F493203

General Info

Members Datasets Scaffolds Average Seq Length
1347 349 2694 176

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100018642|Ga0070690_1000186421
Length 206
Sequence MIETLAFYVFAAVAVGASLLVIAQRNPIYSVLLLIASFGALSGLYVLLDAPFVAAIQIIVYAGAIMVLFLFVVMLLNAPQEDTEYDARVHPLLRPGPMKFGAALALLLIAELWWALGRSGDSGRFPAGAVASVGAIGRSLFTDYAFAFEVTSILILVAMVGAVVLARRDPVAQPTSPLAVPDNLEEDARVASSFGAGGPAATENRP

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
205 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
206 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
207 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
246 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
247 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
252 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
253 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
326 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
345 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
346 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 3.49
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100018642 3300005330 Bacteria 4195
2 JGI24746J21847_1041811 3300001977 Bacteria 638
3 JGI24751J29686_10039665 3300002459 Bacteria 975
4 JGI25406J46586_10048172 3300003203 Bacteria 1447
5 Ga0065714_10184703 3300005288 Bacteria 949
6 Ga0065704_10101672 3300005289 Bacteria 2230
7 Ga0065712_10000240 3300005290 Bacteria 24235
8 Ga0065712_10005522 3300005290 Bacteria 4487
9 Ga0065712_10026914 3300005290 Bacteria 1454
10 Ga0065712_10070470 3300005290 Bacteria 5982
11 Ga0065712_10371044 3300005290 Bacteria 760
12 Ga0065715_10000461 3300005293 Bacteria 26573
13 Ga0065715_10064798 3300005293 Bacteria 1142
14 Ga0065715_10112114 3300005293 Bacteria 2543
15 Ga0065715_10145692 3300005293 Bacteria 1792
16 Ga0065715_10163795 3300005293 Bacteria 1605
17 Ga0065715_10194886 3300005293 Bacteria 1393
18 Ga0065715_10213819 3300005293 Bacteria 1297
19 Ga0065715_10307168 3300005293 Bacteria 1024
20 Ga0065715_10317030 3300005293 Bacteria 1003
21 Ga0065715_10331912 3300005293 Bacteria 982
22 Ga0065715_10578623 3300005293 Bacteria 722
23 Ga0065715_10830841 3300005293 Bacteria 599
24 Ga0065715_10914311 3300005293 Bacteria 570
25 Ga0065707_10094204 3300005295 Bacteria 3526
26 Ga0065707_10099522 3300005295 Bacteria 2993
27 Ga0065707_10146627 3300005295 Bacteria 1702
28 Ga0065707_10228561 3300005295 Bacteria 1197
29 Ga0065707_10276085 3300005295 Bacteria 1059
30 Ga0065707_10279954 3300005295 Bacteria 1050
31 Ga0070658_10089100 3300005327 Bacteria 2541
32 Ga0070676_10005503 3300005328 Bacteria 6745
33 Ga0070676_10014434 3300005328 Bacteria 4341
34 Ga0070676_10033396 3300005328 Bacteria 2952
35 Ga0070676_10140714 3300005328 Bacteria 1536
36 Ga0070676_10159697 3300005328 Bacteria 1450
37 Ga0070676_10333764 3300005328 Bacteria 1038
38 Ga0070676_10359539 3300005328 Bacteria 1003
39 Ga0070676_10668308 3300005328 Bacteria 756
40 Ga0070683_100018004 3300005329 Bacteria 6247
41 Ga0070683_100100664 3300005329 Bacteria 2720
42 Ga0070683_100213646 3300005329 Bacteria 1833
43 Ga0070683_100275344 3300005329 Bacteria 1601
44 Ga0070683_100519512 3300005329 Bacteria 1138
45 Ga0070683_100563121 3300005329 Bacteria 1090
46 Ga0070683_101301167 3300005329 Bacteria 699
47 Ga0070690_100005505 3300005330 Bacteria 7120
48 Ga0070690_100014126 3300005330 Bacteria 4733
49 Ga0070690_100264304 3300005330 Bacteria 1221
50 Ga0070690_100331355 3300005330 Bacteria 1100
51 Ga0070690_100455087 3300005330 Bacteria 950
52 Ga0070690_100753635 3300005330 Bacteria 752
53 Ga0070670_100001520 3300005331 Bacteria 18661
54 Ga0070670_100004554 3300005331 Bacteria 11624
55 Ga0070670_100029058 3300005331 Bacteria 4757
56 Ga0070670_100180505 3300005331 Bacteria 1833
57 Ga0070670_100193933 3300005331 Bacteria 1765
58 Ga0070670_100197968 3300005331 Bacteria 1745
59 Ga0070670_100247051 3300005331 Bacteria 1554
60 Ga0070670_100283972 3300005331 Bacteria 1445
61 Ga0070670_100506819 3300005331 Bacteria 1074
62 Ga0070670_100688794 3300005331 Bacteria 918
63 Ga0070670_100991579 3300005331 Bacteria 764
64 Ga0070670_101007238 3300005331 Bacteria 758
65 Ga0070677_10126897 3300005333 Bacteria 1160
66 Ga0070677_10212763 3300005333 Bacteria 940
67 Ga0070677_10372149 3300005333 Bacteria 746
68 Ga0070677_10469447 3300005333 Bacteria 677
69 Ga0070677_10493093 3300005333 Bacteria 663
70 Ga0068869_100007617 3300005334 Bacteria 6931
71 Ga0068869_100074764 3300005334 Bacteria 2515
72 Ga0068869_100092676 3300005334 Bacteria 2274
73 Ga0068869_100205813 3300005334 Bacteria 1554
74 Ga0068869_100557010 3300005334 Bacteria 964
75 Ga0070666_10021991 3300005335 Bacteria 4138
76 Ga0070666_10118968 3300005335 Bacteria 1831
77 Ga0070666_10222441 3300005335 Bacteria 1332
78 Ga0070666_10237195 3300005335 Bacteria 1289
79 Ga0070666_10266242 3300005335 Bacteria 1216
80 Ga0070666_10281560 3300005335 Bacteria 1182
81 Ga0070666_10305377 3300005335 Bacteria 1134
82 Ga0070666_10399075 3300005335 Bacteria 988
83 Ga0070680_100142020 3300005336 Bacteria 2014
84 Ga0070680_100345938 3300005336 Bacteria 1264
85 Ga0070680_100424081 3300005336 Bacteria 1135
86 Ga0070680_100691247 3300005336 Bacteria 878
87 Ga0070680_100855950 3300005336 Bacteria 784
88 Ga0070682_100170275 3300005337 Bacteria 1513
89 Ga0068868_100013464 3300005338 Bacteria 5997
