F493381

General Info

Members Datasets Scaffolds Average Seq Length
1367 627 1117 358

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000059|JGI25155J39150_100005937
Length 410
Sequence MRRGYDEPPLALGPEETSVRKAGAVTLFHRCSSMPAIRQNYFTFLGYLMQIFSTLLKMGAGLGLVAFTALGTPASVLAQTAGKPNVVILATGGTIAGAGASALNSATYAAAKVPVDKLLAGLPELANIANVKGEQVSQIASESFTNDNLMKLGKRVSALVKQADVDGIVITHGTDTLEETAYFLNLVIRTSKPIVVVGSMRPGTALSADGALNLFDAVSVAASKDAAGKGVLVTMNDEIQSGRDVTKTINIKTEAFKSQWGPLGMVVEGNNYWFRAPVKRHTAQSEFNIDDFDALAPVEIVYGYGNVPRTALDAVAKSGIKALIHGGTGNGSVADRIVPALQEVRAKGIQVVRSSRVPEGFVLRNAEQPDDKYDWVVAHDLNPQKARILAAVALTKNVDSKELQRIFWQY

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231024 Pseudomonas sp. GM84 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
24 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
25 2547132374 Acidovorax radicis N35 Isolate Unclassified
26 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
27 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
28 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
29 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
30 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
31 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
32 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
33 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
34 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
35 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
36 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
37 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
38 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
39 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
40 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
41 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
42 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
43 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
44 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
45 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
46 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
47 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
48 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
49 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
50 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
51 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
52 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
53 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
54 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
55 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
56 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
57 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
58 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
61 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
62 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
63 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
64 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
65 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
66 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
67 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
68 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
69 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
70 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
71 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
72 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
73 2643221570 Acidovorax sp. Root568 Isolate Unclassified
74 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
75 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
76 2643221596 Acidovorax sp. Root70 Isolate Unclassified
77 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
78 2643221609 Acidovorax sp. Root217 Isolate Unclassified
79 2643221611 Acidovorax sp. Root219 Isolate Unclassified
80 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
81 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
82 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
83 2643221652 Acidovorax sp. Root402 Isolate Unclassified
84 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
85 2643221656 Pelomonas sp. Root405 Isolate Unclassified
86 2643221658 Variovorax sp. Root411 Isolate Unclassified
87 2643221672 Variovorax sp. Root434 Isolate Unclassified
88 2643221683 Variovorax sp. Root473 Isolate Unclassified
89 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
90 2643221717 Acidovorax sp. Root267 Isolate Unclassified
91 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
92 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
93 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
94 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
95 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
96 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
97 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
98 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
99 2738541277 Variovorax sp. GV051 Isolate Unclassified
100 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
101 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
102 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
103 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
104 2738541307 Variovorax sp. GV008 Isolate Unclassified
105 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
106 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
107 2738543012 Acidovorax sp. CF301 Isolate Unclassified
108 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
109 2738543019 Variovorax sp. GV040 Isolate Unclassified
110 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
111 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
112 2765235841 Pseudomonas putida AA7 Isolate Unclassified
113 2773857670 Pseudomonas sp. 478 Isolate Unclassified
114 2773857673 Pseudomonas sp. 443 Isolate Unclassified
115 2784132063 Pseudomonas sp. 424 Isolate Unclassified
116 2784132072 Pseudomonas sp. 460 Isolate Unclassified
117 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
118 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
119 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
120 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
121 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
122 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
123 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
124 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
125 2816332133 Acidovorax radicis 2721A Isolate Unclassified
126 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
127 2818991446 Variovorax sp. 1180 Isolate Unclassified
128 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
129 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
130 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
131 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
132 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
133 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
134 2842677519 Variovorax sp. R-72495 Isolate Unclassified
135 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
136 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
137 2842733646 Variovorax sp. R-72446 Isolate Unclassified
138 2842747753 Variovorax sp. R-72060 Isolate Unclassified
139 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
140 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
141 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
142 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
143 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
144 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
145 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
146 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
147 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
148 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
149 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
150 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
151 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
152 2885198086 Variovorax sp. 679 Isolate Unclassified
153 2885211737 Variovorax sp. 553 Isolate Unclassified
154 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
155 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
156 2899924645 Variovorax sp. 369 Isolate Unclassified
157 2902330777 Methylobacterium sp. 2A Isolate Unclassified
158 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
159 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
160 2904456579 Variovorax sp. 2002 Isolate Unclassified
161 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
162 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
163 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
164 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
165 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
166 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
167 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
168 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
169 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
170 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
171 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
172 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
173 2928037797 Variovorax sp. 1126 Isolate Unclassified
174 2928044640 Variovorax sp. 1128 Isolate Unclassified
175 2928051484 Variovorax sp. 1133 Isolate Unclassified
176 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
177 2928070936 Variovorax gossypii 1167 Isolate Unclassified
178 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
179 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
180 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
181 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
182 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
183 2929520902 Variovorax beijingensis 502 Isolate Unclassified
184 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
185 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
186 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
187 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
188 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
189 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
190 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
191 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
192 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
193 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
194 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
195 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
196 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
197 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
198 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
199 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
200 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
201 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
202 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
203 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
204 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
205 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
206 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
207 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
208 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
209 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
210 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
211 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
212 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
213 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
214 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
215 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
216 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
217 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
218 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
219 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
220 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
221 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
222 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
223 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
224 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
225 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
226 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
227 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
228 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
229 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
230 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
231 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
232 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
233 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
234 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
235 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
236 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
237 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
238 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
239 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
240 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
241 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
242 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
243 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
244 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
245 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
246 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
247 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
248 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
249 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
250 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
251 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
252 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
253 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
254 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
255 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
256 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
257 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
258 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
259 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
260 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
261 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
262 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
263 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
264 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
265 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
266 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
267 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
268 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
269 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
270 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
271 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
272 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
273 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
274 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
275 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
276 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
277 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
278 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
279 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
280 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
281 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
282 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
283 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
284 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
285 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
286 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
287 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
288 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
289 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
290 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
291 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
292 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
293 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
294 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
295 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
296 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
297 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
298 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
299 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
300 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
301 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
302 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
303 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
304 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
305 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
306 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
307 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
308 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
309 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
310 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
311 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
312 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
313 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
314 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
315 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
316 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
317 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
318 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
319 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
320 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
321 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
322 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
323 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
324 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
325 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
326 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
327 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
328 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
329 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
330 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
331 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
332 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
333 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
334 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
341 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
342 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
344 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
345 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
346 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
349 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
350 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
351 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
352 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
353 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
354 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
357 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
359 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
361 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
362 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
397 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
398 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
399 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
400 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
401 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
402 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
403 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
405 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
406 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
407 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
408 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
409 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
410 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
411 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
412 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
413 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
414 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
415 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
416 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
417 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
418 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
419 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
420 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
421 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
422 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
423 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
424 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
425 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
426 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
427 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
428 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
429 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
430 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
431 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
432 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
433 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
434 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
435 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
436 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
437 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
438 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
439 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
440 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
441 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
442 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
443 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
444 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
445 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
446 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
447 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
448 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
449 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
450 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
451 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
452 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
453 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
454 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
455 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
456 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
457 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
458 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
459 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
460 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
461 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
462 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
463 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
464 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
465 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
466 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
467 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
468 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
469 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
470 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
471 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
472 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
