ga0373945_0005948_35_1066 335
110 3300035692 Ga0373935_0023556 Ga0373935_0023556_849_1931 335
111 3300046476 Ga0495662_0013547 Ga0495662_0013547_89_1171 335
112 3300046642 Ga0495634_0204666 Ga0495634_0204666_118_1200 335
113 3300046690 Ga0495624_0011613 Ga0495624_0011613_4267_5349 335
114 3300047315 Ga0495581_0068099 Ga0495581_0068099_167_1249 335
115 3300047319 Ga0495674_0029902 Ga0495674_0029902_374_1456 335
116 3300047321 Ga0495676_0017412 Ga0495676_0017412_3189_4271 335
117 3300053077 Ga0495601_0002246 Ga0495601_0002246_4261_5343 335
118 3300005345 Ga0070692_10125904 Ga0070692_101259042 336
119 3300005439 Ga0070711_100225247 Ga0070711_1002252471 336
120 3300009553 Ga0105249_10311229 Ga0105249_103112292 336
121 3300025916 Ga0207663_10240745 Ga0207663_102407451 336
122 3300026121 Ga0207683_10059861 Ga0207683_100598612 336
123 3300044735 Ga0466968_0024836 Ga0466968_0024836_642_1718 336
124 3300045049 Ga0466959_0005026 Ga0466959_0005026_103_1179 336
125 3300049583 Ga0501067_0000414 Ga0501067_0000414_7133_8215 336
126 3300049585 Ga0501069_0000177 Ga0501069_0000177_26499_27581 336
127 3300005327 Ga0070658_10080506 Ga0070658_100805063 337
128 3300005327 Ga0070658_10185514 Ga0070658_101855142 337
129 3300005334 Ga0068869_100140308 Ga0068869_1001403083 337
130 3300005338 Ga0068868_100005641 Ga0068868_1000056412 337
131 3300005339 Ga0070660_100117567 Ga0070660_1001175671 337
132 3300005344 Ga0070661_100013378 Ga0070661_1000133783 337
133 3300005364 Ga0070673_100092634 Ga0070673_1000926342 337
134 3300005366 Ga0070659_100063820 Ga0070659_1000638202 337
135 3300005458 Ga0070681_10044026 Ga0070681_100440263 337
136 3300005530 Ga0070679_100246426 Ga0070679_1002464263 337
137 3300005535 Ga0070684_100003716 Ga0070684_10000371619 337
138 3300005535 Ga0070684_100304808 Ga0070684_1003048081 337
139 3300005539 Ga0068853_100130271 Ga0068853_1001302712 337
140 3300005545 Ga0070695_100215728 Ga0070695_1002157281 337
141 3300005548 Ga0070665_100021998 Ga0070665_1000219987 337
142 3300005563 Ga0068855_100126656 Ga0068855_1001266564 337
143 3300005563 Ga0068855_100134549 Ga0068855_1001345492 337
144 3300005564 Ga0070664_100345432 Ga0070664_1003454322 337
145 3300005577 Ga0068857_100075633 Ga0068857_1000756333 337
146 3300005614 Ga0068856_100071873 Ga0068856_1000718733 337
147 3300020081 Ga0206354_11005081 Ga0206354_110050811 337
148 3300022467 Ga0224712_10113876 Ga0224712_101138761 337
149 3300025901 Ga0207688_10050763 Ga0207688_100507631 337
150 3300025909 Ga0207705_10034989 Ga0207705_100349894 337
151 3300025909 Ga0207705_10181804 Ga0207705_101818043 337
152 3300025912 Ga0207707_10140418 Ga0207707_101404182 337
153 3300025914 Ga0207671_10087507 Ga0207671_100875071 337
154 3300025919 Ga0207657_10032356 Ga0207657_100323561 337
155 3300025920 Ga0207649_10024067 Ga0207649_100240673 337
156 3300025920 Ga0207649_10031156 Ga0207649_100311564 337
157 3300025926 Ga0207659_10065167 Ga0207659_100651674 337
158 3300025927 Ga0207687_10036029 Ga0207687_100360294 337
159 3300025933 Ga0207706_10292913 Ga0207706_102929131 337
160 3300025935 Ga0207709_10263122 Ga0207709_102631221 337
161 3300025940 Ga0207691_10138800 Ga0207691_101388001 337
162 3300025941 Ga0207711_10346898 Ga0207711_103468982 337
163 3300025960 Ga0207651_10138993 Ga0207651_101389932 337
164 3300025981 Ga0207640_10108438 Ga0207640_101084382 337
165 3300026023 Ga0207677_10060840 Ga0207677_100608404 337
166 3300026116 Ga0207674_10006573 Ga0207674_1000657312 337
167 3300026142 Ga0207698_10058506 Ga0207698_100585064 337
168 3300045976 Ga0466967_0164524 Ga0466967_0164524_480_1553 337
169 3300049584 Ga0501068_0000406 Ga0501068_0000406_1388_2470 337
170 3300049587 Ga0501071_0153776 Ga0501071_0153776_338_1420 337
171 3300049590 Ga0501074_0220916 Ga0501074_0220916_76_1152 337
172 3300049741 Ga0501079_0098535 Ga0501079_0098535_794_1870 337
173 3300005329 Ga0070683_100002682 Ga0070683_1000026823 338
174 3300005435 Ga0070714_100142940 Ga0070714_1001429403 338
175 3300005458 Ga0070681_10138901 Ga0070681_101389011 338
176 3300005535 Ga0070684_100003157 Ga0070684_10000315711 338
177 3300005577 Ga0068857_100006214 Ga0068857_10000621411 338
178 3300005614 Ga0068856_100069339 Ga0068856_1000693392 338
179 3300009098 Ga0105245_10021635 Ga0105245_100216353 338
180 3300009553 Ga0105249_10106700 Ga0105249_101067002 338
181 3300014326 Ga0157380_10151368 Ga0157380_101513681 338
182 3300025919 Ga0207657_10029456 Ga0207657_100294565 338
183 3300025927 Ga0207687_10086506 Ga0207687_100865062 338
184 3300025929 Ga0207664_10098413 Ga0207664_100984133 338
185 3300025944 Ga0207661_10007446 Ga0207661_100074466 338
186 3300025961 Ga0207712_10219454 Ga0207712_102194541 338
187 3300026116 Ga0207674_10010846 Ga0207674_100108462 338
188 3300031251 Ga0265327_10072863 Ga0265327_100728633 338
189 3300044684 Ga0466966_0205185 Ga0466966_0205185_71_1150 338
190 3300044694 Ga0466963_0022065 Ga0466963_0022065_2522_3595 338
191 3300044719 Ga0466971_0012360 Ga0466971_0012360_740_1819 338
192 3300045976 Ga0466967_0299659 Ga0466967_0299659_79_1218 338
193 3300048904 Ga0496101_0198658 Ga0496101_0198658_382_1461 338
194 3300048915 Ga0496112_0109809 Ga0496112_0109809_1433_2506 338
195 3300049592 Ga0501076_0402438 Ga0501076_0402438_23_1102 338
196 3300053078 Ga0495612_0009364 Ga0495612_0009364_214_1296 338
197 3300005435 Ga0070714_100003258 Ga0070714_1000032586 339
198 3300005435 Ga0070714_100153236 Ga0070714_1001532362 339
199 3300005437 Ga0070710_10191720 Ga0070710_101917201 339
200 3300005459 Ga0068867_100047283 Ga0068867_1000472834 339
201 3300006028 Ga0070717_10084014 Ga0070717_100840142 339
202 3300011119 Ga0105246_10008947 Ga0105246_100089475 339
203 3300013104 Ga0157370_10122530 Ga0157370_101225304 339
204 3300014969 Ga0157376_10283216 Ga0157376_102832162 339
205 3300025915 Ga0207693_10047628 Ga0207693_100476284 339
206 3300025929 Ga0207664_10081322 Ga0207664_100813223 339
207 3300025935 Ga0207709_10027570 Ga0207709_100275703 339
208 3300045836 Ga0466958_0083110 Ga0466958_0083110_589_1662 339
209 3300045836 Ga0466958_0169116 Ga0466958_0169116_218_1291 339
210 3300046455 Ga0495603_0086668 Ga0495603_0086668_645_1727 339
211 3300046463 Ga0495653_0113793 Ga0495653_0113793_685_1767 339
212 3300047321 Ga0495676_0108687 Ga0495676_0108687_162_1244 339
213 3300047321 Ga0495676_0115359 Ga0495676_0115359_494_1564 339
214 3300048911 Ga0496108_0203356 Ga0496108_0203356_483_1559 339
215 3300048918 Ga0496115_0006577 Ga0496115_0006577_6795_7871 339
216 3300048929 Ga0496126_0115479 Ga0496126_0115479_1147_2223 339
217 3300049593 Ga0501077_0093193 Ga0501077_0093193_546_1625 339
218 3300049824 Ga0501045_0046796 Ga0501045_0046796_1483_2562 339
219 3300061719 Ga0466962_0033581 Ga0466962_0033581_787_1860 339
220 3300005329 Ga0070683_100341656 Ga0070683_1003416562 340
221 3300005467 Ga0070706_100097488 Ga0070706_1000974884 340
222 3300005535 Ga0070684_100138512 Ga0070684_1001385122 340
223 3300025910 Ga0207684_10247160 Ga0207684_102471601 340
224 3300025944 Ga0207661_10086391 Ga0207661_100863912 340
225 3300046455 Ga0495603_0074717 Ga0495603_0074717_623_1702 340
226 3300046517 Ga0495630_0245077 Ga0495630_0245077_91_1170 340
227 3300048905 Ga0496102_0034991 Ga0496102_0034991_1549_2625 340
228 3300048906 Ga0496103_0109477 Ga0496103_0109477_92_1168 340
229 3300048907 Ga0496104_0311629 Ga0496104_0311629_331_1410 340
230 3300048909 Ga0496106_0005239 Ga0496106_0005239_7675_8751 340
231 3300048910 Ga0496107_0000545 Ga0496107_0000545_8896_9972 340
232 3300049575 Ga0501039_0226851 Ga0501039_0226851_263_1345 340
233 3300049580 Ga0501046_0109467 Ga0501046_0109467_277_1359 340
234 3300049824 Ga0501045_0037735 Ga0501045_0037735_1677_2759 340
235 3300053085 Ga0495619_0059040 Ga0495619_0059040_347_1426 340
236 3300005327 Ga0070658_10011810 Ga0070658_100118105 341
237 3300005329 Ga0070683_100018913 Ga0070683_1000189133 341
238 3300005471 Ga0070698_100207210 Ga0070698_1002072102 341
239 3300009093 Ga0105240_10017534 Ga0105240_100175348 341
240 3300013104 Ga0157370_10022667 Ga0157370_100226677 341
241 3300025909 Ga0207705_10013650 Ga0207705_100136504 341
242 3300025921 Ga0207652_10049343 Ga0207652_100493434 341
243 3300025949 Ga0207667_10028354 Ga0207667_100283542 341
244 3300028558 Ga0265326_10004431 Ga0265326_100044313 341
245 3300028563 Ga0265319_1039859 Ga0265319_10398592 341
246 3300028573 Ga0265334_10002745 Ga0265334_100027454 341
247 3300028577 Ga0265318_10003154 Ga0265318_100031549 341
248 3300028653 Ga0265323_10052375 Ga0265323_100523752 341
249 3300028666 Ga0265336_10026432 Ga0265336_100264322 341
250 3300028800 Ga0265338_10011051 Ga0265338_100110514 341
251 3300029957 Ga0265324_10032519 Ga0265324_100325193 341
252 3300031238 Ga0265332_10015422 Ga0265332_100154224 341
253 3300031239 Ga0265328_10024800 Ga0265328_100248003 341
254 3300031247 Ga0265340_10003923 Ga0265340_100039233 341
255 3300031249 Ga0265339_10042298 Ga0265339_100422984 341
256 3300031250 Ga0265331_10032605 Ga0265331_100326053 341
257 3300031251 Ga0265327_10008410 Ga0265327_100084104 341
258 3300031344 Ga0265316_10069891 Ga0265316_100698913 341
259 3300031595 Ga0265313_10005872 Ga0265313_100058728 341
260 3300031711 Ga0265314_10076599 Ga0265314_100765993 341
261 3300031712 Ga0265342_10082671 Ga0265342_100826712 341
262 3300037312 Ga0395899_0010325 Ga0395899_0010325_5433_6509 341
263 3300037418 Ga0395900_0005086 Ga0395900_0005086_1393_2469 341
264 3300037466 Ga0395898_0015934 Ga0395898_0015934_6186_7262 341
265 3300037471 Ga0395905_0006168 Ga0395905_0006168_10002_11078 341
266 3300038443 Ga0395901_0002976 Ga0395901_0002976_1331_2407 341
267 3300044842 Ga0466957_0042190 Ga0466957_0042190_908_1981 341
268 3300045049 Ga0466959_0104658 Ga0466959_0104658_391_1464 341
269 3300045836 Ga0466958_0010574 Ga0466958_0010574_3919_4992 341
270 3300045976 Ga0466967_0004410 Ga0466967_0004410_3092_4120 341
271 3300046461 Ga0495641_0073720 Ga0495641_0073720_196_1275 341
272 3300046511 Ga0495608_0060253 Ga0495608_0060253_1097_2206 341
273 3300046535 Ga0495586_0010916 Ga0495586_0010916_3647_4726 341