90 Ga0068868_100141767 3300005338 Bacteria 1973
91 Ga0068868_100179376 3300005338 Bacteria 1756
92 Ga0068868_100398950 3300005338 Bacteria 1187
93 Ga0068868_100543730 3300005338 Bacteria 1023
94 Ga0068868_100806987 3300005338 Bacteria 847
95 Ga0070660_100116844 3300005339 Bacteria 2127
96 Ga0070660_100235303 3300005339 Bacteria 1491
97 Ga0070660_100495897 3300005339 Bacteria 1016
98 Ga0070689_100022262 3300005340 Bacteria 4731
99 Ga0070689_100039962 3300005340 Bacteria 3594
100 Ga0070689_100098694 3300005340 Bacteria 2310
101 Ga0070689_100273205 3300005340 Bacteria 1400
102 Ga0070689_100351368 3300005340 Bacteria 1237
103 Ga0070691_10110122 3300005341 Bacteria 1377
104 Ga0070691_10157253 3300005341 Bacteria 1169
105 Ga0070691_10343511 3300005341 Bacteria 827
106 Ga0070687_100043586 3300005343 Bacteria 2281
107 Ga0070661_100122208 3300005344 Bacteria 1951
108 Ga0070661_100423015 3300005344 Bacteria 1056
109 Ga0070661_100553510 3300005344 Bacteria 926
110 Ga0070661_101258539 3300005344 Bacteria 620
111 Ga0070692_10622877 3300005345 Bacteria 717
112 Ga0070668_100083339 3300005347 Bacteria 2510
113 Ga0070668_100201570 3300005347 Bacteria 1633
114 Ga0070668_100278583 3300005347 Bacteria 1396
115 Ga0070668_100469874 3300005347 Bacteria 1084
116 Ga0070668_100625792 3300005347 Bacteria 944
117 Ga0070668_100774676 3300005347 Bacteria 851
118 Ga0070669_100030897 3300005353 Bacteria 3866
119 Ga0070669_100249214 3300005353 Bacteria 1414
120 Ga0070669_100261556 3300005353 Bacteria 1381
121 Ga0070669_100295507 3300005353 Bacteria 1301
122 Ga0070669_100353396 3300005353 Bacteria 1193
123 Ga0070669_100406663 3300005353 Bacteria 1115
124 Ga0070669_100434364 3300005353 Bacteria 1080
125 Ga0070675_100000126 3300005354 Bacteria 45585
126 Ga0070675_100003326 3300005354 Bacteria 12193
127 Ga0070675_100007860 3300005354 Bacteria 8265
128 Ga0070675_100023380 3300005354 Bacteria 4941
129 Ga0070675_100041763 3300005354 Bacteria 3746
130 Ga0070675_100053441 3300005354 Bacteria 3322
131 Ga0070675_100073515 3300005354 Bacteria 2838
132 Ga0070675_100139745 3300005354 Bacteria 2070
133 Ga0070675_100233143 3300005354 Bacteria 1606
134 Ga0070675_100414821 3300005354 Bacteria 1203
135 Ga0070675_100782055 3300005354 Bacteria 872
136 Ga0070675_101298423 3300005354 Bacteria 671
137 Ga0070671_100001545 3300005355 Bacteria 17310
138 Ga0070671_100182780 3300005355 Bacteria 1775
139 Ga0070671_100324215 3300005355 Bacteria 1313
140 Ga0070671_100372969 3300005355 Bacteria 1219
141 Ga0070671_100526860 3300005355 Bacteria 1018
142 Ga0070671_101058609 3300005355 Bacteria 712
143 Ga0070674_100013172 3300005356 Bacteria 5103
144 Ga0070674_100052538 3300005356 Bacteria 2811
145 Ga0070674_100096038 3300005356 Bacteria 2150
146 Ga0070674_100246238 3300005356 Bacteria 1402
147 Ga0070674_100418671 3300005356 Bacteria 1098
148 Ga0070674_100666634 3300005356 Bacteria 886
149 Ga0070673_100000690 3300005364 Bacteria 18661
150 Ga0070673_100037832 3300005364 Bacteria 3680
151 Ga0070673_100060303 3300005364 Bacteria 3006
152 Ga0070673_100095114 3300005364 Bacteria 2443
153 Ga0070673_100129850 3300005364 Bacteria 2112
154 Ga0070673_100178025 3300005364 Bacteria 1819
155 Ga0070673_100396736 3300005364 Bacteria 1233
156 Ga0070673_100766536 3300005364 Bacteria 889
157 Ga0070673_100897923 3300005364 Bacteria 821
158 Ga0070673_101454703 3300005364 Bacteria 646
159 Ga0070688_100017879 3300005365 Bacteria 4077
160 Ga0070688_100020144 3300005365 Bacteria 3874
161 Ga0070688_100069081 3300005365 Bacteria 2255
162 Ga0070688_100132335 3300005365 Bacteria 1684
163 Ga0070688_100146247 3300005365 Bacteria 1611
164 Ga0070688_100237521 3300005365 Bacteria 1292
165 Ga0070659_100027011 3300005366 Bacteria 4420
166 Ga0070659_100660401 3300005366 Bacteria 902
167 Ga0070667_100046326 3300005367 Bacteria 3658
168 Ga0070667_100389215 3300005367 Bacteria 1267
169 Ga0070667_100624619 3300005367 Bacteria 994
170 Ga0070667_101255110 3300005367 Bacteria 694
171 Ga0070710_10625798 3300005437 Bacteria 752
172 Ga0070701_10027018 3300005438 Bacteria 2806
173 Ga0070701_10070153 3300005438 Bacteria 1872
174 Ga0070701_10109401 3300005438 Bacteria 1542
175 Ga0070701_10117512 3300005438 Bacteria 1494
176 Ga0070701_10600514 3300005438 Bacteria 729
177 Ga0070701_10839436 3300005438 Bacteria 630
178 Ga0070711_100280936 3300005439 Bacteria 1317
179 Ga0070705_100000680 3300005440 Bacteria 19483
180 Ga0070705_100173502 3300005440 Bacteria 1453
181 Ga0070705_100187543 3300005440 Bacteria 1406
182 Ga0070705_100462112 3300005440 Bacteria 955
183 Ga0070705_101231647 3300005440 Bacteria 618
184 Ga0070700_100034040 3300005441 Bacteria 3073
185 Ga0070700_100055981 3300005441 Bacteria 2471
186 Ga0070700_100207361 3300005441 Bacteria 1381
187 Ga0070700_100482863 3300005441 Bacteria 949
188 Ga0070700_100658650 3300005441 Bacteria 828
189 Ga0070694_100006774 3300005444 Bacteria 6960
190 Ga0070694_100044907 3300005444 Bacteria 2959
191 Ga0070694_100063598 3300005444 Bacteria 2524
192 Ga0070694_100123107 3300005444 Bacteria 1863
193 Ga0070694_100169787 3300005444 Bacteria 1606
194 Ga0070694_100206570 3300005444 Bacteria 1467
195 Ga0070694_100340744 3300005444 Bacteria 1159
196 Ga0070694_100859678 3300005444 Bacteria 747
197 Ga0070708_100031961 3300005445 Bacteria 4561
198 Ga0070708_100661858 3300005445 Bacteria 984