473 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
474 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
475 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
476 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
477 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
478 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
479 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
480 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
481 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
482 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
483 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
484 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
485 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
486 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
487 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
488 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
489 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
490 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
491 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
492 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
493 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
494 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
495 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
496 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
497 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
498 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
499 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
500 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
501 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
502 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
503 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
504 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
505 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
506 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
507 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
508 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
509 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
510 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
511 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
512 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
513 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
514 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
515 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
516 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
517 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
518 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
519 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
520 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
521 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
522 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
523 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
524 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
525 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
526 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
527 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
528 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
529 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
530 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
531 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
532 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
533 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
534 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
535 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
536 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
537 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
538 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
539 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
540 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
541 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
542 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
543 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
544 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
545 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
546 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
547 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
548 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
549 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
550 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
551 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
552 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
553 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
554 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
555 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
556 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
557 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
558 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
559 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
560 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
561 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
562 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
563 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
564 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
567 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
568 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
569 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
570 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
571 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
572 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
573 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
574 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
575 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
576 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
577 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
578 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
579 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
580 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
581 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
582 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
583 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
584 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
585 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
586 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
587 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
588 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
589 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
590 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
591 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
592 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
593 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
594 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
595 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
596 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
597 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
598 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
599 639633007 Azoarcus olearius BH72 Isolate Unclassified
600 641522639 Methylobacterium sp. 4-46 Isolate Nodule
601 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
602 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
603 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
604 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
605 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
606 8052494512 Pseudomonas putida LD6 Isolate Unclassified
607 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
608 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
609 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
610 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
611 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
612 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
613 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
614 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
615 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
616 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
617 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
618 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
619 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
620 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
621 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
622 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
623 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
624 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
625 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
626 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
627 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.42
Metatranscriptomes 0.29
Isolates 18.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.78
Nodule 2.49
Rhizoplane 3.8
Rhizosphere 58.74
Stem 0
Stem Tuber 0
Unclassified 14.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_31 2124908027 Bacteria 35538
2 JGI24740J21852_10008234 3300001979 Bacteria 4172
3 JGI24740J21852_10012589 3300001979 Bacteria 3185
4 JGI24739J22299_10025539 3300001989 Bacteria 2077
5 JGI25155J39150_1000059 3300002704 Bacteria 72038
6 JGI25156J39149_1000081 3300002705 Bacteria 72221
7 JGI25162J39368_1000700 3300002737 Bacteria 23273
8 JGI25162J39368_1000873 3300002737 Bacteria 19739
9 JGI25154J39366_1000109 3300002738 Bacteria 72431
10 JGI25158J39367_1010820 3300002739 Bacteria 1226
11 JGI25157J39369_1000103 3300002741 Bacteria 72221
12 JGI25163J39215_1000641 3300002771 Bacteria 9461
13 JGI25164J39214_1000471 3300002772 Bacteria 20235
14 JGI25164J39214_1000566 3300002772 Bacteria 16711
15 JGI25152J39213_1001784 3300002773 Bacteria 8758
16 JGI25150J39212_1001005 3300002774 Bacteria 8758
17 JGI25150J39212_1007584 3300002774 Bacteria 2171
18 JGI25159J45721_1000488 3300002987 Bacteria 18147
19 JGI25159J45721_1001139 3300002987 Bacteria 11361
20 JGI25159J45721_1001874 3300002987 Bacteria 8411
21 JGI25159J45721_1005762 3300002987 Bacteria 3833
22 JGI25151J46595_10002071 3300003187 Bacteria 12502
23 JGI25151J46595_10002928 3300003187 Bacteria 9776
24 JGI25151J46595_10003438 3300003187 Bacteria 8758
25 JGI25151J46595_10010435 3300003187 Bacteria 4317
26 JGI25165J46597_1000822 3300003214 Bacteria 23273
27 JGI25165J46597_1000954 3300003214 Bacteria 19739
28 JGI25153J46596_10003506 3300003215 Bacteria 8758
29 JGI25153J46596_10018077 3300003215 Bacteria 2751
30 rootH1_10003336 3300003316 Bacteria 17481
31 rootL2_10028827 3300003322 Bacteria 19206
32 JGI25160J50197_1000431 3300003354 Bacteria 26412
33 JGI25160J50197_1001958 3300003354 Bacteria 9823
34 JGI25160J50197_1020225 3300003354 Bacteria 2015
35 JGI25161J50226_1000077 3300003374 Bacteria 83588
36 JGI25161J50226_1001009 3300003374 Bacteria 9823
37 JGI25161J50226_1001698 3300003374 Bacteria 6297
38 Ga0006562J51391_1068686 3300003578 Bacteria 6700
39 Ga0006562J51391_1068687 3300003578 Bacteria 5384
40 Ga0006562J51391_1103584 3300003578 Bacteria 1890
41 Ga0055538_1000066 3300003751 Bacteria 98557
42 Ga0055539_1000102 3300003752 Bacteria 98557
43 Ga0055533_1000110 3300003756 Bacteria 98557
44 Ga0055532_1000138 3300003758 Bacteria 71966
45 Ga0055525_1000458 3300003759 Bacteria 23141
46 Ga0055535_1000299 3300003761 Bacteria 50437
47 Ga0055542_1000328 3300003762 Bacteria 50437
48 Ga0055526_1003320 3300003771 Bacteria 10293
49 Ga0055526_1003553 3300003771 Bacteria 9823
50 Ga0055526_1004938 3300003771 Bacteria 7839
51 Ga0055537_1000478 3300003773 Bacteria 25051
52 Ga0055537_1000486 3300003773 Bacteria 24570
53 Ga0055537_1001368 3300003773 Bacteria 9809
54 Ga0055524_1000295 3300003775 Bacteria 47856
55 Ga0055524_1002182 3300003775 Bacteria 10293
56 Ga0055524_1002357 3300003775 Bacteria 9823
57 Ga0055536_1000765 3300003781 Bacteria 21417
58 Ga0055536_1001476 3300003781 Bacteria 14141
59 Ga0055536_1001638 3300003781 Bacteria 13321
60 Ga0055536_1001859 3300003781 Bacteria 12317
61 Ga0055536_1005320 3300003781 Bacteria 6328
62 Ga0055536_1006454 3300003781 Bacteria 5474
63 Ga0055536_1015196 3300003781 Bacteria 2650
64 Ga0055536_1016829 3300003781 Bacteria 2423
65 Ga0055534_1000391 3300003784 Bacteria 27312
66 Ga0055534_1000439 3300003784 Bacteria 24570
67 Ga0055534_1007685 3300003784 Bacteria 2533
68 Ga0055528_1000714 3300003790 Bacteria 23518
69 Ga0055528_1001893 3300003790 Bacteria 11896
70 Ga0055528_1002502 3300003790 Bacteria 9809
71 Ga0055528_1007065 3300003790 Bacteria 5018
72 Ga0055528_1019872 3300003790 Bacteria 2202
73 Ga0055530_10000201 3300003791 Bacteria 53689
74 Ga0055530_10000765 3300003791 Bacteria 26768
75 Ga0055530_10001083 3300003791 Bacteria 21417
76 Ga0055530_10001183 3300003791 Bacteria 20158
77 Ga0055530_10002956 3300003791 Bacteria 10254
78 Ga0055530_10031609 3300003791 Bacteria 1387
79 Ga0055540_1000139 3300003792 Bacteria 72664
80 Ga0055540_1000971 3300003792 Bacteria 18534
81 Ga0055540_1001293 3300003792 Bacteria 15174
82 Ga0055540_1002031 3300003792 Bacteria 11198
83 Ga0055540_1002297 3300003792 Bacteria 10278
84 Ga0055540_1003604 3300003792 Bacteria 7391
85 Ga0055540_1005987 3300003792 Bacteria 4930
86 Ga0055540_1015362 3300003792 Bacteria 2232
87 Ga0055540_1024097 3300003792 Bacteria 1518
88 Ga0055531_10000517 3300003794 Bacteria 34871
89 Ga0055531_10001255 3300003794 Bacteria 19206
90 Ga0055531_10003333 3300003794 Bacteria 10278
91 Ga0055531_10004286 3300003794 Bacteria 8758
92 Ga0055531_10042254 3300003794 Bacteria 1307
93 Ga0055541_1000068 3300003841 Bacteria 98557
94 Ga0055543_1000685 3300004625 Bacteria 17655
95 Ga0055543_1001285 3300004625 Bacteria 10324
96 Ga0055543_1001493 3300004625 Bacteria 9200
97 Ga0065165_1000692 3300005262 Bacteria 48092
98 Ga0065165_1012395 3300005262 Bacteria 3474
99 Ga0065165_1016127 3300005262 Bacteria 2812
100 Ga0065714_10000533 3300005288 Bacteria 5271
101 Ga0065714_10002575 3300005288 Bacteria 14178
102 Ga0065714_10005979 3300005288 Bacteria 6326
103 Ga0065714_10009063 3300005288 Bacteria 5307
104 Ga0065714_10026649 3300005288 Bacteria 1609
105 Ga0065714_10065679 3300005288 Bacteria 8848
106 Ga0065714_10068098 3300005288 Bacteria 4970
107 Ga0065714_10075654 3300005288 Bacteria 2881
108 Ga0065714_10077839 3300005288 Bacteria 2641
109 Ga0065714_10110456 3300005288 Bacteria 1485
110 Ga0065712_10000544 3300005290 Bacteria 10105
111 Ga0065712_10068148 3300005290 Bacteria 13861
112 Ga0065715_10119702 3300005293 Bacteria 2279
113 Ga0070670_100000684 3300005331 Bacteria 26322
114 Ga0070661_100001203 3300005344 Bacteria 18253
115 Ga0070669_100011343 3300005353 Bacteria 6325
116 Ga0070674_100003297 3300005356 Bacteria 9032
117 Ga0070673_100177201 3300005364 Bacteria 1823
118 Ga0070659_100205529 3300005366 Bacteria 1622
119 Ga0070667_100003893 3300005367 Bacteria 12676
120 Ga0070667_100140257 3300005367 Bacteria 2116
121 Ga0070662_100001183 3300005457 Bacteria 15990
122 Ga0070662_100006434 3300005457 Bacteria 7571
123 Ga0070662_100069938 3300005457 Bacteria 2585
124 Ga0068867_100111383 3300005459 Bacteria 2103
125 Ga0070706_100043070 3300005467 Bacteria 4171
126 Ga0068853_100026185 3300005539 Bacteria 4897
127 Ga0068853_100029071 3300005539 Bacteria 4655
128 Ga0070665_100116265 3300005548 Bacteria 2677
129 Ga0070664_100000485 3300005564 Bacteria 30116
130 Ga0070664_100080048 3300005564 Bacteria 2813
131 Ga0068857_100065437 3300005577 Bacteria 3232
132 Ga0068856_100064902 3300005614 Bacteria 3608
133 Ga0068852_100024127 3300005616 Bacteria 4911
134 Ga0068852_100078454 3300005616 Bacteria 2921
135 Ga0068859_100191343 3300005617 Bacteria 2130
136 Ga0068864_100031830 3300005618 Bacteria 4477
137 Ga0068851_10000175 3300005834 Bacteria 32300
138 Ga0068860_100447017 3300005843 Bacteria 1285
139 Ga0068862_100007521 3300005844 Bacteria 9026
140 Ga0068862_100259589 3300005844 Bacteria 1586
141 Ga0075365_10120912 3300006038 Bacteria 1806
142 Ga0075363_100021755 3300006048 Bacteria 3236
143 Ga0075363_100029076 3300006048 Bacteria 2850
144 Ga0075363_100058099 3300006048 Bacteria 2077
145 Ga0075363_100068069 3300006048 Bacteria 1930
146 Ga0075364_10009269 3300006051 Bacteria 5900
147 Ga0075364_10029994 3300006051 Bacteria 3490
148 Ga0075364_10049665 3300006051 Bacteria 2737
149 Ga0075432_10000456 3300006058 Bacteria 12076
150 Ga0075362_10000753 3300006177 Bacteria 9624
151 Ga0075362_10018867 3300006177 Bacteria 2861
152 Ga0075362_10080452 3300006177 Bacteria 1501
153 Ga0075367_10117140 3300006178 Bacteria 1639
154 Ga0075369_10011122 3300006186 Bacteria 3531
155 Ga0075366_10000612 3300006195 Bacteria 16757
156 Ga0075366_10000666 3300006195 Bacteria 16183
157 Ga0075366_10004969 3300006195 Bacteria 7174
158 Ga0075366_10013083 3300006195 Bacteria 4719
159 Ga0075366_10016384 3300006195 Bacteria 4259
160 Ga0075366_10016386 3300006195 Bacteria 4259
161 Ga0075366_10028404 3300006195 Bacteria 3283
162 Ga0075366_10084247 3300006195 Bacteria 1900
163 Ga0075366_10100843 3300006195 Bacteria 1732
164 Ga0097621_100364102 3300006237 Bacteria 1289
165 Ga0075370_10004610 3300006353 Bacteria 6725
166 Ga0075370_10007052 3300006353 Bacteria 5701
167 Ga0075370_10011070 3300006353 Bacteria 4730
168 Ga0075370_10012063 3300006353 Bacteria 4557
169 Ga0075370_10017611 3300006353 Bacteria 3863
170 Ga0068871_100138439 3300006358 Bacteria 2068
171 Ga0075434_100116254 3300006871 Bacteria 2688
172 Ga0068865_100328123 3300006881 Bacteria 1233
173 Ga0097620_100191347 3300006931 Bacteria 2130
174 Ga0099823_1000045 3300006944 Bacteria 60145
175 Ga0079104_1000451 3300006946 Bacteria 46572
176 Ga0079104_1001518 3300006946 Bacteria 15358
177 Ga0099826_10001915 3300006948 Bacteria 13037
178 Ga0099794_10060092 3300007265 Bacteria 1845
179 Ga0105251_10000603 3300009011 Bacteria 32958
180 Ga0105251_10002924 3300009011 Bacteria 12825
181 Ga0105251_10004088 3300009011 Bacteria 10215
182 Ga0105251_10005146 3300009011 Bacteria 8640
183 Ga0105251_10014391 3300009011 Bacteria 4375
184 Ga0105251_10019616 3300009011 Bacteria 3567
185 Ga0105251_10088355 3300009011 Bacteria 1426
186 Ga0105251_10121033 3300009011 Bacteria 1189
187 Ga0105244_10000913 3300009036 Bacteria 24959
188 Ga0105244_10001396 3300009036 Bacteria 19617
189 Ga0105244_10002283 3300009036 Bacteria 14562
190 Ga0105244_10002726 3300009036 Bacteria 13213
191 Ga0105244_10003570 3300009036 Bacteria 11050
192 Ga0105244_10003950 3300009036 Bacteria 10399
193 Ga0105244_10005280 3300009036 Bacteria 8616
194 Ga0105244_10016662 3300009036 Bacteria 4179
195 Ga0105244_10016941 3300009036 Bacteria 4135
196 Ga0105244_10017665 3300009036 Bacteria 4026
197 Ga0105244_10041198 3300009036 Bacteria 2394
198 Ga0105250_10000318 3300009092 Bacteria 37328
199 Ga0105250_10000453 3300009092 Bacteria 29480
200 Ga0105250_10000798 3300009092 Bacteria 18969
201 Ga0105250_10018637 3300009092 Bacteria 2810
202 Ga0105250_10067284 3300009092 Bacteria 1445
203 Ga0105240_10004595 3300009093 Bacteria 20920
204 Ga0105240_10006473 3300009093 Bacteria 17203
205 Ga0105240_10027286 3300009093 Bacteria 7478
206 Ga0105240_10122651 3300009093 Bacteria 3127
207 Ga0111539_10165425 3300009094 Bacteria 2586
208 Ga0114129_10033329 3300009147 Bacteria 7279
209 Ga0105243_10001964 3300009148 Bacteria 17519
210 Ga0105243_10002688 3300009148 Bacteria 14775
211 Ga0105243_10003156 3300009148 Bacteria 13519
212 Ga0105243_10004626 3300009148 Bacteria 10845
213 Ga0105243_10005878 3300009148 Bacteria 9505
214 Ga0105243_10050342 3300009148 Bacteria 3290
215 Ga0105243_10050893 3300009148 Bacteria 3274
216 Ga0105243_10106467 3300009148 Bacteria 2338
217 Ga0105243_10326843 3300009148 Bacteria 1399
218 Ga0105242_10001154 3300009176 Bacteria 20812
219 Ga0105242_10003311 3300009176 Bacteria 12543
220 Ga0105242_10003610 3300009176 Bacteria 12036
221 Ga0105248_10089700 3300009177 Bacteria 3461
222 Ga0105237_10000404 3300009545 Bacteria 61362
223 Ga0105237_10001782 3300009545 Bacteria 27845
224 Ga0105237_10007640 3300009545 Bacteria 11815
225 Ga0105237_10009474 3300009545 Bacteria 10431
226 Ga0105237_10097664 3300009545 Bacteria 2928
227 Ga0105238_10010667 3300009551 Bacteria 9228
228 Ga0105238_10010668 3300009551 Bacteria 9228
229 Ga0105239_10000316 3300010375 Bacteria 71183
230 Ga0105239_10001826 3300010375 Bacteria 27875
231 Ga0105239_10189182 3300010375 Bacteria 2304
232 Ga0105246_10000356 3300011119 Bacteria 24634
233 Ga0105246_10001149 3300011119 Bacteria 15343
234 Ga0105246_10005790 3300011119 Bacteria 7535
235 Ga0105246_10067584 3300011119 Bacteria 2504
236 Ga0105246_10193675 3300011119 Bacteria 1575
237 Ga0157345_1000071 3300012498 Bacteria 21085
238 Ga0157326_1001498 3300012513 Bacteria 2575
239 Ga0157373_10002465 3300013100 Bacteria 14101
240 Ga0157373_10020015 3300013100 Bacteria 4868
241 Ga0157373_10041850 3300013100 Bacteria 3276
242 Ga0157373_10045194 3300013100 Bacteria 3144
243 Ga0157373_10197565 3300013100 Bacteria 1418
244 Ga0157371_10000334 3300013102 Bacteria 60797
245 Ga0157371_10002004 3300013102 Bacteria 20138
246 Ga0157371_10024892 3300013102 Bacteria 4367
247 Ga0157371_10063988 3300013102 Bacteria 2607
248 Ga0157370_10012520 3300013104 Bacteria 8793
249 Ga0157370_10044736 3300013104 Bacteria 4252
250 Ga0157370_10053938 3300013104 Bacteria 3833
251 Ga0157370_10152121 3300013104 Unclassified 2153
252 Ga0157370_10207586 3300013104 Bacteria 1816
253 Ga0157369_10008448 3300013105 Bacteria 11812
254 Ga0157369_10010370 3300013105 Bacteria 10621
255 Ga0157369_10029284 3300013105 Bacteria 6086
256 Ga0157369_10066908 3300013105 Bacteria 3865
257 Ga0157369_10132270 3300013105 Bacteria 2643
258 Ga0157369_10211961 3300013105 Bacteria 2030
259 Ga0157369_10391164 3300013105 Bacteria 1443
260 Ga0157369_10392271 3300013105 Bacteria 1440
261 Ga0157378_10218865 3300013297 Bacteria 1809
262 Ga0163162_10010780 3300013306 Bacteria 8892
263 Ga0163162_10011888 3300013306 Bacteria 8492
264 Ga0163162_10042713 3300013306 Bacteria 4538
265 Ga0163162_10438395 3300013306 Bacteria 1439
266 Ga0163162_10496190 3300013306 Bacteria 1351
267 Ga0157372_10025090 3300013307 Bacteria 6478
268 Ga0157372_10072350 3300013307 Bacteria 3886
269 Ga0157372_10129042 3300013307 Bacteria 2908
270 Ga0157375_10040615 3300013308 Bacteria 4486
271 Ga0163163_10280482 3300014325 Bacteria 1718
272 Ga0182008_10000683 3300014497 Bacteria 24535
273 Ga0182008_10001357 3300014497 Bacteria 16609
274 Ga0182008_10001936 3300014497 Bacteria 13363
275 Ga0182008_10002949 3300014497 Bacteria 10472
276 Ga0182008_10005317 3300014497 Bacteria 7353
277 Ga0182008_10007114 3300014497 Bacteria 6197
278 Ga0182008_10011794 3300014497 Bacteria 4635
279 Ga0182008_10017319 3300014497 Bacteria 3739
280 Ga0182008_10020764 3300014497 Bacteria 3378
281 Ga0157376_10009486 3300014969 Bacteria 7069
282 Ga0157376_10012434 3300014969 Bacteria 6319
283 Ga0157376_10239932 3300014969 Bacteria 1688
284 Ga0182006_1000782 3300015261 Bacteria 21472
285 Ga0182006_1001695 3300015261 Bacteria 12875
286 Ga0182006_1002072 3300015261 Bacteria 11225
287 Ga0182006_1003567 3300015261 Bacteria 7932
288 Ga0182006_1006215 3300015261 Bacteria 5575
289 Ga0182006_1011878 3300015261 Bacteria 3816
290 Ga0182006_1025354 3300015261 Bacteria 2436
291 Ga0182006_1036329 3300015261 Bacteria 1959
292 Ga0182006_1083392 3300015261 Bacteria 1162
293 Ga0182007_10001773 3300015262 Bacteria 11308
294 Ga0182007_10026904 3300015262 Bacteria 1989
295 Ga0182005_1001332 3300015265 Bacteria 10084
296 Ga0183362_10012 3300015683 Bacteria 49008
297 Ga0163161_10000721 3300017792 Bacteria 26007
298 Ga0163161_10003617 3300017792 Bacteria 10845
299 Ga0163161_10008012 3300017792 Bacteria 7307
300 Ga0163161_10008553 3300017792 Bacteria 7078
301 Ga0163161_10012124 3300017792 Bacteria 5981
302 Ga0163161_10039086 3300017792 Bacteria 3405
303 Ga0163161_10073096 3300017792 Bacteria 2512
304 Ga0163161_10139054 3300017792 Bacteria 1838
305 Ga0163161_10150496 3300017792 Bacteria 1768