274 3300046683 Ga0495658_0029703 Ga0495658_0029703_1800_2879 341
275 3300047319 Ga0495674_0043869 Ga0495674_0043869_23_1102 341
276 3300048912 Ga0496109_0270308 Ga0496109_0270308_538_1566 341
277 3300005344 Ga0070661_100066423 Ga0070661_1000664232 342
278 3300009148 Ga0105243_10225870 Ga0105243_102258702 342
279 3300025915 Ga0207693_10092812 Ga0207693_100928123 342
280 3300031250 Ga0265331_10115920 Ga0265331_101159202 342
281 3300036401 Ga0373937_0090959 Ga0373937_0090959_20_1054 342
282 3300044694 Ga0466963_0009099 Ga0466963_0009099_3442_4518 342
283 3300044706 Ga0466964_0047928 Ga0466964_0047928_233_1309 342
284 3300045836 Ga0466958_0037298 Ga0466958_0037298_281_1357 342
285 3300045976 Ga0466967_0140405 Ga0466967_0140405_1084_2160 342
286 3300049568 Ga0501031_0021577 Ga0501031_0021577_2092_3168 342
287 3300049569 Ga0501032_0011883 Ga0501032_0011883_1020_2096 342
288 3300049571 Ga0501034_0091417 Ga0501034_0091417_843_1919 342
289 3300049573 Ga0501037_0118948 Ga0501037_0118948_331_1407 342
290 3300049575 Ga0501039_0060380 Ga0501039_0060380_332_1408 342
291 3300049577 Ga0501041_0009853 Ga0501041_0009853_2466_3542 342
292 3300049578 Ga0501042_0063071 Ga0501042_0063071_1520_2596 342
293 3300049579 Ga0501043_0009045 Ga0501043_0009045_5493_6569 342
294 3300049580 Ga0501046_0017581 Ga0501046_0017581_3549_4625 342
295 3300049581 Ga0501047_0177679 Ga0501047_0177679_297_1373 342
296 3300049584 Ga0501068_0069292 Ga0501068_0069292_504_1580 342
297 3300049586 Ga0501070_0023584 Ga0501070_0023584_425_1501 342
298 3300049586 Ga0501070_0070360 Ga0501070_0070360_1269_2345 342
299 3300049586 Ga0501070_0072383 Ga0501070_0072383_298_1374 342
300 3300049587 Ga0501071_0043464 Ga0501071_0043464_2093_3169 342
301 3300049588 Ga0501072_0023633 Ga0501072_0023633_1810_2886 342
302 3300049588 Ga0501072_0143332 Ga0501072_0143332_211_1287 342
303 3300049589 Ga0501073_0028115 Ga0501073_0028115_849_1925 342
304 3300049589 Ga0501073_0091672 Ga0501073_0091672_877_1953 342
305 3300049591 Ga0501075_0181280 Ga0501075_0181280_223_1299 342
306 3300049742 Ga0501080_0065754 Ga0501080_0065754_1982_3058 342
307 3300049744 Ga0501083_0019905 Ga0501083_0019905_2759_3835 342
308 3300049744 Ga0501083_0025198 Ga0501083_0025198_978_2054 342
309 3300049823 Ga0501044_0218080 Ga0501044_0218080_435_1511 342
310 3300049824 Ga0501045_0040451 Ga0501045_0040451_2104_3180 342
311 3300054114 Ga0501084_0018159 Ga0501084_0018159_945_2021 342
312 3300060353 Ga0501082_0098941 Ga0501082_0098941_643_1719 342
313 3300061734 Ga0530510_0056867 Ga0530510_0056867_1698_2774 342
314 3300005365 Ga0070688_100158982 Ga0070688_1001589822 343
315 3300028800 Ga0265338_10050405 Ga0265338_100504055 343
316 3300035692 Ga0373935_0047919 Ga0373935_0047919_138_1214 343
317 3300035695 Ga0373927_0021786 Ga0373927_0021786_476_1552 343
318 3300045976 Ga0466967_0103306 Ga0466967_0103306_1316_2389 343
319 3300046642 Ga0495634_0014856 Ga0495634_0014856_1289_2320 343
320 3300046663 Ga0495635_0067755 Ga0495635_0067755_389_1465 343
321 3300049571 Ga0501034_0006312 Ga0501034_0006312_905_1981 343
322 3300049572 Ga0501036_0033834 Ga0501036_0033834_2225_3367 343
323 3300049579 Ga0501043_0087464 Ga0501043_0087464_187_1329 343
324 3300049580 Ga0501046_0043766 Ga0501046_0043766_1242_2384 343
325 3300049582 Ga0501048_0004258 Ga0501048_0004258_4584_5726 343
326 3300049585 Ga0501069_0062810 Ga0501069_0062810_55_1131 343
327 3300049587 Ga0501071_0029991 Ga0501071_0029991_442_1584 343
328 3300049588 Ga0501072_0002616 Ga0501072_0002616_3798_4940 343
329 3300049589 Ga0501073_0041253 Ga0501073_0041253_1334_2410 343
330 3300049590 Ga0501074_0030399 Ga0501074_0030399_764_1840 343
331 3300049590 Ga0501074_0050290 Ga0501074_0050290_800_1942 343
332 3300049591 Ga0501075_0037036 Ga0501075_0037036_1424_2566 343
333 3300049592 Ga0501076_0017096 Ga0501076_0017096_500_1642 343
334 3300049742 Ga0501080_0001785 Ga0501080_0001785_14789_15865 343
335 3300049743 Ga0501081_0180591 Ga0501081_0180591_188_1330 343
336 3300049824 Ga0501045_0057654 Ga0501045_0057654_989_2131 343
337 3300050512 nmdc:mga0n895_213161_c1 nmdc:mga0n895_213161_c1_484_1560 343
338 3300054114 Ga0501084_0013069 Ga0501084_0013069_4361_5503 343
339 3300061734 Ga0530510_0021443 Ga0530510_0021443_3054_4196 343
340 3300005842 Ga0068858_100040878 Ga0068858_1000408784 344
341 3300009098 Ga0105245_10010713 Ga0105245_100107134 344
342 3300009101 Ga0105247_10031126 Ga0105247_100311264 344
343 3300009176 Ga0105242_10077163 Ga0105242_100771631 344
344 3300013296 Ga0157374_10060575 Ga0157374_100605755 344
345 3300014968 Ga0157379_10176821 Ga0157379_101768211 344
346 3300025900 Ga0207710_10028513 Ga0207710_100285134 344
347 3300025909 Ga0207705_10141276 Ga0207705_101412762 344
348 3300025927 Ga0207687_10033035 Ga0207687_100330353 344
349 3300025928 Ga0207700_10224896 Ga0207700_102248962 344
350 3300026035 Ga0207703_10054226 Ga0207703_100542263 344
351 3300026078 Ga0207702_10043354 Ga0207702_100433545 344
352 3300045976 Ga0466967_0208154 Ga0466967_0208154_22_1095 344
353 3300046475 Ga0495639_0139098 Ga0495639_0139098_121_1155 344
354 3300005339 Ga0070660_100123015 Ga0070660_1001230152 345
355 3300005458 Ga0070681_10116269 Ga0070681_101162692 345
356 3300005471 Ga0070698_100241519 Ga0070698_1002415192 345
357 3300025919 Ga0207657_10101424 Ga0207657_101014242 345
358 3300048918 Ga0496115_0081242 Ga0496115_0081242_330_1400 345
359 3300049586 Ga0501070_0046789 Ga0501070_0046789_1834_2916 345
360 3300049590 Ga0501074_0057087 Ga0501074_0057087_281_1363 345
361 3300005336 Ga0070680_100111784 Ga0070680_1001117842 346
362 3300005338 Ga0068868_100162712 Ga0068868_1001627122 346
363 3300005530 Ga0070679_100171905 Ga0070679_1001719052 346
364 3300005544 Ga0070686_100057069 Ga0070686_1000570692 346
365 3300009098 Ga0105245_10105372 Ga0105245_101053722 346
366 3300025917 Ga0207660_10062611 Ga0207660_100626112 346
367 3300048903 Ga0496100_0103101 Ga0496100_0103101_45_1127 346
368 3300048905 Ga0496102_0102547 Ga0496102_0102547_1563_2645 346
369 3300048908 Ga0496105_0074654 Ga0496105_0074654_1166_2248 346
370 3300048910 Ga0496107_0013425 Ga0496107_0013425_2478_3560 346
371 3300048912 Ga0496109_0045380 Ga0496109_0045380_1937_3019 346
372 3300048913 Ga0496110_0030818 Ga0496110_0030818_3052_4134 346
373 3300048915 Ga0496112_0201869 Ga0496112_0201869_585_1667 346
374 3300048916 Ga0496113_0030876 Ga0496113_0030876_930_2012 346
375 3300048917 Ga0496114_0059492 Ga0496114_0059492_646_1728 346
376 3300027907 Ga0207428_10047915 Ga0207428_100479154 347
377 3300028563 Ga0265319_1000776 Ga0265319_10007767 347
378 3300028577 Ga0265318_10004647 Ga0265318_100046477 347
379 3300031711 Ga0265314_10158755 Ga0265314_101587552 347
380 3300042009 Ga0439451_007714 Ga0439451_007714_1027_2106 347
381 3300044694 Ga0466963_0009206 Ga0466963_0009206_1575_2648 347
382 3300044706 Ga0466964_0049322 Ga0466964_0049322_444_1508 347
383 3300045976 Ga0466967_0025102 Ga0466967_0025102_1361_2434 347
384 3300037466 Ga0395898_0112177 Ga0395898_0112177_249_1325 348
385 3300045976 Ga0466967_0020616 Ga0466967_0020616_504_1577 348
386 3300005338 Ga0068868_100011526 Ga0068868_1000115263 349
387 3300005341 Ga0070691_10029838 Ga0070691_100298383 349
388 3300005366 Ga0070659_100085643 Ga0070659_1000856433 349
389 3300005456 Ga0070678_100144887 Ga0070678_1001448872 349
390 3300005563 Ga0068855_100014421 Ga0068855_1000144216 349
391 3300006871 Ga0075434_100001958 Ga0075434_1000019586 349
392 3300006914 Ga0075436_100007259 Ga0075436_1000072594 349
393 3300007076 Ga0075435_100004915 Ga0075435_1000049156 349
394 3300009148 Ga0105243_10068593 Ga0105243_100685933 349
395 3300010375 Ga0105239_10162379 Ga0105239_101623793 349
396 3300013297 Ga0157378_10106202 Ga0157378_101062023 349
397 3300025901 Ga0207688_10002129 Ga0207688_100021297 349
398 3300025919 Ga0207657_10000634 Ga0207657_1000063423 349
399 3300025924 Ga0207694_10027888 Ga0207694_100278883 349
400 3300025927 Ga0207687_10002883 Ga0207687_100028833 349
401 3300025931 Ga0207644_10164373 Ga0207644_101643732 349
402 3300025932 Ga0207690_10062330 Ga0207690_100623303 349
403 3300025938 Ga0207704_10083955 Ga0207704_100839553 349
404 3300025939 Ga0207665_10047629 Ga0207665_100476292 349
405 3300025949 Ga0207667_10014735 Ga0207667_100147356 349
406 3300026121 Ga0207683_10020326 Ga0207683_100203266 349
407 3300048903 Ga0496100_0001463 Ga0496100_0001463_4331_5413 349
408 3300048904 Ga0496101_0010095 Ga0496101_0010095_3205_4287 349
409 3300048905 Ga0496102_0002197 Ga0496102_0002197_11333_12415 349
410 3300048905 Ga0496102_0123627 Ga0496102_0123627_1004_2083 349
411 3300048906 Ga0496103_0002459 Ga0496103_0002459_5143_6225 349
412 3300048906 Ga0496103_0042072 Ga0496103_0042072_1369_2448 349
413 3300048907 Ga0496104_0027989 Ga0496104_0027989_3318_4400 349
414 3300048907 Ga0496104_0157545 Ga0496104_0157545_1060_2139 349
415 3300048909 Ga0496106_0002042 Ga0496106_0002042_5020_6102 349
416 3300048909 Ga0496106_0047440 Ga0496106_0047440_319_1398 349
417 3300048910 Ga0496107_0014162 Ga0496107_0014162_60_1142 349
418 3300048911 Ga0496108_0001800 Ga0496108_0001800_6344_7426 349
419 3300048913 Ga0496110_0001093 Ga0496110_0001093_10104_11186 349
420 3300048914 Ga0496111_0014563 Ga0496111_0014563_387_1469 349
421 3300048914 Ga0496111_0030321 Ga0496111_0030321_198_1277 349
422 3300048916 Ga0496113_0000452 Ga0496113_0000452_10805_11887 349
423 3300049580 Ga0501046_0201467 Ga0501046_0201467_337_1413 349
424 3300049593 Ga0501077_0022527 Ga0501077_0022527_106_1182 349
425 3300050512 nmdc:mga0n895_685_c1 nmdc:mga0n895_685_c1_17405_18580 349
426 3300050514 nmdc:mga08x19_5360_c1 nmdc:mga08x19_5360_c1_2061_3236 349
427 3300005347 Ga0070668_100236709 Ga0070668_1002367092 350
428 3300005354 Ga0070675_100065652 Ga0070675_1000656522 350
429 3300005466 Ga0070685_10034706 Ga0070685_100347063 350
430 3300013296 Ga0157374_10012233 Ga0157374_100122333 350
431 3300025900 Ga0207710_10063304 Ga0207710_100633042 350
432 3300035170 Ga0373943_0055277 Ga0373943_0055277_125_1201 350
433 3300037466 Ga0395898_0036109 Ga0395898_0036109_3533_4606 350