199 Ga0070708_100730200 3300005445 Bacteria 932
200 Ga0070708_101323328 3300005445 Bacteria 673
201 Ga0070663_100066957 3300005455 Bacteria 2604
202 Ga0070663_100144362 3300005455 Bacteria 1820
203 Ga0070678_100004340 3300005456 Bacteria 8024
204 Ga0070678_100135625 3300005456 Bacteria 1962
205 Ga0070678_100552197 3300005456 Bacteria 1023
206 Ga0070678_100592467 3300005456 Bacteria 989
207 Ga0070678_100955161 3300005456 Bacteria 786
208 Ga0070678_101605623 3300005456 Bacteria 611
209 Ga0070662_100151156 3300005457 Bacteria 1808
210 Ga0070662_100219691 3300005457 Bacteria 1516
211 Ga0070662_100219998 3300005457 Bacteria 1515
212 Ga0070662_100248910 3300005457 Bacteria 1428
213 Ga0070662_100266352 3300005457 Bacteria 1382
214 Ga0070662_100366917 3300005457 Bacteria 1183
215 Ga0070662_100536470 3300005457 Bacteria 979
216 Ga0070662_100967423 3300005457 Bacteria 728
217 Ga0070681_10021192 3300005458 Bacteria 6512
218 Ga0070681_10083175 3300005458 Bacteria 3154
219 Ga0070681_10211278 3300005458 Bacteria 1857
220 Ga0070681_10238377 3300005458 Bacteria 1733
221 Ga0070681_10802843 3300005458 Bacteria 858
222 Ga0068867_100002261 3300005459 Bacteria 13543
223 Ga0068867_100283344 3300005459 Bacteria 1360
224 Ga0068867_100299779 3300005459 Bacteria 1325
225 Ga0068867_100383231 3300005459 Bacteria 1181
226 Ga0068867_100466036 3300005459 Bacteria 1079
227 Ga0068867_101612259 3300005459 Bacteria 607
228 Ga0070685_10003607 3300005466 Bacteria 7854
229 Ga0070685_10467536 3300005466 Bacteria 887
230 Ga0070685_10494207 3300005466 Bacteria 864
231 Ga0070706_100199536 3300005467 Bacteria 1869
232 Ga0070706_100293009 3300005467 Bacteria 1518
233 Ga0070706_100416918 3300005467 Bacteria 1250
234 Ga0070706_100690614 3300005467 Bacteria 947
235 Ga0070707_100043580 3300005468 Bacteria 4294
236 Ga0070707_100237663 3300005468 Bacteria 1773
237 Ga0070707_100306268 3300005468 Bacteria 1544
238 Ga0070707_100408713 3300005468 Bacteria 1318
239 Ga0070698_100009236 3300005471 Bacteria 10578
240 Ga0070698_100167566 3300005471 Bacteria 2138
241 Ga0070698_100229712 3300005471 Bacteria 1789
242 Ga0070698_100323196 3300005471 Bacteria 1474
243 Ga0070698_100777578 3300005471 Bacteria 901
244 Ga0070698_101688872 3300005471 Bacteria 586
245 Ga0070699_100009305 3300005518 Bacteria 8508
246 Ga0070699_100073511 3300005518 Bacteria 2974
247 Ga0070699_100183126 3300005518 Bacteria 1859
248 Ga0070699_100329184 3300005518 Bacteria 1374
249 Ga0070699_100417218 3300005518 Bacteria 1215
250 Ga0070679_100010924 3300005530 Bacteria 8628
251 Ga0070679_100106332 3300005530 Bacteria 2792
252 Ga0070679_100183062 3300005530 Bacteria 2067
253 Ga0070684_100053249 3300005535 Bacteria 3522
254 Ga0070684_100078170 3300005535 Bacteria 2923
255 Ga0070684_100189390 3300005535 Bacteria 1871
256 Ga0070697_100039640 3300005536 Bacteria 3810
257 Ga0070697_100041400 3300005536 Bacteria 3729
258 Ga0070697_100072419 3300005536 Bacteria 2828
259 Ga0070697_100453942 3300005536 Bacteria 1117
260 Ga0070697_100789868 3300005536 Bacteria 840
261 Ga0070697_100892027 3300005536 Bacteria 789
262 Ga0070697_100931937 3300005536 Bacteria 771
263 Ga0070697_101069763 3300005536 Bacteria 718
264 Ga0070697_101419677 3300005536 Bacteria 620
265 Ga0068853_100219864 3300005539 Bacteria 1734
266 Ga0068853_100771361 3300005539 Bacteria 920
267 Ga0070672_100017929 3300005543 Bacteria 5107
268 Ga0070672_100027960 3300005543 Bacteria 4212
269 Ga0070672_100056768 3300005543 Bacteria 3072
270 Ga0070672_100069451 3300005543 Bacteria 2797
271 Ga0070672_100080293 3300005543 Bacteria 2613
272 Ga0070672_100203611 3300005543 Bacteria 1655
273 Ga0070672_100357082 3300005543 Bacteria 1247
274 Ga0070672_100377457 3300005543 Bacteria 1212
275 Ga0070672_100379500 3300005543 Bacteria 1209
276 Ga0070672_100639362 3300005543 Bacteria 929
277 Ga0070672_100662583 3300005543 Bacteria 912
278 Ga0070686_100044521 3300005544 Bacteria 2790
279 Ga0070686_100128432 3300005544 Bacteria 1750
280 Ga0070686_100238538 3300005544 Bacteria 1322
281 Ga0070686_100410575 3300005544 Bacteria 1032
282 Ga0070695_100000031 3300005545 Bacteria 53175
283 Ga0070695_100003224 3300005545 Bacteria 9522
284 Ga0070695_100044059 3300005545 Bacteria 2839
285 Ga0070695_100156145 3300005545 Bacteria 1597
286 Ga0070695_100347849 3300005545 Bacteria 1110
287 Ga0070695_100457061 3300005545 Bacteria 980
288 Ga0070695_100695368 3300005545 Bacteria 807
289 Ga0070696_100003109 3300005546 Bacteria 11043
290 Ga0070696_100038755 3300005546 Bacteria 3290
291 Ga0070696_100097038 3300005546 Bacteria 2107
292 Ga0070696_100155336 3300005546 Bacteria 1682
293 Ga0070696_100192271 3300005546 Bacteria 1519
294 Ga0070696_100323931 3300005546 Bacteria 1187
295 Ga0070696_100373261 3300005546 Bacteria 1110
296 Ga0070696_100555146 3300005546 Bacteria 921
297 Ga0070696_100602768 3300005546 Bacteria 886
298 Ga0070696_100795914 3300005546 Bacteria 778
299 Ga0070693_100191081 3300005547 Bacteria 1324
300 Ga0070693_100484980 3300005547 Bacteria 874
301 Ga0070665_100022156 3300005548 Bacteria 6391
302 Ga0070665_100128541 3300005548 Bacteria 2536
303 Ga0070665_100261816 3300005548 Bacteria 1731
304 Ga0070665_100424751 3300005548 Bacteria 1338
305 Ga0070665_101659199 3300005548 Bacteria 647
306 Ga0070704_100019765 3300005549 Bacteria 4333
307 Ga0070704_100176454 3300005549 Bacteria 1705