306 Ga0213872_10059729 3300021361 Bacteria 1725
307 Ga0213876_10047687 3300021384 Bacteria 2264
308 Ga0209435_100047 3300025206 Bacteria 92749
309 Ga0209435_101226 3300025206 Bacteria 3438
310 Ga0209760_100023 3300025207 Bacteria 159144
311 Ga0209760_100220 3300025207 Bacteria 25002
312 Ga0209436_111087 3300025208 Bacteria 1605
313 Ga0209784_100057 3300025224 Bacteria 167476
314 Ga0209566_100073 3300025225 Bacteria 167476
315 Ga0209674_100095 3300025226 Bacteria 167476
316 Ga0209672_100981 3300025228 Bacteria 12598
317 Ga0209147_100092 3300025229 Bacteria 167476
318 Ga0209147_101820 3300025229 Bacteria 6622
319 Ga0209563_100093 3300025230 Bacteria 167476
320 Ga0209563_100231 3300025230 Bacteria 27006
321 Ga0207427_100001 3300025231 Bacteria 1410763
322 Ga0207427_100018 3300025231 Bacteria 530735
323 Ga0209437_100003 3300025233 Bacteria 1517827
324 Ga0209437_100031 3300025233 Bacteria 530871
325 Ga0209258_100416 3300025242 Bacteria 50935
326 Ga0209258_100995 3300025242 Bacteria 13087
327 Ga0207425_1000379 3300025245 Bacteria 30494
328 Ga0207425_1000386 3300025245 Bacteria 29781
329 Ga0207425_1002217 3300025245 Bacteria 7055
330 Ga0209646_1000038 3300025246 Bacteria 353982
331 Ga0209646_1000430 3300025246 Bacteria 23256
332 Ga0209026_1000180 3300025250 Bacteria 94396
333 Ga0209677_100054 3300025253 Bacteria 167476
334 Ga0209148_1000033 3300025254 Bacteria 555508
335 Ga0209759_1000205 3300025256 Bacteria 92894
336 Ga0209759_1002140 3300025256 Bacteria 9102
337 Ga0209129_1000013 3300025258 Bacteria 524874
338 Ga0209129_1000274 3300025258 Bacteria 49988
339 Ga0209129_1005364 3300025258 Bacteria 4572
340 Ga0209233_1000007 3300025261 Bacteria 1411234
341 Ga0209233_1000012 3300025261 Bacteria 1019519
342 Ga0209565_1000016 3300025263 Bacteria 477707
343 Ga0209565_1000020 3300025263 Bacteria 432627
344 Ga0209565_1000207 3300025263 Bacteria 68646
345 Ga0209565_1000483 3300025263 Bacteria 29283
346 Ga0209565_1000771 3300025263 Bacteria 18692
347 Ga0209565_1003831 3300025263 Bacteria 4737
348 Ga0209673_1000072 3300025273 Bacteria 236935
349 Ga0209673_1000316 3300025273 Bacteria 89031
350 Ga0209673_1000495 3300025273 Bacteria 65000
351 Ga0209673_1000619 3300025273 Bacteria 54306
352 Ga0209673_1000701 3300025273 Bacteria 47545
353 Ga0209673_1001091 3300025273 Bacteria 30494
354 Ga0209673_1004823 3300025273 Bacteria 7067
355 Ga0209130_1000040 3300025284 Bacteria 262926
356 Ga0209130_1000158 3300025284 Bacteria 101323
357 Ga0209130_1000354 3300025284 Bacteria 52516
358 Ga0209130_1000430 3300025284 Bacteria 44991
359 Ga0209130_1000492 3300025284 Bacteria 40584
360 Ga0209130_1000603 3300025284 Bacteria 34694
361 Ga0209130_1001093 3300025284 Bacteria 20138
362 Ga0209130_1001975 3300025284 Bacteria 11317
363 Ga0209675_1000122 3300025291 Bacteria 106769
364 Ga0209675_1000130 3300025291 Bacteria 102667
365 Ga0209675_1000343 3300025291 Bacteria 40578
366 Ga0209675_1000640 3300025291 Bacteria 24883
367 Ga0209675_1002208 3300025291 Bacteria 10188
368 Ga0209675_1003318 3300025291 Bacteria 7731
369 Ga0209675_1003383 3300025291 Bacteria 7606
370 Ga0209675_1004566 3300025291 Bacteria 6108
371 Ga0209675_1005920 3300025291 Bacteria 5016
372 Ga0209675_1014770 3300025291 Bacteria 2358
373 Ga0209676_1000005 3300025292 Bacteria 1076001
374 Ga0209676_1000055 3300025292 Bacteria 361565
375 Ga0209676_1000088 3300025292 Bacteria 263010
376 Ga0209676_1000395 3300025292 Bacteria 79555
377 Ga0209676_1000950 3300025292 Bacteria 35488
378 Ga0209676_1001490 3300025292 Bacteria 21535
379 Ga0209676_1001603 3300025292 Bacteria 20124
380 Ga0209676_1001871 3300025292 Bacteria 17269
381 Ga0209676_1002102 3300025292 Bacteria 15367
382 Ga0209676_1002341 3300025292 Bacteria 13691
383 Ga0209676_1002542 3300025292 Bacteria 12696
384 Ga0209676_1004099 3300025292 Bacteria 8321
385 Ga0209676_1010970 3300025292 Bacteria 3706
386 Ga0209676_1025051 3300025292 Bacteria 1920
387 Ga0209025_1000169 3300025294 Bacteria 161428
388 Ga0209025_1000994 3300025294 Bacteria 41995
389 Ga0209025_1001450 3300025294 Bacteria 31111
390 Ga0209025_1001908 3300025294 Bacteria 24280
391 Ga0209025_1001984 3300025294 Bacteria 23473
392 Ga0209025_1002648 3300025294 Bacteria 18307
393 Ga0209025_1002988 3300025294 Bacteria 16756
394 Ga0209025_1005800 3300025294 Bacteria 9906
395 Ga0209025_1005968 3300025294 Bacteria 9685
396 Ga0209025_1024133 3300025294 Bacteria 3152
397 Ga0209025_1039132 3300025294 Bacteria 2074
398 Ga0209564_1000171 3300025295 Bacteria 155716
399 Ga0209564_1000292 3300025295 Bacteria 101735
400 Ga0209564_1000684 3300025295 Bacteria 49988
401 Ga0209564_1000816 3300025295 Bacteria 42443
402 Ga0209564_1001283 3300025295 Bacteria 27528
403 Ga0209564_1001405 3300025295 Bacteria 24909
404 Ga0209564_1008775 3300025295 Bacteria 4929
405 Ga0209758_1000067 3300025297 Bacteria 288575
406 Ga0209758_1000691 3300025297 Bacteria 49988
407 Ga0209758_1031681 3300025297 Bacteria 2165
408 Ga0209050_1000007 3300025298 Bacteria 1187891
409 Ga0209050_1000084 3300025298 Bacteria 263245
410 Ga0209050_1000110 3300025298 Bacteria 216664
411 Ga0209050_1000447 3300025298 Bacteria 74743
412 Ga0209050_1000606 3300025298 Bacteria 57003
413 Ga0209050_1000941 3300025298 Bacteria 37976
414 Ga0209050_1000970 3300025298 Bacteria 36710
415 Ga0209050_1005427 3300025298 Bacteria 8028
416 Ga0209050_1008406 3300025298 Bacteria 5528
417 Ga0209050_1011717 3300025298 Bacteria 4118
418 Ga0209256_1000038 3300025299 Bacteria 375225
419 Ga0209256_1000065 3300025299 Bacteria 248104
420 Ga0209256_1000121 3300025299 Bacteria 167299
421 Ga0209256_1000313 3300025299 Bacteria 84424
422 Ga0209256_1000591 3300025299 Bacteria 50522
423 Ga0207426_1000090 3300025302 Bacteria 280662
424 Ga0207426_1000101 3300025302 Bacteria 262096
425 Ga0207426_1000124 3300025302 Bacteria 218145
426 Ga0207426_1000359 3300025302 Bacteria 82359
427 Ga0207426_1000568 3300025302 Bacteria 49988
428 Ga0209051_1000009 3300025303 Bacteria 706778
429 Ga0209051_1000058 3300025303 Bacteria 263137
430 Ga0209051_1000083 3300025303 Bacteria 192732
431 Ga0209051_1000285 3300025303 Bacteria 82429
432 Ga0209051_1000429 3300025303 Bacteria 57551
433 Ga0209051_1000578 3300025303 Bacteria 43994
434 Ga0209051_1000686 3300025303 Bacteria 37500
435 Ga0209051_1001721 3300025303 Bacteria 17468
436 Ga0209051_1004300 3300025303 Bacteria 8849
437 Ga0209051_1007470 3300025303 Bacteria 5966
438 Ga0209051_1040112 3300025303 Bacteria 1682
439 Ga0209257_1000011 3300025304 Bacteria 1112630
440 Ga0209257_1000092 3300025304 Bacteria 263137
441 Ga0209257_1000093 3300025304 Bacteria 263088
442 Ga0209257_1000175 3300025304 Bacteria 165070
443 Ga0209257_1000417 3300025304 Bacteria 82249
444 Ga0209257_1000780 3300025304 Bacteria 47084
445 Ga0209257_1006323 3300025304 Bacteria 7710
446 Ga0209257_1038720 3300025304 Bacteria 1441
447 Ga0207656_10000071 3300025321 Bacteria 37264
448 Ga0207656_10085454 3300025321 Bacteria 1424
449 Ga0207696_1000002 3300025711 Bacteria 1098043
450 Ga0207696_1000018 3300025711 Bacteria 478605
451 Ga0207696_1000549 3300025711 Bacteria 30290
452 Ga0207696_1000720 3300025711 Bacteria 22388
453 Ga0207696_1000960 3300025711 Bacteria 17569
454 Ga0207696_1001354 3300025711 Bacteria 13460
455 Ga0207696_1005957 3300025711 Bacteria 4978
456 Ga0207696_1008622 3300025711 Bacteria 3876
457 Ga0207696_1008668 3300025711 Bacteria 3860
458 Ga0207655_1000081 3300025728 Bacteria 214272
459 Ga0207655_1000085 3300025728 Bacteria 206425
460 Ga0207655_1000180 3300025728 Bacteria 112767
461 Ga0207655_1000434 3300025728 Bacteria 56142
462 Ga0207655_1001629 3300025728 Bacteria 19942
463 Ga0207655_1002190 3300025728 Bacteria 16226
464 Ga0207655_1002250 3300025728 Bacteria 15966
465 Ga0207655_1004450 3300025728 Bacteria 9934
466 Ga0207655_1007273 3300025728 Bacteria 7205
467 Ga0207655_1012707 3300025728 Bacteria 4895
468 Ga0207655_1015180 3300025728 Bacteria 4299
469 Ga0207655_1016997 3300025728 Bacteria 3946
470 Ga0207655_1020275 3300025728 Bacteria 3424
471 Ga0207655_1026915 3300025728 Bacteria 2752
472 Ga0207655_1066446 3300025728 Bacteria 1363
473 Ga0207713_1000299 3300025735 Bacteria 56880
474 Ga0207713_1000635 3300025735 Bacteria 34145
475 Ga0207713_1002663 3300025735 Bacteria 12808
476 Ga0207713_1002920 3300025735 Bacteria 11969
477 Ga0207713_1002955 3300025735 Bacteria 11884
478 Ga0207713_1003521 3300025735 Bacteria 10615
479 Ga0207713_1005230 3300025735 Bacteria 8182
480 Ga0207713_1005724 3300025735 Bacteria 7705
481 Ga0207713_1009904 3300025735 Bacteria 5330
482 Ga0207713_1013434 3300025735 Bacteria 4314
483 Ga0207713_1018972 3300025735 Bacteria 3385
484 Ga0207645_10152063 3300025907 Bacteria 1511
485 Ga0207695_10023769 3300025913 Bacteria 6916
486 Ga0207695_10063283 3300025913 Bacteria 3815
487 Ga0207695_10094878 3300025913 Bacteria 2989
488 Ga0207671_10000018 3300025914 Bacteria 318130
489 Ga0207671_10001211 3300025914 Bacteria 30648
490 Ga0207671_10016471 3300025914 Bacteria 5743
491 Ga0207671_10020189 3300025914 Bacteria 5076
492 Ga0207663_10084404 3300025916 Bacteria 2089
493 Ga0207649_10000008 3300025920 Bacteria 315683
494 Ga0207649_10168624 3300025920 Bacteria 1523
495 Ga0207681_10003123 3300025923 Bacteria 10421
496 Ga0207681_10024836 3300025923 Bacteria 3848
497 Ga0207694_10020967 3300025924 Bacteria 4946
498 Ga0207694_10032186 3300025924 Bacteria 4012
499 Ga0207650_10000693 3300025925 Bacteria 26316
500 Ga0207650_10002019 3300025925 Bacteria 14208
501 Ga0207644_10043306 3300025931 Bacteria 3194
502 Ga0207690_10095842 3300025932 Bacteria 2109
503 Ga0207706_10001894 3300025933 Bacteria 20548
504 Ga0207706_10006446 3300025933 Bacteria 10900
505 Ga0207706_10013068 3300025933 Bacteria 7555
506 Ga0207686_10007660 3300025934 Bacteria 5819
507 Ga0207686_10030944 3300025934 Bacteria 3175
508 Ga0207686_10153404 3300025934 Bacteria 1606
509 Ga0207709_10000089 3300025935 Bacteria 149139
510 Ga0207709_10000152 3300025935 Bacteria 93738
511 Ga0207709_10000941 3300025935 Bacteria 21805
512 Ga0207709_10001498 3300025935 Bacteria 16136
513 Ga0207709_10002236 3300025935 Bacteria 12332
514 Ga0207709_10006321 3300025935 Bacteria 6649
515 Ga0207709_10041122 3300025935 Bacteria 2772
516 Ga0207709_10150210 3300025935 Bacteria 1613
517 Ga0207669_10053809 3300025937 Bacteria 2427
518 Ga0207711_10154529 3300025941 Bacteria 2073
519 Ga0207689_10132289 3300025942 Bacteria 2053
520 Ga0207679_10000008 3300025945 Bacteria 412057
521 Ga0207679_10009831 3300025945 Bacteria 6140
522 Ga0207679_10057717 3300025945 Bacteria 2872
523 Ga0207667_10173768 3300025949 Bacteria 2214
524 Ga0207640_10174947 3300025981 Bacteria 1603
525 Ga0207658_10078826 3300025986 Bacteria 2518
526 Ga0207658_10225489 3300025986 Bacteria 1579
527 Ga0207677_10067819 3300026023 Bacteria 2501
528 Ga0207639_10005536 3300026041 Bacteria 8538
529 Ga0207639_10043510 3300026041 Bacteria 3372
530 Ga0207639_10049140 3300026041 Bacteria 3197
531 Ga0207639_10118383 3300026041 Bacteria 2172
532 Ga0207639_10158676 3300026041 Bacteria 1904
533 Ga0207678_10127927 3300026067 Bacteria 2167
534 Ga0207648_10080143 3300026089 Bacteria 2848
535 Ga0207648_10089379 3300026089 Bacteria 2691
536 Ga0207676_10250380 3300026095 Bacteria 1594
537 Ga0207674_10057396 3300026116 Bacteria 3946
538 Ga0207674_10259429 3300026116 Bacteria 1685
539 Ga0207683_10186206 3300026121 Bacteria 1884
540 Ga0207698_10097244 3300026142 Bacteria 2429
541 Ga0209281_1000072 3300027111 Bacteria 273114
542 Ga0209281_1000391 3300027111 Bacteria 68959
543 Ga0209281_1000947 3300027111 Bacteria 23656
544 Ga0209389_1000013 3300027296 Bacteria 208890
545 Ga0209371_1000940 3300027312 Bacteria 22736
546 Ga0209282_1000713 3300027666 Bacteria 16638
547 Ga0209998_10019890 3300027717 Bacteria 1433
548 Ga0209974_10015358 3300027876 Bacteria 2542
549 Ga0207428_10035435 3300027907 Bacteria 4079
550 Ga0207428_10090969 3300027907 Bacteria 2369
551 Ga0207428_10179606 3300027907 Bacteria 1600
552 Ga0268266_10014302 3300028379 Bacteria 6825
553 Ga0307517_10151323 3300028786 Bacteria 1591
554 Ga0307515_10000291 3300028794 Bacteria 123206
555 Ga0307515_10000975 3300028794 Bacteria 65367
556 Ga0307515_10005133 3300028794 Bacteria 26611
557 Ga0307515_10005432 3300028794 Bacteria 25831
558 Ga0307515_10022988 3300028794 Bacteria 10960
559 Ga0307515_10171969 3300028794 Bacteria 2155
560 Ga0307515_10223077 3300028794 Bacteria 1697
561 Ga0268256_1000839 3300030500 Bacteria 21805
562 Ga0307511_10039058 3300030521 Bacteria 4062
563 Ga0314311_1138841 3300030733 Bacteria 4995
564 Ga0314311_1177087 3300030733 Bacteria 3446
565 Ga0316178_1009884 3300030735 Bacteria 6473
566 Ga0316178_1056564 3300030735 Bacteria 5650
567 Ga0316183_1109609 3300030742 Bacteria 5372
568 Ga0265327_10015797 3300031251 Bacteria 4845
569 Ga0265327_10015944 3300031251 Bacteria 4811
570 Ga0265316_10000069 3300031344 Bacteria 104235
571 Ga0307513_10000070 3300031456 Bacteria 139895
572 Ga0307513_10000072 3300031456 Bacteria 138840
573 Ga0307513_10002066 3300031456 Bacteria 28187
574 Ga0307513_10017129 3300031456 Bacteria 8703
575 Ga0307513_10091485 3300031456 Bacteria 3100
576 Ga0307513_10139894 3300031456 Bacteria 2349
577 Ga0307513_10278630 3300031456 Bacteria 1451
578 Ga0307509_10004038 3300031507 Bacteria 21555
579 Ga0307509_10211721 3300031507 Bacteria 1762
580 Ga0307408_100000030 3300031548 Bacteria 223389
581 Ga0307408_100000153 3300031548 Bacteria 76717
582 Ga0307408_100025018 3300031548 Bacteria 4084
583 Ga0307408_100042577 3300031548 Bacteria 3226
584 Ga0307408_100271332 3300031548 Bacteria 1408
585 Ga0307508_10000269 3300031616 Bacteria 63656
586 Ga0307508_10000727 3300031616 Bacteria 39082
587 Ga0307508_10170067 3300031616 Bacteria 1782
588 Ga0307514_10055648 3300031649 Bacteria 3039
589 Ga0307516_10001343 3300031730 Bacteria 34183
590 Ga0307516_10002058 3300031730 Bacteria 27388
591 Ga0307516_10013675 3300031730 Bacteria 8625
592 Ga0307516_10020015 3300031730 Bacteria 6919
593 Ga0307516_10063622 3300031730 Bacteria 3571
594 Ga0307405_10011987 3300031731 Bacteria 4567
595 Ga0307413_10056994 3300031824 Bacteria 2387
596 Ga0307413_10114846 3300031824 Bacteria 1810
597 Ga0307406_10001388 3300031901 Bacteria 13477
598 Ga0307406_10081353 3300031901 Bacteria 2153
599 Ga0307407_10022562 3300031903 Bacteria 3268
600 Ga0307412_10009459 3300031911 Bacteria 5594
601 Ga0307412_10079477 3300031911 Bacteria 2262
602 Ga0307412_10087242 3300031911 Bacteria 2173
603 Ga0307416_100054154 3300032002 Bacteria 3224
604 Ga0307416_100202600 3300032002 Bacteria 1884
605 Ga0307414_10019333 3300032004 Bacteria 4218
606 Ga0307414_10032780 3300032004 Bacteria 3425
607 Ga0307414_10068528 3300032004 Bacteria 2546
608 Ga0307510_10003652 3300033180 Bacteria 17966
609 Ga0395905_0004162 3300037471 Bacteria 15128
610 Ga0395905_0109594 3300037471 Bacteria 2592
611 Ga0395905_0156373 3300037471 Bacteria 2144
612 Ga0395905_0203969 3300037471 Bacteria 1853
613 Ga0395905_0213175 3300037471 Bacteria 1809
614 Ga0395905_0411658 3300037471 Bacteria 1247
615 Ga0436364_0403586 3300037853 Bacteria 3903
616 Ga0436365_0774305 3300039437 Bacteria 92788
617 Ga0436361_0483449 3300039447 Bacteria 2527
618 Ga0436361_0847829 3300039447 Bacteria 11961
619 Ga0436361_0881506 3300039447 Bacteria 38796
620 Ga0439438_000715 3300041405 Bacteria 14838
621 Ga0439438_003425 3300041405 Bacteria 6414
622 Ga0439438_004854 3300041405 Bacteria 5056
623 Ga0439438_012163 3300041405 Bacteria 2649
624 Ga0439438_012602 3300041405 Bacteria 2587
625 Ga0439438_014037 3300041405 Bacteria 2394
626 Ga0439439_0024603 3300041406 Bacteria 1512
627 Ga0439447_000485 3300041407 Bacteria 14768
628 Ga0439447_001874 3300041407 Bacteria 7691
629 Ga0439447_003428 3300041407 Bacteria 5639
630 Ga0439447_005002 3300041407 Bacteria 4469
631 Ga0439447_014600 3300041407 Bacteria 2198
632 Ga0439466_0000438 3300041411 Bacteria 15873
633 Ga0439466_0000472 3300041411 Bacteria 15329
634 Ga0439466_0000930 3300041411 Bacteria 11212
635 Ga0439466_0002563 3300041411 Bacteria 7119
636 Ga0439466_0005854 3300041411 Bacteria 4682
637 Ga0439466_0009010 3300041411 Bacteria 3747
638 Ga0439465_0002274 3300041413 Bacteria 6310
639 Ga0451789_0743220 3300041443 Bacteria 1821
640 Ga0439431_0000366 3300041997 Bacteria 9512
641 Ga0439431_0004532 3300041997 Bacteria 3055
642 Ga0439433_0002847 3300041999 Bacteria 3697
643 Ga0439442_004724 3300042002 Bacteria 2709
644 Ga0439442_023138 3300042002 Bacteria 1291
645 Ga0439432_000153 3300042006 Bacteria 23425
646 Ga0439432_001142 3300042006 Bacteria 10060
647 Ga0439432_001390 3300042006 Bacteria 9142
648 Ga0439432_016540 3300042006 Bacteria 2481
649 Ga0439432_017528 3300042006 Bacteria 2403
650 Ga0439449_0001688 3300042007 Bacteria 8691
651 Ga0439449_0019436 3300042007 Bacteria 2546
652 Ga0439449_0023035 3300042007 Bacteria 2331
653 Ga0439451_001579 3300042009 Bacteria 4500
654 Ga0439451_003699 3300042009 Bacteria 3101
655 Ga0439452_000283 3300042010 Bacteria 32887
656 Ga0439452_000473 3300042010 Bacteria 22581
657 Ga0439452_000565 3300042010 Bacteria 19364
658 Ga0439452_000632 3300042010 Bacteria 17734
659 Ga0439452_002595 3300042010 Bacteria 6624
660 Ga0439452_004893 3300042010 Bacteria 4395
661 Ga0439452_017091 3300042010 Bacteria 1958
662 Ga0439456_003162 3300042013 Bacteria 3332
663 Ga0439456_021587 3300042013 Bacteria 1362
664 Ga0439457_007351 3300042014 Bacteria 2649
665 Ga0450911_000171 3300042115 Bacteria 25601
666 Ga0450911_000434 3300042115 Bacteria 13628
667 Ga0450892_001138 3300042130 Bacteria 2761
668 Ga0450896_009371 3300042133 Bacteria 1363
669 Ga0450902_003430 3300042137 Bacteria 2311
670 Ga0450903_002282 3300042138 Bacteria 3423
671 Ga0450905_000083 3300042142 Bacteria 9030
672 Ga0450905_009558 3300042142 Bacteria 1335
673 Ga0450889_000039 3300042144 Bacteria 11538
674 Ga0450906_000881 3300042145 Bacteria 6574
675 Ga0450906_000932 3300042145 Bacteria 6405
676 Ga0450907_000066 3300042146 Bacteria 40668
677 Ga0450907_000936 3300042146 Bacteria 6937
678 Ga0450910_001417 3300042147 Bacteria 3011
679 Ga0439446_0002138 3300042156 Bacteria 4693
680 Ga0439446_0007120 3300042156 Bacteria 2934
681 Ga0450908_001783 3300042184 Bacteria 4198
682 Ga0450909_000645 3300042185 Bacteria 4610
683 Ga0439434_0003716 3300042435 Bacteria 4464
684 Ga0439434_0035996 3300042435 Bacteria 1513
685 Ga0450893_0000471 3300042532 Bacteria 5681
686 Ga0450893_0003856 3300042532 Bacteria 2377
687 Ga0450893_0004453 3300042532 Bacteria 2234
688 Ga0451577_0021322 3300042876 Bacteria 5931
689 Ga0451577_0082142 3300042876 Bacteria 2874
690 Ga0439440_0003893 3300042993 Bacteria 2905
691 Ga0453683_0013512 3300044673 Bacteria 5327
692 Ga0466965_0030014 3300044683 Bacteria 2647
693 Ga0453684_0000384 3300044712 Bacteria 181189
694 Ga0453684_0023821 3300044712 Bacteria 8986
695 Ga0453684_0039564 3300044712 Bacteria 6422
696 Ga0453684_0052686 3300044712 Bacteria 5318
697 Ga0453684_0224091 3300044712 Bacteria 2176
698 Ga0453684_0316398 3300044712 Bacteria 1769
699 Ga0466971_0019319 3300044719 Bacteria 3026
700 Ga0466960_0036212 3300044901 Bacteria 2310
701 Ga0466960_0046580 3300044901 Bacteria 2077
702 Ga0466959_0174986 3300045049 Bacteria 1504
703 Ga0451576_0000305 3300045051 Bacteria 119146
704 Ga0451576_0010978 3300045051 Bacteria 10349
705 Ga0451576_0051145 3300045051 Bacteria 4332
706 Ga0451576_0115679 3300045051 Bacteria 2792
707 Ga0495617_000370 3300046452 Bacteria 24894
708 Ga0495617_001202 3300046452 Bacteria 11652
709 Ga0495617_002985 3300046452 Bacteria 6467
710 Ga0495617_018256 3300046452 Bacteria 2372
711 Ga0495617_025829 3300046452 Bacteria 1979
712 Ga0495627_000818 3300046453 Bacteria 22733
713 Ga0495627_001538 3300046453 Bacteria 13202
714 Ga0495627_003441 3300046453 Bacteria 6993
715 Ga0495627_004267 3300046453 Bacteria 6029
716 Ga0495627_012922 3300046453 Bacteria 2947
717 Ga0495603_0007078 3300046455 Bacteria 6731
718 Ga0495590_0017395 3300046457 Bacteria 2588
719 Ga0495591_000040 3300046458 Bacteria 155841
720 Ga0495591_000276 3300046458 Bacteria 47822
721 Ga0495591_000901 3300046458 Bacteria 20733
722 Ga0495591_001682 3300046458 Bacteria 13221
723 Ga0495591_001890 3300046458 Bacteria 12319
724 Ga0495591_002914 3300046458 Bacteria 9159
725 Ga0495638_0000193 3300046460 Bacteria 89025
726 Ga0495638_0009647 3300046460 Bacteria 6752
727 Ga0495638_0015010 3300046460 Bacteria 5214
728 Ga0495638_0051003 3300046460 Bacteria 2582
729 Ga0495638_0134715 3300046460 Bacteria 1448
730 Ga0495653_0000481 3300046463 Bacteria 30931
731 Ga0495653_0078735 3300046463 Bacteria 2443
732 Ga0495650_0009065 3300046471 Bacteria 5708
733 Ga0495650_0010879 3300046471 Bacteria 5039
734 Ga0495650_0018806 3300046471 Bacteria 3423
735 Ga0495582_0003396 3300046473 Bacteria 8965
736 Ga0495605_0000017 3300046474 Bacteria 273775
737 Ga0495605_0000750 3300046474 Bacteria 23783
738 Ga0495605_0001177 3300046474 Bacteria 17389
739 Ga0495605_0001458 3300046474 Bacteria 15455
740 Ga0495605_0013768 3300046474 Bacteria 4445
741 Ga0495639_0000653 3300046475 Bacteria 16009
742 Ga0495584_0000328 3300046491 Bacteria 33188
743 Ga0495584_0003158 3300046491 Bacteria 9152
744 Ga0495584_0003317 3300046491 Bacteria 8909
745 Ga0495584_0040511 3300046491 Bacteria 2352
746 Ga0495584_0044903 3300046491 Bacteria 2229
747 Ga0495585_0001070 3300046492 Bacteria 22591
748 Ga0495585_0001824 3300046492 Bacteria 16125
749 Ga0495585_0002099 3300046492 Bacteria 14581
750 Ga0495585_0011871 3300046492 Bacteria 5145
751 Ga0495585_0014312 3300046492 Bacteria 4624
752 Ga0495596_0000009 3300046500 Bacteria 145647
753 Ga0495607_0000022 3300046501 Bacteria 162516
754 Ga0495607_0002782 3300046501 Bacteria 13934
755 Ga0495607_0003533 3300046501 Bacteria 11906
756 Ga0495607_0012323 3300046501 Bacteria 5651
757 Ga0495607_0014743 3300046501 Bacteria 5081
758 Ga0495607_0103118 3300046501 Bacteria 1524
759 Ga0495583_0002630 3300046506 Bacteria 15012
760 Ga0495583_0003057 3300046506 Bacteria 13292
761 Ga0495583_0004304 3300046506 Bacteria 10286
762 Ga0495583_0014680 3300046506 Bacteria 4306
763 Ga0495583_0034046 3300046506 Bacteria 2444
764 Ga0495606_0000343 3300046507 Bacteria 79977
765 Ga0495606_0001326 3300046507 Bacteria 33799
766 Ga0495606_0005384 3300046507 Bacteria 12273
767 Ga0495606_0006246 3300046507 Bacteria 11060
768 Ga0495606_0007766 3300046507 Bacteria 9492
769 Ga0495606_0008721 3300046507 Bacteria 8726
770 Ga0495606_0016867 3300046507 Bacteria 5546
771 Ga0495606_0106407 3300046507 Bacteria 1698
772 Ga0495606_0163474 3300046507 Bacteria 1297
773 Ga0495610_0003088 3300046512 Bacteria 13294
774 Ga0495610_0010725 3300046512 Bacteria 5667
775 Ga0495610_0020309 3300046512 Bacteria 3690
776 Ga0495610_0025505 3300046512 Bacteria 3171
777 Ga0495610_0034754 3300046512 Bacteria 2593
778 Ga0495610_0040454 3300046512 Bacteria 2349
779 Ga0495616_0000979 3300046513 Bacteria 20483
780 Ga0495616_0001762 3300046513 Bacteria 14733
781 Ga0495616_0002475 3300046513 Bacteria 12248
782 Ga0495616_0011360 3300046513 Bacteria 5108
783 Ga0495616_0031203 3300046513 Bacteria 2792
784 Ga0495620_0000037 3300046515 Bacteria 114491
785 Ga0495620_0000105 3300046515 Bacteria 67077
786 Ga0495620_0001050 3300046515 Bacteria 16934
787 Ga0495620_0009335 3300046515 Bacteria 5222
788 Ga0495620_0022393 3300046515 Bacteria 3043
789 Ga0495630_0144885 3300046517 Bacteria 1806
790 Ga0495631_0000289 3300046518 Bacteria 35094
791 Ga0495631_0000358 3300046518 Bacteria 31408
792 Ga0495631_0000738 3300046518 Bacteria 21019
793 Ga0495631_0054272 3300046518 Bacteria 1748
794 Ga0495632_0000415 3300046519 Bacteria 40433
795 Ga0495632_0000977 3300046519 Bacteria 24971
796 Ga0495632_0001361 3300046519 Bacteria 20568
797 Ga0495632_0001580 3300046519 Bacteria 18777
798 Ga0495632_0002160 3300046519 Bacteria 15194
799 Ga0495632_0009081 3300046519 Bacteria 6019
800 Ga0495632_0014769 3300046519 Bacteria 4405
801 Ga0495632_0028474 3300046519 Bacteria 2915
802 Ga0495632_0034692 3300046519 Bacteria 2579
803 Ga0495632_0034903 3300046519 Bacteria 2570
804 Ga0495632_0052412 3300046519 Bacteria 2006