434 3300044693 Ga0466961_0005636 Ga0466961_0005636_5129_6208 350
435 3300044694 Ga0466963_0004258 Ga0466963_0004258_739_1815 350
436 3300044694 Ga0466963_0030683 Ga0466963_0030683_1275_2354 350
437 3300044842 Ga0466957_0010894 Ga0466957_0010894_1117_2196 350
438 3300044842 Ga0466957_0101098 Ga0466957_0101098_460_1536 350
439 3300045049 Ga0466959_0058838 Ga0466959_0058838_601_1680 350
440 3300045836 Ga0466958_0029730 Ga0466958_0029730_1351_2427 350
441 3300045836 Ga0466958_0095450 Ga0466958_0095450_101_1180 350
442 3300045976 Ga0466967_0167800 Ga0466967_0167800_475_1548 350
443 3300046531 Ga0495665_0014212 Ga0495665_0014212_1917_2993 350
444 3300046690 Ga0495624_0071156 Ga0495624_0071156_1048_2124 350
445 3300047315 Ga0495581_0001437 Ga0495581_0001437_2461_3537 350
446 3300047321 Ga0495676_0016250 Ga0495676_0016250_3718_4794 350
447 3300048907 Ga0496104_0388000 Ga0496104_0388000_19_1098 350
448 3300048911 Ga0496108_0090483 Ga0496108_0090483_121_1197 350
449 3300005336 Ga0070680_100176877 Ga0070680_1001768773 351
450 3300005458 Ga0070681_10122641 Ga0070681_101226412 351
451 3300005563 Ga0068855_100095467 Ga0068855_1000954672 351
452 3300009545 Ga0105237_10220125 Ga0105237_102201252 351
453 3300009551 Ga0105238_10006133 Ga0105238_100061335 351
454 3300013104 Ga0157370_10048491 Ga0157370_100484915 351
455 3300020081 Ga0206354_10308263 Ga0206354_103082636 351
456 3300020082 Ga0206353_10462240 Ga0206353_104622403 351
457 3300025912 Ga0207707_10133409 Ga0207707_101334092 351
458 3300025949 Ga0207667_10307145 Ga0207667_103071452 351
459 3300035089 Ga0373944_0006456 Ga0373944_0006456_2004_3086 351
460 3300035119 Ga0373956_0060749 Ga0373956_0060749_276_1358 351
461 3300035170 Ga0373943_0001876 Ga0373943_0001876_141_1223 351
462 3300035171 Ga0373946_0061295 Ga0373946_0061295_279_1361 351
463 3300035172 Ga0373955_0179860 Ga0373955_0179860_81_1163 351
464 3300035410 Ga0373924_0022475 Ga0373924_0022475_761_1843 351
465 3300035695 Ga0373927_0015218 Ga0373927_0015218_782_1864 351
466 3300035725 Ga0373947_0005562 Ga0373947_0005562_72_1154 351
467 3300036401 Ga0373937_0245990 Ga0373937_0245990_52_1134 351
468 3300037068 Ga0373925_0006097 Ga0373925_0006097_4736_5818 351
469 3300037418 Ga0395900_0262876 Ga0395900_0262876_611_1669 351
470 3300046454 Ga0495592_0092780 Ga0495592_0092780_640_1722 351
471 3300046455 Ga0495603_0024054 Ga0495603_0024054_2558_3640 351
472 3300046459 Ga0495629_0027827 Ga0495629_0027827_540_1622 351
473 3300046461 Ga0495641_0003765 Ga0495641_0003765_5768_6850 351
474 3300046463 Ga0495653_0005235 Ga0495653_0005235_6284_7366 351
475 3300046473 Ga0495582_0002392 Ga0495582_0002392_4704_5786 351
476 3300046475 Ga0495639_0002167 Ga0495639_0002167_7205_8287 351
477 3300046476 Ga0495662_0032603 Ga0495662_0032603_1260_2342 351
478 3300046511 Ga0495608_0006095 Ga0495608_0006095_5482_6564 351
479 3300046514 Ga0495618_0004507 Ga0495618_0004507_99_1181 351
480 3300046517 Ga0495630_0003907 Ga0495630_0003907_4508_5590 351
481 3300046529 Ga0495652_0116556 Ga0495652_0116556_788_1870 351
482 3300046531 Ga0495665_0001485 Ga0495665_0001485_10166_11248 351
483 3300046533 Ga0495640_0003074 Ga0495640_0003074_4407_5489 351
484 3300046536 Ga0495587_0043290 Ga0495587_0043290_649_1731 351
485 3300046559 Ga0495667_0006817 Ga0495667_0006817_5309_6391 351
486 3300046642 Ga0495634_0003097 Ga0495634_0003097_5051_6133 351
487 3300046663 Ga0495635_0022878 Ga0495635_0022878_68_1150 351
488 3300046674 Ga0495588_0017098 Ga0495588_0017098_2403_3485 351
489 3300046675 Ga0495657_0122511 Ga0495657_0122511_59_1141 351
490 3300046689 Ga0495613_0005558 Ga0495613_0005558_4083_5165 351
491 3300047315 Ga0495581_0003775 Ga0495581_0003775_4301_5383 351
492 3300047317 Ga0495604_0018043 Ga0495604_0018043_1854_2936 351
493 3300047319 Ga0495674_0004046 Ga0495674_0004046_7221_8303 351
494 3300047319 Ga0495674_0146740 Ga0495674_0146740_710_1945 351
495 3300047321 Ga0495676_0083518 Ga0495676_0083518_147_1229 351
496 3300047322 Ga0495680_0012939 Ga0495680_0012939_2384_3466 351
497 3300047444 Ga0495675_0092568 Ga0495675_0092568_235_1317 351
498 3300047471 Ga0495684_0002922 Ga0495684_0002922_11297_12379 351
499 3300047673 Ga0495593_0005440 Ga0495593_0005440_3207_4289 351
500 3300048088 Ga0495602_0195071 Ga0495602_0195071_342_1424 351
501 3300048089 Ga0495614_0007485 Ga0495614_0007485_3136_4218 351
502 3300053077 Ga0495601_0045071 Ga0495601_0045071_709_1944 351
503 3300053077 Ga0495601_0065382 Ga0495601_0065382_452_1534 351
504 3300053084 Ga0495595_0002243 Ga0495595_0002243_4594_5676 351
505 3300013105 Ga0157369_10079013 Ga0157369_100790133 352
506 3300035116 Ga0373945_0001307 Ga0373945_0001307_5859_6920 352
507 3300035170 Ga0373943_0034010 Ga0373943_0034010_612_1673 352
508 3300035724 Ga0373933_0072322 Ga0373933_0072322_436_1497 352
509 3300037068 Ga0373925_0061700 Ga0373925_0061700_1419_2480 352
510 3300044694 Ga0466963_0006926 Ga0466963_0006926_202_1263 352
511 3300045976 Ga0466967_0037850 Ga0466967_0037850_3059_4120 352
512 3300046462 Ga0495651_0075929 Ga0495651_0075929_528_1589 352
513 3300046463 Ga0495653_0014560 Ga0495653_0014560_201_1262 352
514 3300046517 Ga0495630_0044270 Ga0495630_0044270_653_1714 352
515 3300046529 Ga0495652_0046019 Ga0495652_0046019_199_1260 352
516 3300046536 Ga0495587_0042987 Ga0495587_0042987_1205_2266 352
517 3300046543 Ga0495645_0155427 Ga0495645_0155427_427_1488 352
518 3300046559 Ga0495667_0061790 Ga0495667_0061790_427_1488 352
519 3300046679 Ga0495623_0007303 Ga0495623_0007303_1217_2278 352
520 3300046683 Ga0495658_0080700 Ga0495658_0080700_566_1627 352
521 3300046689 Ga0495613_0086610 Ga0495613_0086610_216_1277 352
522 3300047319 Ga0495674_0050028 Ga0495674_0050028_1358_2419 352
523 3300047321 Ga0495676_0037163 Ga0495676_0037163_888_1949 352
524 3300047444 Ga0495675_0058945 Ga0495675_0058945_1213_2274 352
525 3300048088 Ga0495602_0114418 Ga0495602_0114418_728_1789 352
526 3300053077 Ga0495601_0031741 Ga0495601_0031741_2174_3235 352
527 3300009098 Ga0105245_10255762 Ga0105245_102557622 353
528 3300009176 Ga0105242_10071317 Ga0105242_100713172 353
529 3300013104 Ga0157370_10023626 Ga0157370_100236267 353
530 3300013297 Ga0157378_10207458 Ga0157378_102074582 353
531 3300013307 Ga0157372_10205252 Ga0157372_102052521 353
532 3300020080 Ga0206350_10429191 Ga0206350_104291912 353
533 3300037418 Ga0395900_0071158 Ga0395900_0071158_740_1804 353
534 3300038443 Ga0395901_0137165 Ga0395901_0137165_288_1352 353
535 3300045976 Ga0466967_0104521 Ga0466967_0104521_1243_2325 353
536 3300046455 Ga0495603_0192524 Ga0495603_0192524_69_1130 353
537 3300046642 Ga0495634_0031690 Ga0495634_0031690_160_1221 353
538 3300046683 Ga0495658_0041059 Ga0495658_0041059_188_1249 353
539 3300046689 Ga0495613_0043999 Ga0495613_0043999_975_2036 353
540 3300048088 Ga0495602_0130574 Ga0495602_0130574_408_1472 353
541 3300048904 Ga0496101_0089983 Ga0496101_0089983_1171_2232 353
542 3300048907 Ga0496104_0006694 Ga0496104_0006694_250_1311 353
543 3300048908 Ga0496105_0005070 Ga0496105_0005070_8222_9283 353
544 3300048909 Ga0496106_0134997 Ga0496106_0134997_176_1237 353
545 3300048911 Ga0496108_0000403 Ga0496108_0000403_19506_20567 353
546 3300048911 Ga0496108_0007848 Ga0496108_0007848_1012_2073 353
547 3300048911 Ga0496108_0064846 Ga0496108_0064846_1558_2619 353
548 3300048912 Ga0496109_0001790 Ga0496109_0001790_13881_14942 353
549 3300048912 Ga0496109_0003464 Ga0496109_0003464_5400_6461 353
550 3300048913 Ga0496110_0004541 Ga0496110_0004541_7676_8737 353
551 3300048913 Ga0496110_0059548 Ga0496110_0059548_98_1159 353
552 3300048914 Ga0496111_0005179 Ga0496111_0005179_714_1775 353
553 3300048914 Ga0496111_0022906 Ga0496111_0022906_964_2025 353
554 3300048915 Ga0496112_0028928 Ga0496112_0028928_3634_4695 353
555 3300048915 Ga0496112_0491056 Ga0496112_0491056_43_1104 353
556 3300048916 Ga0496113_0124353 Ga0496113_0124353_691_1752 353
557 3300048917 Ga0496114_0077885 Ga0496114_0077885_378_1439 353
558 3300048917 Ga0496114_0125549 Ga0496114_0125549_885_1946 353
559 3300048917 Ga0496114_0172182 Ga0496114_0172182_496_1557 353
560 3300053085 Ga0495619_0020674 Ga0495619_0020674_2337_3404 353
561 3300005981 Ga0081538_10062371 Ga0081538_100623712 354
562 3300009094 Ga0111539_10003876 Ga0111539_1000387617 354
563 3300031901 Ga0307406_10195892 Ga0307406_101958921 354
564 3300038443 Ga0395901_0257376 Ga0395901_0257376_223_1290 354
565 3300049586 Ga0501070_0154480 Ga0501070_0154480_314_1381 354
566 3300049741 Ga0501079_0264720 Ga0501079_0264720_159_1232 354
567 3300050511 nmdc:mga08y16_9028_c1 nmdc:mga08y16_9028_c1_7693_8760 354
568 3300005327 Ga0070658_10003443 Ga0070658_100034433 355
569 3300005327 Ga0070658_10073886 Ga0070658_100738861 355
570 3300005339 Ga0070660_100016340 Ga0070660_1000163406 355
571 3300005344 Ga0070661_100036123 Ga0070661_1000361234 355
572 3300005344 Ga0070661_100245207 Ga0070661_1002452071 355
573 3300005367 Ga0070667_100041251 Ga0070667_1000412511 355
574 3300005563 Ga0068855_100019598 Ga0068855_1000195982 355
575 3300005937 Ga0081455_10020753 Ga0081455_100207538 355
576 3300009093 Ga0105240_10031933 Ga0105240_100319336 355
577 3300014497 Ga0182008_10003096 Ga0182008_100030969 355
578 3300015262 Ga0182007_10012378 Ga0182007_100123783 355
579 3300020069 Ga0197907_10413493 Ga0197907_104134933 355
580 3300020070 Ga0206356_11749891 Ga0206356_117498911 355
581 3300020081 Ga0206354_10258447 Ga0206354_102584471 355
582 3300022467 Ga0224712_10024379 Ga0224712_100243791 355
583 3300025909 Ga0207705_10320279 Ga0207705_103202792 355
584 3300025919 Ga0207657_10025770 Ga0207657_100257706 355
585 3300025986 Ga0207658_10006900 Ga0207658_100069006 355
586 3300037312 Ga0395899_0044895 Ga0395899_0044895_455_1528 355
587 3300037418 Ga0395900_0055281 Ga0395900_0055281_593_1666 355
588 3300037418 Ga0395900_0098108 Ga0395900_0098108_490_1563 355
589 3300037418 Ga0395900_0123245 Ga0395900_0123245_997_2079 355
590 3300037466 Ga0395898_0002058 Ga0395898_0002058_4702_5778 355
591 3300037466 Ga0395898_0004841 Ga0395898_0004841_4910_5992 355
592 3300037466 Ga0395898_0049577 Ga0395898_0049577_1613_2686 355