308 Ga0070704_100392204 3300005549 Bacteria 1182
309 Ga0070704_100421913 3300005549 Bacteria 1143
310 Ga0070704_100472899 3300005549 Bacteria 1083
311 Ga0070704_100501845 3300005549 Bacteria 1053
312 Ga0070704_100561090 3300005549 Bacteria 999
313 Ga0068855_100857735 3300005563 Bacteria 962
314 Ga0070664_100019238 3300005564 Bacteria 5617
315 Ga0070664_100041229 3300005564 Bacteria 3895
316 Ga0070664_100124761 3300005564 Bacteria 2257
317 Ga0070664_100261840 3300005564 Bacteria 1556
318 Ga0070664_100280757 3300005564 Bacteria 1502
319 Ga0070664_100379572 3300005564 Bacteria 1290
320 Ga0070664_100413365 3300005564 Bacteria 1235
321 Ga0070664_100444437 3300005564 Bacteria 1190
322 Ga0070664_100474456 3300005564 Bacteria 1151
323 Ga0070664_100596854 3300005564 Bacteria 1024
324 Ga0068857_101582180 3300005577 Bacteria 640
325 Ga0068854_100016855 3300005578 Bacteria 4878
326 Ga0068854_100026705 3300005578 Bacteria 3971
327 Ga0068854_100132776 3300005578 Bacteria 1903
328 Ga0068854_100186137 3300005578 Bacteria 1625
329 Ga0068856_100026269 3300005614 Bacteria 5678
330 Ga0068856_100695622 3300005614 Bacteria 1037
331 Ga0070702_100000460 3300005615 Bacteria 14494
332 Ga0070702_100210470 3300005615 Bacteria 1294
333 Ga0070702_100658458 3300005615 Bacteria 793
334 Ga0068852_100009316 3300005616 Bacteria 7284
335 Ga0068852_100317470 3300005616 Bacteria 1512
336 Ga0068852_100585006 3300005616 Bacteria 1119
337 Ga0068859_100006510 3300005617 Bacteria 11857
338 Ga0068859_100067705 3300005617 Bacteria 3605
339 Ga0068859_100234179 3300005617 Bacteria 1925
340 Ga0068859_100350703 3300005617 Bacteria 1571
341 Ga0068859_100430111 3300005617 Bacteria 1416
342 Ga0068859_100442126 3300005617 Bacteria 1396
343 Ga0068859_100697893 3300005617 Bacteria 1106
344 Ga0068859_100725153 3300005617 Bacteria 1084
345 Ga0068859_101272626 3300005617 Bacteria 810
346 Ga0068859_101536273 3300005617 Bacteria 735
347 Ga0068864_100004169 3300005618 Bacteria 11873
348 Ga0068864_100021080 3300005618 Bacteria 5457
349 Ga0068864_100162912 3300005618 Bacteria 2028
350 Ga0068864_100270407 3300005618 Bacteria 1583
351 Ga0068864_100500744 3300005618 Bacteria 1169
352 Ga0068864_100824145 3300005618 Bacteria 913
353 Ga0068864_101381185 3300005618 Bacteria 706
354 Ga0068866_10095462 3300005718 Bacteria 1629
355 Ga0068866_10236387 3300005718 Bacteria 1110
356 Ga0068866_10380714 3300005718 Bacteria 905
357 Ga0068866_10561546 3300005718 Bacteria 765
358 Ga0068861_100004634 3300005719 Bacteria 9230
359 Ga0068861_100137986 3300005719 Bacteria 1987
360 Ga0068861_100157076 3300005719 Bacteria 1872
361 Ga0068861_100188601 3300005719 Bacteria 1722
362 Ga0068861_100412120 3300005719 Bacteria 1202
363 Ga0068861_100501662 3300005719 Bacteria 1097
364 Ga0068861_101082166 3300005719 Bacteria 770
365 Ga0068861_101606016 3300005719 Bacteria 641
366 Ga0068851_10148780 3300005834 Bacteria 1279
367 Ga0068870_10110901 3300005840 Bacteria 1566
368 Ga0068870_10575843 3300005840 Bacteria 762
369 Ga0068870_10621337 3300005840 Bacteria 737
370 Ga0068863_100020030 3300005841 Bacteria 6399
371 Ga0068863_100031383 3300005841 Bacteria 5071
372 Ga0068863_100206555 3300005841 Bacteria 1890
373 Ga0068863_100243057 3300005841 Bacteria 1737
374 Ga0068863_100357183 3300005841 Bacteria 1424
375 Ga0068863_100464303 3300005841 Bacteria 1243
376 Ga0068863_100890646 3300005841 Bacteria 890
377 Ga0068858_100011089 3300005842 Bacteria 8522
378 Ga0068858_100032694 3300005842 Bacteria 4831
379 Ga0068858_100043870 3300005842 Bacteria 4146
380 Ga0068858_100069082 3300005842 Bacteria 3275
381 Ga0068858_100096160 3300005842 Bacteria 2760
382 Ga0068858_100110035 3300005842 Bacteria 2572
383 Ga0068858_100206491 3300005842 Bacteria 1858
384 Ga0068858_100330655 3300005842 Bacteria 1458
385 Ga0068858_100532217 3300005842 Bacteria 1137
386 Ga0068858_100723501 3300005842 Bacteria 969
387 Ga0068860_100030217 3300005843 Bacteria 5210
388 Ga0068860_100031570 3300005843 Bacteria 5092
389 Ga0068860_100187292 3300005843 Bacteria 2002
390 Ga0068860_100258861 3300005843 Bacteria 1695
391 Ga0068860_100309844 3300005843 Bacteria 1548
392 Ga0068860_100335039 3300005843 Bacteria 1487
393 Ga0068860_100471152 3300005843 Bacteria 1251
394 Ga0068860_100551557 3300005843 Bacteria 1155
395 Ga0068860_100991600 3300005843 Bacteria 858
396 Ga0068862_100003771 3300005844 Bacteria 12929
397 Ga0068862_100118946 3300005844 Bacteria 2327
398 Ga0068862_100141069 3300005844 Bacteria 2139
399 Ga0068862_100702580 3300005844 Bacteria 980
400 Ga0068862_100703845 3300005844 Bacteria 979
401 Ga0068862_101036202 3300005844 Bacteria 813
402 Ga0068862_101599725 3300005844 Bacteria 659
403 Ga0081455_10032518 3300005937 Bacteria 4699
404 Ga0081539_10011631 3300005985 Bacteria 6928
405 Ga0075364_10001175 3300006051 Bacteria 14026
406 Ga0070715_10148861 3300006163 Bacteria 1145
407 Ga0070716_100141970 3300006173 Bacteria 1533
408 Ga0070712_100336622 3300006175 Bacteria 1231
409 Ga0075367_10078003 3300006178 Bacteria 2000
410 Ga0097621_100000646 3300006237 Bacteria 24618
411 Ga0097621_100057369 3300006237 Bacteria 3184
412 Ga0097621_100074576 3300006237 Bacteria 2810
413 Ga0097621_100092048 3300006237 Bacteria 2539
414 Ga0097621_100116803 3300006237 Bacteria 2260
415 Ga0097621_100121483 3300006237 Bacteria 2215
416 Ga0097621_100127825 3300006237 Bacteria 2160