805 Ga0495637_0000296 3300046520 Bacteria 38508
806 Ga0495637_0002081 3300046520 Bacteria 11257
807 Ga0495637_0007978 3300046520 Bacteria 5214
808 Ga0495637_0022912 3300046520 Bacteria 2842
809 Ga0495643_0000476 3300046522 Bacteria 51006
810 Ga0495643_0000887 3300046522 Bacteria 31854
811 Ga0495643_0011306 3300046522 Bacteria 5443
812 Ga0495643_0012964 3300046522 Bacteria 5008
813 Ga0495643_0027049 3300046522 Bacteria 3228
814 Ga0495643_0049848 3300046522 Bacteria 2256
815 Ga0495643_0051381 3300046522 Bacteria 2217
816 Ga0495644_0000355 3300046523 Bacteria 20713
817 Ga0495644_0007616 3300046523 Bacteria 4173
818 Ga0495644_0015637 3300046523 Bacteria 2908
819 Ga0495644_0022448 3300046523 Bacteria 2405
820 Ga0495648_0000074 3300046524 Bacteria 129886
821 Ga0495648_0000816 3300046524 Bacteria 32976
822 Ga0495648_0009311 3300046524 Bacteria 7631
823 Ga0495648_0015625 3300046524 Bacteria 5501
824 Ga0495648_0016479 3300046524 Bacteria 5328
825 Ga0495648_0024300 3300046524 Bacteria 4129
826 Ga0495648_0031588 3300046524 Bacteria 3484
827 Ga0495648_0031810 3300046524 Bacteria 3470
828 Ga0495642_0000138 3300046528 Bacteria 42510
829 Ga0495642_0000391 3300046528 Bacteria 23597
830 Ga0495654_0001270 3300046530 Bacteria 17739
831 Ga0495654_0002011 3300046530 Bacteria 13387
832 Ga0495654_0002569 3300046530 Bacteria 11608
833 Ga0495654_0002671 3300046530 Bacteria 11308
834 Ga0495654_0023403 3300046530 Bacteria 3199
835 Ga0495654_0026854 3300046530 Bacteria 2956
836 Ga0495654_0042852 3300046530 Bacteria 2245
837 Ga0495598_0036325 3300046537 Bacteria 1415
838 Ga0495609_0000049 3300046538 Bacteria 155608
839 Ga0495609_0002470 3300046538 Bacteria 11358
840 Ga0495609_0006420 3300046538 Bacteria 5999
841 Ga0495621_0001102 3300046539 Bacteria 6956
842 Ga0495597_0000602 3300046542 Bacteria 29457
843 Ga0495597_0008755 3300046542 Bacteria 5055
844 Ga0495597_0039508 3300046542 Bacteria 2112
845 Ga0495597_0041817 3300046542 Bacteria 2045
846 Ga0495597_0077594 3300046542 Bacteria 1423
847 Ga0495645_0060569 3300046543 Bacteria 2744
848 Ga0495622_0000960 3300046557 Bacteria 15471
849 Ga0495622_0001253 3300046557 Bacteria 13032
850 Ga0495622_0001294 3300046557 Bacteria 12840
851 Ga0495633_0000595 3300046558 Bacteria 34943
852 Ga0495633_0010978 3300046558 Bacteria 4918
853 Ga0495656_0003253 3300046615 Bacteria 5479
854 Ga0495656_0003574 3300046615 Bacteria 5266
855 Ga0495656_0037601 3300046615 Bacteria 2001
856 Ga0495668_0001693 3300046616 Bacteria 20395
857 Ga0495668_0008272 3300046616 Bacteria 6517
858 Ga0495668_0015940 3300046616 Bacteria 4378
859 Ga0495634_0001281 3300046642 Bacteria 23031
860 Ga0495611_0000391 3300046648 Bacteria 27614
861 Ga0495625_0000235 3300046660 Bacteria 86400
862 Ga0495625_0001906 3300046660 Bacteria 23574
863 Ga0495625_0002566 3300046660 Bacteria 19514
864 Ga0495625_0003243 3300046660 Bacteria 16456
865 Ga0495625_0008422 3300046660 Bacteria 8804
866 Ga0495625_0010661 3300046660 Bacteria 7574
867 Ga0495625_0016218 3300046660 Bacteria 5869
868 Ga0495625_0019516 3300046660 Bacteria 5256
869 Ga0495625_0020719 3300046660 Bacteria 5069
870 Ga0495625_0073485 3300046660 Bacteria 2396
871 Ga0495625_0104244 3300046660 Bacteria 1944
872 Ga0495635_0014815 3300046663 Bacteria 5454
873 Ga0495635_0025799 3300046663 Bacteria 4093
874 Ga0495659_0000673 3300046664 Bacteria 12415
875 Ga0495661_0000085 3300046665 Bacteria 114501
876 Ga0495661_0010963 3300046665 Bacteria 6157
877 Ga0495661_0040679 3300046665 Bacteria 2880
878 Ga0495661_0098583 3300046665 Bacteria 1649
879 Ga0495661_0119212 3300046665 Bacteria 1459
880 Ga0495588_0027446 3300046674 Bacteria 2845
881 Ga0495588_0058881 3300046674 Bacteria 1986
882 Ga0495669_0007636 3300046684 Bacteria 4538
883 Ga0495624_0001195 3300046690 Bacteria 20523
884 Ga0495670_0000329 3300046691 Bacteria 22647
885 Ga0495670_0016605 3300046691 Bacteria 3620
886 Ga0495670_0044488 3300046691 Bacteria 2216
887 Ga0495670_0056299 3300046691 Bacteria 1972
888 Ga0495670_0078081 3300046691 Bacteria 1684
889 Ga0495671_0000996 3300046692 Bacteria 19740
890 Ga0495671_0006371 3300046692 Bacteria 6820
891 Ga0495671_0010143 3300046692 Bacteria 5235
892 Ga0495671_0012943 3300046692 Bacteria 4539
893 Ga0495671_0022894 3300046692 Bacteria 3267
894 Ga0495671_0028435 3300046692 Bacteria 2879
895 Ga0495671_0031010 3300046692 Bacteria 2734
896 Ga0495671_0044624 3300046692 Bacteria 2221
897 Ga0495671_0047979 3300046692 Bacteria 2131
898 Ga0495649_0000669 3300046694 Bacteria 27959
899 Ga0495649_0001381 3300046694 Bacteria 18363
900 Ga0495649_0001911 3300046694 Bacteria 15173
901 Ga0495649_0002054 3300046694 Bacteria 14488
902 Ga0495649_0002115 3300046694 Bacteria 14257
903 Ga0495649_0004031 3300046694 Bacteria 9672
904 Ga0495589_0001220 3300046794 Bacteria 15268
905 Ga0495589_0001226 3300046794 Bacteria 15199
906 Ga0495589_0010620 3300046794 Bacteria 4787
907 Ga0495589_0011847 3300046794 Bacteria 4524
908 Ga0495589_0026039 3300046794 Bacteria 2965
909 Ga0495589_0046096 3300046794 Bacteria 2164
910 Ga0495589_0072911 3300046794 Bacteria 1676
911 Ga0495600_0066546 3300046809 Bacteria 2355
912 Ga0495660_0002046 3300046810 Bacteria 13110
913 Ga0495660_0009301 3300046810 Bacteria 5733
914 Ga0495660_0013427 3300046810 Bacteria 4745
915 Ga0495660_0014046 3300046810 Bacteria 4641
916 Ga0495660_0014780 3300046810 Bacteria 4515
917 Ga0495660_0031206 3300046810 Bacteria 2997
918 Ga0495660_0040582 3300046810 Bacteria 2578
919 Ga0495660_0049066 3300046810 Bacteria 2306
920 Ga0495581_0092864 3300047315 Bacteria 1751
921 Ga0495604_0001053 3300047317 Bacteria 22917
922 Ga0495604_0031777 3300047317 Bacteria 4186
923 Ga0495604_0075240 3300047317 Bacteria 2543
924 Ga0495604_0159435 3300047317 Bacteria 1595
925 Ga0495636_0008415 3300047318 Bacteria 4071
926 Ga0495636_0049036 3300047318 Bacteria 1765
927 Ga0495672_0001293 3300047320 Bacteria 24976
928 Ga0495672_0001470 3300047320 Bacteria 23127
929 Ga0495672_0003596 3300047320 Bacteria 13167
930 Ga0495672_0003633 3300047320 Bacteria 13075
931 Ga0495672_0004034 3300047320 Bacteria 12273
932 Ga0495672_0004181 3300047320 Bacteria 11963
933 Ga0495672_0005600 3300047320 Bacteria 9917
934 Ga0495672_0005963 3300047320 Bacteria 9545
935 Ga0495672_0022966 3300047320 Bacteria 4046
936 Ga0495672_0052546 3300047320 Bacteria 2392
937 Ga0495676_0001991 3300047321 Bacteria 17975
938 Ga0495676_0135383 3300047321 Bacteria 1772
939 Ga0495680_0007262 3300047322 Bacteria 10196
940 Ga0495680_0009252 3300047322 Bacteria 8876
941 Ga0495683_0000398 3300047323 Bacteria 34936
942 Ga0495683_0000521 3300047323 Bacteria 29404
943 Ga0495683_0004343 3300047323 Bacteria 8080
944 Ga0495683_0011875 3300047323 Bacteria 4577
945 Ga0495683_0019465 3300047323 Bacteria 3502
946 Ga0495687_002015 3300047443 Bacteria 17212
947 Ga0495687_002509 3300047443 Bacteria 14588
948 Ga0495687_018160 3300047443 Bacteria 3483
949 Ga0495675_0152773 3300047444 Bacteria 1425
950 Ga0495677_0000430 3300047445 Bacteria 17950
951 Ga0495679_000856 3300047446 Bacteria 19247
952 Ga0495679_001532 3300047446 Bacteria 13060
953 Ga0495679_009936 3300047446 Bacteria 3770
954 Ga0495679_024865 3300047446 Bacteria 2011
955 Ga0495679_036486 3300047446 Bacteria 1552
956 Ga0495673_0000920 3300047469 Bacteria 26741
957 Ga0495673_0001377 3300047469 Bacteria 19630
958 Ga0495673_0002095 3300047469 Bacteria 14528
959 Ga0495673_0002401 3300047469 Bacteria 13204
960 Ga0495673_0002697 3300047469 Bacteria 12213
961 Ga0495673_0004117 3300047469 Bacteria 9217
962 Ga0495673_0005693 3300047469 Bacteria 7487
963 Ga0495673_0015724 3300047469 Bacteria 3891
964 Ga0495673_0018043 3300047469 Bacteria 3568
965 Ga0495673_0029410 3300047469 Bacteria 2592
966 Ga0495681_0001697 3300047470 Bacteria 16294
967 Ga0495681_0005270 3300047470 Bacteria 8682
968 Ga0495681_0007114 3300047470 Bacteria 7216
969 Ga0495681_0007978 3300047470 Bacteria 6684
970 Ga0495681_0010384 3300047470 Bacteria 5637
971 Ga0495681_0018824 3300047470 Bacteria 3790
972 Ga0495681_0024583 3300047470 Bacteria 3169
973 Ga0495681_0025715 3300047470 Bacteria 3075
974 Ga0495684_0002346 3300047471 Bacteria 15124
975 Ga0495686_0001725 3300047472 Bacteria 22504
976 Ga0495686_0003808 3300047472 Bacteria 12802
977 Ga0495686_0008731 3300047472 Bacteria 7394
978 Ga0495593_0010238 3300047673 Bacteria 5421
979 Ga0495593_0045807 3300047673 Bacteria 2332
980 Ga0495593_0060026 3300047673 Bacteria 1991
981 Ga0495602_0006039 3300048088 Bacteria 12710
982 Ga0495626_0000700 3300048091 Bacteria 31923
983 Ga0495626_0001141 3300048091 Bacteria 22174
984 Ga0495626_0002058 3300048091 Bacteria 14711
985 Ga0495626_0002369 3300048091 Bacteria 13200
986 Ga0495626_0002577 3300048091 Bacteria 12401
987 Ga0495626_0002605 3300048091 Bacteria 12318
988 Ga0495626_0004067 3300048091 Bacteria 9112
989 Ga0495626_0047215 3300048091 Bacteria 2002
990 Ga0496102_0001319 3300048905 Bacteria 22262
991 Ga0496102_0002070 3300048905 Bacteria 17279
992 Ga0496102_0023271 3300048905 Bacteria 5500
993 Ga0496103_0130400 3300048906 Bacteria 1605
994 Ga0496104_0048919 3300048907 Bacteria 3987
995 Ga0496105_0198254 3300048908 Bacteria 1639
996 Ga0496106_0148329 3300048909 Bacteria 1849
997 Ga0496108_0077219 3300048911 Bacteria 2816
998 Ga0496108_0108097 3300048911 Bacteria 2376
999 Ga0496109_0110422 3300048912 Bacteria 2556
1000 Ga0496110_0028388 3300048913 Bacteria 4805
1001 Ga0496110_0107949 3300048913 Bacteria 2499
1002 Ga0496112_0028541 3300048915 Bacteria 5386
1003 Ga0496116_0001097 3300048919 Bacteria 32518
1004 Ga0496116_0003192 3300048919 Bacteria 16397
1005 Ga0496116_0006297 3300048919 Bacteria 10804
1006 Ga0496116_0013876 3300048919 Bacteria 6464
1007 Ga0496116_0032359 3300048919 Bacteria 3728
1008 Ga0496117_0001203 3300048920 Bacteria 38893
1009 Ga0496117_0003903 3300048920 Bacteria 16896
1010 Ga0496117_0042306 3300048920 Bacteria 3325
1011 Ga0496117_0084548 3300048920 Bacteria 2070
1012 Ga0496118_0004774 3300048921 Bacteria 15847
1013 Ga0496118_0013177 3300048921 Bacteria 7844
1014 Ga0496118_0034444 3300048921 Bacteria 4130
1015 Ga0496118_0094654 3300048921 Bacteria 2042
1016 Ga0496118_0106597 3300048921 Bacteria 1874
1017 Ga0496119_0000011 3300048922 Bacteria 438315
1018 Ga0496119_0013053 3300048922 Bacteria 6665
1019 Ga0496119_0130288 3300048922 Bacteria 1371
1020 Ga0496120_0000306 3300048923 Bacteria 81699
1021 Ga0496121_0001896 3300048924 Bacteria 33498
1022 Ga0496121_0002793 3300048924 Bacteria 25870
1023 Ga0496121_0004254 3300048924 Bacteria 19459
1024 Ga0496121_0005855 3300048924 Bacteria 15573
1025 Ga0496121_0006997 3300048924 Bacteria 13705
1026 Ga0496121_0042676 3300048924 Bacteria 3940
1027 Ga0496121_0102423 3300048924 Bacteria 2205
1028 Ga0496121_0123020 3300048924 Bacteria 1956
1029 Ga0496122_0015718 3300048925 Bacteria 7217
1030 Ga0496122_0031402 3300048925 Bacteria 4421
1031 Ga0496122_0073997 3300048925 Bacteria 2412
1032 Ga0496123_0000136 3300048926 Bacteria 152399
1033 Ga0496123_0020558 3300048926 Bacteria 5161
1034 Ga0496123_0034769 3300048926 Bacteria 3603
1035 Ga0496123_0056940 3300048926 Bacteria 2549
1036 Ga0496124_0001568 3300048927 Bacteria 33060
1037 Ga0496124_0007112 3300048927 Bacteria 11985
1038 Ga0496124_0007942 3300048927 Bacteria 11168
1039 Ga0496124_0008900 3300048927 Bacteria 10408
1040 Ga0496124_0009896 3300048927 Bacteria 9747
1041 Ga0496124_0035612 3300048927 Bacteria 4353
1042 Ga0496124_0065901 3300048927 Bacteria 3018
1043 Ga0496124_0118392 3300048927 Bacteria 2120
1044 Ga0496125_0001504 3300048928 Bacteria 33396
1045 Ga0496125_0001952 3300048928 Bacteria 28153
1046 Ga0496125_0002615 3300048928 Bacteria 23108
1047 Ga0496125_0007693 3300048928 Bacteria 11419
1048 Ga0496125_0018002 3300048928 Bacteria 6716
1049 Ga0496125_0020557 3300048928 Bacteria 6194
1050 Ga0496125_0028488 3300048928 Bacteria 5043
1051 Ga0496125_0030547 3300048928 Bacteria 4818
1052 Ga0496125_0061660 3300048928 Bacteria 3006
1053 Ga0496125_0085469 3300048928 Bacteria 2390
1054 Ga0496126_0026316 3300048929 Bacteria 5580
1055 Ga0496126_0101028 3300048929 Bacteria 2523
1056 Ga0496126_0180593 3300048929 Bacteria 1793
1057 Ga0495678_000886 3300049459 Bacteria 26599
1058 Ga0495678_001463 3300049459 Bacteria 18521
1059 Ga0495678_002299 3300049459 Bacteria 13202
1060 Ga0495678_002983 3300049459 Bacteria 10791
1061 Ga0495678_017451 3300049459 Bacteria 3253
1062 Ga0495678_019194 3300049459 Bacteria 3055
1063 Ga0495678_021113 3300049459 Bacteria 2872
1064 Ga0495678_026028 3300049459 Bacteria 2504
1065 Ga0495678_028507 3300049459 Bacteria 2354
1066 Ga0495678_035024 3300049459 Bacteria 2061
1067 Ga0495682_0000272 3300049460 Bacteria 40618
1068 Ga0495682_0001892 3300049460 Bacteria 10428
1069 Ga0501292_002082 3300049515 Bacteria 2543
1070 Ga0501320_004253 3300049536 Bacteria 1254
1071 Ga0501034_0000045 3300049571 Bacteria 226186
1072 Ga0501206_001791 3300049653 Bacteria 2695
1073 Ga0501249_014464 3300049679 Bacteria 1682
1074 Ga0501257_021556 3300049686 Bacteria 1520
1075 Ga0501225_0004238 3300049705 Bacteria 4282
1076 Ga0501262_005205 3300049759 Bacteria 1531
1077 nmdc:mga03683_2820_c2 3300050489 Bacteria 2555
1078 nmdc:mga03683_928_c2 3300050489 Bacteria 8011
1079 nmdc:mga03n38_109330_c1 3300050490 Bacteria 1344
1080 nmdc:mga00v17_61558_c1 3300050491 Bacteria 2308
1081 nmdc:mga0yw44_58390_c1 3300050492 Bacteria 2357
1082 nmdc:mga0k408_10021_c2 3300050493 Bacteria 2593
1083 nmdc:mga0k408_102602_c1 3300050493 Bacteria 1687
1084 nmdc:mga0k408_24528_c1 3300050493 Bacteria 3410
1085 nmdc:mga0k408_2645_c1 3300050493 Bacteria 9511
1086 nmdc:mga0k408_4130_c1 3300050493 Bacteria 7713
1087 nmdc:mga0k408_423_c1 3300050493 Bacteria 23086
1088 nmdc:mga0k408_7860_c1 3300050493 Bacteria 5706
1089 nmdc:mga06z11_14429_c1 3300050494 Bacteria 3499
1090 nmdc:mga07m45_1188_c1 3300050496 Bacteria 11752
1091 nmdc:mga07m45_12011_c1 3300050496 Bacteria 4566
1092 nmdc:mga07m45_30000_c1 3300050496 Bacteria 3011
1093 nmdc:mga07m45_54670_c1 3300050496 Bacteria 2256
1094 nmdc:mga07m45_80423_c1 3300050496 Bacteria 1861
1095 nmdc:mga07m45_906_c1 3300050496 Bacteria 12950
1096 nmdc:mga05p37_58672_c1 3300050507 Bacteria 4740
1097 nmdc:mga08y16_90677_c1 3300050511 Bacteria 3186
1098 nmdc:mga0n895_212798_c1 3300050512 Bacteria 1963
1099 nmdc:mga0rr50_25290_c1 3300050513 Bacteria 4125
1100 Ga0500610_0001285 3300053079 Bacteria 8425
1101 Ga0500651_0000746 3300053093 Bacteria 15874
1102 Ga0500571_000063 3300053110 Bacteria 32832
1103 Ga0500593_000254 3300053117 Bacteria 21832
1104 Ga0500593_001808 3300053117 Bacteria 7684
1105 Ga0500594_0007233 3300053118 Bacteria 2509
1106 Ga0500607_001363 3300053121 Bacteria 22191
1107 Ga0500655_001803 3300053133 Bacteria 4013
1108 Ga0500658_0000200 3300053134 Bacteria 28358
1109 Ga0500658_0003834 3300053134 Bacteria 5653
1110 Ga0500568_0000894 3300053139 Bacteria 20725
1111 Ga0500616_0006565 3300053153 Bacteria 7590
1112 Ga0500619_000062 3300053154 Bacteria 32808
1113 Ga0500634_0089140 3300053161 Bacteria 1570
1114 Ga0500636_0001305 3300053177 Bacteria 13524
1115 Ga0500570_042406 3300053724 Bacteria 2366
1116 Ga0500645_000911 3300053730 Bacteria 17004
1117 Ga0500565_001043 3300053734 Bacteria 1740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002739 JGI25158J39367_1010820 JGI25158J39367_10108202 290
2 3300025931 Ga0207644_10043306 Ga0207644_100433065 302
3 3300002774 JGI25150J39212_1007584 JGI25150J39212_10075842 316
4 3300003578 Ga0006562J51391_1103584 Ga0006562J51391_11035842 316
5 3300025245 Ga0207425_1002217 Ga0207425_10022176 316
6 3300003784 Ga0055534_1007685 Ga0055534_10076852 318
7 3300003215 JGI25153J46596_10018077 JGI25153J46596_100180772 319
8 3300003354 JGI25160J50197_1020225 JGI25160J50197_10202252 319
9 3300003374 JGI25161J50226_1001698 JGI25161J50226_10016982 319
10 3300003771 Ga0055526_1003320 Ga0055526_10033209 319
11 3300003775 Ga0055524_1002182 Ga0055524_10021823 319
12 3300003781 Ga0055536_1001476 Ga0055536_100147612 319
13 3300003791 Ga0055530_10001183 Ga0055530_100011833 319
14 3300003792 Ga0055540_1002297 Ga0055540_10022979 319
15 3300003794 Ga0055531_10003333 Ga0055531_100033339 319
16 3300004625 Ga0055543_1001285 Ga0055543_10012859 319
17 3300005262 Ga0065165_1016127 Ga0065165_10161272 319
18 3300025273 Ga0209673_1000701 Ga0209673_100070133 319
19 3300025284 Ga0209130_1000492 Ga0209130_100049227 319
20 3300025291 Ga0209675_1005920 Ga0209675_10059202 319
21 3300025292 Ga0209676_1000005 Ga0209676_1000005209 319
22 3300025295 Ga0209564_1000292 Ga0209564_100029264 319
23 3300025298 Ga0209050_1000007 Ga0209050_1000007888 319
24 3300025299 Ga0209256_1000038 Ga0209256_100003869 319
25 3300025302 Ga0207426_1000090 Ga0207426_100009020 319
26 3300025303 Ga0209051_1000009 Ga0209051_1000009209 319
27 3300025304 Ga0209257_1000011 Ga0209257_1000011183 319
28 3300013105 Ga0157369_10066908 Ga0157369_100669082 320
29 3300045049 Ga0466959_0174986 Ga0466959_0174986_193_1254 325
30 3300025303 Ga0209051_1007470 Ga0209051_10074705 326
31 3300028794 Ga0307515_10000291 Ga0307515_1000029186 326
32 3300031507 Ga0307509_10004038 Ga0307509_1000403810 326
33 3300031616 Ga0307508_10000727 Ga0307508_100007272 326
34 3300031616 Ga0307508_10170067 Ga0307508_101700672 326
35 3300031730 Ga0307516_10002058 Ga0307516_100020587 326
36 3300031456 Ga0307513_10091485 Ga0307513_100914852 327
37 3300048908 Ga0496105_0198254 Ga0496105_0198254_490_1620 327
38 3300017792 Ga0163161_10139054 Ga0163161_101390542 328
39 3300031730 Ga0307516_10063622 Ga0307516_100636222 329
40 3300053117 Ga0500593_000254 Ga0500593_000254_11222_12316 329
41 3300005356 Ga0070674_100003297 Ga0070674_10000329712 330
42 3300005367 Ga0070667_100003893 Ga0070667_10000389316 330
43 3300005459 Ga0068867_100111383 Ga0068867_1001113832 330
44 3300005548 Ga0070665_100116265 Ga0070665_1001162652 330
45 3300006237 Ga0097621_100364102 Ga0097621_1003641021 330
46 3300006881 Ga0068865_100328123 Ga0068865_1003281231 330
47 3300013306 Ga0163162_10496190 Ga0163162_104961901 330
48 3300014969 Ga0157376_10009486 Ga0157376_100094866 330
49 3300025907 Ga0207645_10152063 Ga0207645_101520631 330
50 3300025937 Ga0207669_10053809 Ga0207669_100538092 330
51 3300026089 Ga0207648_10089379 Ga0207648_100893793 330
52 3300013306 Ga0163162_10042713 Ga0163162_100427133 331
53 3300026089 Ga0207648_10080143 Ga0207648_100801433 331
54 3300050493 nmdc:mga0k408_24528_c1 nmdc:mga0k408_24528_c1_228_1325 331
55 3300005366 Ga0070659_100205529 Ga0070659_1002055291 332
56 3300025916 Ga0207663_10084404 Ga0207663_100844042 332
57 3300025932 Ga0207690_10095842 Ga0207690_100958422 332
58 3300025945 Ga0207679_10057717 Ga0207679_100577172 332
59 3300009147 Ga0114129_10033329 Ga0114129_100333292 333
60 3300050507 nmdc:mga05p37_58672_c1 nmdc:mga05p37_58672_c1_677_1747 333
61 3300001979 JGI24740J21852_10008234 JGI24740J21852_100082342 335
62 3300001979 JGI24740J21852_10012589 JGI24740J21852_100125892 335
63 3300001989 JGI24739J22299_10025539 JGI24739J22299_100255392 335
64 3300003761 Ga0055535_1000299 Ga0055535_100029923 335
65 3300003762 Ga0055542_1000328 Ga0055542_100032825 335
66 3300003781 Ga0055536_1005320 Ga0055536_10053203 335
67 3300003781 Ga0055536_1015196 Ga0055536_10151963 335
68 3300003790 Ga0055528_1007065 Ga0055528_10070656 335
69 3300003791 Ga0055530_10000765 Ga0055530_1000076512 335
70 3300003791 Ga0055530_10031609 Ga0055530_100316091 335
71 3300003792 Ga0055540_1002031 Ga0055540_10020313 335
72 3300003792 Ga0055540_1024097 Ga0055540_10240971 335
73 3300003794 Ga0055531_10001255 Ga0055531_1000125518 335
74 3300005539 Ga0068853_100026185 Ga0068853_1000261852 335
75 3300005564 Ga0070664_100080048 Ga0070664_1000800483 335
76 3300005577 Ga0068857_100065437 Ga0068857_1000654374 335
77 3300005616 Ga0068852_100078454 Ga0068852_1000784542 335
78 3300006358 Ga0068871_100138439 Ga0068871_1001384391 335
79 3300009036 Ga0105244_10005280 Ga0105244_100052803 335
80 3300009148 Ga0105243_10001964 Ga0105243_100019644 335
81 3300010375 Ga0105239_10189182 Ga0105239_101891822 335
82 3300011119 Ga0105246_10005790 Ga0105246_100057908 335
83 3300013102 Ga0157371_10063988 Ga0157371_100639883 335
84 3300013105 Ga0157369_10392271 Ga0157369_103922712 335
85 3300014497 Ga0182008_10001936 Ga0182008_1000193611 335
86 3300014969 Ga0157376_10239932 Ga0157376_102399322 335
87 3300015261 Ga0182006_1002072 Ga0182006_10020722 335
88 3300015262 Ga0182007_10001773 Ga0182007_1000177312 335
89 3300025228 Ga0209672_100981 Ga0209672_10098112 335
90 3300025229 Ga0209147_101820 Ga0209147_1018203 335
91 3300025242 Ga0209258_100416 Ga0209258_10041623 335
92 3300025245 Ga0207425_1000379 Ga0207425_100037917 335
93 3300025254 Ga0209148_1000033 Ga0209148_1000033506 335
94 3300025258 Ga0209129_1000274 Ga0209129_100027426 335
95 3300025263 Ga0209565_1000483 Ga0209565_100048313 335
96 3300025263 Ga0209565_1003831 Ga0209565_10038313 335
97 3300025273 Ga0209673_1000619 Ga0209673_100061926 335
98 3300025273 Ga0209673_1001091 Ga0209673_100109114 335
99 3300025284 Ga0209130_1000430 Ga0209130_100043017 335
100 3300025284 Ga0209130_1000603 Ga0209130_100060311 335
101 3300025284 Ga0209130_1001093 Ga0209130_100109311 335
102 3300025291 Ga0209675_1000343 Ga0209675_100034319 335
103 3300025291 Ga0209675_1014770 Ga0209675_10147701 335
104 3300025292 Ga0209676_1000088 Ga0209676_1000088218 335
105 3300025292 Ga0209676_1001603 Ga0209676_10016033 335
106 3300025292 Ga0209676_1001871 Ga0209676_100187117 335
107 3300025292 Ga0209676_1004099 Ga0209676_10040994 335
108 3300025294 Ga0209025_1000994 Ga0209025_100099422 335
109 3300025294 Ga0209025_1002988 Ga0209025_10029887 335
110 3300025295 Ga0209564_1000684 Ga0209564_100068426 335
111 3300025295 Ga0209564_1000816 Ga0209564_100081626 335
112 3300025297 Ga0209758_1000691 Ga0209758_100069126 335
113 3300025297 Ga0209758_1031681 Ga0209758_10316812 335
114 3300025298 Ga0209050_1000110 Ga0209050_100011025 335
115 3300025298 Ga0209050_1000447 Ga0209050_100044750 335
116 3300025299 Ga0209256_1000065 Ga0209256_1000065210 335
117 3300025299 Ga0209256_1000591 Ga0209256_100059127 335
118 3300025302 Ga0207426_1000124 Ga0207426_1000124185 335
119 3300025302 Ga0207426_1000568 Ga0207426_100056826 335
120 3300025303 Ga0209051_1000578 Ga0209051_100057818 335
121 3300025303 Ga0209051_1000686 Ga0209051_100068624 335
122 3300025304 Ga0209257_1000093 Ga0209257_100009326 335
123 3300025304 Ga0209257_1000417 Ga0209257_100041753 335
124 3300025321 Ga0207656_10085454 Ga0207656_100854541 335
125 3300025728 Ga0207655_1004450 Ga0207655_10044502 335
126 3300025935 Ga0207709_10001498 Ga0207709_100014988 335
127 3300025942 Ga0207689_10132289 Ga0207689_101322892 335
128 3300025945 Ga0207679_10009831 Ga0207679_100098315 335
129 3300026041 Ga0207639_10005536 Ga0207639_100055367 335
130 3300026067 Ga0207678_10127927 Ga0207678_101279273 335
131 3300026116 Ga0207674_10057396 Ga0207674_100573961 335
132 3300048919 Ga0496116_0032359 Ga0496116_0032359_1885_2955 335
133 3300048925 Ga0496122_0015718 Ga0496122_0015718_3098_4282 335
134 3300048926 Ga0496123_0034769 Ga0496123_0034769_2003_3175 335
135 3300048928 Ga0496125_0002615 Ga0496125_0002615_18890_20074 335
136 3300048928 Ga0496125_0030547 Ga0496125_0030547_370_1440 335
137 3300050496 nmdc:mga07m45_54670_c1 nmdc:mga07m45_54670_c1_931_2001 335
138 3300046537 Ga0495598_0036325 Ga0495598_0036325_17_1039 336
139 3300006946 Ga0079104_1000451 Ga0079104_100045136 337
140 3300009148 Ga0105243_10002688 Ga0105243_100026882 337
141 3300025935 Ga0207709_10000152 Ga0207709_100001527 337
142 3300025986 Ga0207658_10225489 Ga0207658_102254892 337
143 3300027111 Ga0209281_1000072 Ga0209281_100007248 337
144 3300046512 Ga0495610_0025505 Ga0495610_0025505_1985_3055 337
145 3300046513 Ga0495616_0002475 Ga0495616_0002475_9706_10776 337
146 3300046518 Ga0495631_0000289 Ga0495631_0000289_19303_20373 337
147 3300046530 Ga0495654_0042852 Ga0495654_0042852_347_1417 337
148 3300046558 Ga0495633_0010978 Ga0495633_0010978_2793_3809 337
149 3300046660 Ga0495625_0019516 Ga0495625_0019516_2073_3143 337
150 3300047321 Ga0495676_0135383 Ga0495676_0135383_266_1336 337