593 3300037471 Ga0395905_0027947 Ga0395905_0027947_3889_4971 355
594 3300037471 Ga0395905_0042323 Ga0395905_0042323_1127_2200 355
595 3300038443 Ga0395901_0012209 Ga0395901_0012209_1317_2399 355
596 3300038443 Ga0395901_0048813 Ga0395901_0048813_1365_2438 355
597 3300038443 Ga0395901_0166982 Ga0395901_0166982_63_1139 355
598 3300045836 Ga0466958_0005672 Ga0466958_0005672_4351_5424 355
599 3300045836 Ga0466958_0246825 Ga0466958_0246825_43_1125 355
600 3300045976 Ga0466967_0174473 Ga0466967_0174473_21_1094 355
601 3300048089 Ga0495614_0088080 Ga0495614_0088080_89_1159 355
602 3300048907 Ga0496104_0060150 Ga0496104_0060150_1981_3048 355
603 3300048915 Ga0496112_0108985 Ga0496112_0108985_1033_2100 355
604 3300049583 Ga0501067_0030495 Ga0501067_0030495_1284_2357 355
605 3300049590 Ga0501074_0185814 Ga0501074_0185814_197_1267 355
606 3300005329 Ga0070683_100368282 Ga0070683_1003682822 356
607 3300005331 Ga0070670_100196243 Ga0070670_1001962431 356
608 3300005334 Ga0068869_100085644 Ga0068869_1000856444 356
609 3300005336 Ga0070680_100303575 Ga0070680_1003035752 356
610 3300005336 Ga0070680_100355603 Ga0070680_1003556032 356
611 3300005337 Ga0070682_100005908 Ga0070682_1000059087 356
612 3300005338 Ga0068868_100059303 Ga0068868_1000593034 356
613 3300005339 Ga0070660_100000759 Ga0070660_10000075921 356
614 3300005340 Ga0070689_100087756 Ga0070689_1000877564 356
615 3300005343 Ga0070687_100057512 Ga0070687_1000575121 356
616 3300005347 Ga0070668_100095597 Ga0070668_1000955972 356
617 3300005354 Ga0070675_100107472 Ga0070675_1001074724 356
618 3300005355 Ga0070671_100142501 Ga0070671_1001425012 356
619 3300005364 Ga0070673_100031989 Ga0070673_1000319895 356
620 3300005365 Ga0070688_100011865 Ga0070688_1000118651 356
621 3300005366 Ga0070659_100155318 Ga0070659_1001553182 356
622 3300005367 Ga0070667_100212058 Ga0070667_1002120581 356
623 3300005435 Ga0070714_100051384 Ga0070714_1000513843 356
624 3300005436 Ga0070713_100058244 Ga0070713_1000582444 356
625 3300005436 Ga0070713_100226647 Ga0070713_1002266472 356
626 3300005438 Ga0070701_10002326 Ga0070701_100023268 356
627 3300005440 Ga0070705_100029624 Ga0070705_1000296245 356
628 3300005444 Ga0070694_100306185 Ga0070694_1003061851 356
629 3300005455 Ga0070663_100088073 Ga0070663_1000880734 356
630 3300005456 Ga0070678_100003794 Ga0070678_1000037947 356
631 3300005458 Ga0070681_10000518 Ga0070681_1000051829 356
632 3300005459 Ga0068867_100060000 Ga0068867_1000600001 356
633 3300005518 Ga0070699_100303905 Ga0070699_1003039051 356
634 3300005535 Ga0070684_100177061 Ga0070684_1001770614 356
635 3300005535 Ga0070684_100328482 Ga0070684_1003284821 356
636 3300005543 Ga0070672_100005975 Ga0070672_1000059757 356
637 3300005544 Ga0070686_100089851 Ga0070686_1000898512 356
638 3300005546 Ga0070696_100142854 Ga0070696_1001428542 356
639 3300005548 Ga0070665_100214940 Ga0070665_1002149401 356
640 3300005563 Ga0068855_100019419 Ga0068855_1000194193 356
641 3300005564 Ga0070664_100113394 Ga0070664_1001133942 356
642 3300005614 Ga0068856_100142078 Ga0068856_1001420782 356
643 3300005616 Ga0068852_100297503 Ga0068852_1002975033 356
644 3300005617 Ga0068859_100025360 Ga0068859_1000253604 356
645 3300005618 Ga0068864_100014184 Ga0068864_1000141845 356
646 3300005718 Ga0068866_10086979 Ga0068866_100869793 356
647 3300005719 Ga0068861_100131528 Ga0068861_1001315282 356
648 3300005841 Ga0068863_100148724 Ga0068863_1001487242 356
649 3300005842 Ga0068858_100108478 Ga0068858_1001084784 356
650 3300005843 Ga0068860_100135494 Ga0068860_1001354943 356
651 3300005844 Ga0068862_100253726 Ga0068862_1002537262 356
652 3300006028 Ga0070717_10032371 Ga0070717_100323713 356
653 3300006028 Ga0070717_10047365 Ga0070717_100473653 356
654 3300006237 Ga0097621_100053182 Ga0097621_1000531824 356
655 3300006237 Ga0097621_100260383 Ga0097621_1002603831 356
656 3300006358 Ga0068871_100052867 Ga0068871_1000528674 356
657 3300006881 Ga0068865_100022585 Ga0068865_1000225854 356
658 3300006931 Ga0097620_100025360 Ga0097620_1000253604 356
659 3300009093 Ga0105240_10108444 Ga0105240_101084442 356
660 3300009094 Ga0111539_10217044 Ga0111539_102170443 356
661 3300009098 Ga0105245_10132349 Ga0105245_101323491 356
662 3300009098 Ga0105245_10344290 Ga0105245_103442901 356
663 3300009101 Ga0105247_10301659 Ga0105247_103016591 356
664 3300009148 Ga0105243_10185032 Ga0105243_101850321 356
665 3300009174 Ga0105241_10007740 Ga0105241_100077407 356
666 3300009177 Ga0105248_10039933 Ga0105248_100399339 356
667 3300013104 Ga0157370_10388171 Ga0157370_103881711 356
668 3300013105 Ga0157369_10002142 Ga0157369_100021429 356
669 3300013297 Ga0157378_10059956 Ga0157378_100599565 356
670 3300013297 Ga0157378_10079526 Ga0157378_100795263 356
671 3300013308 Ga0157375_10100991 Ga0157375_101009914 356
672 3300014325 Ga0163163_10055085 Ga0163163_100550858 356
673 3300014326 Ga0157380_10208905 Ga0157380_102089051 356
674 3300014497 Ga0182008_10084527 Ga0182008_100845271 356
675 3300014968 Ga0157379_10132872 Ga0157379_101328723 356
676 3300014969 Ga0157376_10071467 Ga0157376_100714674 356
677 3300017792 Ga0163161_10029345 Ga0163161_100293454 356
678 3300020069 Ga0197907_11502165 Ga0197907_115021653 356
679 3300020070 Ga0206356_10826571 Ga0206356_108265712 356
680 3300020070 Ga0206356_11574989 Ga0206356_115749895 356
681 3300020082 Ga0206353_11844595 Ga0206353_118445951 356
682 3300022467 Ga0224712_10033194 Ga0224712_100331943 356
683 3300025899 Ga0207642_10056390 Ga0207642_100563904 356
684 3300025900 Ga0207710_10142515 Ga0207710_101425151 356
685 3300025909 Ga0207705_10157196 Ga0207705_101571962 356
686 3300025912 Ga0207707_10323822 Ga0207707_103238222 356
687 3300025914 Ga0207671_10052810 Ga0207671_100528103 356
688 3300025915 Ga0207693_10062134 Ga0207693_100621342 356
689 3300025915 Ga0207693_10096857 Ga0207693_100968573 356
690 3300025916 Ga0207663_10057651 Ga0207663_100576511 356
691 3300025921 Ga0207652_10141597 Ga0207652_101415973 356
692 3300025923 Ga0207681_10085496 Ga0207681_100854964 356
693 3300025925 Ga0207650_10184737 Ga0207650_101847371 356
694 3300025926 Ga0207659_10162006 Ga0207659_101620063 356
695 3300025927 Ga0207687_10043412 Ga0207687_100434121 356
696 3300025927 Ga0207687_10219302 Ga0207687_102193023 356
697 3300025928 Ga0207700_10143507 Ga0207700_101435073 356
698 3300025928 Ga0207700_10220250 Ga0207700_102202503 356
699 3300025929 Ga0207664_10020210 Ga0207664_100202101 356
700 3300025929 Ga0207664_10115711 Ga0207664_101157112 356
701 3300025929 Ga0207664_10157829 Ga0207664_101578292 356
702 3300025935 Ga0207709_10074225 Ga0207709_100742253 356
703 3300025937 Ga0207669_10296743 Ga0207669_102967431 356
704 3300025938 Ga0207704_10029230 Ga0207704_100292305 356
705 3300025940 Ga0207691_10005009 Ga0207691_100050095 356
706 3300025941 Ga0207711_10043125 Ga0207711_100431254 356
707 3300025942 Ga0207689_10092850 Ga0207689_100928504 356
708 3300025944 Ga0207661_10075679 Ga0207661_100756791 356
709 3300025945 Ga0207679_10271027 Ga0207679_102710272 356
710 3300025949 Ga0207667_10141856 Ga0207667_101418562 356
711 3300025949 Ga0207667_10562850 Ga0207667_105628501 356
712 3300025981 Ga0207640_10140746 Ga0207640_101407461 356
713 3300026067 Ga0207678_10089986 Ga0207678_100899862 356
714 3300026078 Ga0207702_10117296 Ga0207702_101172962 356
715 3300026078 Ga0207702_10233586 Ga0207702_102335862 356
716 3300026089 Ga0207648_10011420 Ga0207648_100114209 356
717 3300026116 Ga0207674_10114503 Ga0207674_101145033 356
718 3300026116 Ga0207674_10165715 Ga0207674_101657154 356
719 3300026118 Ga0207675_100024268 Ga0207675_1000242687 356
720 3300026118 Ga0207675_100086010 Ga0207675_1000860103 356
721 3300026118 Ga0207675_100287015 Ga0207675_1002870153 356
722 3300026121 Ga0207683_10001830 Ga0207683_1000183021 356
723 3300026121 Ga0207683_10028456 Ga0207683_100284562 356
724 3300026142 Ga0207698_10277723 Ga0207698_102777231 356
725 3300027907 Ga0207428_10012892 Ga0207428_100128924 356
726 3300027907 Ga0207428_10066624 Ga0207428_100666243 356
727 3300027907 Ga0207428_10161924 Ga0207428_101619243 356
728 3300028381 Ga0268264_10222192 Ga0268264_102221921 356
729 3300028666 Ga0265336_10019559 Ga0265336_100195594 356
730 3300028800 Ga0265338_10017007 Ga0265338_100170073 356
731 3300031238 Ga0265332_10008679 Ga0265332_100086795 356
732 3300031241 Ga0265325_10067502 Ga0265325_100675022 356
733 3300031249 Ga0265339_10002601 Ga0265339_100026016 356
734 3300031251 Ga0265327_10068147 Ga0265327_100681472 356
735 3300031344 Ga0265316_10068157 Ga0265316_100681573 356
736 3300031595 Ga0265313_10030584 Ga0265313_100305842 356
737 3300031711 Ga0265314_10019069 Ga0265314_100190692 356
738 3300035112 Ga0373932_0011944 Ga0373932_0011944_641_1714 356
739 3300035241 Ga0373961_0006199 Ga0373961_0006199_27_1100 356
740 3300035241 Ga0373961_0016909 Ga0373961_0016909_352_1425 356
741 3300035242 Ga0373962_0043643 Ga0373962_0043643_68_1141 356
742 3300035691 Ga0373931_0023272 Ga0373931_0023272_1980_3053 356
743 3300039438 Ga0436360_0119211 Ga0436360_0119211_17_1087 356
744 3300044684 Ga0466966_0078134 Ga0466966_0078134_946_2022 356
745 3300044694 Ga0466963_0005430 Ga0466963_0005430_694_1776 356
746 3300044694 Ga0466963_0121817 Ga0466963_0121817_582_1655 356
747 3300044719 Ga0466971_0013595 Ga0466971_0013595_1456_2529 356
748 3300045049 Ga0466959_0142998 Ga0466959_0142998_286_1362 356
749 3300045976 Ga0466967_0015391 Ga0466967_0015391_4829_5902 356
750 3300045976 Ga0466967_0040602 Ga0466967_0040602_2729_3835 356
751 3300045976 Ga0466967_0204882 Ga0466967_0204882_221_1294 356
752 3300048903 Ga0496100_0034267 Ga0496100_0034267_594_1667 356
753 3300048903 Ga0496100_0172339 Ga0496100_0172339_441_1514 356
754 3300048904 Ga0496101_0001319 Ga0496101_0001319_3759_4832 356
755 3300048904 Ga0496101_0096503 Ga0496101_0096503_470_1543 356
756 3300048905 Ga0496102_0002028 Ga0496102_0002028_4660_5733 356
757 3300048906 Ga0496103_0028176 Ga0496103_0028176_2148_3221 356
758 3300048907 Ga0496104_0050038 Ga0496104_0050038_1836_2909 356
759 3300048907 Ga0496104_0175203 Ga0496104_0175203_535_1608 356