417 Ga0097621_100247333 3300006237 Bacteria 1561
418 Ga0097621_100286015 3300006237 Bacteria 1452
419 Ga0097621_100312628 3300006237 Bacteria 1390
420 Ga0097621_100322879 3300006237 Bacteria 1368
421 Ga0097621_101030519 3300006237 Bacteria 771
422 Ga0068871_100000958 3300006358 Bacteria 19291
423 Ga0068871_100015651 3300006358 Bacteria 5685
424 Ga0068871_100086620 3300006358 Bacteria 2603
425 Ga0068871_100102706 3300006358 Bacteria 2396
426 Ga0068871_100124392 3300006358 Bacteria 2181
427 Ga0068871_100216299 3300006358 Bacteria 1659
428 Ga0068871_100282503 3300006358 Bacteria 1452
429 Ga0068871_100308324 3300006358 Bacteria 1391
430 Ga0068871_100398626 3300006358 Bacteria 1225
431 Ga0068871_100400882 3300006358 Bacteria 1222
432 Ga0068871_100405985 3300006358 Bacteria 1214
433 Ga0068871_100621822 3300006358 Bacteria 984
434 Ga0068871_100835359 3300006358 Bacteria 851
435 Ga0075428_100004388 3300006844 Bacteria 15572
436 Ga0075428_100016696 3300006844 Bacteria 8106
437 Ga0075428_100109939 3300006844 Bacteria 3002
438 Ga0075428_100134607 3300006844 Bacteria 2687
439 Ga0075428_100260668 3300006844 Bacteria 1866
440 Ga0075428_100284409 3300006844 Bacteria 1779
441 Ga0075430_100033863 3300006846 Bacteria 4335
442 Ga0075430_100079109 3300006846 Bacteria 2756
443 Ga0075430_100183058 3300006846 Bacteria 1742
444 Ga0075430_100726437 3300006846 Bacteria 819
445 Ga0075431_100124505 3300006847 Bacteria 2660
446 Ga0075433_10000410 3300006852 Bacteria 27366
447 Ga0075433_10032578 3300006852 Bacteria 4464
448 Ga0075433_10041447 3300006852 Bacteria 3989
449 Ga0075433_10104151 3300006852 Bacteria 2514
450 Ga0075433_10227262 3300006852 Bacteria 1657
451 Ga0075433_10478873 3300006852 Bacteria 1096
452 Ga0075434_100002649 3300006871 Bacteria 15793
453 Ga0075434_100010265 3300006871 Bacteria 8775
454 Ga0075434_100016691 3300006871 Bacteria 7062
455 Ga0075434_100043489 3300006871 Bacteria 4456
456 Ga0075434_100060461 3300006871 Bacteria 3768
457 Ga0075434_100067384 3300006871 Bacteria 3566
458 Ga0075434_100160624 3300006871 Bacteria 2267
459 Ga0075434_100441610 3300006871 Bacteria 1322
460 Ga0075434_100462824 3300006871 Bacteria 1289
461 Ga0075429_100019101 3300006880 Bacteria 5937
462 Ga0075429_100023000 3300006880 Bacteria 5403
463 Ga0075429_100105538 3300006880 Bacteria 2461
464 Ga0075429_100206805 3300006880 Bacteria 1720
465 Ga0075429_100328372 3300006880 Bacteria 1339
466 Ga0068865_100058565 3300006881 Bacteria 2691
467 Ga0068865_100161970 3300006881 Bacteria 1707
468 Ga0068865_100330149 3300006881 Bacteria 1229
469 Ga0068865_100441636 3300006881 Bacteria 1074
470 Ga0068865_100491087 3300006881 Bacteria 1022
471 Ga0068865_100754984 3300006881 Bacteria 836
472 Ga0068865_100846877 3300006881 Bacteria 792
473 Ga0068865_100940308 3300006881 Bacteria 754
474 Ga0075436_100003619 3300006914 Bacteria 10603
475 Ga0075436_100005691 3300006914 Bacteria 8557
476 Ga0075436_100009419 3300006914 Bacteria 6676
477 Ga0075436_100017953 3300006914 Bacteria 4845
478 Ga0075436_100028119 3300006914 Bacteria 3869
479 Ga0075436_100352500 3300006914 Bacteria 1061
480 Ga0075436_100367401 3300006914 Bacteria 1039
481 Ga0097620_100006510 3300006931 Bacteria 11857
482 Ga0097620_100067705 3300006931 Bacteria 3605
483 Ga0097620_100234167 3300006931 Bacteria 1925
484 Ga0097620_100350699 3300006931 Bacteria 1571
485 Ga0097620_100430095 3300006931 Bacteria 1416
486 Ga0097620_100442128 3300006931 Bacteria 1396
487 Ga0097620_100478463 3300006931 Bacteria 1341
488 Ga0097620_100697882 3300006931 Bacteria 1106
489 Ga0097620_100725164 3300006931 Bacteria 1084
490 Ga0097620_101272564 3300006931 Bacteria 810
491 Ga0097620_101536670 3300006931 Bacteria 735
492 Ga0075435_100000177 3300007076 Bacteria 37596
493 Ga0075435_100000511 3300007076 Bacteria 23696
494 Ga0075435_100000948 3300007076 Bacteria 18280
495 Ga0075435_100010836 3300007076 Bacteria 6676
496 Ga0075435_100022074 3300007076 Bacteria 4907
497 Ga0075435_100027736 3300007076 Bacteria 4433
498 Ga0075435_100055969 3300007076 Bacteria 3187
499 Ga0075435_100064419 3300007076 Bacteria 2978
500 Ga0075435_100102306 3300007076 Bacteria 2374
501 Ga0075435_100117559 3300007076 Bacteria 2216
502 Ga0075435_100208146 3300007076 Bacteria 1658
503 Ga0075435_100334610 3300007076 Bacteria 1297
504 Ga0075435_100646487 3300007076 Bacteria 918
505 Ga0075435_100855095 3300007076 Bacteria 793
506 Ga0075435_101014131 3300007076 Bacteria 725
507 Ga0099795_10230239 3300007788 Bacteria 792
508 Ga0105240_10026350 3300009093 Bacteria 7627
509 Ga0105240_10082475 3300009093 Bacteria 3949
510 Ga0105240_10099671 3300009093 Bacteria 3536
511 Ga0105240_10176666 3300009093 Bacteria 2524
512 Ga0105240_10939089 3300009093 Bacteria 928
513 Ga0111539_10000282 3300009094 Bacteria 61040
514 Ga0111539_10002116 3300009094 Bacteria 26536
515 Ga0111539_10013636 3300009094 Bacteria 10152
516 Ga0111539_10026941 3300009094 Bacteria 7021
517 Ga0111539_10048552 3300009094 Bacteria 5067
518 Ga0111539_10319787 3300009094 Bacteria 1806
519 Ga0111539_10404725 3300009094 Bacteria 1589
520 Ga0111539_10669366 3300009094 Bacteria 1209
521 Ga0111539_10756812 3300009094 Bacteria 1131
522 Ga0111539_11219210 3300009094 Bacteria 874
523 Ga0105245_10010813 3300009098 Bacteria 7941
524 Ga0105245_10050221 3300009098 Bacteria 3737
525 Ga0105245_10183411 3300009098 Bacteria 2001