151 3300048921 Ga0496118_0013177 Ga0496118_0013177_6152_7222 337
152 3300048924 Ga0496121_0102423 Ga0496121_0102423_281_1351 337
153 3300048929 Ga0496126_0180593 Ga0496126_0180593_88_1158 337
154 3300053093 Ga0500651_0000746 Ga0500651_0000746_13734_14804 337
155 3300053110 Ga0500571_000063 Ga0500571_000063_24227_25297 337
156 3300053118 Ga0500594_0007233 Ga0500594_0007233_1324_2394 337
157 3300053133 Ga0500655_001803 Ga0500655_001803_1435_2505 337
158 3300053134 Ga0500658_0000200 Ga0500658_0000200_1950_3020 337
159 3300053134 Ga0500658_0003834 Ga0500658_0003834_2528_3598 337
160 3300053139 Ga0500568_0000894 Ga0500568_0000894_1526_2596 337
161 3300053153 Ga0500616_0006565 Ga0500616_0006565_324_1394 337
162 3300053177 Ga0500636_0001305 Ga0500636_0001305_1447_2517 337
163 3300053734 Ga0500565_001043 Ga0500565_001043_24_1094 337
164 3300009092 Ga0105250_10000318 Ga0105250_100003184 338
165 3300009094 Ga0111539_10165425 Ga0111539_101654252 338
166 3300014325 Ga0163163_10280482 Ga0163163_102804823 338
167 3300025711 Ga0207696_1000960 Ga0207696_100096018 338
168 3300048924 Ga0496121_0004254 Ga0496121_0004254_13505_14638 339
169 3300048928 Ga0496125_0018002 Ga0496125_0018002_3097_4230 339
170 3300050511 nmdc:mga08y16_90677_c1 nmdc:mga08y16_90677_c1_376_1497 340
171 iso_pu_bacteria 2831265667 2831270368 340
172 iso_pu_bacteria 2838054893 2838056596 340
173 3300005614 Ga0068856_100064902 Ga0068856_1000649023 341
174 3300013306 Ga0163162_10438395 Ga0163162_104383951 341
175 3300025949 Ga0207667_10173768 Ga0207667_101737682 341
176 3300041997 Ga0439431_0004532 Ga0439431_0004532_31_1101 341
177 3300042133 Ga0450896_009371 Ga0450896_009371_267_1337 341
178 3300046615 Ga0495656_0037601 Ga0495656_0037601_523_1590 341
179 3300048911 Ga0496108_0077219 Ga0496108_0077219_901_1968 341
180 3300048913 Ga0496110_0028388 Ga0496110_0028388_2598_3665 341
181 3300003773 Ga0055537_1000486 Ga0055537_100048622 342
182 3300003784 Ga0055534_1000439 Ga0055534_100043922 342
183 3300003790 Ga0055528_1001893 Ga0055528_100189310 342
184 3300005843 Ga0068860_100447017 Ga0068860_1004470171 342
185 3300006353 Ga0075370_10012063 Ga0075370_100120634 342
186 3300006948 Ga0099826_10001915 Ga0099826_1000191511 342
187 3300009176 Ga0105242_10003311 Ga0105242_100033117 342
188 3300025263 Ga0209565_1000020 Ga0209565_10000209 342
189 3300025273 Ga0209673_1000072 Ga0209673_1000072191 342
190 3300025291 Ga0209675_1000640 Ga0209675_10006405 342
191 3300025934 Ga0207686_10030944 Ga0207686_100309443 342
192 3300027666 Ga0209282_1000713 Ga0209282_100071311 342
193 3300031649 Ga0307514_10055648 Ga0307514_100556484 342
194 3300044719 Ga0466971_0019319 Ga0466971_0019319_1635_2729 342
195 3300049759 Ga0501262_005205 Ga0501262_005205_54_1226 342
196 3300003578 Ga0006562J51391_1068686 Ga0006562J51391_10686865 343
197 3300003578 Ga0006562J51391_1068687 Ga0006562J51391_10686872 343
198 3300003792 Ga0055540_1005987 Ga0055540_10059872 343
199 3300005288 Ga0065714_10110456 Ga0065714_101104562 343
200 3300013100 Ga0157373_10020015 Ga0157373_100200152 343
201 3300014497 Ga0182008_10000683 Ga0182008_100006834 343
202 3300014497 Ga0182008_10020764 Ga0182008_100207643 343
203 3300015261 Ga0182006_1036329 Ga0182006_10363292 343
204 3300015261 Ga0182006_1083392 Ga0182006_10833921 343
205 3300025292 Ga0209676_1025051 Ga0209676_10250512 343
206 3300025303 Ga0209051_1001721 Ga0209051_100172117 343
207 3300026116 Ga0207674_10259429 Ga0207674_102594291 343
208 3300046660 Ga0495625_0016218 Ga0495625_0016218_1922_2974 343
209 3300046692 Ga0495671_0006371 Ga0495671_0006371_1766_2818 343
210 3300048924 Ga0496121_0006997 Ga0496121_0006997_12582_13634 343
211 3300050489 nmdc:mga03683_2820_c2 nmdc:mga03683_2820_c2_1261_2331 343
212 3300006177 Ga0075362_10000753 Ga0075362_100007533 344
213 3300006195 Ga0075366_10016386 Ga0075366_100163864 344
214 3300006353 Ga0075370_10004610 Ga0075370_100046104 344
215 3300014497 Ga0182008_10002949 Ga0182008_100029492 344
216 3300015262 Ga0182007_10026904 Ga0182007_100269041 344
217 3300015683 Ga0183362_10012 Ga0183362_100125 344
218 3300026121 Ga0207683_10186206 Ga0207683_101862062 344
219 3300032002 Ga0307416_100202600 Ga0307416_1002026001 344
220 3300037471 Ga0395905_0203969 Ga0395905_0203969_703_1770 344
221 3300041406 Ga0439439_0024603 Ga0439439_0024603_230_1300 344
222 3300042007 Ga0439449_0001688 Ga0439449_0001688_6985_8055 344
223 3300050489 nmdc:mga03683_928_c2 nmdc:mga03683_928_c2_1840_2910 344
224 3300050493 nmdc:mga0k408_102602_c1 nmdc:mga0k408_102602_c1_52_1122 344
225 3300050496 nmdc:mga07m45_1188_c1 nmdc:mga07m45_1188_c1_4780_5850 344
226 3300027717 Ga0209998_10019890 Ga0209998_100198902 345
227 3300031548 Ga0307408_100271332 Ga0307408_1002713321 345
228 3300046674 Ga0495588_0058881 Ga0495588_0058881_666_1733 345
229 3300021361 Ga0213872_10059729 Ga0213872_100597292 346
230 3300047443 Ga0495687_018160 Ga0495687_018160_459_1499 346
231 3300007265 Ga0099794_10060092 Ga0099794_100600923 347
232 3300009011 Ga0105251_10019616 Ga0105251_100196165 347
233 3300025735 Ga0207713_1018972 Ga0207713_10189721 347
234 3300027876 Ga0209974_10015358 Ga0209974_100153582 347
235 3300048906 Ga0496103_0130400 Ga0496103_0130400_316_1533 347
236 3300048907 Ga0496104_0048919 Ga0496104_0048919_2373_3590 347
237 3300048909 Ga0496106_0148329 Ga0496106_0148329_272_1489 347
238 iso_pu_bacteria 2932422444 2932425666 347
239 3300005364 Ga0070673_100177201 Ga0070673_1001772012 348
240 3300005367 Ga0070667_100140257 Ga0070667_1001402572 348
241 3300017792 Ga0163161_10073096 Ga0163161_100730962 348
242 3300025986 Ga0207658_10078826 Ga0207658_100788262 348
243 3300031251 Ga0265327_10015797 Ga0265327_100157973 348
244 3300037471 Ga0395905_0109594 Ga0395905_0109594_425_1483 348
245 3300037471 Ga0395905_0156373 Ga0395905_0156373_948_2051 348
246 iso_pu_bacteria 2511231221 2512037190 348
247 3300031251 Ga0265327_10015944 Ga0265327_100159443 349
248 3300039447 Ga0436361_0881506 Ga0436361_0881506_7209_8270 349
249 iso_pu_bacteria 2599185214 2599627237 349
250 iso_pu_bacteria 2599185226 2599676652 349
251 iso_pu_bacteria 2599185227 2599680054 349
252 iso_pu_bacteria 2599185229 2599692070 349
253 3300013297 Ga0157378_10218865 Ga0157378_102188651 350
254 3300014969 Ga0157376_10012434 Ga0157376_100124342 350
255 3300026023 Ga0207677_10067819 Ga0207677_100678193 350
256 3300027907 Ga0207428_10090969 Ga0207428_100909692 350
257 3300031730 Ga0307516_10001343 Ga0307516_1000134315 350
258 3300037471 Ga0395905_0213175 Ga0395905_0213175_236_1303 350
259 3300042532 Ga0450893_0000471 Ga0450893_0000471_3453_4523 350
260 3300044712 Ga0453684_0224091 Ga0453684_0224091_534_1592 350
261 3300049459 Ga0495678_000886 Ga0495678_000886_25524_26576 350
262 iso_pu_bacteria 2842718218 2842718311 350
263 iso_pu_bacteria 2945909444 2945909478 350
264 3300002773 JGI25152J39213_1001784 JGI25152J39213_10017843 351
265 3300002774 JGI25150J39212_1001005 JGI25150J39212_10010053 351
266 3300002987 JGI25159J45721_1001874 JGI25159J45721_10018743 351
267 3300003187 JGI25151J46595_10003438 JGI25151J46595_100034383 351
268 3300003215 JGI25153J46596_10003506 JGI25153J46596_100035065 351
269 3300003354 JGI25160J50197_1001958 JGI25160J50197_10019587 351
270 3300003374 JGI25161J50226_1001009 JGI25161J50226_10010097 351
271 3300003771 Ga0055526_1003553 Ga0055526_10035533 351
272 3300003773 Ga0055537_1001368 Ga0055537_10013683 351
273 3300003775 Ga0055524_1002357 Ga0055524_10023573 351
274 3300003784 Ga0055534_1000391 Ga0055534_100039118 351
275 3300003790 Ga0055528_1002502 Ga0055528_10025023 351
276 3300003792 Ga0055540_1015362 Ga0055540_10153622 351
277 3300003794 Ga0055531_10004286 Ga0055531_100042863 351
278 3300004625 Ga0055543_1001493 Ga0055543_10014932 351
279 3300005262 Ga0065165_1000692 Ga0065165_10006927 351
280 3300006195 Ga0075366_10000612 Ga0075366_1000061210 351
281 3300009011 Ga0105251_10014391 Ga0105251_100143912 351
282 3300009176 Ga0105242_10003610 Ga0105242_1000361012 351
283 3300025245 Ga0207425_1000386 Ga0207425_100038618 351
284 3300025258 Ga0209129_1000013 Ga0209129_1000013160 351
285 3300025263 Ga0209565_1000207 Ga0209565_100020725 351
286 3300025273 Ga0209673_1000316 Ga0209673_100031649 351
287 3300025284 Ga0209130_1000158 Ga0209130_100015856 351
288 3300025291 Ga0209675_1000130 Ga0209675_100013068 351
289 3300025292 Ga0209676_1002542 Ga0209676_10025425 351
290 3300025294 Ga0209025_1000169 Ga0209025_1000169118 351
291 3300025295 Ga0209564_1000171 Ga0209564_1000171118 351
292 3300025297 Ga0209758_1000067 Ga0209758_100006795 351
293 3300025299 Ga0209256_1000121 Ga0209256_1000121118 351
294 3300025302 Ga0207426_1000101 Ga0207426_1000101160 351
295 3300025303 Ga0209051_1004300 Ga0209051_10043008 351
296 3300025304 Ga0209257_1000780 Ga0209257_100078020 351
297 3300025735 Ga0207713_1013434 Ga0207713_10134342 351
298 3300025934 Ga0207686_10153404 Ga0207686_101534041 351
299 3300028794 Ga0307515_10005133 Ga0307515_1000513314 351
300 3300028794 Ga0307515_10005432 Ga0307515_100054328 351
301 3300031456 Ga0307513_10017129 Ga0307513_100171292 351
302 3300031507 Ga0307509_10211721 Ga0307509_102117212 351
303 3300031616 Ga0307508_10000269 Ga0307508_1000026922 351
304 3300031730 Ga0307516_10013675 Ga0307516_100136759 351
305 3300041443 Ga0451789_0743220 Ga0451789_0743220_230_1312 351
306 3300042007 Ga0439449_0023035 Ga0439449_0023035_1055_2119 351
307 3300046512 Ga0495610_0034754 Ga0495610_0034754_271_1353 351
308 3300046519 Ga0495632_0052412 Ga0495632_0052412_150_1232 351
309 3300046660 Ga0495625_0010661 Ga0495625_0010661_1095_2177 351
310 3300048905 Ga0496102_0001319 Ga0496102_0001319_2440_3522 351
311 3300048926 Ga0496123_0020558 Ga0496123_0020558_391_1479 351
312 3300048927 Ga0496124_0008900 Ga0496124_0008900_185_1273 351
313 3300048928 Ga0496125_0061660 Ga0496125_0061660_306_1394 351
314 3300050493 nmdc:mga0k408_423_c1 nmdc:mga0k408_423_c1_11618_12700 351
315 3300050496 nmdc:mga07m45_80423_c1 nmdc:mga07m45_80423_c1_409_1491 351
316 3300053154 Ga0500619_000062 Ga0500619_000062_8191_9276 351
317 3300053724 Ga0500570_042406 Ga0500570_042406_818_1987 351
318 iso_pu_bacteria 2513020051 2513230542 351
319 iso_pu_bacteria 2585428062 2587758053 351
320 iso_pu_bacteria 2599185214 2599626079 351
321 iso_pu_bacteria 2599185226 2599677720 351
322 iso_pu_bacteria 2599185227 2599682399 351
323 iso_pu_bacteria 2599185229 2599697455 351
324 iso_pu_bacteria 2643221609 2644057574 351
325 iso_pu_bacteria 2643221611 2644072337 351
326 iso_pu_bacteria 2643221628 2644163964 351
327 iso_pu_bacteria 2643221654 2644303185 351
328 iso_pu_bacteria 2643221658 2644326704 351
329 iso_pu_bacteria 2643221672 2644400035 351
330 iso_pu_bacteria 2643221683 2644466572 351
331 iso_pu_bacteria 2738541277 2738721623 351
332 iso_pu_bacteria 2738541307 2738880949 351
333 iso_pu_bacteria 2738543012 2739241845 351
334 iso_pu_bacteria 2738543019 2739281292 351
335 iso_pu_bacteria 2816332133 2816470850 351
336 iso_pu_bacteria 2818991446 2819601370 351
337 iso_pu_bacteria 2831265667 2831272380 351
338 iso_pu_bacteria 2838054893 2838059537 351
339 iso_pu_bacteria 2842677519 2842682785 351
340 iso_pu_bacteria 2842733646 2842733760 351
341 iso_pu_bacteria 2842747753 2842752266 351
342 iso_pu_bacteria 2885192300 2885193273 351
343 iso_pu_bacteria 2885198086 2885202737 351
344 iso_pu_bacteria 2885211737 2885216867 351
345 iso_pu_bacteria 2899924645 2899926899 351
346 iso_pu_bacteria 2904449895 2904452839 351
347 iso_pu_bacteria 2904456579 2904460132 351
348 iso_pu_bacteria 2904541872 2904547322 351
349 iso_pu_bacteria 2919462493 2919463540 351
350 iso_pu_bacteria 2928037797 2928040678 351
351 iso_pu_bacteria 2928044640 2928047520 351
352 iso_pu_bacteria 2928051484 2928055297 351
353 iso_pu_bacteria 2928064002 2928069397 351
354 iso_pu_bacteria 2928070936 2928078424 351
355 iso_pu_bacteria 2928084124 2928089588 351
356 iso_pu_bacteria 2928115317 2928121202 351
357 iso_pu_bacteria 2929160207 2929165835 351
358 iso_pu_bacteria 2929520902 2929525819 351
359 iso_pu_bacteria 2945945610 2945945630 351
360 iso_pu_bacteria 2945972063 2945975279 351
361 iso_pu_bacteria 2945984333 2945988541 351
362 iso_pu_bacteria 2954767861 2954769287 351
363 3300005457 Ga0070662_100069938 Ga0070662_1000699382 352
364 3300005616 Ga0068852_100024127 Ga0068852_1000241273 352
365 3300005617 Ga0068859_100191343 Ga0068859_1001913432 352
366 3300005844 Ga0068862_100259589 Ga0068862_1002595892 352
367 3300006178 Ga0075367_10117140 Ga0075367_101171402 352
368 3300006195 Ga0075366_10004969 Ga0075366_100049697 352
369 3300006195 Ga0075366_10013083 Ga0075366_100130835 352
370 3300006195 Ga0075366_10100843 Ga0075366_101008432 352
371 3300006353 Ga0075370_10011070 Ga0075370_100110701 352
372 3300006931 Ga0097620_100191347 Ga0097620_1001913472 352
373 3300009093 Ga0105240_10027286 Ga0105240_100272866 352
374 3300009148 Ga0105243_10326843 Ga0105243_103268431 352
375 3300009545 Ga0105237_10097664 Ga0105237_100976643 352
376 3300025913 Ga0207695_10094878 Ga0207695_100948782 352
377 3300025914 Ga0207671_10020189 Ga0207671_100201893 352
378 3300025933 Ga0207706_10006446 Ga0207706_100064462 352
379 3300026041 Ga0207639_10049140 Ga0207639_100491401 352
380 3300028794 Ga0307515_10223077 Ga0307515_102230772 352
381 3300031456 Ga0307513_10278630 Ga0307513_102786302 352
382 3300037471 Ga0395905_0004162 Ga0395905_0004162_10747_11817 352
383 3300037471 Ga0395905_0411658 Ga0395905_0411658_50_1120 352
384 3300039437 Ga0436365_0774305 Ga0436365_0774305_11346_12422 352
385 3300039447 Ga0436361_0483449 Ga0436361_0483449_1286_2362 352
386 3300039447 Ga0436361_0847829 Ga0436361_0847829_2249_3325 352
387 3300042115 Ga0450911_000171 Ga0450911_000171_17439_18575 352
388 3300044683 Ga0466965_0030014 Ga0466965_0030014_1065_2144 352
389 3300044712 Ga0453684_0052686 Ga0453684_0052686_3931_4989 352
390 3300044901 Ga0466960_0036212 Ga0466960_0036212_1044_2123 352
391 3300047443 Ga0495687_002015 Ga0495687_002015_8366_9460 352
392 3300048928 Ga0496125_0020557 Ga0496125_0020557_2424_3560 352
393 3300050493 nmdc:mga0k408_4130_c1 nmdc:mga0k408_4130_c1_2370_3467 352
394 3300050493 nmdc:mga0k408_7860_c1 nmdc:mga0k408_7860_c1_229_1299 352
395 3300050496 nmdc:mga07m45_12011_c1 nmdc:mga07m45_12011_c1_3378_4457 352
396 3300050496 nmdc:mga07m45_30000_c1 nmdc:mga07m45_30000_c1_662_1759 352
397 3300003781 Ga0055536_1006454 Ga0055536_10064545 353
398 3300003790 Ga0055528_1019872 Ga0055528_10198722 353
399 3300003792 Ga0055540_1003604 Ga0055540_10036045 353
400 3300005288 Ga0065714_10068098 Ga0065714_100680983 353
401 3300005618 Ga0068864_100031830 Ga0068864_1000318305 353
402 3300005844 Ga0068862_100007521 Ga0068862_1000075217 353
403 3300006038 Ga0075365_10120912 Ga0075365_101209121 353
404 3300006048 Ga0075363_100029076 Ga0075363_1000290762 353
405 3300006048 Ga0075363_100058099 Ga0075363_1000580991 353
406 3300006048 Ga0075363_100068069 Ga0075363_1000680691 353
407 3300006177 Ga0075362_10018867 Ga0075362_100188673 353
408 3300006195 Ga0075366_10016384 Ga0075366_100163845 353
409 3300006353 Ga0075370_10017611 Ga0075370_100176111 353
410 3300006944 Ga0099823_1000045 Ga0099823_100004511 353
411 3300009036 Ga0105244_10000913 Ga0105244_1000091311 353
412 3300009093 Ga0105240_10122651 Ga0105240_101226513 353
413 3300009148 Ga0105243_10004626 Ga0105243_100046264 353
414 3300009177 Ga0105248_10089700 Ga0105248_100897002 353
415 3300009545 Ga0105237_10009474 Ga0105237_100094746 353
416 3300011119 Ga0105246_10067584 Ga0105246_100675842 353
417 3300013104 Ga0157370_10044736 Ga0157370_100447364 353
418 3300013104 Ga0157370_10053938 Ga0157370_100539382 353
419 3300013105 Ga0157369_10132270 Ga0157369_101322702 353
420 3300014497 Ga0182008_10011794 Ga0182008_100117944 353
421 3300017792 Ga0163161_10000721 Ga0163161_1000072122 353
422 3300017792 Ga0163161_10008553 Ga0163161_100085535 353
423 3300021384 Ga0213876_10047687 Ga0213876_100476873 353
424 3300025273 Ga0209673_1004823 Ga0209673_10048232 353
425 3300025284 Ga0209130_1001975 Ga0209130_100197511 353
426 3300025291 Ga0209675_1002208 Ga0209675_10022081 353
427 3300025291 Ga0209675_1004566 Ga0209675_10045665 353
428 3300025292 Ga0209676_1002102 Ga0209676_100210211 353
429 3300025294 Ga0209025_1001450 Ga0209025_100145030 353
430 3300025294 Ga0209025_1001908 Ga0209025_100190814 353
431 3300025294 Ga0209025_1024133 Ga0209025_10241333 353
432 3300025294 Ga0209025_1039132 Ga0209025_10391322 353
433 3300025298 Ga0209050_1011717 Ga0209050_10117173 353
434 3300025303 Ga0209051_1000285 Ga0209051_100028570 353
435 3300025304 Ga0209257_1038720 Ga0209257_10387202 353
436 3300025728 Ga0207655_1000180 Ga0207655_1000180110 353
437 3300025920 Ga0207649_10168624 Ga0207649_101686241 353
438 3300025935 Ga0207709_10000941 Ga0207709_1000094113 353
439 3300025935 Ga0207709_10006321 Ga0207709_100063212 353
440 3300025941 Ga0207711_10154529 Ga0207711_101545291 353
441 3300026095 Ga0207676_10250380 Ga0207676_102503801 353
442 3300027296 Ga0209389_1000013 Ga0209389_1000013141 353
443 3300028786 Ga0307517_10151323 Ga0307517_101513232 353
444 3300028794 Ga0307515_10000975 Ga0307515_1000097542 353
445 3300028794 Ga0307515_10171969 Ga0307515_101719692 353
446 3300030733 Ga0314311_1177087 Ga0314311_11770873 353
447 3300030735 Ga0316178_1009884 Ga0316178_10098843 353
448 3300031344 Ga0265316_10000069 Ga0265316_1000006967 353
449 3300031456 Ga0307513_10000070 Ga0307513_1000007068 353
450 3300031456 Ga0307513_10139894 Ga0307513_101398941 353
451 3300031548 Ga0307408_100000153 Ga0307408_10000015324 353
452 3300031901 Ga0307406_10001388 Ga0307406_1000138811 353
453 3300031911 Ga0307412_10009459 Ga0307412_100094594 353
454 3300037853 Ga0436364_0403586 Ga0436364_0403586_1179_2261 353
455 3300041407 Ga0439447_005002 Ga0439447_005002_130_1200 353
456 3300041413 Ga0439465_0002274 Ga0439465_0002274_3103_4173 353
457 3300041997 Ga0439431_0000366 Ga0439431_0000366_5983_7053 353
458 3300041999 Ga0439433_0002847 Ga0439433_0002847_437_1507 353
459 3300042002 Ga0439442_004724 Ga0439442_004724_197_1369 353
460 3300042002 Ga0439442_023138 Ga0439442_023138_128_1198 353
461 3300042006 Ga0439432_001142 Ga0439432_001142_904_1974 353
462 3300042007 Ga0439449_0019436 Ga0439449_0019436_271_1341 353
463 3300042014 Ga0439457_007351 Ga0439457_007351_129_1199 353
464 3300042147 Ga0450910_001417 Ga0450910_001417_1751_2923 353
465 3300042156 Ga0439446_0002138 Ga0439446_0002138_521_1591 353
466 3300042184 Ga0450908_001783 Ga0450908_001783_123_1295 353
467 3300042435 Ga0439434_0003716 Ga0439434_0003716_264_1334 353
468 3300042435 Ga0439434_0035996 Ga0439434_0035996_231_1403 353
469 3300042532 Ga0450893_0004453 Ga0450893_0004453_1007_2179 353
470 3300042876 Ga0451577_0082142 Ga0451577_0082142_1525_2586 353
471 3300044712 Ga0453684_0023821 Ga0453684_0023821_3574_4635 353
472 3300044712 Ga0453684_0316398 Ga0453684_0316398_679_1740 353
473 3300045051 Ga0451576_0115679 Ga0451576_0115679_1659_2720 353
474 3300046453 Ga0495627_004267 Ga0495627_004267_3278_4348 353
475 3300046453 Ga0495627_012922 Ga0495627_012922_48_1118 353
476 3300046507 Ga0495606_0163474 Ga0495606_0163474_12_1082 353
477 3300046515 Ga0495620_0000037 Ga0495620_0000037_89393_90481 353
478 3300046522 Ga0495643_0000476 Ga0495643_0000476_10994_12082 353
479 3300046524 Ga0495648_0016479 Ga0495648_0016479_4138_5226 353
480 3300046539 Ga0495621_0001102 Ga0495621_0001102_2508_3608 353
481 3300046615 Ga0495656_0003574 Ga0495656_0003574_141_1211 353
482 3300046660 Ga0495625_0000235 Ga0495625_0000235_21128_22198 353
483 3300046674 Ga0495588_0027446 Ga0495588_0027446_1190_2260 353
484 3300048911 Ga0496108_0108097 Ga0496108_0108097_992_2104 353
485 3300048912 Ga0496109_0110422 Ga0496109_0110422_193_1305 353
486 3300048915 Ga0496112_0028541 Ga0496112_0028541_2896_4008 353
487 3300048927 Ga0496124_0118392 Ga0496124_0118392_60_1130 353
488 3300049571 Ga0501034_0000045 Ga0501034_0000045_9972_11060 353
489 3300049679 Ga0501249_014464 Ga0501249_014464_119_1189 353
490 3300049705 Ga0501225_0004238 Ga0501225_0004238_3034_4104 353
491 3300050490 nmdc:mga03n38_109330_c1 nmdc:mga03n38_109330_c1_151_1221 353
492 3300050491 nmdc:mga00v17_61558_c1 nmdc:mga00v17_61558_c1_1050_2120 353
493 3300050492 nmdc:mga0yw44_58390_c1 nmdc:mga0yw44_58390_c1_178_1248 353
494 3300050494 nmdc:mga06z11_14429_c1 nmdc:mga06z11_14429_c1_43_1113 353
495 3300053079 Ga0500610_0001285 Ga0500610_0001285_1298_2368 353
496 3300053117 Ga0500593_001808 Ga0500593_001808_1408_2478 353
497 3300053121 Ga0500607_001363 Ga0500607_001363_19868_20938 353
498 3300053161 Ga0500634_0089140 Ga0500634_0089140_234_1304 353
499 3300053730 Ga0500645_000911 Ga0500645_000911_14401_15480 353
500 iso_pu_bacteria 2547132374 2548499367 353
501 iso_pu_bacteria 2643221544 2643745542 353
502 iso_pu_bacteria 2643221570 2643866195 353
503 iso_pu_bacteria 2643221596 2643994194 353
504 iso_pu_bacteria 2643221646 2644257836 353
505 iso_pu_bacteria 2643221652 2644293005 353
506 iso_pu_bacteria 2643221656 2644317723 353
507 iso_pu_bacteria 2643221717 2644648025 353
508 iso_pu_bacteria 2738541281 2738744696 353
509 iso_pu_bacteria 2738543032 2739353926 353
510 iso_pu_bacteria 2990710928 2990714254 353
511 3300003316 rootH1_10003336 rootH1_100033369 354
512 3300003322 rootL2_10028827 rootL2_1002882715 354
513 3300006195 Ga0075366_10084247 Ga0075366_100842472 354
514 3300006353 Ga0075370_10007052 Ga0075370_100070524 354
515 3300009093 Ga0105240_10004595 Ga0105240_1000459514 354
516 3300009148 Ga0105243_10050342 Ga0105243_100503422 354
517 3300009545 Ga0105237_10001782 Ga0105237_1000178214 354
518 3300009551 Ga0105238_10010668 Ga0105238_100106684 354
519 3300010375 Ga0105239_10001826 Ga0105239_1000182615 354
520 3300025913 Ga0207695_10063283 Ga0207695_100632832 354
521 3300025914 Ga0207671_10016471 Ga0207671_100164713 354
522 3300025924 Ga0207694_10020967 Ga0207694_100209674 354
523 3300026041 Ga0207639_10158676 Ga0207639_101586761 354
524 3300028794 Ga0307515_10022988 Ga0307515_100229884 354
525 3300031456 Ga0307513_10002066 Ga0307513_100020667 354
526 3300031548 Ga0307408_100000030 Ga0307408_100000030174 354
527 3300042130 Ga0450892_001138 Ga0450892_001138_983_2062 354
528 3300042144 Ga0450889_000039 Ga0450889_000039_6040_7119 354
529 3300045051 Ga0451576_0010978 Ga0451576_0010978_6967_8046 354
530 3300050496 nmdc:mga07m45_906_c1 nmdc:mga07m45_906_c1_8091_9170 354
531 iso_pu_bacteria 2511231002 2511247276 354
532 iso_pu_bacteria 2974320154 2974320719 354
533 iso_pu_bacteria 8054002106 8054007541 354
534 3300005467 Ga0070706_100043070 Ga0070706_1000430702 355
535 3300006195 Ga0075366_10028404 Ga0075366_100284043 355
536 3300009093 Ga0105240_10006473 Ga0105240_100064733 355
537 3300009545 Ga0105237_10000404 Ga0105237_1000040446 355
538 3300009551 Ga0105238_10010667 Ga0105238_100106674 355
539 3300010375 Ga0105239_10000316 Ga0105239_1000031661 355
540 3300013104 Ga0157370_10152121 Ga0157370_101521211 355
541 3300025913 Ga0207695_10023769 Ga0207695_100237693 355
542 3300025914 Ga0207671_10001211 Ga0207671_1000121120 355
543 3300025924 Ga0207694_10032186 Ga0207694_100321862 355
544 3300026142 Ga0207698_10097244 Ga0207698_100972441 355
545 3300031456 Ga0307513_10000072 Ga0307513_1000007296 355
546 3300031730 Ga0307516_10020015 Ga0307516_100200154 355
547 3300042876 Ga0451577_0021322 Ga0451577_0021322_822_1889 355
548 3300044673 Ga0453683_0013512 Ga0453683_0013512_3789_4856 355
549 3300044712 Ga0453684_0000384 Ga0453684_0000384_3239_4306 355
550 3300044712 Ga0453684_0039564 Ga0453684_0039564_514_1581 355
551 3300045051 Ga0451576_0000305 Ga0451576_0000305_117566_118633 355
552 3300045051 Ga0451576_0051145 Ga0451576_0051145_1365_2438 355
553 3300049515 Ga0501292_002082 Ga0501292_002082_322_1443 355
554 3300049536 Ga0501320_004253 Ga0501320_004253_20_1105 355
555 3300049653 Ga0501206_001791 Ga0501206_001791_77_1198 355
556 3300049686 Ga0501257_021556 Ga0501257_021556_374_1495 355
557 3300050493 nmdc:mga0k408_10021_c2 nmdc:mga0k408_10021_c2_1304_2404 355
558 iso_pu_bacteria 2545555834 2545674848 355