760 3300048907 Ga0496104_0232332 Ga0496104_0232332_349_1422 356
761 3300048908 Ga0496105_0021711 Ga0496105_0021711_3654_4727 356
762 3300048908 Ga0496105_0093458 Ga0496105_0093458_1189_2262 356
763 3300048909 Ga0496106_0012413 Ga0496106_0012413_702_1775 356
764 3300048910 Ga0496107_0037931 Ga0496107_0037931_238_1311 356
765 3300048911 Ga0496108_0009997 Ga0496108_0009997_4881_5954 356
766 3300048911 Ga0496108_0047867 Ga0496108_0047867_1810_2883 356
767 3300048912 Ga0496109_0001324 Ga0496109_0001324_517_1590 356
768 3300048912 Ga0496109_0035256 Ga0496109_0035256_1711_2784 356
769 3300048913 Ga0496110_0060428 Ga0496110_0060428_1553_2626 356
770 3300048913 Ga0496110_0100503 Ga0496110_0100503_1427_2500 356
771 3300048914 Ga0496111_0109252 Ga0496111_0109252_663_1736 356
772 3300048914 Ga0496111_0110935 Ga0496111_0110935_516_1589 356
773 3300048915 Ga0496112_0025795 Ga0496112_0025795_4404_5477 356
774 3300048916 Ga0496113_0142609 Ga0496113_0142609_128_1201 356
775 3300048917 Ga0496114_0172138 Ga0496114_0172138_511_1584 356
776 3300048918 Ga0496115_0040254 Ga0496115_0040254_1939_3012 356
777 3300049568 Ga0501031_0038228 Ga0501031_0038228_1069_2142 356
778 3300049570 Ga0501033_0174724 Ga0501033_0174724_321_1394 356
779 3300049571 Ga0501034_0169105 Ga0501034_0169105_916_1989 356
780 3300049573 Ga0501037_0051496 Ga0501037_0051496_1513_2586 356
781 3300049575 Ga0501039_0014271 Ga0501039_0014271_3837_4910 356
782 3300049575 Ga0501039_0045732 Ga0501039_0045732_297_1370 356
783 3300049576 Ga0501040_0028718 Ga0501040_0028718_2259_3332 356
784 3300049576 Ga0501040_0036298 Ga0501040_0036298_919_1992 356
785 3300049577 Ga0501041_0167483 Ga0501041_0167483_228_1301 356
786 3300049578 Ga0501042_0168670 Ga0501042_0168670_22_1098 356
787 3300049578 Ga0501042_0286175 Ga0501042_0286175_68_1141 356
788 3300049579 Ga0501043_0181787 Ga0501043_0181787_540_1613 356
789 3300049580 Ga0501046_0062402 Ga0501046_0062402_328_1401 356
790 3300049582 Ga0501048_0122263 Ga0501048_0122263_209_1282 356
791 3300049583 Ga0501067_0001281 Ga0501067_0001281_7466_8548 356
792 3300049584 Ga0501068_0016027 Ga0501068_0016027_2421_3494 356
793 3300049585 Ga0501069_0002079 Ga0501069_0002079_1657_2739 356
794 3300049586 Ga0501070_0294739 Ga0501070_0294739_142_1215 356
795 3300049587 Ga0501071_0003379 Ga0501071_0003379_780_1853 356
796 3300049588 Ga0501072_0009939 Ga0501072_0009939_1227_2300 356
797 3300049589 Ga0501073_0153558 Ga0501073_0153558_297_1370 356
798 3300049590 Ga0501074_0015063 Ga0501074_0015063_2220_3293 356
799 3300049591 Ga0501075_0011316 Ga0501075_0011316_3540_4613 356
800 3300049591 Ga0501075_0043575 Ga0501075_0043575_1351_2424 356
801 3300049591 Ga0501075_0187805 Ga0501075_0187805_272_1348 356
802 3300049592 Ga0501076_0196317 Ga0501076_0196317_170_1243 356
803 3300049741 Ga0501079_0048852 Ga0501079_0048852_1527_2600 356
804 3300049742 Ga0501080_0033454 Ga0501080_0033454_1184_2257 356
805 3300049743 Ga0501081_0013013 Ga0501081_0013013_2071_3144 356
806 3300049743 Ga0501081_0025770 Ga0501081_0025770_555_1628 356
807 3300049822 Ga0501035_0081862 Ga0501035_0081862_1368_2441 356
808 3300049824 Ga0501045_0017057 Ga0501045_0017057_3835_4908 356
809 3300050511 nmdc:mga08y16_123250_c1 nmdc:mga08y16_123250_c1_302_1384 356
810 3300050511 nmdc:mga08y16_168278_c1 nmdc:mga08y16_168278_c1_181_1257 356
811 3300050511 nmdc:mga08y16_25095_c1 nmdc:mga08y16_25095_c1_3305_4378 356
812 3300050515 nmdc:mga0a205_122740_c1 nmdc:mga0a205_122740_c1_744_1817 356
813 3300054114 Ga0501084_0035499 Ga0501084_0035499_2154_3227 356
814 3300054114 Ga0501084_0052581 Ga0501084_0052581_517_1590 356
815 3300059505 Ga0587083_0025450 Ga0587083_0025450_46_1119 356
816 3300060353 Ga0501082_0060438 Ga0501082_0060438_1675_2748 356
817 3300003659 JGI25404J52841_10019399 JGI25404J52841_100193992 357
818 3300005327 Ga0070658_10015018 Ga0070658_100150181 357
819 3300005329 Ga0070683_100019430 Ga0070683_1000194301 357
820 3300005330 Ga0070690_100086932 Ga0070690_1000869322 357
821 3300005336 Ga0070680_100011868 Ga0070680_1000118686 357
822 3300005337 Ga0070682_100087443 Ga0070682_1000874432 357
823 3300005338 Ga0068868_100012174 Ga0068868_1000121742 357
824 3300005339 Ga0070660_100050468 Ga0070660_1000504685 357
825 3300005339 Ga0070660_100129479 Ga0070660_1001294792 357
826 3300005341 Ga0070691_10020246 Ga0070691_100202462 357
827 3300005341 Ga0070691_10035697 Ga0070691_100356972 357
828 3300005347 Ga0070668_100089427 Ga0070668_1000894273 357
829 3300005353 Ga0070669_100116168 Ga0070669_1001161683 357
830 3300005356 Ga0070674_100043947 Ga0070674_1000439473 357
831 3300005356 Ga0070674_100175630 Ga0070674_1001756302 357
832 3300005365 Ga0070688_100177876 Ga0070688_1001778761 357
833 3300005366 Ga0070659_100000080 Ga0070659_10000008060 357
834 3300005438 Ga0070701_10061840 Ga0070701_100618402 357
835 3300005440 Ga0070705_100011226 Ga0070705_1000112266 357
836 3300005441 Ga0070700_100011512 Ga0070700_1000115122 357
837 3300005441 Ga0070700_100024380 Ga0070700_1000243802 357
838 3300005444 Ga0070694_100036445 Ga0070694_1000364454 357
839 3300005445 Ga0070708_100007570 Ga0070708_1000075704 357
840 3300005456 Ga0070678_100234039 Ga0070678_1002340392 357
841 3300005456 Ga0070678_100368691 Ga0070678_1003686911 357
842 3300005458 Ga0070681_10005563 Ga0070681_1000556316 357
843 3300005458 Ga0070681_10048436 Ga0070681_100484364 357
844 3300005458 Ga0070681_10106009 Ga0070681_101060093 357
845 3300005459 Ga0068867_100147885 Ga0068867_1001478852 357
846 3300005466 Ga0070685_10047068 Ga0070685_100470681 357
847 3300005518 Ga0070699_100085358 Ga0070699_1000853582 357
848 3300005530 Ga0070679_100043990 Ga0070679_1000439905 357
849 3300005535 Ga0070684_100051855 Ga0070684_1000518554 357
850 3300005539 Ga0068853_100196714 Ga0068853_1001967142 357
851 3300005544 Ga0070686_100015313 Ga0070686_1000153134 357
852 3300005545 Ga0070695_100028559 Ga0070695_1000285594 357
853 3300005546 Ga0070696_100022477 Ga0070696_1000224774 357
854 3300005547 Ga0070693_100016564 Ga0070693_1000165642 357
855 3300005549 Ga0070704_100065782 Ga0070704_1000657823 357
856 3300005563 Ga0068855_100108032 Ga0068855_1001080323 357
857 3300005563 Ga0068855_100436688 Ga0068855_1004366882 357
858 3300005578 Ga0068854_100045419 Ga0068854_1000454194 357
859 3300005578 Ga0068854_100250098 Ga0068854_1002500982 357
860 3300005615 Ga0070702_100015335 Ga0070702_1000153355 357
861 3300005615 Ga0070702_100039812 Ga0070702_1000398121 357
862 3300005616 Ga0068852_100042171 Ga0068852_1000421713 357
863 3300005840 Ga0068870_10022453 Ga0068870_100224532 357
864 3300005937 Ga0081455_10023080 Ga0081455_100230804 357
865 3300005983 Ga0081540_1002691 Ga0081540_100269112 357
866 3300005983 Ga0081540_1015448 Ga0081540_10154481 357
867 3300005983 Ga0081540_1016680 Ga0081540_10166804 357
868 3300006058 Ga0075432_10018462 Ga0075432_100184621 357
869 3300006163 Ga0070715_10009629 Ga0070715_100096293 357
870 3300006847 Ga0075431_100021201 Ga0075431_1000212016 357
871 3300006871 Ga0075434_100415876 Ga0075434_1004158761 357
872 3300006881 Ga0068865_100012987 Ga0068865_1000129876 357
873 3300006881 Ga0068865_100014363 Ga0068865_1000143636 357
874 3300006914 Ga0075436_100130757 Ga0075436_1001307571 357
875 3300007076 Ga0075435_100137004 Ga0075435_1001370041 357
876 3300009093 Ga0105240_10309329 Ga0105240_103093292 357
877 3300009094 Ga0111539_10252483 Ga0111539_102524833 357
878 3300009098 Ga0105245_10067593 Ga0105245_100675933 357
879 3300009147 Ga0114129_10082542 Ga0114129_100825425 357
880 3300009147 Ga0114129_10122685 Ga0114129_101226854 357
881 3300009148 Ga0105243_10028730 Ga0105243_100287304 357
882 3300009148 Ga0105243_10100357 Ga0105243_101003573 357
883 3300009148 Ga0105243_10317989 Ga0105243_103179892 357
884 3300009553 Ga0105249_10116847 Ga0105249_101168472 357
885 3300010375 Ga0105239_10134732 Ga0105239_101347323 357
886 3300010375 Ga0105239_10150823 Ga0105239_101508232 357
887 3300013102 Ga0157371_10110462 Ga0157371_101104623 357
888 3300013105 Ga0157369_10010968 Ga0157369_100109687 357
889 3300013307 Ga0157372_10048986 Ga0157372_100489864 357
890 3300013308 Ga0157375_10130990 Ga0157375_101309904 357
891 3300014325 Ga0163163_10113274 Ga0163163_101132743 357
892 3300014326 Ga0157380_10008142 Ga0157380_100081427 357
893 3300014326 Ga0157380_10076617 Ga0157380_100766173 357
894 3300014326 Ga0157380_10175687 Ga0157380_101756872 357
895 3300014968 Ga0157379_10020906 Ga0157379_100209065 357
896 3300014969 Ga0157376_10268485 Ga0157376_102684851 357
897 3300020069 Ga0197907_10465623 Ga0197907_104656233 357
898 3300020069 Ga0197907_10844542 Ga0197907_108445421 357
899 3300020070 Ga0206356_11372788 Ga0206356_113727883 357
900 3300020075 Ga0206349_1949934 Ga0206349_19499342 357
901 3300020078 Ga0206352_10699679 Ga0206352_106996791 357
902 3300020081 Ga0206354_10684124 Ga0206354_106841248 357
903 3300020082 Ga0206353_10083848 Ga0206353_100838482 357
904 3300020082 Ga0206353_11523222 Ga0206353_115232226 357
905 3300022467 Ga0224712_10054154 Ga0224712_100541543 357
906 3300025912 Ga0207707_10077434 Ga0207707_100774343 357
907 3300025917 Ga0207660_10056829 Ga0207660_100568291 357
908 3300025918 Ga0207662_10023043 Ga0207662_100230433 357
909 3300025919 Ga0207657_10000054 Ga0207657_1000005429 357
910 3300025919 Ga0207657_10100735 Ga0207657_101007353 357
911 3300025919 Ga0207657_10174614 Ga0207657_101746143 357
912 3300025920 Ga0207649_10039292 Ga0207649_100392925 357
913 3300025923 Ga0207681_10003168 Ga0207681_1000316812 357
914 3300025923 Ga0207681_10122434 Ga0207681_101224343 357
915 3300025926 Ga0207659_10094951 Ga0207659_100949513 357
916 3300025927 Ga0207687_10085567 Ga0207687_100855673 357
917 3300025932 Ga0207690_10000126 Ga0207690_1000012613 357
918 3300025935 Ga0207709_10151080 Ga0207709_101510802 357
919 3300025941 Ga0207711_10188004 Ga0207711_101880041 357
920 3300025942 Ga0207689_10153100 Ga0207689_101531002 357
921 3300025944 Ga0207661_10006480 Ga0207661_100064806 357
922 3300025949 Ga0207667_10285976 Ga0207667_102859761 357