526 Ga0105245_10917310 3300009098 Bacteria 918
527 Ga0105245_11038599 3300009098 Bacteria 865
528 Ga0105245_11390841 3300009098 Bacteria 752
529 Ga0105245_11828249 3300009098 Bacteria 660
530 Ga0105247_10056647 3300009101 Bacteria 2421
531 Ga0105247_11302611 3300009101 Bacteria 583
532 Ga0114129_10003573 3300009147 Bacteria 21875
533 Ga0114129_10004190 3300009147 Bacteria 20370
534 Ga0114129_10014054 3300009147 Bacteria 11404
535 Ga0114129_10014093 3300009147 Bacteria 11388
536 Ga0114129_10018498 3300009147 Bacteria 9920
537 Ga0114129_10031673 3300009147 Bacteria 7475
538 Ga0114129_10044870 3300009147 Bacteria 6217
539 Ga0114129_10057177 3300009147 Bacteria 5460
540 Ga0114129_10058076 3300009147 Bacteria 5412
541 Ga0114129_10058845 3300009147 Bacteria 5375
542 Ga0114129_10082700 3300009147 Bacteria 4461
543 Ga0114129_10104046 3300009147 Bacteria 3924
544 Ga0114129_10265864 3300009147 Bacteria 2296
545 Ga0114129_10293507 3300009147 Bacteria 2169
546 Ga0114129_10600237 3300009147 Bacteria 1426
547 Ga0114129_10680533 3300009147 Bacteria 1324
548 Ga0114129_10776011 3300009147 Bacteria 1225
549 Ga0105243_10035459 3300009148 Bacteria 3868
550 Ga0105243_10059961 3300009148 Bacteria 3039
551 Ga0105243_10115129 3300009148 Bacteria 2257
552 Ga0105243_10238482 3300009148 Bacteria 1617
553 Ga0105243_10420464 3300009148 Bacteria 1246
554 Ga0105243_10586968 3300009148 Bacteria 1070
555 Ga0105243_12345986 3300009148 Bacteria 571
556 Ga0105241_10173253 3300009174 Bacteria 1784
557 Ga0105241_10188803 3300009174 Bacteria 1714
558 Ga0105241_10522734 3300009174 Bacteria 1061
559 Ga0105242_10002492 3300009176 Bacteria 14439
560 Ga0105242_10081765 3300009176 Bacteria 2702
561 Ga0105242_10084593 3300009176 Bacteria 2658
562 Ga0105242_10137478 3300009176 Bacteria 2116
563 Ga0105242_10347997 3300009176 Bacteria 1368
564 Ga0105242_10711529 3300009176 Bacteria 984
565 Ga0105248_10020126 3300009177 Bacteria 7394
566 Ga0105248_10069824 3300009177 Bacteria 3945
567 Ga0105248_10070905 3300009177 Bacteria 3913
568 Ga0105248_10090779 3300009177 Bacteria 3440
569 Ga0105248_10101253 3300009177 Bacteria 3247
570 Ga0105248_10127825 3300009177 Bacteria 2867
571 Ga0105248_10158871 3300009177 Bacteria 2550
572 Ga0105248_10263125 3300009177 Bacteria 1942
573 Ga0105248_10332765 3300009177 Bacteria 1710
574 Ga0105248_10396148 3300009177 Bacteria 1555
575 Ga0105248_10884236 3300009177 Bacteria 1009
576 Ga0105248_11024909 3300009177 Bacteria 932
577 Ga0105237_10172459 3300009545 Bacteria 2163
578 Ga0105237_11045192 3300009545 Bacteria 823
579 Ga0105238_10024987 3300009551 Bacteria 6089
580 Ga0105238_10393500 3300009551 Bacteria 1378
581 Ga0105238_10425864 3300009551 Bacteria 1322
582 Ga0105249_10262533 3300009553 Bacteria 1717
583 Ga0105249_10517591 3300009553 Bacteria 1240
584 Ga0105249_10533276 3300009553 Bacteria 1223
585 Ga0105249_10693025 3300009553 Bacteria 1078
586 Ga0105249_10943379 3300009553 Bacteria 931
587 Ga0105249_11282939 3300009553 Bacteria 804
588 Ga0105239_10186410 3300010375 Bacteria 2322
589 Ga0105239_10467547 3300010375 Bacteria 1432
590 Ga0105239_10493066 3300010375 Bacteria 1392
591 Ga0105246_10048810 3300011119 Bacteria 2895
592 Ga0105246_10167361 3300011119 Bacteria 1680
593 Ga0105246_10311839 3300011119 Bacteria 1275
594 Ga0105246_10346591 3300011119 Bacteria 1216
595 Ga0105246_10790199 3300011119 Bacteria 841
596 Ga0105246_11541779 3300011119 Bacteria 626
597 Ga0157338_1008432 3300012515 Bacteria 999
598 Ga0157374_10192833 3300013296 Bacteria 1993
599 Ga0157374_10204087 3300013296 Bacteria 1936
600 Ga0157374_10340989 3300013296 Bacteria 1488
601 Ga0157374_10539200 3300013296 Bacteria 1174
602 Ga0157374_10832917 3300013296 Bacteria 939
603 Ga0157378_10012769 3300013297 Bacteria 7353
604 Ga0157378_10161424 3300013297 Bacteria 2096
605 Ga0157378_10200340 3300013297 Bacteria 1888
606 Ga0157378_10339317 3300013297 Bacteria 1465
607 Ga0157378_10781398 3300013297 Bacteria 979
608 Ga0157378_11976714 3300013297 Bacteria 633
609 Ga0163162_10067943 3300013306 Bacteria 3615
610 Ga0163162_10094830 3300013306 Bacteria 3071
611 Ga0163162_10194131 3300013306 Bacteria 2158
612 Ga0163162_10434928 3300013306 Bacteria 1444
613 Ga0163162_10990504 3300013306 Bacteria 950
614 Ga0163162_11596565 3300013306 Bacteria 744
615 Ga0157372_11649718 3300013307 Bacteria 738
616 Ga0157375_10149988 3300013308 Bacteria 2466
617 Ga0157375_10174945 3300013308 Bacteria 2296
618 Ga0157375_10204411 3300013308 Bacteria 2131
619 Ga0157375_10429887 3300013308 Bacteria 1486
620 Ga0157375_10434553 3300013308 Bacteria 1479
621 Ga0157375_11375098 3300013308 Bacteria 831
622 Ga0163163_10005196 3300014325 Bacteria 11229
623 Ga0163163_10018766 3300014325 Bacteria 6483
624 Ga0163163_10032453 3300014325 Bacteria 5043
625 Ga0163163_10048391 3300014325 Bacteria 4181
626 Ga0163163_10128949 3300014325 Bacteria 2569
627 Ga0163163_10152698 3300014325 Bacteria 2352
628 Ga0163163_10185791 3300014325 Bacteria 2126
629 Ga0163163_10299530 3300014325 Bacteria 1660
630 Ga0163163_10549148 3300014325 Bacteria 1218
631 Ga0157380_10048153 3300014326 Bacteria 3356
632 Ga0157380_10048852 3300014326 Bacteria 3334
633 Ga0157380_10067426 3300014326 Bacteria 2881
634 Ga0157380_10089867 3300014326 Bacteria 2532
635 Ga0157380_10280433 3300014326 Bacteria 1524