559 iso_pu_bacteria 2839138175 2839141508 355
560 iso_pu_bacteria 2894023352 2894027985 355
561 iso_pu_bacteria 641522639 641645178 355
562 3300002704 JGI25155J39150_1000059 JGI25155J39150_100005937 356
563 3300002705 JGI25156J39149_1000081 JGI25156J39149_100008137 356
564 3300002738 JGI25154J39366_1000109 JGI25154J39366_100010937 356
565 3300002741 JGI25157J39369_1000103 JGI25157J39369_100010326 356
566 3300002987 JGI25159J45721_1000488 JGI25159J45721_10004884 356
567 3300002987 JGI25159J45721_1001139 JGI25159J45721_10011394 356
568 3300002987 JGI25159J45721_1005762 JGI25159J45721_10057621 356
569 3300003187 JGI25151J46595_10002071 JGI25151J46595_100020714 356
570 3300003187 JGI25151J46595_10002928 JGI25151J46595_100029282 356
571 3300003187 JGI25151J46595_10010435 JGI25151J46595_100104353 356
572 3300003354 JGI25160J50197_1000431 JGI25160J50197_100043120 356
573 3300003374 JGI25161J50226_1000077 JGI25161J50226_10000774 356
574 3300003771 Ga0055526_1004938 Ga0055526_10049388 356
575 3300003773 Ga0055537_1000478 Ga0055537_100047811 356
576 3300003775 Ga0055524_1000295 Ga0055524_100029531 356
577 3300003781 Ga0055536_1016829 Ga0055536_10168292 356
578 3300003790 Ga0055528_1000714 Ga0055528_10007147 356
579 3300003791 Ga0055530_10000201 Ga0055530_1000020130 356
580 3300003792 Ga0055540_1000139 Ga0055540_100013964 356
581 3300003794 Ga0055531_10042254 Ga0055531_100422541 356
582 3300004625 Ga0055543_1000685 Ga0055543_100068512 356
583 3300005262 Ga0065165_1012395 Ga0065165_10123952 356
584 3300006048 Ga0075363_100021755 Ga0075363_1000217552 356
585 3300006051 Ga0075364_10009269 Ga0075364_100092693 356
586 3300006871 Ga0075434_100116254 Ga0075434_1001162541 356
587 3300012513 Ga0157326_1001498 Ga0157326_10014983 356
588 3300025206 Ga0209435_100047 Ga0209435_10004725 356
589 3300025208 Ga0209436_111087 Ga0209436_1110872 356
590 3300025246 Ga0209646_1000038 Ga0209646_1000038271 356
591 3300025250 Ga0209026_1000180 Ga0209026_100018025 356
592 3300025256 Ga0209759_1000205 Ga0209759_100020525 356
593 3300025258 Ga0209129_1005364 Ga0209129_10053642 356
594 3300025263 Ga0209565_1000016 Ga0209565_100001629 356
595 3300025263 Ga0209565_1000771 Ga0209565_10007712 356
596 3300025273 Ga0209673_1000495 Ga0209673_100049529 356
597 3300025284 Ga0209130_1000040 Ga0209130_1000040215 356
598 3300025284 Ga0209130_1000354 Ga0209130_10003548 356
599 3300025291 Ga0209675_1000122 Ga0209675_100012262 356
600 3300025291 Ga0209675_1003383 Ga0209675_10033836 356
601 3300025292 Ga0209676_1000395 Ga0209676_100039529 356
602 3300025292 Ga0209676_1002341 Ga0209676_10023419 356
603 3300025294 Ga0209025_1001984 Ga0209025_100198415 356
604 3300025294 Ga0209025_1002648 Ga0209025_100264811 356
605 3300025294 Ga0209025_1005800 Ga0209025_10058002 356
606 3300025294 Ga0209025_1005968 Ga0209025_10059684 356
607 3300025295 Ga0209564_1001283 Ga0209564_100128316 356
608 3300025295 Ga0209564_1001405 Ga0209564_100140515 356
609 3300025295 Ga0209564_1008775 Ga0209564_10087754 356
610 3300025298 Ga0209050_1000084 Ga0209050_100008429 356
611 3300025298 Ga0209050_1005427 Ga0209050_10054273 356
612 3300025298 Ga0209050_1008406 Ga0209050_10084063 356
613 3300025299 Ga0209256_1000313 Ga0209256_100031348 356
614 3300025302 Ga0207426_1000359 Ga0207426_100035946 356
615 3300025303 Ga0209051_1000058 Ga0209051_100005829 356
616 3300025304 Ga0209257_1000092 Ga0209257_100009229 356
617 3300025304 Ga0209257_1006323 Ga0209257_10063235 356
618 3300026041 Ga0207639_10118383 Ga0207639_101183831 356
619 3300031824 Ga0307413_10056994 Ga0307413_100569942 356
620 3300031901 Ga0307406_10081353 Ga0307406_100813532 356
621 3300050512 nmdc:mga0n895_212798_c1 nmdc:mga0n895_212798_c1_682_1776 356
622 3300050513 nmdc:mga0rr50_25290_c1 nmdc:mga0rr50_25290_c1_398_1492 356
623 iso_pu_bacteria 2595698237 2596375774 356
624 iso_pu_bacteria 2889306138 2889310597 356
625 iso_pu_bacteria 2902330777 2902334747 356
626 iso_pu_bacteria 2902405164 2902405209 356
627 iso_pu_bacteria 2928125067 2928129319 356
628 iso_pu_bacteria 643348564 643602981 357
629 3300006195 Ga0075366_10000666 Ga0075366_1000066615 358
630 3300050493 nmdc:mga0k408_2645_c1 nmdc:mga0k408_2645_c1_3424_4512 358
631 iso_pu_bacteria 2511231004 2511257574 358
632 iso_pu_bacteria 2511231006 2511262971 358
633 iso_pu_bacteria 2511231007 2511273237 358
634 iso_pu_bacteria 2511231010 2511290743 358
635 iso_pu_bacteria 2511231011 2511293556 358
636 iso_pu_bacteria 2511231012 2511302471 358
637 iso_pu_bacteria 2511231014 2511316793 358
638 iso_pu_bacteria 2511231015 2511317372 358
639 iso_pu_bacteria 2511231016 2511324810 358
640 iso_pu_bacteria 2511231017 2511330471 358
641 iso_pu_bacteria 2511231018 2511337978 358
642 iso_pu_bacteria 2511231019 2511342799 358
643 iso_pu_bacteria 2511231020 2511348744 358
644 iso_pu_bacteria 2511231021 2511355377 358
645 iso_pu_bacteria 2511231022 2511365871 358
646 iso_pu_bacteria 2511231023 2511369986 358
647 iso_pu_bacteria 2511231024 2511373692 358
648 iso_pu_bacteria 2511231031 2511413279 358
649 iso_pu_bacteria 2512047018 2512326814 358
650 iso_pu_bacteria 2554235132 2554816388 358
651 iso_pu_bacteria 2554235231 2555248868 358
652 iso_pu_bacteria 2582580891 2583791445 358
653 iso_pu_bacteria 2597489887 2597857231 358
654 iso_pu_bacteria 2597489888 2597864844 358
655 iso_pu_bacteria 2597489889 2597870717 358
656 iso_pu_bacteria 2599185160 2599358020 358
657 iso_pu_bacteria 2599185161 2599361778 358
658 iso_pu_bacteria 2599185162 2599368099 358
659 iso_pu_bacteria 2599185163 2599374888 358
660 iso_pu_bacteria 2599185164 2599383184 358
661 iso_pu_bacteria 2599185165 2599389432 358
662 iso_pu_bacteria 2599185166 2599393746 358
663 iso_pu_bacteria 2599185167 2599398031 358
664 iso_pu_bacteria 2599185168 2599405513 358
665 iso_pu_bacteria 2599185179 2599452479 358
666 iso_pu_bacteria 2599185181 2599464835 358
667 iso_pu_bacteria 2599185182 2599468387 358
668 iso_pu_bacteria 2599185185 2599484253 358
669 iso_pu_bacteria 2599185186 2599493859 358
670 iso_pu_bacteria 2599185189 2599507030 358
671 iso_pu_bacteria 2599185190 2599516214 358
672 iso_pu_bacteria 2599185191 2599518356 358
673 iso_pu_bacteria 2599185257 2599801897 358
674 iso_pu_bacteria 2599185288 2599878191 358
675 iso_pu_bacteria 2599185290 2599895488 358
676 iso_pu_bacteria 2599185303 2599947384 358
677 iso_pu_bacteria 2599185356 2600217566 358
678 iso_pu_bacteria 2600254931 2600365410 358
679 iso_pu_bacteria 2600255296 2601689886 358
680 iso_pu_bacteria 2600255313 2601777734 358
681 iso_pu_bacteria 2600255318 2601795847 358
682 iso_pu_bacteria 2603880185 2606075305 358
683 iso_pu_bacteria 2603880199 2606128168 358
684 iso_pu_bacteria 2606217733 2608382603 358
685 iso_pu_bacteria 2619619299 2621298551 358
686 iso_pu_bacteria 2623620443 2624479785 358
687 iso_pu_bacteria 2623620446 2624491109 358
688 iso_pu_bacteria 2643221565 2643842537 358
689 iso_pu_bacteria 2643221571 2643871548 358
690 iso_pu_bacteria 2643221589 2643952988 358
691 iso_pu_bacteria 2643221602 2644022750 358
692 iso_pu_bacteria 2643221633 2644188934 358
693 iso_pu_bacteria 2643221713 2644622338 358
694 iso_pu_bacteria 2667528171 2671098417 358
695 iso_pu_bacteria 2671180172 2671768847 358
696 iso_pu_bacteria 2675903420 2677900872 358
697 iso_pu_bacteria 2713897148 2715752554 358
698 iso_pu_bacteria 2713897149 2715758906 358
699 iso_pu_bacteria 2718217725 2718633457 358
700 iso_pu_bacteria 2721755607 2723249601 358
701 iso_pu_bacteria 2738541265 2738674538 358
702 iso_pu_bacteria 2738541282 2738752931 358
703 iso_pu_bacteria 2738541294 2738809738 358
704 iso_pu_bacteria 2738541303 2738861972 358
705 iso_pu_bacteria 2738541309 2738897098 358
706 iso_pu_bacteria 2738543004 2739199767 358
707 iso_pu_bacteria 2738543015 2739259358 358
708 iso_pu_bacteria 2738543025 2739315823 358
709 iso_pu_bacteria 2765235841 2765583188 358
710 iso_pu_bacteria 2773857670 2774123758 358
711 iso_pu_bacteria 2773857673 2774137365 358
712 iso_pu_bacteria 2784132063 2784263675 358
713 iso_pu_bacteria 2784132072 2784317788 358
714 iso_pu_bacteria 2808606377 2808927804 358
715 iso_pu_bacteria 2808606381 2808949656 358
716 iso_pu_bacteria 2808606382 2808960222 358
717 iso_pu_bacteria 2808606385 2808977139 358
718 iso_pu_bacteria 2808606388 2808992294 358
719 iso_pu_bacteria 2808606445 2809216744 358
720 iso_pu_bacteria 2816332298 2817492299 358
721 iso_pu_bacteria 2818991456 2819656485 358
722 iso_pu_bacteria 2818991464 2819703497 358
723 iso_pu_bacteria 2834028612 2834033707 358
724 iso_pu_bacteria 2842826826 2842831160 358
725 iso_pu_bacteria 2842832357 2842835461 358
726 iso_pu_bacteria 2842837860 2842842419 358
727 iso_pu_bacteria 2842843487 2842848676 358
728 iso_pu_bacteria 2844665904 2844669523 358
729 iso_pu_bacteria 2852612431 2852613507 358
730 iso_pu_bacteria 2852657418 2852658249 358
731 iso_pu_bacteria 2852667396 2852668757 358
732 iso_pu_bacteria 2860339153 2860339581 358
733 iso_pu_bacteria 2860867994 2860871355 358
734 iso_pu_bacteria 2878029506 2878031800 358
735 iso_pu_bacteria 2880230671 2880234253 358
736 iso_pu_bacteria 2904518522 2904523631 358
737 iso_pu_bacteria 2904550169 2904554265 358
738 iso_pu_bacteria 2908446538 2908450667 358
739 iso_pu_bacteria 2912963787 2912967171 358
740 iso_pu_bacteria 2917070673 2917072886 358
741 iso_pu_bacteria 2919063839 2919068271 358
742 iso_pu_bacteria 2919155634 2919157061 358
743 iso_pu_bacteria 2919385768 2919386761 358
744 iso_pu_bacteria 2919456309 2919456671 358
745 iso_pu_bacteria 2919487758 2919491543 358
746 iso_pu_bacteria 2929189879 2929193377 358
747 iso_pu_bacteria 2931390751 2931394687 358
748 iso_pu_bacteria 2931396565 2931400529 358
749 iso_pu_bacteria 2935353572 2935359314 358
750 iso_pu_bacteria 2939636861 2939639223 358
751 iso_pu_bacteria 2939651529 2939656148 358
752 iso_pu_bacteria 2945928738 2945932602 358
753 iso_pu_bacteria 2945961074 2945962523 358
754 iso_pu_bacteria 2946006987 2946008847 358
755 iso_pu_bacteria 2946027586 2946031851 358
756 iso_pu_bacteria 2947233263 2947238672 358
757 iso_pu_bacteria 2969304461 2969306590 358
758 iso_pu_bacteria 2974289157 2974291724 358
759 iso_pu_bacteria 2984286254 2984290360 358
760 iso_pu_bacteria 2998139840 2998142055 358
761 iso_pu_bacteria 3007395558 3007401245 358
762 iso_pu_bacteria 3007511990 3007513405 358
763 iso_pu_bacteria 3007614139 3007614869 358
764 iso_pu_bacteria 3007619802 3007624167 358
765 iso_pu_bacteria 3007718800 3007723751 358
766 iso_pu_bacteria 3007803356 3007808851 358
767 iso_pu_bacteria 3007855910 3007860644 358
768 iso_pu_bacteria 3007861166 3007862788 358
769 iso_pu_bacteria 3007866637 3007868415 358
770 iso_pu_bacteria 637000220 637319438 358
771 iso_pu_bacteria 8015687852 8015689917 358
772 iso_pu_bacteria 8019775933 8019778000 358
773 iso_pu_bacteria 8029995093 8029998723 358
774 iso_pu_bacteria 8052494512 8052496628 358
775 iso_pu_bacteria 8054285046 8054285240 358
776 iso_pu_bacteria 8054347763 8054348747 358
777 iso_pu_bacteria 8054503363 8054507228 358
778 iso_pu_bacteria 8054929484 8054932826 358
779 iso_pu_bacteria 8055770955 8055773021 358
780 iso_pu_bacteria 8055817908 8055822129 358
781 iso_pu_bacteria 8055878733 8055882255 358
782 iso_pu_bacteria 8056120720 8056124030 358
783 iso_pu_bacteria 8056125926 8056127963 358
784 iso_pu_bacteria 8056131705 8056135618 358
785 iso_pu_bacteria 8056148874 8056152901 358
786 iso_pu_bacteria 8056155041 8056155953 358
787 iso_pu_bacteria 8056161164 8056161817 358
788 iso_pu_bacteria 8056166840 8056169019 358
789 iso_pu_bacteria 8056172158 8056175173 358
790 iso_pu_bacteria 8056177738 8056183487 358
791 iso_pu_bacteria 8056569372 8056572971 358
792 iso_pu_bacteria 2806310737 2807408929 359
793 iso_pu_bacteria 2806310745 2807457259 359
794 iso_pu_bacteria 2842698319 2842700138 359
795 iso_pu_bacteria 3007872151 3007873565 359
796 iso_pu_bacteria 8056115690 8056118440 359
797 iso_pu_bacteria 8056137416 8056141024 359
798 3300044901 Ga0466960_0046580 Ga0466960_0046580_833_1954 360
799 iso_pu_bacteria 639633007 639785549 360
800 3300006051 Ga0075364_10049665 Ga0075364_100496652 361
801 2124908027 MRS2a_Contig_31 MRS2a_00209600 362
802 3300002737 JGI25162J39368_1000700 JGI25162J39368_100070017 362
803 3300002737 JGI25162J39368_1000873 JGI25162J39368_100087316 362
804 3300002771 JGI25163J39215_1000641 JGI25163J39215_10006417 362
805 3300002772 JGI25164J39214_1000471 JGI25164J39214_100047117 362
806 3300002772 JGI25164J39214_1000566 JGI25164J39214_100056614 362
807 3300003214 JGI25165J46597_1000822 JGI25165J46597_100082217 362
808 3300003214 JGI25165J46597_1000954 JGI25165J46597_100095412 362
809 3300003751 Ga0055538_1000066 Ga0055538_100006690 362
810 3300003752 Ga0055539_1000102 Ga0055539_100010290 362
811 3300003756 Ga0055533_1000110 Ga0055533_100011090 362
812 3300003758 Ga0055532_1000138 Ga0055532_100013868 362
813 3300003759 Ga0055525_1000458 Ga0055525_100045815 362
814 3300003781 Ga0055536_1000765 Ga0055536_100076515 362
815 3300003781 Ga0055536_1001638 Ga0055536_10016386 362
816 3300003781 Ga0055536_1001859 Ga0055536_10018594 362
817 3300003791 Ga0055530_10001083 Ga0055530_1000108315 362
818 3300003791 Ga0055530_10002956 Ga0055530_100029569 362
819 3300003792 Ga0055540_1000971 Ga0055540_100097113 362
820 3300003792 Ga0055540_1001293 Ga0055540_100129314 362
821 3300003794 Ga0055531_10000517 Ga0055531_1000051727 362
822 3300003841 Ga0055541_1000068 Ga0055541_100006817 362
823 3300005288 Ga0065714_10000533 Ga0065714_100005332 362
824 3300005288 Ga0065714_10002575 Ga0065714_1000257510 362
825 3300005288 Ga0065714_10005979 Ga0065714_100059794 362
826 3300005288 Ga0065714_10009063 Ga0065714_100090634 362
827 3300005288 Ga0065714_10026649 Ga0065714_100266492 362
828 3300005288 Ga0065714_10065679 Ga0065714_100656793 362
829 3300005288 Ga0065714_10075654 Ga0065714_100756541 362
830 3300005288 Ga0065714_10077839 Ga0065714_100778394 362
831 3300005290 Ga0065712_10000544 Ga0065712_100005449 362
832 3300005290 Ga0065712_10068148 Ga0065712_100681489 362
833 3300005293 Ga0065715_10119702 Ga0065715_101197021 362
834 3300005331 Ga0070670_100000684 Ga0070670_10000068426 362
835 3300005344 Ga0070661_100001203 Ga0070661_1000012032 362
836 3300005353 Ga0070669_100011343 Ga0070669_1000113431 362
837 3300005457 Ga0070662_100001183 Ga0070662_10000118318 362
838 3300005457 Ga0070662_100006434 Ga0070662_1000064349 362
839 3300005539 Ga0068853_100029071 Ga0068853_1000290712 362
840 3300005564 Ga0070664_100000485 Ga0070664_10000048530 362
841 3300005834 Ga0068851_10000175 Ga0068851_1000017526 362
842 3300006051 Ga0075364_10029994 Ga0075364_100299944 362
843 3300006058 Ga0075432_10000456 Ga0075432_100004564 362
844 3300006177 Ga0075362_10080452 Ga0075362_100804522 362
845 3300006186 Ga0075369_10011122 Ga0075369_100111224 362
846 3300006946 Ga0079104_1001518 Ga0079104_100151813 362
847 3300009011 Ga0105251_10000603 Ga0105251_1000060319 362
848 3300009011 Ga0105251_10002924 Ga0105251_1000292417 362
849 3300009011 Ga0105251_10004088 Ga0105251_100040889 362
850 3300009011 Ga0105251_10005146 Ga0105251_100051464 362
851 3300009011 Ga0105251_10088355 Ga0105251_100883551 362
852 3300009011 Ga0105251_10121033 Ga0105251_101210331 362
853 3300009036 Ga0105244_10001396 Ga0105244_1000139616 362
854 3300009036 Ga0105244_10002283 Ga0105244_1000228318 362
855 3300009036 Ga0105244_10002726 Ga0105244_1000272612 362
856 3300009036 Ga0105244_10003570 Ga0105244_100035707 362
857 3300009036 Ga0105244_10003950 Ga0105244_100039504 362
858 3300009036 Ga0105244_10016662 Ga0105244_100166622 362
859 3300009036 Ga0105244_10016941 Ga0105244_100169414 362
860 3300009036 Ga0105244_10017665 Ga0105244_100176651 362
861 3300009036 Ga0105244_10041198 Ga0105244_100411981 362
862 3300009092 Ga0105250_10000453 Ga0105250_1000045313 362
863 3300009092 Ga0105250_10000798 Ga0105250_1000079812 362
864 3300009092 Ga0105250_10018637 Ga0105250_100186373 362
865 3300009092 Ga0105250_10067284 Ga0105250_100672841 362
866 3300009148 Ga0105243_10003156 Ga0105243_1000315614 362
867 3300009148 Ga0105243_10005878 Ga0105243_100058782 362
868 3300009148 Ga0105243_10050893 Ga0105243_100508934 362
869 3300009148 Ga0105243_10106467 Ga0105243_101064671 362
870 3300009176 Ga0105242_10001154 Ga0105242_1000115419 362
871 3300009545 Ga0105237_10007640 Ga0105237_100076404 362
872 3300011119 Ga0105246_10000356 Ga0105246_1000035624 362
873 3300011119 Ga0105246_10001149 Ga0105246_1000114913 362
874 3300011119 Ga0105246_10193675 Ga0105246_101936752 362
875 3300012498 Ga0157345_1000071 Ga0157345_100007117 362
876 3300013100 Ga0157373_10002465 Ga0157373_100024657 362
877 3300013100 Ga0157373_10041850 Ga0157373_100418504 362
878 3300013100 Ga0157373_10045194 Ga0157373_100451944 362
879 3300013100 Ga0157373_10197565 Ga0157373_101975651 362
880 3300013102 Ga0157371_10000334 Ga0157371_1000033479 362
881 3300013102 Ga0157371_10002004 Ga0157371_1000200412 362
882 3300013102 Ga0157371_10024892 Ga0157371_100248923 362
883 3300013104 Ga0157370_10012520 Ga0157370_100125203 362
884 3300013104 Ga0157370_10207586 Ga0157370_102075862 362
885 3300013105 Ga0157369_10008448 Ga0157369_100084484 362
886 3300013105 Ga0157369_10010370 Ga0157369_1001037013 362
887 3300013105 Ga0157369_10029284 Ga0157369_100292845 362
888 3300013105 Ga0157369_10211961 Ga0157369_102119613 362
889 3300013105 Ga0157369_10391164 Ga0157369_103911641 362
890 3300013306 Ga0163162_10010780 Ga0163162_1001078010 362
891 3300013306 Ga0163162_10011888 Ga0163162_100118883 362
892 3300013307 Ga0157372_10025090 Ga0157372_100250903 362
893 3300013307 Ga0157372_10072350 Ga0157372_100723502 362
894 3300013307 Ga0157372_10129042 Ga0157372_101290421 362
895 3300013308 Ga0157375_10040615 Ga0157375_100406152 362
896 3300014497 Ga0182008_10001357 Ga0182008_1000135713 362
897 3300014497 Ga0182008_10005317 Ga0182008_100053174 362
898 3300014497 Ga0182008_10007114 Ga0182008_100071143 362
899 3300014497 Ga0182008_10017319 Ga0182008_100173193 362
900 3300015261 Ga0182006_1000782 Ga0182006_100078211 362
901 3300015261 Ga0182006_1001695 Ga0182006_100169513 362
902 3300015261 Ga0182006_1003567 Ga0182006_10035676 362
903 3300015261 Ga0182006_1006215 Ga0182006_10062154 362
904 3300015261 Ga0182006_1011878 Ga0182006_10118784 362
905 3300015261 Ga0182006_1025354 Ga0182006_10253543 362
906 3300015265 Ga0182005_1001332 Ga0182005_10013325 362
907 3300017792 Ga0163161_10003617 Ga0163161_100036171 362
908 3300017792 Ga0163161_10008012 Ga0163161_100080123 362
909 3300017792 Ga0163161_10012124 Ga0163161_100121242 362
910 3300017792 Ga0163161_10039086 Ga0163161_100390861 362
911 3300017792 Ga0163161_10150496 Ga0163161_101504961 362
912 3300025206 Ga0209435_101226 Ga0209435_1012261 362
913 3300025207 Ga0209760_100023 Ga0209760_10002314 362
914 3300025207 Ga0209760_100220 Ga0209760_10022015 362
915 3300025224 Ga0209784_100057 Ga0209784_100057153 362
916 3300025225 Ga0209566_100073 Ga0209566_100073153 362
917 3300025226 Ga0209674_100095 Ga0209674_100095153 362
918 3300025229 Ga0209147_100092 Ga0209147_100092153 362
919 3300025230 Ga0209563_100093 Ga0209563_10009317 362
920 3300025230 Ga0209563_100231 Ga0209563_1002316 362
921 3300025231 Ga0207427_100001 Ga0207427_1000011357 362
922 3300025231 Ga0207427_100018 Ga0207427_10001812 362
923 3300025233 Ga0209437_100003 Ga0209437_10000315 362
924 3300025233 Ga0209437_100031 Ga0209437_10003112 362
925 3300025242 Ga0209258_100995 Ga0209258_10099517 362
926 3300025246 Ga0209646_1000430 Ga0209646_100043015 362
927 3300025253 Ga0209677_100054 Ga0209677_100054153 362
928 3300025256 Ga0209759_1002140 Ga0209759_10021402 362
929 3300025261 Ga0209233_1000007 Ga0209233_10000071357 362
930 3300025261 Ga0209233_1000012 Ga0209233_100001212 362
931 3300025291 Ga0209675_1003318 Ga0209675_10033184 362
932 3300025292 Ga0209676_1000055 Ga0209676_1000055176 362
933 3300025292 Ga0209676_1000950 Ga0209676_100095027 362
934 3300025292 Ga0209676_1001490 Ga0209676_100149013 362
935 3300025292 Ga0209676_1010970 Ga0209676_10109704 362
936 3300025298 Ga0209050_1000606 Ga0209050_100060648 362
937 3300025298 Ga0209050_1000941 Ga0209050_100094130 362
938 3300025298 Ga0209050_1000970 Ga0209050_100097029 362
939 3300025303 Ga0209051_1000083 Ga0209051_100008316 362
940 3300025303 Ga0209051_1000429 Ga0209051_100042947 362
941 3300025303 Ga0209051_1040112 Ga0209051_10401121 362
942 3300025304 Ga0209257_1000175 Ga0209257_1000175123 362
943 3300025321 Ga0207656_10000071 Ga0207656_1000007130 362
944 3300025711 Ga0207696_1000002 Ga0207696_10000029 362
945 3300025711 Ga0207696_1000018 Ga0207696_1000018277 362
946 3300025711 Ga0207696_1000549 Ga0207696_100054914 362
947 3300025711 Ga0207696_1000720 Ga0207696_100072015 362
948 3300025711 Ga0207696_1001354 Ga0207696_100135413 362
949 3300025711 Ga0207696_1005957 Ga0207696_10059574 362
950 3300025711 Ga0207696_1008622 Ga0207696_10086221 362
951 3300025711 Ga0207696_1008668 Ga0207696_10086684 362
952 3300025728 Ga0207655_1000081 Ga0207655_100008118 362
953 3300025728 Ga0207655_1000085 Ga0207655_100008521 362
954 3300025728 Ga0207655_1000434 Ga0207655_100043416 362
955 3300025728 Ga0207655_1001629 Ga0207655_100162916 362
956 3300025728 Ga0207655_1002190 Ga0207655_100219016 362
957 3300025728 Ga0207655_1002250 Ga0207655_100225016 362
958 3300025728 Ga0207655_1007273 Ga0207655_10072734 362
959 3300025728 Ga0207655_1012707 Ga0207655_10127074 362
960 3300025728 Ga0207655_1015180 Ga0207655_10151806 362
961 3300025728 Ga0207655_1016997 Ga0207655_10169972 362
962 3300025728 Ga0207655_1020275 Ga0207655_10202754 362
963 3300025728 Ga0207655_1026915 Ga0207655_10269152 362
964 3300025728 Ga0207655_1066446 Ga0207655_10664461 362
965 3300025735 Ga0207713_1000299 Ga0207713_100029922 362
966 3300025735 Ga0207713_1000635 Ga0207713_100063519 362
967 3300025735 Ga0207713_1002663 Ga0207713_100266318 362
968 3300025735 Ga0207713_1002920 Ga0207713_10029209 362
969 3300025735 Ga0207713_1002955 Ga0207713_10029556 362
970 3300025735 Ga0207713_1003521 Ga0207713_10035211 362
971 3300025735 Ga0207713_1005230 Ga0207713_10052302 362
972 3300025735 Ga0207713_1005724 Ga0207713_10057247 362
973 3300025735 Ga0207713_1009904 Ga0207713_10099048 362
974 3300025914 Ga0207671_10000018 Ga0207671_10000018255 362
975 3300025920 Ga0207649_10000008 Ga0207649_10000008244 362
976 3300025923 Ga0207681_10003123 Ga0207681_100031234 362
977 3300025923 Ga0207681_10024836 Ga0207681_100248365 362
978 3300025925 Ga0207650_10000693 Ga0207650_1000069324 362
979 3300025925 Ga0207650_10002019 Ga0207650_100020191 362
980 3300025933 Ga0207706_10001894 Ga0207706_1000189418 362
981 3300025933 Ga0207706_10013068 Ga0207706_100130684 362
982 3300025934 Ga0207686_10007660 Ga0207686_100076603 362
983 3300025935 Ga0207709_10000089 Ga0207709_10000089102 362
984 3300025935 Ga0207709_10002236 Ga0207709_100022365 362
985 3300025935 Ga0207709_10041122 Ga0207709_100411223 362
986 3300025935 Ga0207709_10150210 Ga0207709_101502101 362
987 3300025945 Ga0207679_10000008 Ga0207679_10000008145 362
988 3300025981 Ga0207640_10174947 Ga0207640_101749471 362
989 3300026041 Ga0207639_10043510 Ga0207639_100435105 362
990 3300027111 Ga0209281_1000391 Ga0209281_100039159 362
991 3300027111 Ga0209281_1000947 Ga0209281_10009475 362
992 3300027312 Ga0209371_1000940 Ga0209371_100094014 362
993 3300027907 Ga0207428_10035435 Ga0207428_100354352 362
994 3300027907 Ga0207428_10179606 Ga0207428_101796062 362
995 3300028379 Ga0268266_10014302 Ga0268266_100143026 362
996 3300030500 Ga0268256_1000839 Ga0268256_100083913 362
997 3300030521 Ga0307511_10039058 Ga0307511_100390582 362
998 3300030733 Ga0314311_1138841 Ga0314311_11388416 362
999 3300030735 Ga0316178_1056564 Ga0316178_10565648 362
1000 3300030742 Ga0316183_1109609 Ga0316183_11096094 362
1001 3300031548 Ga0307408_100025018 Ga0307408_1000250183 362
1002 3300031548 Ga0307408_100042577 Ga0307408_1000425775 362
1003 3300031731 Ga0307405_10011987 Ga0307405_100119875 362
1004 3300031824 Ga0307413_10114846 Ga0307413_101148461 362