923 3300025961 Ga0207712_10155757 Ga0207712_101557572 357
924 3300025972 Ga0207668_10083758 Ga0207668_100837582 357
925 3300025981 Ga0207640_10293785 Ga0207640_102937851 357
926 3300026023 Ga0207677_10095658 Ga0207677_100956581 357
927 3300026075 Ga0207708_10002859 Ga0207708_100028596 357
928 3300026075 Ga0207708_10022225 Ga0207708_100222253 357
929 3300026089 Ga0207648_10003572 Ga0207648_1000357217 357
930 3300026089 Ga0207648_10147193 Ga0207648_101471932 357
931 3300026118 Ga0207675_100007251 Ga0207675_1000072514 357
932 3300026121 Ga0207683_10054512 Ga0207683_100545124 357
933 3300026121 Ga0207683_10095111 Ga0207683_100951112 357
934 3300027907 Ga0207428_10023615 Ga0207428_100236154 357
935 3300028800 Ga0265338_10004855 Ga0265338_1000485512 357
936 3300031251 Ga0265327_10030642 Ga0265327_100306424 357
937 3300031548 Ga0307408_100119125 Ga0307408_1001191252 357
938 3300031852 Ga0307410_10133577 Ga0307410_101335772 357
939 3300031995 Ga0307409_100106203 Ga0307409_1001062032 357
940 3300032005 Ga0307411_10181397 Ga0307411_101813972 357
941 3300032126 Ga0307415_100057706 Ga0307415_1000577062 357
942 3300035116 Ga0373945_0006781 Ga0373945_0006781_1005_2162 357
943 3300035116 Ga0373945_0012851 Ga0373945_0012851_1475_2551 357
944 3300035170 Ga0373943_0004986 Ga0373943_0004986_540_1697 357
945 3300035170 Ga0373943_0009984 Ga0373943_0009984_2907_3983 357
946 3300035171 Ga0373946_0004447 Ga0373946_0004447_583_1740 357
947 3300035725 Ga0373947_0000849 Ga0373947_0000849_1135_2211 357
948 3300035725 Ga0373947_0001085 Ga0373947_0001085_7579_8736 357
949 3300037068 Ga0373925_0010210 Ga0373925_0010210_1356_2513 357
950 3300037068 Ga0373925_0321590 Ga0373925_0321590_15_1091 357
951 3300037312 Ga0395899_0019784 Ga0395899_0019784_1854_2930 357
952 3300037418 Ga0395900_0040417 Ga0395900_0040417_1836_2912 357
953 3300037418 Ga0395900_0220606 Ga0395900_0220606_254_1330 357
954 3300037466 Ga0395898_0060561 Ga0395898_0060561_764_1840 357
955 3300042005 Ga0439448_0054022 Ga0439448_0054022_47_1123 357
956 3300042157 Ga0439458_0006053 Ga0439458_0006053_226_1302 357
957 3300042435 Ga0439434_0027177 Ga0439434_0027177_81_1157 357
958 3300044694 Ga0466963_0000006 Ga0466963_0000006_29397_30470 357
959 3300044694 Ga0466963_0012811 Ga0466963_0012811_685_1758 357
960 3300044719 Ga0466971_0070273 Ga0466971_0070273_473_1546 357
961 3300044735 Ga0466968_0000363 Ga0466968_0000363_9048_10121 357
962 3300044901 Ga0466960_0006327 Ga0466960_0006327_1866_2942 357
963 3300045051 Ga0451576_0016035 Ga0451576_0016035_231_1307 357
964 3300045051 Ga0451576_0449104 Ga0451576_0449104_114_1187 357
965 3300045836 Ga0466958_0008410 Ga0466958_0008410_2522_3595 357
966 3300045976 Ga0466967_0000151 Ga0466967_0000151_16230_17303 357
967 3300045976 Ga0466967_0028487 Ga0466967_0028487_660_1733 357
968 3300045976 Ga0466967_0032263 Ga0466967_0032263_71_1144 357
969 3300045976 Ga0466967_0053109 Ga0466967_0053109_452_1525 357
970 3300046455 Ga0495603_0000747 Ga0495603_0000747_16669_17826 357
971 3300046455 Ga0495603_0155901 Ga0495603_0155901_160_1242 357
972 3300046459 Ga0495629_0028291 Ga0495629_0028291_1094_2170 357
973 3300046461 Ga0495641_0000806 Ga0495641_0000806_11952_13028 357
974 3300046461 Ga0495641_0001759 Ga0495641_0001759_13169_14326 357
975 3300046462 Ga0495651_0040320 Ga0495651_0040320_1610_2686 357
976 3300046472 Ga0495580_0066821 Ga0495580_0066821_166_1323 357
977 3300046473 Ga0495582_0000316 Ga0495582_0000316_25374_26450 357
978 3300046473 Ga0495582_0060948 Ga0495582_0060948_662_1819 357
979 3300046475 Ga0495639_0001521 Ga0495639_0001521_85_1161 357
980 3300046476 Ga0495662_0036169 Ga0495662_0036169_992_2068 357
981 3300046499 Ga0495594_0002313 Ga0495594_0002313_7304_8461 357
982 3300046500 Ga0495596_0030208 Ga0495596_0030208_275_1351 357
983 3300046511 Ga0495608_0096853 Ga0495608_0096853_50_1126 357
984 3300046516 Ga0495628_0024213 Ga0495628_0024213_1610_2686 357
985 3300046516 Ga0495628_0072630 Ga0495628_0072630_1199_2278 357
986 3300046517 Ga0495630_0026133 Ga0495630_0026133_1936_3012 357
987 3300046517 Ga0495630_0126727 Ga0495630_0126727_348_1424 357
988 3300046526 Ga0495666_0003513 Ga0495666_0003513_4061_5137 357
989 3300046526 Ga0495666_0009326 Ga0495666_0009326_559_1716 357
990 3300046531 Ga0495665_0000308 Ga0495665_0000308_14421_15497 357
991 3300046533 Ga0495640_0022519 Ga0495640_0022519_1227_2303 357
992 3300046558 Ga0495633_0114384 Ga0495633_0114384_67_1140 357
993 3300046559 Ga0495667_0012635 Ga0495667_0012635_1123_2199 357
994 3300046663 Ga0495635_0080722 Ga0495635_0080722_691_1767 357
995 3300046674 Ga0495588_0000321 Ga0495588_0000321_14655_15812 357
996 3300046675 Ga0495657_0025955 Ga0495657_0025955_500_1576 357
997 3300046678 Ga0495599_0193359 Ga0495599_0193359_153_1229 357
998 3300046681 Ga0495647_0004021 Ga0495647_0004021_3072_4148 357
999 3300046681 Ga0495647_0012909 Ga0495647_0012909_224_1381 357
1000 3300046683 Ga0495658_0008016 Ga0495658_0008016_280_1356 357
1001 3300046683 Ga0495658_0034717 Ga0495658_0034717_1570_2727 357
1002 3300046689 Ga0495613_0045132 Ga0495613_0045132_506_1582 357
1003 3300046691 Ga0495670_0122634 Ga0495670_0122634_209_1285 357
1004 3300046794 Ga0495589_0096842 Ga0495589_0096842_135_1217 357
1005 3300047315 Ga0495581_0000733 Ga0495581_0000733_16098_17174 357
1006 3300047317 Ga0495604_0233277 Ga0495604_0233277_107_1183 357
1007 3300047319 Ga0495674_0010079 Ga0495674_0010079_7819_8895 357
1008 3300047319 Ga0495674_0301701 Ga0495674_0301701_208_1284 357
1009 3300047321 Ga0495676_0002697 Ga0495676_0002697_14742_15818 357
1010 3300047321 Ga0495676_0002980 Ga0495676_0002980_14133_15290 357
1011 3300047322 Ga0495680_0000393 Ga0495680_0000393_39189_40265 357
1012 3300047322 Ga0495680_0016132 Ga0495680_0016132_1335_2414 357
1013 3300047322 Ga0495680_0176706 Ga0495680_0176706_373_1449 357
1014 3300047471 Ga0495684_0066717 Ga0495684_0066717_886_1962 357
1015 3300047471 Ga0495684_0070731 Ga0495684_0070731_38_1117 357
1016 3300048088 Ga0495602_0287342 Ga0495602_0287342_101_1180 357
1017 3300048089 Ga0495614_0039952 Ga0495614_0039952_856_1932 357
1018 3300048903 Ga0496100_0064548 Ga0496100_0064548_672_1748 357
1019 3300048904 Ga0496101_0019640 Ga0496101_0019640_275_1351 357
1020 3300048905 Ga0496102_0012042 Ga0496102_0012042_1265_2344 357
1021 3300048905 Ga0496102_0063890 Ga0496102_0063890_1801_2877 357
1022 3300048907 Ga0496104_0000776 Ga0496104_0000776_20426_21502 357
1023 3300048907 Ga0496104_0009484 Ga0496104_0009484_634_1713 357
1024 3300048907 Ga0496104_0132863 Ga0496104_0132863_605_1681 357
1025 3300048907 Ga0496104_0250590 Ga0496104_0250590_300_1379 357
1026 3300048908 Ga0496105_0000249 Ga0496105_0000249_13653_14729 357
1027 3300048908 Ga0496105_0005525 Ga0496105_0005525_7254_8333 357
1028 3300048908 Ga0496105_0027226 Ga0496105_0027226_2548_3627 357
1029 3300048909 Ga0496106_0038625 Ga0496106_0038625_2161_3240 357
1030 3300048909 Ga0496106_0100766 Ga0496106_0100766_235_1308 357
1031 3300048910 Ga0496107_0042859 Ga0496107_0042859_2070_3146 357
1032 3300048911 Ga0496108_0000716 Ga0496108_0000716_20356_21432 357
1033 3300048911 Ga0496108_0002434 Ga0496108_0002434_3015_4091 357
1034 3300048912 Ga0496109_0002927 Ga0496109_0002927_1294_2370 357
1035 3300048912 Ga0496109_0004184 Ga0496109_0004184_2862_3938 357
1036 3300048912 Ga0496109_0083202 Ga0496109_0083202_1426_2505 357
1037 3300048912 Ga0496109_0194649 Ga0496109_0194649_513_1592 357
1038 3300048913 Ga0496110_0000558 Ga0496110_0000558_21741_22817 357
1039 3300048913 Ga0496110_0017237 Ga0496110_0017237_3824_4900 357
1040 3300048913 Ga0496110_0091182 Ga0496110_0091182_443_1522 357
1041 3300048913 Ga0496110_0137870 Ga0496110_0137870_263_1339 357
1042 3300048914 Ga0496111_0000179 Ga0496111_0000179_3684_4760 357
1043 3300048914 Ga0496111_0003808 Ga0496111_0003808_716_1792 357
1044 3300048915 Ga0496112_0008702 Ga0496112_0008702_7985_9061 357
1045 3300048915 Ga0496112_0015407 Ga0496112_0015407_4073_5149 357
1046 3300048915 Ga0496112_0216337 Ga0496112_0216337_54_1130 357
1047 3300048916 Ga0496113_0000413 Ga0496113_0000413_2768_3844 357
1048 3300048916 Ga0496113_0165287 Ga0496113_0165287_414_1493 357
1049 3300048917 Ga0496114_0011972 Ga0496114_0011972_87_1163 357
1050 3300048917 Ga0496114_0012699 Ga0496114_0012699_3282_4358 357
1051 3300048917 Ga0496114_0013327 Ga0496114_0013327_1640_2719 357
1052 3300048917 Ga0496114_0035891 Ga0496114_0035891_2476_3552 357
1053 3300048917 Ga0496114_0037833 Ga0496114_0037833_1378_2469 357
1054 3300048918 Ga0496115_0009303 Ga0496115_0009303_5058_6134 357
1055 3300049568 Ga0501031_0000740 Ga0501031_0000740_12868_13944 357
1056 3300049568 Ga0501031_0152233 Ga0501031_0152233_318_1397 357
1057 3300049570 Ga0501033_0134424 Ga0501033_0134424_290_1366 357
1058 3300049572 Ga0501036_0034240 Ga0501036_0034240_537_1613 357
1059 3300049574 Ga0501038_0017811 Ga0501038_0017811_2177_3253 357
1060 3300049575 Ga0501039_0104493 Ga0501039_0104493_634_1710 357
1061 3300049576 Ga0501040_0117606 Ga0501040_0117606_287_1363 357
1062 3300049578 Ga0501042_0000668 Ga0501042_0000668_1418_2494 357
1063 3300049579 Ga0501043_0178660 Ga0501043_0178660_375_1451 357
1064 3300049582 Ga0501048_0004552 Ga0501048_0004552_9128_10204 357
1065 3300049585 Ga0501069_0069693 Ga0501069_0069693_321_1397 357
1066 3300049587 Ga0501071_0024150 Ga0501071_0024150_252_1328 357
1067 3300049588 Ga0501072_0124411 Ga0501072_0124411_458_1534 357
1068 3300049590 Ga0501074_0035860 Ga0501074_0035860_2409_3485 357
1069 3300049591 Ga0501075_0002962 Ga0501075_0002962_2981_4057 357
1070 3300049592 Ga0501076_0010903 Ga0501076_0010903_1870_2946 357
1071 3300049593 Ga0501077_0003762 Ga0501077_0003762_2146_3222 357
1072 3300049742 Ga0501080_0002437 Ga0501080_0002437_14957_16033 357
1073 3300049743 Ga0501081_0030650 Ga0501081_0030650_2004_3080 357
1074 3300049743 Ga0501081_0165079 Ga0501081_0165079_162_1241 357
1075 3300049744 Ga0501083_0150236 Ga0501083_0150236_65_1141 357
1076 3300049822 Ga0501035_0039172 Ga0501035_0039172_1989_3065 357
1077 3300049824 Ga0501045_0075657 Ga0501045_0075657_754_1833 357