636 Ga0157380_10418269 3300014326 Bacteria 1277
637 Ga0157377_10010613 3300014745 Bacteria 4563
638 Ga0157377_10376081 3300014745 Bacteria 960
639 Ga0157377_10460443 3300014745 Bacteria 880
640 Ga0157377_10522712 3300014745 Bacteria 833
641 Ga0157377_10594996 3300014745 Bacteria 788
642 Ga0157379_10023958 3300014968 Bacteria 5417
643 Ga0157379_10110882 3300014968 Bacteria 2464
644 Ga0157379_10185004 3300014968 Bacteria 1882
645 Ga0157379_10300632 3300014968 Bacteria 1462
646 Ga0157379_10579596 3300014968 Bacteria 1046
647 Ga0157379_10731281 3300014968 Bacteria 930
648 Ga0157376_10029841 3300014969 Bacteria 4347
649 Ga0157376_10066676 3300014969 Bacteria 3043
650 Ga0157376_10128399 3300014969 Bacteria 2258
651 Ga0157376_10176220 3300014969 Bacteria 1951
652 Ga0157376_10310036 3300014969 Bacteria 1497
653 Ga0157376_10354541 3300014969 Bacteria 1405
654 Ga0157376_10411794 3300014969 Bacteria 1310
655 Ga0157376_10492328 3300014969 Bacteria 1203
656 Ga0157376_10984558 3300014969 Bacteria 865
657 Ga0163161_10017118 3300017792 Bacteria 5071
658 Ga0163161_10041079 3300017792 Bacteria 3323
659 Ga0163161_10180239 3300017792 Bacteria 1619
660 Ga0213876_10172729 3300021384 Bacteria 1150
661 Ga0207697_10046780 3300025315 Bacteria 1783
662 Ga0207697_10062387 3300025315 Bacteria 1552
663 Ga0207697_10190440 3300025315 Bacteria 900
664 Ga0207682_10043301 3300025893 Bacteria 1842
665 Ga0207682_10178417 3300025893 Bacteria 969
666 Ga0207682_10214588 3300025893 Bacteria 888
667 Ga0207682_10248304 3300025893 Bacteria 828
668 Ga0207642_10025151 3300025899 Bacteria 2404
669 Ga0207642_10080014 3300025899 Bacteria 1584
670 Ga0207642_10105605 3300025899 Bacteria 1423
671 Ga0207642_10149054 3300025899 Bacteria 1243
672 Ga0207642_10225855 3300025899 Bacteria 1049
673 Ga0207642_10332613 3300025899 Bacteria 890
674 Ga0207710_10035406 3300025900 Bacteria 2197
675 Ga0207710_10381475 3300025900 Bacteria 721
676 Ga0207688_10051028 3300025901 Bacteria 2317
677 Ga0207688_10121837 3300025901 Bacteria 1522
678 Ga0207688_10177531 3300025901 Bacteria 1269
679 Ga0207688_10181973 3300025901 Bacteria 1254
680 Ga0207688_10187522 3300025901 Bacteria 1235
681 Ga0207688_10252524 3300025901 Bacteria 1068
682 Ga0207680_10087679 3300025903 Bacteria 1971
683 Ga0207680_10136644 3300025903 Bacteria 1621
684 Ga0207680_10184477 3300025903 Bacteria 1413
685 Ga0207680_10220982 3300025903 Bacteria 1299
686 Ga0207680_10287847 3300025903 Bacteria 1143
687 Ga0207680_10298911 3300025903 Bacteria 1122
688 Ga0207680_10365326 3300025903 Bacteria 1015
689 Ga0207680_10899920 3300025903 Bacteria 634
690 Ga0207685_10178670 3300025905 Bacteria 982
691 Ga0207685_10278841 3300025905 Bacteria 819
692 Ga0207699_10114676 3300025906 Bacteria 1733
693 Ga0207645_10010770 3300025907 Bacteria 6269
694 Ga0207645_10015244 3300025907 Bacteria 5115
695 Ga0207645_10057974 3300025907 Bacteria 2472
696 Ga0207645_10123382 3300025907 Bacteria 1683
697 Ga0207645_10219413 3300025907 Bacteria 1253
698 Ga0207645_10430296 3300025907 Bacteria 890
699 Ga0207645_10506459 3300025907 Bacteria 818
700 Ga0207643_10011395 3300025908 Bacteria 4800
701 Ga0207643_10069371 3300025908 Bacteria 2026
702 Ga0207643_10422751 3300025908 Bacteria 845
703 Ga0207684_10397363 3300025910 Bacteria 1185
704 Ga0207684_10973129 3300025910 Bacteria 711
705 Ga0207654_10138054 3300025911 Bacteria 1551
706 Ga0207654_10621436 3300025911 Bacteria 772
707 Ga0207707_10054129 3300025912 Bacteria 3493
708 Ga0207707_10244670 3300025912 Bacteria 1559
709 Ga0207707_10288882 3300025912 Bacteria 1419
710 Ga0207707_10288976 3300025912 Bacteria 1419
711 Ga0207707_10831008 3300025912 Bacteria 768
712 Ga0207695_10100723 3300025913 Bacteria 2884
713 Ga0207695_10145218 3300025913 Bacteria 2317
714 Ga0207671_10156397 3300025914 Bacteria 1763
715 Ga0207660_10436516 3300025917 Bacteria 1058
716 Ga0207660_10620515 3300025917 Bacteria 881
717 Ga0207662_10010431 3300025918 Bacteria 5131
718 Ga0207662_10016049 3300025918 Bacteria 4222
719 Ga0207657_10027231 3300025919 Bacteria 5237
720 Ga0207657_10327945 3300025919 Bacteria 1209
721 Ga0207657_10513651 3300025919 Bacteria 938
722 Ga0207649_10069567 3300025920 Bacteria 2242
723 Ga0207649_10106517 3300025920 Bacteria 1865
724 Ga0207649_10403973 3300025920 Bacteria 1023
725 Ga0207652_10182675 3300025921 Bacteria 1885
726 Ga0207652_11132307 3300025921 Bacteria 683
727 Ga0207646_10040980 3300025922 Bacteria 4164
728 Ga0207646_10064873 3300025922 Bacteria 3260
729 Ga0207646_10179402 3300025922 Bacteria 1913
730 Ga0207646_10188644 3300025922 Bacteria 1862
731 Ga0207681_10059308 3300025923 Bacteria 2623
732 Ga0207681_10119336 3300025923 Bacteria 1932
733 Ga0207681_10175915 3300025923 Bacteria 1626
734 Ga0207681_10580728 3300025923 Bacteria 924
735 Ga0207681_10585620 3300025923 Bacteria 921
736 Ga0207681_10646553 3300025923 Bacteria 876
737 Ga0207681_11014121 3300025923 Bacteria 696
738 Ga0207694_10003652 3300025924 Bacteria 12184
739 Ga0207650_10016323 3300025925 Bacteria 5189
740 Ga0207650_10016409 3300025925 Bacteria 5176
741 Ga0207650_10030902 3300025925 Bacteria 3863
742 Ga0207650_10058067 3300025925 Bacteria 2880
743 Ga0207650_10083356 3300025925 Bacteria 2428
744 Ga0207650_10114907 3300025925 Bacteria 2088
745 Ga0207650_10190944 3300025925 Bacteria 1637
746 Ga0207650_10205730 3300025925 Bacteria 1579