1005 3300031903 Ga0307407_10022562 Ga0307407_100225623 362
1006 3300031911 Ga0307412_10079477 Ga0307412_100794774 362
1007 3300031911 Ga0307412_10087242 Ga0307412_100872421 362
1008 3300032002 Ga0307416_100054154 Ga0307416_1000541544 362
1009 3300032004 Ga0307414_10019333 Ga0307414_100193331 362
1010 3300032004 Ga0307414_10032780 Ga0307414_100327804 362
1011 3300032004 Ga0307414_10068528 Ga0307414_100685282 362
1012 3300033180 Ga0307510_10003652 Ga0307510_1000365212 362
1013 3300041405 Ga0439438_000715 Ga0439438_000715_9314_10402 362
1014 3300041405 Ga0439438_003425 Ga0439438_003425_2392_3480 362
1015 3300041405 Ga0439438_004854 Ga0439438_004854_3630_4718 362
1016 3300041405 Ga0439438_012163 Ga0439438_012163_240_1328 362
1017 3300041405 Ga0439438_012602 Ga0439438_012602_1277_2365 362
1018 3300041405 Ga0439438_014037 Ga0439438_014037_241_1329 362
1019 3300041407 Ga0439447_000485 Ga0439447_000485_4348_5436 362
1020 3300041407 Ga0439447_001874 Ga0439447_001874_135_1223 362
1021 3300041407 Ga0439447_003428 Ga0439447_003428_3355_4443 362
1022 3300041407 Ga0439447_014600 Ga0439447_014600_712_1800 362
1023 3300041411 Ga0439466_0000438 Ga0439466_0000438_5439_6527 362
1024 3300041411 Ga0439466_0000472 Ga0439466_0000472_1145_2233 362
1025 3300041411 Ga0439466_0000930 Ga0439466_0000930_766_1854 362
1026 3300041411 Ga0439466_0002563 Ga0439466_0002563_2934_4022 362
1027 3300041411 Ga0439466_0005854 Ga0439466_0005854_213_1301 362
1028 3300041411 Ga0439466_0009010 Ga0439466_0009010_288_1376 362
1029 3300042006 Ga0439432_000153 Ga0439432_000153_8856_9944 362
1030 3300042006 Ga0439432_001390 Ga0439432_001390_3709_4797 362
1031 3300042006 Ga0439432_016540 Ga0439432_016540_252_1340 362
1032 3300042006 Ga0439432_017528 Ga0439432_017528_1265_2353 362
1033 3300042009 Ga0439451_001579 Ga0439451_001579_2349_3437 362
1034 3300042009 Ga0439451_003699 Ga0439451_003699_51_1139 362
1035 3300042010 Ga0439452_000283 Ga0439452_000283_9273_10361 362
1036 3300042010 Ga0439452_000473 Ga0439452_000473_12236_13324 362
1037 3300042010 Ga0439452_000565 Ga0439452_000565_8874_9962 362
1038 3300042010 Ga0439452_000632 Ga0439452_000632_15018_16106 362
1039 3300042010 Ga0439452_002595 Ga0439452_002595_4346_5434 362
1040 3300042010 Ga0439452_004893 Ga0439452_004893_766_1854 362
1041 3300042010 Ga0439452_017091 Ga0439452_017091_338_1426 362
1042 3300042013 Ga0439456_003162 Ga0439456_003162_2053_3141 362
1043 3300042013 Ga0439456_021587 Ga0439456_021587_218_1306 362
1044 3300042115 Ga0450911_000434 Ga0450911_000434_3267_4355 362
1045 3300042137 Ga0450902_003430 Ga0450902_003430_973_2061 362
1046 3300042138 Ga0450903_002282 Ga0450903_002282_734_1822 362
1047 3300042142 Ga0450905_000083 Ga0450905_000083_2604_3692 362
1048 3300042142 Ga0450905_009558 Ga0450905_009558_32_1120 362
1049 3300042145 Ga0450906_000881 Ga0450906_000881_1826_2914 362
1050 3300042145 Ga0450906_000932 Ga0450906_000932_3002_4090 362
1051 3300042146 Ga0450907_000066 Ga0450907_000066_9337_10425 362
1052 3300042146 Ga0450907_000936 Ga0450907_000936_457_1545 362
1053 3300042156 Ga0439446_0007120 Ga0439446_0007120_1589_2677 362
1054 3300042185 Ga0450909_000645 Ga0450909_000645_2107_3195 362
1055 3300042532 Ga0450893_0003856 Ga0450893_0003856_197_1285 362
1056 3300042993 Ga0439440_0003893 Ga0439440_0003893_1480_2568 362
1057 3300046452 Ga0495617_000370 Ga0495617_000370_14508_15638 362
1058 3300046452 Ga0495617_001202 Ga0495617_001202_10333_11421 362
1059 3300046452 Ga0495617_002985 Ga0495617_002985_674_1762 362
1060 3300046452 Ga0495617_018256 Ga0495617_018256_853_1941 362
1061 3300046452 Ga0495617_025829 Ga0495617_025829_224_1312 362
1062 3300046453 Ga0495627_000818 Ga0495627_000818_11293_12381 362
1063 3300046453 Ga0495627_001538 Ga0495627_001538_9306_10394 362
1064 3300046453 Ga0495627_003441 Ga0495627_003441_1665_2753 362
1065 3300046455 Ga0495603_0007078 Ga0495603_0007078_1054_2142 362
1066 3300046457 Ga0495590_0017395 Ga0495590_0017395_749_1837 362
1067 3300046458 Ga0495591_000040 Ga0495591_000040_144757_145860 362
1068 3300046458 Ga0495591_000276 Ga0495591_000276_1645_2733 362
1069 3300046458 Ga0495591_000901 Ga0495591_000901_9136_10224 362
1070 3300046458 Ga0495591_001682 Ga0495591_001682_9325_10413 362
1071 3300046458 Ga0495591_001890 Ga0495591_001890_1938_3026 362
1072 3300046458 Ga0495591_002914 Ga0495591_002914_609_1697 362
1073 3300046460 Ga0495638_0000193 Ga0495638_0000193_7416_8504 362
1074 3300046460 Ga0495638_0009647 Ga0495638_0009647_1397_2485 362
1075 3300046460 Ga0495638_0015010 Ga0495638_0015010_1850_2938 362
1076 3300046460 Ga0495638_0051003 Ga0495638_0051003_746_1834 362
1077 3300046460 Ga0495638_0134715 Ga0495638_0134715_46_1134 362
1078 3300046463 Ga0495653_0000481 Ga0495653_0000481_2558_3646 362
1079 3300046463 Ga0495653_0078735 Ga0495653_0078735_416_1504 362
1080 3300046471 Ga0495650_0009065 Ga0495650_0009065_1841_2929 362
1081 3300046471 Ga0495650_0010879 Ga0495650_0010879_3061_4149 362
1082 3300046471 Ga0495650_0018806 Ga0495650_0018806_778_1866 362
1083 3300046473 Ga0495582_0003396 Ga0495582_0003396_5480_6568 362
1084 3300046474 Ga0495605_0000017 Ga0495605_0000017_263603_264889 362
1085 3300046474 Ga0495605_0000750 Ga0495605_0000750_9383_10471 362
1086 3300046474 Ga0495605_0001177 Ga0495605_0001177_6664_7794 362
1087 3300046474 Ga0495605_0001458 Ga0495605_0001458_5072_6160 362
1088 3300046474 Ga0495605_0013768 Ga0495605_0013768_2164_3252 362
1089 3300046475 Ga0495639_0000653 Ga0495639_0000653_9308_10396 362
1090 3300046491 Ga0495584_0000328 Ga0495584_0000328_25718_26806 362
1091 3300046491 Ga0495584_0003158 Ga0495584_0003158_4729_5859 362
1092 3300046491 Ga0495584_0003317 Ga0495584_0003317_6588_7676 362
1093 3300046491 Ga0495584_0040511 Ga0495584_0040511_223_1311 362
1094 3300046491 Ga0495584_0044903 Ga0495584_0044903_257_1345 362
1095 3300046492 Ga0495585_0001070 Ga0495585_0001070_12197_13285 362
1096 3300046492 Ga0495585_0001824 Ga0495585_0001824_5648_6736 362
1097 3300046492 Ga0495585_0002099 Ga0495585_0002099_4400_5488 362
1098 3300046492 Ga0495585_0011871 Ga0495585_0011871_2804_3892 362
1099 3300046492 Ga0495585_0014312 Ga0495585_0014312_1571_2659 362
1100 3300046500 Ga0495596_0000009 Ga0495596_0000009_135423_136511 362
1101 3300046501 Ga0495607_0000022 Ga0495607_0000022_149453_150556 362
1102 3300046501 Ga0495607_0002782 Ga0495607_0002782_10206_11294 362
1103 3300046501 Ga0495607_0003533 Ga0495607_0003533_4785_5915 362
1104 3300046501 Ga0495607_0012323 Ga0495607_0012323_489_1577 362
1105 3300046501 Ga0495607_0014743 Ga0495607_0014743_3200_4288 362
1106 3300046501 Ga0495607_0103118 Ga0495607_0103118_377_1465 362
1107 3300046506 Ga0495583_0002630 Ga0495583_0002630_10334_11422 362
1108 3300046506 Ga0495583_0003057 Ga0495583_0003057_5725_6813 362
1109 3300046506 Ga0495583_0004304 Ga0495583_0004304_9010_10113 362
1110 3300046506 Ga0495583_0014680 Ga0495583_0014680_1689_2777 362
1111 3300046506 Ga0495583_0034046 Ga0495583_0034046_1103_2191 362
1112 3300046507 Ga0495606_0000343 Ga0495606_0000343_69946_71049 362
1113 3300046507 Ga0495606_0001326 Ga0495606_0001326_2857_3945 362
1114 3300046507 Ga0495606_0005384 Ga0495606_0005384_1926_3014 362
1115 3300046507 Ga0495606_0006246 Ga0495606_0006246_4294_5382 362
1116 3300046507 Ga0495606_0007766 Ga0495606_0007766_258_1346 362
1117 3300046507 Ga0495606_0008721 Ga0495606_0008721_7386_8474 362
1118 3300046507 Ga0495606_0016867 Ga0495606_0016867_4334_5422 362
1119 3300046507 Ga0495606_0106407 Ga0495606_0106407_519_1607 362
1120 3300046512 Ga0495610_0003088 Ga0495610_0003088_9393_10481 362
1121 3300046512 Ga0495610_0010725 Ga0495610_0010725_300_1388 362
1122 3300046512 Ga0495610_0020309 Ga0495610_0020309_1953_3041 362
1123 3300046512 Ga0495610_0040454 Ga0495610_0040454_47_1135 362
1124 3300046513 Ga0495616_0000979 Ga0495616_0000979_14352_15482 362
1125 3300046513 Ga0495616_0001762 Ga0495616_0001762_4337_5425 362
1126 3300046513 Ga0495616_0011360 Ga0495616_0011360_948_2036 362
1127 3300046513 Ga0495616_0031203 Ga0495616_0031203_632_1720 362
1128 3300046515 Ga0495620_0000105 Ga0495620_0000105_62772_63875 362
1129 3300046515 Ga0495620_0001050 Ga0495620_0001050_7639_8727 362
1130 3300046515 Ga0495620_0009335 Ga0495620_0009335_2223_3311 362
1131 3300046515 Ga0495620_0022393 Ga0495620_0022393_1345_2433 362
1132 3300046517 Ga0495630_0144885 Ga0495630_0144885_249_1337 362
1133 3300046518 Ga0495631_0000358 Ga0495631_0000358_20944_22032 362
1134 3300046518 Ga0495631_0000738 Ga0495631_0000738_10640_11728 362
1135 3300046518 Ga0495631_0054272 Ga0495631_0054272_56_1144 362
1136 3300046519 Ga0495632_0000415 Ga0495632_0000415_29918_31006 362
1137 3300046519 Ga0495632_0000977 Ga0495632_0000977_14552_15682 362
1138 3300046519 Ga0495632_0001361 Ga0495632_0001361_18797_19885 362
1139 3300046519 Ga0495632_0001580 Ga0495632_0001580_2518_3606 362
1140 3300046519 Ga0495632_0002160 Ga0495632_0002160_10215_11303 362
1141 3300046519 Ga0495632_0009081 Ga0495632_0009081_2204_3292 362
1142 3300046519 Ga0495632_0014769 Ga0495632_0014769_3158_4246 362
1143 3300046519 Ga0495632_0028474 Ga0495632_0028474_1768_2856 362
1144 3300046519 Ga0495632_0034692 Ga0495632_0034692_902_1990 362
1145 3300046519 Ga0495632_0034903 Ga0495632_0034903_1310_2398 362
1146 3300046520 Ga0495637_0000296 Ga0495637_0000296_28235_29323 362
1147 3300046520 Ga0495637_0002081 Ga0495637_0002081_2059_3147 362
1148 3300046520 Ga0495637_0007978 Ga0495637_0007978_731_1819 362
1149 3300046520 Ga0495637_0022912 Ga0495637_0022912_537_1625 362
1150 3300046522 Ga0495643_0000887 Ga0495643_0000887_9705_10793 362
1151 3300046522 Ga0495643_0011306 Ga0495643_0011306_3345_4433 362
1152 3300046522 Ga0495643_0012964 Ga0495643_0012964_3085_4173 362
1153 3300046522 Ga0495643_0027049 Ga0495643_0027049_938_2026 362
1154 3300046522 Ga0495643_0049848 Ga0495643_0049848_717_1805 362
1155 3300046522 Ga0495643_0051381 Ga0495643_0051381_202_1290 362
1156 3300046523 Ga0495644_0000355 Ga0495644_0000355_14355_15443 362
1157 3300046523 Ga0495644_0007616 Ga0495644_0007616_1305_2393 362
1158 3300046523 Ga0495644_0015637 Ga0495644_0015637_535_1623 362
1159 3300046523 Ga0495644_0022448 Ga0495644_0022448_1242_2330 362
1160 3300046524 Ga0495648_0000074 Ga0495648_0000074_9281_10369 362
1161 3300046524 Ga0495648_0000816 Ga0495648_0000816_7664_8752 362
1162 3300046524 Ga0495648_0009311 Ga0495648_0009311_2391_3479 362
1163 3300046524 Ga0495648_0015625 Ga0495648_0015625_1877_2965 362
1164 3300046524 Ga0495648_0024300 Ga0495648_0024300_2244_3332 362
1165 3300046524 Ga0495648_0031588 Ga0495648_0031588_484_1572 362
1166 3300046524 Ga0495648_0031810 Ga0495648_0031810_1112_2200 362
1167 3300046528 Ga0495642_0000138 Ga0495642_0000138_9353_10441 362
1168 3300046528 Ga0495642_0000391 Ga0495642_0000391_13101_14189 362
1169 3300046530 Ga0495654_0001270 Ga0495654_0001270_9292_10380 362
1170 3300046530 Ga0495654_0002011 Ga0495654_0002011_9491_10579 362
1171 3300046530 Ga0495654_0002569 Ga0495654_0002569_8838_9926 362
1172 3300046530 Ga0495654_0002671 Ga0495654_0002671_9271_10359 362
1173 3300046530 Ga0495654_0023403 Ga0495654_0023403_1813_2901 362
1174 3300046530 Ga0495654_0026854 Ga0495654_0026854_1418_2506 362
1175 3300046538 Ga0495609_0000049 Ga0495609_0000049_142234_143337 362
1176 3300046538 Ga0495609_0002470 Ga0495609_0002470_5725_6813 362
1177 3300046538 Ga0495609_0006420 Ga0495609_0006420_2833_3921 362
1178 3300046542 Ga0495597_0000602 Ga0495597_0000602_18042_19130 362
1179 3300046542 Ga0495597_0008755 Ga0495597_0008755_2983_4071 362
1180 3300046542 Ga0495597_0039508 Ga0495597_0039508_68_1156 362
1181 3300046542 Ga0495597_0041817 Ga0495597_0041817_252_1340 362
1182 3300046542 Ga0495597_0077594 Ga0495597_0077594_60_1148 362
1183 3300046543 Ga0495645_0060569 Ga0495645_0060569_1090_2178 362
1184 3300046557 Ga0495622_0000960 Ga0495622_0000960_9300_10388 362
1185 3300046557 Ga0495622_0001253 Ga0495622_0001253_2646_3734 362
1186 3300046557 Ga0495622_0001294 Ga0495622_0001294_9402_10490 362
1187 3300046558 Ga0495633_0000595 Ga0495633_0000595_9368_10456 362
1188 3300046615 Ga0495656_0003253 Ga0495656_0003253_345_1433 362
1189 3300046616 Ga0495668_0001693 Ga0495668_0001693_9383_10471 362
1190 3300046616 Ga0495668_0008272 Ga0495668_0008272_5250_6353 362
1191 3300046616 Ga0495668_0015940 Ga0495668_0015940_1320_2408 362
1192 3300046642 Ga0495634_0001281 Ga0495634_0001281_9264_10352 362
1193 3300046648 Ga0495611_0000391 Ga0495611_0000391_12191_13279 362
1194 3300046660 Ga0495625_0001906 Ga0495625_0001906_9326_10414 362
1195 3300046660 Ga0495625_0002566 Ga0495625_0002566_9134_10222 362
1196 3300046660 Ga0495625_0003243 Ga0495625_0003243_10343_11431 362
1197 3300046660 Ga0495625_0008422 Ga0495625_0008422_4819_5907 362
1198 3300046660 Ga0495625_0020719 Ga0495625_0020719_2934_4022 362
1199 3300046660 Ga0495625_0073485 Ga0495625_0073485_934_2022 362
1200 3300046660 Ga0495625_0104244 Ga0495625_0104244_21_1109 362
1201 3300046663 Ga0495635_0014815 Ga0495635_0014815_3368_4456 362
1202 3300046663 Ga0495635_0025799 Ga0495635_0025799_525_1727 362
1203 3300046664 Ga0495659_0000673 Ga0495659_0000673_9292_10380 362
1204 3300046665 Ga0495661_0000085 Ga0495661_0000085_104544_105632 362
1205 3300046665 Ga0495661_0010963 Ga0495661_0010963_938_2041 362
1206 3300046665 Ga0495661_0040679 Ga0495661_0040679_1330_2418 362
1207 3300046665 Ga0495661_0098583 Ga0495661_0098583_249_1337 362
1208 3300046665 Ga0495661_0119212 Ga0495661_0119212_147_1235 362
1209 3300046684 Ga0495669_0007636 Ga0495669_0007636_1606_2694 362
1210 3300046690 Ga0495624_0001195 Ga0495624_0001195_9312_10400 362
1211 3300046691 Ga0495670_0000329 Ga0495670_0000329_11226_12314 362
1212 3300046691 Ga0495670_0016605 Ga0495670_0016605_1891_2979 362
1213 3300046691 Ga0495670_0044488 Ga0495670_0044488_499_1587 362
1214 3300046691 Ga0495670_0056299 Ga0495670_0056299_203_1291 362
1215 3300046691 Ga0495670_0078081 Ga0495670_0078081_102_1190 362
1216 3300046692 Ga0495671_0000996 Ga0495671_0000996_15127_16215 362
1217 3300046692 Ga0495671_0010143 Ga0495671_0010143_3222_4310 362
1218 3300046692 Ga0495671_0012943 Ga0495671_0012943_2812_3900 362
1219 3300046692 Ga0495671_0022894 Ga0495671_0022894_2055_3143 362
1220 3300046692 Ga0495671_0028435 Ga0495671_0028435_1753_2841 362
1221 3300046692 Ga0495671_0031010 Ga0495671_0031010_1628_2716 362
1222 3300046692 Ga0495671_0044624 Ga0495671_0044624_443_1531 362
1223 3300046692 Ga0495671_0047979 Ga0495671_0047979_471_1559 362
1224 3300046694 Ga0495649_0000669 Ga0495649_0000669_18055_19143 362
1225 3300046694 Ga0495649_0001381 Ga0495649_0001381_9318_10406 362
1226 3300046694 Ga0495649_0001911 Ga0495649_0001911_9325_10455 362
1227 3300046694 Ga0495649_0002054 Ga0495649_0002054_10899_11987 362
1228 3300046694 Ga0495649_0002115 Ga0495649_0002115_2809_3897 362
1229 3300046694 Ga0495649_0004031 Ga0495649_0004031_407_1495 362
1230 3300046794 Ga0495589_0001220 Ga0495589_0001220_9318_10406 362
1231 3300046794 Ga0495589_0001226 Ga0495589_0001226_4777_5907 362
1232 3300046794 Ga0495589_0010620 Ga0495589_0010620_1831_2919 362
1233 3300046794 Ga0495589_0011847 Ga0495589_0011847_731_1819 362
1234 3300046794 Ga0495589_0026039 Ga0495589_0026039_709_1797 362
1235 3300046794 Ga0495589_0046096 Ga0495589_0046096_271_1359 362
1236 3300046794 Ga0495589_0072911 Ga0495589_0072911_114_1202 362
1237 3300046809 Ga0495600_0066546 Ga0495600_0066546_554_1756 362
1238 3300046810 Ga0495660_0002046 Ga0495660_0002046_9295_10383 362
1239 3300046810 Ga0495660_0009301 Ga0495660_0009301_3996_5084 362
1240 3300046810 Ga0495660_0013427 Ga0495660_0013427_52_1140 362
1241 3300046810 Ga0495660_0014046 Ga0495660_0014046_217_1305 362
1242 3300046810 Ga0495660_0014780 Ga0495660_0014780_2243_3331 362
1243 3300046810 Ga0495660_0031206 Ga0495660_0031206_701_1789 362
1244 3300046810 Ga0495660_0040582 Ga0495660_0040582_1388_2476 362
1245 3300046810 Ga0495660_0049066 Ga0495660_0049066_163_1251 362
1246 3300047315 Ga0495581_0092864 Ga0495581_0092864_183_1385 362
1247 3300047317 Ga0495604_0001053 Ga0495604_0001053_9289_10377 362
1248 3300047317 Ga0495604_0031777 Ga0495604_0031777_945_2033 362
1249 3300047317 Ga0495604_0075240 Ga0495604_0075240_1233_2321 362
1250 3300047317 Ga0495604_0159435 Ga0495604_0159435_72_1274 362
1251 3300047318 Ga0495636_0008415 Ga0495636_0008415_2510_3598 362
1252 3300047318 Ga0495636_0049036 Ga0495636_0049036_458_1588 362
1253 3300047320 Ga0495672_0001293 Ga0495672_0001293_9261_10391 362
1254 3300047320 Ga0495672_0001470 Ga0495672_0001470_13152_14240 362
1255 3300047320 Ga0495672_0003596 Ga0495672_0003596_9327_10415 362
1256 3300047320 Ga0495672_0003633 Ga0495672_0003633_2659_3747 362
1257 3300047320 Ga0495672_0004034 Ga0495672_0004034_1888_2976 362
1258 3300047320 Ga0495672_0004181 Ga0495672_0004181_9687_10775 362
1259 3300047320 Ga0495672_0005600 Ga0495672_0005600_349_1437 362
1260 3300047320 Ga0495672_0005963 Ga0495672_0005963_3363_4451 362
1261 3300047320 Ga0495672_0022966 Ga0495672_0022966_1154_2242 362
1262 3300047320 Ga0495672_0052546 Ga0495672_0052546_350_1438 362
1263 3300047321 Ga0495676_0001991 Ga0495676_0001991_9337_10425 362
1264 3300047322 Ga0495680_0007262 Ga0495680_0007262_9049_10137 362
1265 3300047322 Ga0495680_0009252 Ga0495680_0009252_4652_5740 362
1266 3300047323 Ga0495683_0000398 Ga0495683_0000398_22559_23647 362
1267 3300047323 Ga0495683_0000521 Ga0495683_0000521_18997_20085 362
1268 3300047323 Ga0495683_0004343 Ga0495683_0004343_5143_6231 362
1269 3300047323 Ga0495683_0011875 Ga0495683_0011875_2568_3656 362
1270 3300047323 Ga0495683_0019465 Ga0495683_0019465_1351_2439 362
1271 3300047443 Ga0495687_002509 Ga0495687_002509_5433_6521 362
1272 3300047444 Ga0495675_0152773 Ga0495675_0152773_278_1366 362
1273 3300047445 Ga0495677_0000430 Ga0495677_0000430_2821_3909 362
1274 3300047446 Ga0495679_000856 Ga0495679_000856_8849_9937 362
1275 3300047446 Ga0495679_001532 Ga0495679_001532_9178_10266 362
1276 3300047446 Ga0495679_009936 Ga0495679_009936_1638_2726 362
1277 3300047446 Ga0495679_024865 Ga0495679_024865_285_1373 362
1278 3300047446 Ga0495679_036486 Ga0495679_036486_227_1315 362
1279 3300047469 Ga0495673_0000920 Ga0495673_0000920_9245_10333 362
1280 3300047469 Ga0495673_0001377 Ga0495673_0001377_9246_10334 362
1281 3300047469 Ga0495673_0002095 Ga0495673_0002095_2889_3977 362
1282 3300047469 Ga0495673_0002401 Ga0495673_0002401_9308_10396 362
1283 3300047469 Ga0495673_0002697 Ga0495673_0002697_1873_2961 362
1284 3300047469 Ga0495673_0004117 Ga0495673_0004117_2222_3325 362
1285 3300047469 Ga0495673_0005693 Ga0495673_0005693_3594_4682 362
1286 3300047469 Ga0495673_0015724 Ga0495673_0015724_1760_2848 362
1287 3300047469 Ga0495673_0018043 Ga0495673_0018043_1958_3061 362
1288 3300047469 Ga0495673_0029410 Ga0495673_0029410_1131_2219 362
1289 3300047470 Ga0495681_0001697 Ga0495681_0001697_9272_10360 362
1290 3300047470 Ga0495681_0005270 Ga0495681_0005270_5654_6742 362
1291 3300047470 Ga0495681_0007114 Ga0495681_0007114_4123_5211 362
1292 3300047470 Ga0495681_0007978 Ga0495681_0007978_1538_2626 362
1293 3300047470 Ga0495681_0010384 Ga0495681_0010384_4013_5101 362
1294 3300047470 Ga0495681_0018824 Ga0495681_0018824_731_1819 362
1295 3300047470 Ga0495681_0024583 Ga0495681_0024583_1644_2732 362
1296 3300047470 Ga0495681_0025715 Ga0495681_0025715_1037_2125 362
1297 3300047471 Ga0495684_0002346 Ga0495684_0002346_8465_9553 362
1298 3300047472 Ga0495686_0001725 Ga0495686_0001725_10351_11439 362
1299 3300047472 Ga0495686_0003808 Ga0495686_0003808_2452_3540 362
1300 3300047472 Ga0495686_0008731 Ga0495686_0008731_1468_2556 362
1301 3300047673 Ga0495593_0010238 Ga0495593_0010238_2196_3284 362
1302 3300047673 Ga0495593_0045807 Ga0495593_0045807_311_1399 362
1303 3300047673 Ga0495593_0060026 Ga0495593_0060026_168_1256 362
1304 3300048088 Ga0495602_0006039 Ga0495602_0006039_9299_10387 362
1305 3300048091 Ga0495626_0000700 Ga0495626_0000700_21499_22587 362
1306 3300048091 Ga0495626_0001141 Ga0495626_0001141_11684_12772 362
1307 3300048091 Ga0495626_0002058 Ga0495626_0002058_9170_10258 362
1308 3300048091 Ga0495626_0002369 Ga0495626_0002369_9304_10392 362
1309 3300048091 Ga0495626_0002577 Ga0495626_0002577_9294_10382 362
1310 3300048091 Ga0495626_0002605 Ga0495626_0002605_1916_3004 362
1311 3300048091 Ga0495626_0004067 Ga0495626_0004067_4735_5865 362
1312 3300048091 Ga0495626_0047215 Ga0495626_0047215_792_1880 362
1313 3300048905 Ga0496102_0002070 Ga0496102_0002070_6945_8033 362
1314 3300048905 Ga0496102_0023271 Ga0496102_0023271_3374_4477 362
1315 3300048913 Ga0496110_0107949 Ga0496110_0107949_418_1506 362
1316 3300048919 Ga0496116_0001097 Ga0496116_0001097_18926_20014 362
1317 3300048919 Ga0496116_0003192 Ga0496116_0003192_6008_7096 362
1318 3300048919 Ga0496116_0006297 Ga0496116_0006297_5501_6589 362
1319 3300048919 Ga0496116_0013876 Ga0496116_0013876_4283_5371 362
1320 3300048920 Ga0496117_0001203 Ga0496117_0001203_8913_10001 362
1321 3300048920 Ga0496117_0003903 Ga0496117_0003903_9426_10514 362
1322 3300048920 Ga0496117_0042306 Ga0496117_0042306_1699_2787 362
1323 3300048920 Ga0496117_0084548 Ga0496117_0084548_190_1278 362
1324 3300048921 Ga0496118_0004774 Ga0496118_0004774_3532_4620 362
1325 3300048921 Ga0496118_0034444 Ga0496118_0034444_2671_3759 362
1326 3300048921 Ga0496118_0094654 Ga0496118_0094654_786_1874 362
1327 3300048921 Ga0496118_0106597 Ga0496118_0106597_303_1391 362
1328 3300048922 Ga0496119_0000011 Ga0496119_0000011_78408_79496 362
1329 3300048922 Ga0496119_0013053 Ga0496119_0013053_4886_5974 362
1330 3300048922 Ga0496119_0130288 Ga0496119_0130288_167_1255 362
1331 3300048923 Ga0496120_0000306 Ga0496120_0000306_57178_58266 362
1332 3300048924 Ga0496121_0001896 Ga0496121_0001896_2969_4072 362
1333 3300048924 Ga0496121_0002793 Ga0496121_0002793_15357_16445 362
1334 3300048924 Ga0496121_0005855 Ga0496121_0005855_4240_5328 362
1335 3300048924 Ga0496121_0042676 Ga0496121_0042676_2237_3325 362
1336 3300048924 Ga0496121_0123020 Ga0496121_0123020_146_1234 362
1337 3300048925 Ga0496122_0031402 Ga0496122_0031402_2004_3092 362
1338 3300048925 Ga0496122_0073997 Ga0496122_0073997_177_1280 362
1339 3300048926 Ga0496123_0000136 Ga0496123_0000136_109906_110994 362
1340 3300048926 Ga0496123_0056940 Ga0496123_0056940_761_1849 362
1341 3300048927 Ga0496124_0001568 Ga0496124_0001568_8849_9937 362
1342 3300048927 Ga0496124_0007112 Ga0496124_0007112_9627_10715 362
1343 3300048927 Ga0496124_0007942 Ga0496124_0007942_8853_9956 362
1344 3300048927 Ga0496124_0009896 Ga0496124_0009896_8143_9231 362
1345 3300048927 Ga0496124_0035612 Ga0496124_0035612_1351_2442 362
1346 3300048927 Ga0496124_0065901 Ga0496124_0065901_379_1482 362
1347 3300048928 Ga0496125_0001504 Ga0496125_0001504_11688_12776 362
1348 3300048928 Ga0496125_0001952 Ga0496125_0001952_25186_26274 362
1349 3300048928 Ga0496125_0007693 Ga0496125_0007693_1633_2721 362
1350 3300048928 Ga0496125_0028488 Ga0496125_0028488_1746_2834 362
1351 3300048928 Ga0496125_0085469 Ga0496125_0085469_1064_2152 362
1352 3300048929 Ga0496126_0026316 Ga0496126_0026316_324_1412 362
1353 3300048929 Ga0496126_0101028 Ga0496126_0101028_815_1903 362
1354 3300049459 Ga0495678_001463 Ga0495678_001463_6752_7882 362
1355 3300049459 Ga0495678_002299 Ga0495678_002299_9306_10394 362
1356 3300049459 Ga0495678_002983 Ga0495678_002983_7049_8137 362
1357 3300049459 Ga0495678_017451 Ga0495678_017451_935_2023 362
1358 3300049459 Ga0495678_019194 Ga0495678_019194_57_1145 362
1359 3300049459 Ga0495678_021113 Ga0495678_021113_1755_2843 362
1360 3300049459 Ga0495678_026028 Ga0495678_026028_1210_2298 362
1361 3300049459 Ga0495678_028507 Ga0495678_028507_213_1301 362
1362 3300049459 Ga0495678_035024 Ga0495678_035024_226_1314 362
1363 3300049460 Ga0495682_0000272 Ga0495682_0000272_28761_29864 362
1364 3300049460 Ga0495682_0001892 Ga0495682_0001892_9321_10409 362
1365 iso_pu_bacteria 2554235341 2555669088 362
1366 iso_pu_bacteria 8019769354 8019775294 362
1367 iso_pu_bacteria 8057798959 8057799454 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17763