1078 3300049824 Ga0501045_0109713 Ga0501045_0109713_124_1200 357
1079 3300050507 nmdc:mga05p37_116071_c1 nmdc:mga05p37_116071_c1_1527_2615 357
1080 3300050507 nmdc:mga05p37_93319_c1 nmdc:mga05p37_93319_c1_1009_2085 357
1081 3300050508 nmdc:mga09592_7671_c1 nmdc:mga09592_7671_c1_6084_7175 357
1082 3300050511 nmdc:mga08y16_40720_c1 nmdc:mga08y16_40720_c1_3155_4231 357
1083 3300050512 nmdc:mga0n895_160971_c1 nmdc:mga0n895_160971_c1_393_1481 357
1084 3300050512 nmdc:mga0n895_401910_c1 nmdc:mga0n895_401910_c1_264_1340 357
1085 3300050513 nmdc:mga0rr50_72907_c1 nmdc:mga0rr50_72907_c1_1496_2572 357
1086 3300053077 Ga0495601_0020968 Ga0495601_0020968_730_1806 357
1087 3300053084 Ga0495595_0024985 Ga0495595_0024985_271_1350 357
1088 3300054114 Ga0501084_0057405 Ga0501084_0057405_440_1516 357
1089 3300060353 Ga0501082_0052963 Ga0501082_0052963_419_1495 357
1090 3300002077 JGI24744J21845_10002884 JGI24744J21845_100028842 358
1091 3300002244 JGI24742J22300_10005646 JGI24742J22300_100056462 358
1092 3300005329 Ga0070683_100059336 Ga0070683_1000593363 358
1093 3300005330 Ga0070690_100029743 Ga0070690_1000297433 358
1094 3300005336 Ga0070680_100010728 Ga0070680_1000107283 358
1095 3300005336 Ga0070680_100046131 Ga0070680_1000461315 358
1096 3300005337 Ga0070682_100005203 Ga0070682_1000052036 358
1097 3300005337 Ga0070682_100038562 Ga0070682_1000385622 358
1098 3300005338 Ga0068868_100047501 Ga0068868_1000475013 358
1099 3300005339 Ga0070660_100007876 Ga0070660_1000078768 358
1100 3300005340 Ga0070689_100013742 Ga0070689_1000137426 358
1101 3300005345 Ga0070692_10017715 Ga0070692_100177153 358
1102 3300005355 Ga0070671_100043832 Ga0070671_1000438322 358
1103 3300005355 Ga0070671_100050442 Ga0070671_1000504422 358
1104 3300005356 Ga0070674_100172688 Ga0070674_1001726881 358
1105 3300005364 Ga0070673_100389175 Ga0070673_1003891751 358
1106 3300005365 Ga0070688_100008183 Ga0070688_1000081833 358
1107 3300005434 Ga0070709_10007139 Ga0070709_100071394 358
1108 3300005435 Ga0070714_100000036 Ga0070714_100000036108 358
1109 3300005435 Ga0070714_100048134 Ga0070714_1000481345 358
1110 3300005435 Ga0070714_100096340 Ga0070714_1000963402 358
1111 3300005435 Ga0070714_100477661 Ga0070714_1004776611 358
1112 3300005436 Ga0070713_100011491 Ga0070713_1000114915 358
1113 3300005437 Ga0070710_10001541 Ga0070710_100015419 358
1114 3300005437 Ga0070710_10007082 Ga0070710_100070823 358
1115 3300005438 Ga0070701_10014128 Ga0070701_100141281 358
1116 3300005439 Ga0070711_100003182 Ga0070711_1000031828 358
1117 3300005439 Ga0070711_100040213 Ga0070711_1000402133 358
1118 3300005441 Ga0070700_100001522 Ga0070700_1000015228 358
1119 3300005444 Ga0070694_100054439 Ga0070694_1000544393 358
1120 3300005455 Ga0070663_100007368 Ga0070663_1000073685 358
1121 3300005456 Ga0070678_100001885 Ga0070678_1000018858 358
1122 3300005458 Ga0070681_10012878 Ga0070681_100128786 358
1123 3300005459 Ga0068867_100002812 Ga0068867_1000028128 358
1124 3300005467 Ga0070706_100099647 Ga0070706_1000996473 358
1125 3300005467 Ga0070706_100158513 Ga0070706_1001585132 358
1126 3300005467 Ga0070706_100244060 Ga0070706_1002440601 358
1127 3300005468 Ga0070707_100026524 Ga0070707_1000265242 358
1128 3300005468 Ga0070707_100144453 Ga0070707_1001444533 358
1129 3300005471 Ga0070698_100100234 Ga0070698_1001002342 358
1130 3300005536 Ga0070697_100015513 Ga0070697_1000155135 358
1131 3300005539 Ga0068853_100010897 Ga0068853_1000108972 358
1132 3300005544 Ga0070686_100004420 Ga0070686_1000044207 358
1133 3300005546 Ga0070696_100005547 Ga0070696_1000055472 358
1134 3300005546 Ga0070696_100203906 Ga0070696_1002039061 358
1135 3300005547 Ga0070693_100002841 Ga0070693_1000028414 358
1136 3300005547 Ga0070693_100026239 Ga0070693_1000262392 358
1137 3300005548 Ga0070665_100105506 Ga0070665_1001055063 358
1138 3300005549 Ga0070704_100018433 Ga0070704_1000184332 358
1139 3300005614 Ga0068856_100019097 Ga0068856_1000190972 358
1140 3300005614 Ga0068856_100044239 Ga0068856_1000442392 358
1141 3300005615 Ga0070702_100006871 Ga0070702_1000068713 358
1142 3300005615 Ga0070702_100035391 Ga0070702_1000353913 358
1143 3300005616 Ga0068852_100072866 Ga0068852_1000728663 358
1144 3300005617 Ga0068859_100044009 Ga0068859_1000440092 358
1145 3300005718 Ga0068866_10004917 Ga0068866_100049173 358
1146 3300005841 Ga0068863_100105335 Ga0068863_1001053353 358
1147 3300005937 Ga0081455_10058043 Ga0081455_100580432 358
1148 3300005985 Ga0081539_10031156 Ga0081539_100311564 358
1149 3300006028 Ga0070717_10000006 Ga0070717_10000006256 358
1150 3300006028 Ga0070717_10042733 Ga0070717_100427333 358
1151 3300006038 Ga0075365_10220905 Ga0075365_102209051 358
1152 3300006163 Ga0070715_10012087 Ga0070715_100120873 358
1153 3300006163 Ga0070715_10025627 Ga0070715_100256272 358
1154 3300006173 Ga0070716_100004482 Ga0070716_1000044826 358
1155 3300006173 Ga0070716_100061862 Ga0070716_1000618622 358
1156 3300006175 Ga0070712_100078499 Ga0070712_1000784992 358
1157 3300006175 Ga0070712_100177010 Ga0070712_1001770102 358
1158 3300006237 Ga0097621_100268824 Ga0097621_1002688241 358
1159 3300006358 Ga0068871_100013932 Ga0068871_1000139322 358
1160 3300006358 Ga0068871_100102089 Ga0068871_1001020892 358
1161 3300006852 Ga0075433_10032954 Ga0075433_100329541 358
1162 3300006871 Ga0075434_100015804 Ga0075434_1000158049 358
1163 3300006871 Ga0075434_100030670 Ga0075434_1000306702 358
1164 3300006881 Ga0068865_100002447 Ga0068865_1000024471 358
1165 3300006914 Ga0075436_100025415 Ga0075436_1000254152 358
1166 3300006914 Ga0075436_100028376 Ga0075436_1000283762 358
1167 3300006931 Ga0097620_100044009 Ga0097620_1000440092 358
1168 3300007076 Ga0075435_100008824 Ga0075435_1000088245 358
1169 3300007076 Ga0075435_100010843 Ga0075435_1000108436 358
1170 3300007076 Ga0075435_100318621 Ga0075435_1003186211 358
1171 3300009098 Ga0105245_10067558 Ga0105245_100675582 358
1172 3300009098 Ga0105245_10076089 Ga0105245_100760893 358
1173 3300009101 Ga0105247_10009486 Ga0105247_100094866 358
1174 3300009147 Ga0114129_10002432 Ga0114129_1000243212 358
1175 3300009147 Ga0114129_10260979 Ga0114129_102609794 358
1176 3300009148 Ga0105243_10003824 Ga0105243_100038248 358
1177 3300009148 Ga0105243_10119321 Ga0105243_101193212 358
1178 3300009174 Ga0105241_10206493 Ga0105241_102064932 358
1179 3300009176 Ga0105242_10003423 Ga0105242_100034239 358
1180 3300009176 Ga0105242_10151211 Ga0105242_101512112 358
1181 3300009177 Ga0105248_10012945 Ga0105248_100129454 358
1182 3300009551 Ga0105238_10123948 Ga0105238_101239483 358
1183 3300009553 Ga0105249_10001792 Ga0105249_100017927 358
1184 3300010375 Ga0105239_10006563 Ga0105239_1000656316 358
1185 3300010375 Ga0105239_10421419 Ga0105239_104214192 358
1186 3300010375 Ga0105239_10537819 Ga0105239_105378191 358
1187 3300011119 Ga0105246_10143123 Ga0105246_101431231 358
1188 3300013296 Ga0157374_10014245 Ga0157374_100142452 358
1189 3300013296 Ga0157374_10027317 Ga0157374_100273177 358
1190 3300013297 Ga0157378_10004712 Ga0157378_100047126 358
1191 3300013306 Ga0163162_10005507 Ga0163162_100055079 358
1192 3300013308 Ga0157375_10190020 Ga0157375_101900201 358
1193 3300013308 Ga0157375_10436488 Ga0157375_104364882 358
1194 3300014325 Ga0163163_10213174 Ga0163163_102131742 358
1195 3300014326 Ga0157380_10259385 Ga0157380_102593851 358
1196 3300014969 Ga0157376_10064957 Ga0157376_100649573 358
1197 3300017792 Ga0163161_10087553 Ga0163161_100875531 358
1198 3300020082 Ga0206353_10676388 Ga0206353_106763882 358
1199 3300025898 Ga0207692_10025531 Ga0207692_100255313 358
1200 3300025898 Ga0207692_10055044 Ga0207692_100550443 358
1201 3300025899 Ga0207642_10016714 Ga0207642_100167143 358
1202 3300025905 Ga0207685_10006238 Ga0207685_100062383 358
1203 3300025906 Ga0207699_10009410 Ga0207699_100094103 358
1204 3300025910 Ga0207684_10236421 Ga0207684_102364212 358
1205 3300025910 Ga0207684_10395095 Ga0207684_103950951 358
1206 3300025912 Ga0207707_10009696 Ga0207707_100096966 358
1207 3300025913 Ga0207695_10164148 Ga0207695_101641482 358
1208 3300025915 Ga0207693_10006088 Ga0207693_100060889 358
1209 3300025915 Ga0207693_10011416 Ga0207693_100114163 358
1210 3300025916 Ga0207663_10001265 Ga0207663_100012654 358
1211 3300025916 Ga0207663_10005939 Ga0207663_100059394 358
1212 3300025917 Ga0207660_10018008 Ga0207660_100180087 358
1213 3300025917 Ga0207660_10054691 Ga0207660_100546912 358
1214 3300025921 Ga0207652_10011117 Ga0207652_100111176 358
1215 3300025922 Ga0207646_10020445 Ga0207646_100204457 358
1216 3300025922 Ga0207646_10024163 Ga0207646_100241638 358
1217 3300025924 Ga0207694_10215776 Ga0207694_102157762 358
1218 3300025926 Ga0207659_10354707 Ga0207659_103547072 358
1219 3300025927 Ga0207687_10070358 Ga0207687_100703582 358
1220 3300025927 Ga0207687_10175577 Ga0207687_101755772 358
1221 3300025928 Ga0207700_10013406 Ga0207700_100134064 358
1222 3300025928 Ga0207700_10233911 Ga0207700_102339111 358
1223 3300025929 Ga0207664_10000025 Ga0207664_10000025165 358
1224 3300025929 Ga0207664_10001134 Ga0207664_100011346 358
1225 3300025929 Ga0207664_10012867 Ga0207664_100128674 358
1226 3300025929 Ga0207664_10112820 Ga0207664_101128202 358
1227 3300025929 Ga0207664_10159922 Ga0207664_101599222 358
1228 3300025929 Ga0207664_10352047 Ga0207664_103520471 358
1229 3300025931 Ga0207644_10053241 Ga0207644_100532412 358
1230 3300025934 Ga0207686_10055329 Ga0207686_100553292 358
1231 3300025934 Ga0207686_10057027 Ga0207686_100570273 358
1232 3300025935 Ga0207709_10002377 Ga0207709_100023778 358
1233 3300025937 Ga0207669_10029874 Ga0207669_100298741 358
1234 3300025938 Ga0207704_10002110 Ga0207704_1000211010 358
1235 3300025939 Ga0207665_10000671 Ga0207665_100006716 358
1236 3300025939 Ga0207665_10084889 Ga0207665_100848892 358
1237 3300025941 Ga0207711_10284621 Ga0207711_102846212 358
1238 3300025944 Ga0207661_10007239 Ga0207661_100072395 358
1239 3300025961 Ga0207712_10049053 Ga0207712_100490531 358
1240 3300025972 Ga0207668_10112248 Ga0207668_101122482 358
1241 3300026023 Ga0207677_10041071 Ga0207677_100410713 358
1242 3300026067 Ga0207678_10028844 Ga0207678_100288441 358