Asparaginase_C

Glutaminase/Asparaginase C-terminal domain

297

407

0.99

PF00710

Asparaginase

Asparaginase, N-terminal

85

279

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wyz-assembly1.cif.gz_D crystal structure of pseudomonas 7a glutaminase-asparaginase (mutant k173m) in complex with d-glu at ph 5.5 0.9875 34 362
6wyz-assembly1.cif.gz_C crystal structure of pseudomonas 7a glutaminase-asparaginase (mutant k173m) in complex with d-glu at ph 5.5 0.9873 33 362
6wyz-assembly1.cif.gz_B crystal structure of pseudomonas 7a glutaminase-asparaginase (mutant k173m) in complex with d-glu at ph 5.5 0.9854 33 362
6wyy-assembly1.cif.gz_B crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-glu at ph 6.5 0.985 33 362
6wyx-assembly1.cif.gz_B crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-asp at ph 5.0 0.9845 32 362
ID Description Score Start End Superfamily
1djoB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.984 248 361 3.40.50.40
1djoB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9755 248 361 3.40.50.40
2wt4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.9639 34 244 3.40.50.1170
2wt4A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.963 248 361 3.40.50.40
1hfjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.9601 33 247 3.40.50.1170
ID Description Score Start End GO Terms
AF-A0A3M5PLP8-F1-model_v4 deleted 0.989 70 362
AF-A0A7Y2PKT2-F1-model_v4 L-asparaginase 0.9888 174 362 GO:0004067
AF-A0A2N2R126-F1-model_v4 L-asparaginase 0.9888 206 362 GO:0004067
AF-A0A3M4HBY0-F1-model_v4 deleted 0.9837 47 362
AF-A0A2N2R126-F1-model_v4 L-asparaginase 0.9825 206 362 GO:0004067

Feature Viewer

pLDDT pTM Quality
88.09 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map