1243 3300026075 Ga0207708_10001783 Ga0207708_100017837 358
1244 3300026078 Ga0207702_10006756 Ga0207702_100067568 358
1245 3300026078 Ga0207702_10029006 Ga0207702_100290062 358
1246 3300026088 Ga0207641_10193806 Ga0207641_101938063 358
1247 3300026089 Ga0207648_10002707 Ga0207648_100027078 358
1248 3300026121 Ga0207683_10000699 Ga0207683_1000069929 358
1249 3300026142 Ga0207698_10262924 Ga0207698_102629242 358
1250 3300028379 Ga0268266_10093455 Ga0268266_100934553 358
1251 3300028573 Ga0265334_10061592 Ga0265334_100615922 358
1252 3300028800 Ga0265338_10015278 Ga0265338_100152787 358
1253 3300028800 Ga0265338_10160824 Ga0265338_101608243 358
1254 3300031247 Ga0265340_10097559 Ga0265340_100975592 358
1255 3300031249 Ga0265339_10133517 Ga0265339_101335172 358
1256 3300031251 Ga0265327_10021309 Ga0265327_100213097 358
1257 3300031344 Ga0265316_10022315 Ga0265316_100223154 358
1258 3300031595 Ga0265313_10012800 Ga0265313_100128008 358
1259 3300031711 Ga0265314_10024769 Ga0265314_100247693 358
1260 3300031711 Ga0265314_10104756 Ga0265314_101047562 358
1261 3300031712 Ga0265342_10060378 Ga0265342_100603781 358
1262 3300031731 Ga0307405_10092653 Ga0307405_100926533 358
1263 3300037312 Ga0395899_0006013 Ga0395899_0006013_7567_8646 358
1264 3300037312 Ga0395899_0048736 Ga0395899_0048736_1717_2796 358
1265 3300037312 Ga0395899_0144673 Ga0395899_0144673_112_1188 358
1266 3300037418 Ga0395900_0002119 Ga0395900_0002119_3125_4204 358
1267 3300037418 Ga0395900_0079235 Ga0395900_0079235_1233_2312 358
1268 3300037418 Ga0395900_0082546 Ga0395900_0082546_2128_3204 358
1269 3300037418 Ga0395900_0141996 Ga0395900_0141996_1029_2108 358
1270 3300037418 Ga0395900_0183978 Ga0395900_0183978_406_1482 358
1271 3300037466 Ga0395898_0015334 Ga0395898_0015334_1747_2826 358
1272 3300037466 Ga0395898_0041701 Ga0395898_0041701_432_1508 358
1273 3300037466 Ga0395898_0050847 Ga0395898_0050847_1353_2432 358
1274 3300037466 Ga0395898_0052076 Ga0395898_0052076_2679_3755 358
1275 3300037466 Ga0395898_0065331 Ga0395898_0065331_2103_3182 358
1276 3300037471 Ga0395905_0011128 Ga0395905_0011128_2728_3807 358
1277 3300037471 Ga0395905_0011152 Ga0395905_0011152_511_1590 358
1278 3300037471 Ga0395905_0025839 Ga0395905_0025839_298_1377 358
1279 3300037471 Ga0395905_0088822 Ga0395905_0088822_1717_2796 358
1280 3300037471 Ga0395905_0131753 Ga0395905_0131753_1067_2143 358
1281 3300038443 Ga0395901_0004555 Ga0395901_0004555_9949_11025 358
1282 3300038443 Ga0395901_0005934 Ga0395901_0005934_9025_10104 358
1283 3300038443 Ga0395901_0012661 Ga0395901_0012661_40_1119 358
1284 3300038443 Ga0395901_0027505 Ga0395901_0027505_1617_2696 358
1285 3300038443 Ga0395901_0269273 Ga0395901_0269273_156_1232 358
1286 3300041406 Ga0439439_0000233 Ga0439439_0000233_4454_5533 358
1287 3300041999 Ga0439433_0001227 Ga0439433_0001227_3653_4732 358
1288 3300042002 Ga0439442_007793 Ga0439442_007793_574_1653 358
1289 3300042015 Ga0439462_0000620 Ga0439462_0000620_4699_5778 358
1290 3300046462 Ga0495651_0088568 Ga0495651_0088568_593_1672 358
1291 3300046474 Ga0495605_0041597 Ga0495605_0041597_504_1580 358
1292 3300046477 Ga0495664_0063511 Ga0495664_0063511_625_1704 358
1293 3300046491 Ga0495584_0035302 Ga0495584_0035302_218_1294 358
1294 3300046511 Ga0495608_0056012 Ga0495608_0056012_1127_2206 358
1295 3300046514 Ga0495618_0019626 Ga0495618_0019626_568_1647 358
1296 3300046518 Ga0495631_0104143 Ga0495631_0104143_99_1175 358
1297 3300046615 Ga0495656_0016105 Ga0495656_0016105_1452_2528 358
1298 3300046683 Ga0495658_0108505 Ga0495658_0108505_50_1126 358
1299 3300046691 Ga0495670_0144593 Ga0495670_0144593_77_1153 358
1300 3300046794 Ga0495589_0127306 Ga0495589_0127306_88_1164 358
1301 3300047315 Ga0495581_0032656 Ga0495581_0032656_1231_2307 358
1302 3300047319 Ga0495674_0169732 Ga0495674_0169732_313_1392 358
1303 3300047322 Ga0495680_0121685 Ga0495680_0121685_143_1222 358
1304 3300047471 Ga0495684_0018569 Ga0495684_0018569_1002_2081 358
1305 3300047471 Ga0495684_0091375 Ga0495684_0091375_116_1201 358
1306 3300048903 Ga0496100_0001838 Ga0496100_0001838_7484_8560 358
1307 3300048903 Ga0496100_0013914 Ga0496100_0013914_3346_4428 358
1308 3300048903 Ga0496100_0057468 Ga0496100_0057468_1134_2216 358
1309 3300048904 Ga0496101_0003443 Ga0496101_0003443_4233_5312 358
1310 3300048904 Ga0496101_0008890 Ga0496101_0008890_668_1744 358
1311 3300048904 Ga0496101_0011879 Ga0496101_0011879_1781_2863 358
1312 3300048904 Ga0496101_0014879 Ga0496101_0014879_1720_2802 358
1313 3300048904 Ga0496101_0018246 Ga0496101_0018246_663_1739 358
1314 3300048904 Ga0496101_0066628 Ga0496101_0066628_847_1923 358
1315 3300048905 Ga0496102_0009883 Ga0496102_0009883_282_1358 358
1316 3300048905 Ga0496102_0021038 Ga0496102_0021038_2188_3267 358
1317 3300048905 Ga0496102_0030802 Ga0496102_0030802_2598_3674 358
1318 3300048905 Ga0496102_0037399 Ga0496102_0037399_564_1640 358
1319 3300048905 Ga0496102_0038224 Ga0496102_0038224_1431_2513 358
1320 3300048906 Ga0496103_0005119 Ga0496103_0005119_6695_7771 358
1321 3300048906 Ga0496103_0050758 Ga0496103_0050758_305_1387 358
1322 3300048907 Ga0496104_0002034 Ga0496104_0002034_7836_8915 358
1323 3300048907 Ga0496104_0157816 Ga0496104_0157816_68_1144 358
1324 3300048907 Ga0496104_0318953 Ga0496104_0318953_139_1218 358
1325 3300048908 Ga0496105_0000050 Ga0496105_0000050_12444_13523 358
1326 3300048908 Ga0496105_0118081 Ga0496105_0118081_865_1941 358
1327 3300048908 Ga0496105_0315547 Ga0496105_0315547_81_1160 358
1328 3300048909 Ga0496106_0004053 Ga0496106_0004053_8304_9386 358
1329 3300048909 Ga0496106_0010325 Ga0496106_0010325_925_2007 358
1330 3300048909 Ga0496106_0028124 Ga0496106_0028124_1425_2501 358
1331 3300048909 Ga0496106_0041946 Ga0496106_0041946_246_1322 358
1332 3300048910 Ga0496107_0002007 Ga0496107_0002007_2849_3931 358
1333 3300048910 Ga0496107_0012651 Ga0496107_0012651_1721_2803 358
1334 3300048910 Ga0496107_0041450 Ga0496107_0041450_1864_2943 358
1335 3300048911 Ga0496108_0154491 Ga0496108_0154491_285_1364 358
1336 3300048912 Ga0496109_0002493 Ga0496109_0002493_7132_8211 358
1337 3300048913 Ga0496110_0079358 Ga0496110_0079358_1828_2907 358
1338 3300048914 Ga0496111_0003419 Ga0496111_0003419_4304_5383 358
1339 3300048914 Ga0496111_0016396 Ga0496111_0016396_3170_4246 358
1340 3300048915 Ga0496112_0042535 Ga0496112_0042535_253_1329 358
1341 3300048915 Ga0496112_0242627 Ga0496112_0242627_120_1196 358
1342 3300048917 Ga0496114_0003284 Ga0496114_0003284_5909_6985 358
1343 3300048917 Ga0496114_0004568 Ga0496114_0004568_4853_5935 358
1344 3300048917 Ga0496114_0005710 Ga0496114_0005710_4234_5313 358
1345 3300048917 Ga0496114_0007644 Ga0496114_0007644_2788_3864 358
1346 3300048918 Ga0496115_0006641 Ga0496115_0006641_6662_7738 358
1347 3300048918 Ga0496115_0082242 Ga0496115_0082242_1421_2500 358
1348 3300049572 Ga0501036_0187002 Ga0501036_0187002_536_1615 358
1349 3300049576 Ga0501040_0091443 Ga0501040_0091443_450_1529 358
1350 3300049578 Ga0501042_0012127 Ga0501042_0012127_1935_3014 358
1351 3300049582 Ga0501048_0133068 Ga0501048_0133068_514_1593 358
1352 3300049587 Ga0501071_0142305 Ga0501071_0142305_336_1415 358
1353 3300049590 Ga0501074_0087881 Ga0501074_0087881_596_1675 358
1354 3300049592 Ga0501076_0058438 Ga0501076_0058438_322_1401 358
1355 3300049742 Ga0501080_0409535 Ga0501080_0409535_29_1108 358
1356 3300049824 Ga0501045_0067469 Ga0501045_0067469_812_1891 358
1357 3300050507 nmdc:mga05p37_172461_c1 nmdc:mga05p37_172461_c1_144_1220 358
1358 3300050507 nmdc:mga05p37_8517_c1 nmdc:mga05p37_8517_c1_828_1904 358
1359 3300050511 nmdc:mga08y16_302823_c1 nmdc:mga08y16_302823_c1_148_1227 358
1360 3300050512 nmdc:mga0n895_43470_c1 nmdc:mga0n895_43470_c1_3075_4151 358
1361 3300050512 nmdc:mga0n895_44397_c1 nmdc:mga0n895_44397_c1_1694_2770 358
1362 3300050512 nmdc:mga0n895_52992_c1 nmdc:mga0n895_52992_c1_271_1368 358
1363 3300050513 nmdc:mga0rr50_345306_c1 nmdc:mga0rr50_345306_c1_43_1119 358
1364 3300050514 nmdc:mga08x19_128590_c1 nmdc:mga08x19_128590_c1_231_1307 358
1365 3300050514 nmdc:mga08x19_93625_c1 nmdc:mga08x19_93625_c1_57_1133 358
1366 3300050515 nmdc:mga0a205_41861_c1 nmdc:mga0a205_41861_c1_2967_4043 358
1367 3300053085 Ga0495619_0035187 Ga0495619_0035187_1181_2260 358
1368 3300053085 Ga0495619_0066812 Ga0495619_0066812_1241_2320 358
1369 3300054114 Ga0501084_0065720 Ga0501084_0065720_1729_2808 358
1370 3300059424 Ga0590075_006978 Ga0590075_006978_392_1474 358
1371 3300059424 Ga0590075_007586 Ga0590075_007586_679_1761 358

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9242 2 355
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9118 2 355
8asl-assembly1.cif.gz_S rcii/psi complex, class 2 0.7449 35 341
6pg8-assembly2.cif.gz_B wdr5delta23 bound to (2-(3-phenylpropyl)-1h-imidazol-4-yl)methanol 0.7414 37 351
6ufx-assembly1.cif.gz_A wd repeat-containing protein 5 complexed with n-[(3,5-dimethoxyphenyl)methyl]-4'-fluoro-5-{[(2e)-2-imino-3-methyl-2,3-dihydro-1h-imidazol-1-yl]methyl}-2'-methyl[1,1'-biphenyl]-3-carboxamide (compound 13) 0.7413 6 351
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9042 1 355 2.130.10.10
af_A0A2R8PYI8_197_421_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7635 203 348 2.120.10.30
af_Q8WQB4_122_256_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7513 7 117 2.40.128.630
af_Q8IDZ2_478_587_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.745 7 114 2.130.10.10
af_A0A1D6LLW6_250_394_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7405 7 175 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A257WU66-F1-model_v4 Glycosyl hydrolase 0.9953 290 358 GO:0016787
AF-A0A1Q7UB65-F1-model_v4 Sortilin N-terminal domain-containing protein 0.9932 1 358 GO:0000272
GO:0010411
GO:0016798
AF-A0A7V9G8E3-F1-model_v4 Glycosyl hydrolase 0.9916 271 351
AF-A0A7W0N342-F1-model_v4 Exo-alpha-sialidase 0.9884 223 358 GO:0000272
GO:0010411
GO:0016798
AF-A0A537WT27-F1-model_v4 Exo-alpha-sialidase 0.9878 63 358 GO:0000272
GO:0010411
GO:0016798

Feature Viewer

pLDDT pTM Quality
93.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map