747 Ga0207650_10220038 3300025925 Bacteria 1528
748 Ga0207659_10005817 3300025926 Bacteria 7516
749 Ga0207659_10013442 3300025926 Bacteria 5243
750 Ga0207659_10014731 3300025926 Bacteria 5052
751 Ga0207659_10024786 3300025926 Bacteria 4024
752 Ga0207659_10026603 3300025926 Bacteria 3905
753 Ga0207659_10047932 3300025926 Bacteria 3024
754 Ga0207659_10058334 3300025926 Bacteria 2771
755 Ga0207659_10085346 3300025926 Bacteria 2345
756 Ga0207659_10119654 3300025926 Bacteria 2016
757 Ga0207659_10560340 3300025926 Bacteria 972
758 Ga0207659_10620968 3300025926 Bacteria 922
759 Ga0207687_10006141 3300025927 Bacteria 7947
760 Ga0207687_10128353 3300025927 Bacteria 1907
761 Ga0207687_10165816 3300025927 Bacteria 1699
762 Ga0207687_10262199 3300025927 Bacteria 1378
763 Ga0207644_10041359 3300025931 Bacteria 3260
764 Ga0207644_10046712 3300025931 Bacteria 3086
765 Ga0207644_10058311 3300025931 Bacteria 2790
766 Ga0207644_10092838 3300025931 Bacteria 2252
767 Ga0207644_10189544 3300025931 Bacteria 1616
768 Ga0207690_10508823 3300025932 Bacteria 975
769 Ga0207690_10813369 3300025932 Bacteria 772
770 Ga0207706_10027640 3300025933 Bacteria 5072
771 Ga0207706_10172829 3300025933 Bacteria 1898
772 Ga0207706_10208208 3300025933 Bacteria 1714
773 Ga0207706_10228865 3300025933 Bacteria 1627
774 Ga0207706_10262333 3300025933 Bacteria 1508
775 Ga0207706_10349206 3300025933 Bacteria 1286
776 Ga0207706_10376242 3300025933 Bacteria 1233
777 Ga0207706_11180752 3300025933 Bacteria 637
778 Ga0207706_11303762 3300025933 Bacteria 600
779 Ga0207686_10004134 3300025934 Bacteria 7788
780 Ga0207686_10004419 3300025934 Bacteria 7542
781 Ga0207686_10055949 3300025934 Bacteria 2477
782 Ga0207686_10074842 3300025934 Bacteria 2190
783 Ga0207709_10015349 3300025935 Bacteria 4246
784 Ga0207709_10057968 3300025935 Bacteria 2404
785 Ga0207709_10119652 3300025935 Bacteria 1776
786 Ga0207709_10220055 3300025935 Bacteria 1369
787 Ga0207709_10355536 3300025935 Bacteria 1107
788 Ga0207670_10040873 3300025936 Bacteria 3046
789 Ga0207670_10082130 3300025936 Bacteria 2258
790 Ga0207670_10172695 3300025936 Bacteria 1622
791 Ga0207670_10379384 3300025936 Bacteria 1126
792 Ga0207669_10008736 3300025937 Bacteria 4777
793 Ga0207669_10072734 3300025937 Bacteria 2166
794 Ga0207669_10257683 3300025937 Bacteria 1303
795 Ga0207669_10295911 3300025937 Bacteria 1228
796 Ga0207669_10310429 3300025937 Bacteria 1203
797 Ga0207669_10547433 3300025937 Bacteria 933
798 Ga0207704_10053344 3300025938 Bacteria 2457
799 Ga0207704_10064086 3300025938 Bacteria 2294
800 Ga0207704_10130818 3300025938 Bacteria 1737
801 Ga0207704_10137113 3300025938 Bacteria 1705
802 Ga0207704_10458283 3300025938 Bacteria 1019
803 Ga0207704_10458989 3300025938 Bacteria 1018
804 Ga0207704_10509359 3300025938 Bacteria 971
805 Ga0207704_10798962 3300025938 Bacteria 788
806 Ga0207665_10076235 3300025939 Bacteria 2299
807 Ga0207691_10019196 3300025940 Bacteria 6472
808 Ga0207691_10020028 3300025940 Bacteria 6329
809 Ga0207691_10046633 3300025940 Bacteria 3981
810 Ga0207691_10047190 3300025940 Bacteria 3954
811 Ga0207691_10075019 3300025940 Bacteria 3050
812 Ga0207691_10088896 3300025940 Bacteria 2770
813 Ga0207691_10107811 3300025940 Bacteria 2479
814 Ga0207691_10123301 3300025940 Bacteria 2294
815 Ga0207691_10143040 3300025940 Bacteria 2106
816 Ga0207691_10153427 3300025940 Bacteria 2024
817 Ga0207691_10157443 3300025940 Bacteria 1994
818 Ga0207691_10574184 3300025940 Bacteria 955
819 Ga0207691_10951179 3300025940 Bacteria 718
820 Ga0207711_10002123 3300025941 Bacteria 17906
821 Ga0207711_10028025 3300025941 Bacteria 4736
822 Ga0207711_10031580 3300025941 Bacteria 4472
823 Ga0207711_10060421 3300025941 Bacteria 3266
824 Ga0207711_10083634 3300025941 Bacteria 2792
825 Ga0207711_10172107 3300025941 Bacteria 1965
826 Ga0207711_10213689 3300025941 Bacteria 1762
827 Ga0207711_10568841 3300025941 Bacteria 1057
828 Ga0207711_10639438 3300025941 Bacteria 992
829 Ga0207711_11037468 3300025941 Bacteria 760
830 Ga0207711_11172651 3300025941 Bacteria 709
831 Ga0207689_10014164 3300025942 Bacteria 6785
832 Ga0207689_10103375 3300025942 Bacteria 2341
833 Ga0207689_10149368 3300025942 Bacteria 1926
834 Ga0207689_10179651 3300025942 Bacteria 1745
835 Ga0207689_10197891 3300025942 Bacteria 1658
836 Ga0207689_10751062 3300025942 Bacteria 823
837 Ga0207661_10048674 3300025944 Bacteria 3371
838 Ga0207661_10211406 3300025944 Bacteria 1710
839 Ga0207661_10388520 3300025944 Bacteria 1264
840 Ga0207661_10761455 3300025944 Bacteria 891
841 Ga0207679_10024884 3300025945 Bacteria 4110
842 Ga0207679_10146741 3300025945 Bacteria 1915
843 Ga0207679_10162214 3300025945 Bacteria 1831
844 Ga0207679_10162690 3300025945 Bacteria 1829
845 Ga0207679_10538374 3300025945 Bacteria 1046
846 Ga0207679_10812347 3300025945 Bacteria 853
847 Ga0207667_10428769 3300025949 Bacteria 1345
848 Ga0207651_10024415 3300025960 Bacteria 3739
849 Ga0207651_10030996 3300025960 Bacteria 3412
850 Ga0207651_10034980 3300025960 Bacteria 3260
851 Ga0207651_10055436 3300025960 Bacteria 2722
852 Ga0207651_10066190 3300025960 Bacteria 2538
853 Ga0207651_10132166 3300025960 Bacteria 1913
854 Ga0207651_10190590 3300025960 Bacteria 1635
855 Ga0207651_10252212 3300025960 Bacteria 1444
856 Ga0207651_10271767 3300025960 Bacteria 1396
857 Ga0207651_10504504 3300025960 Bacteria 1046
858 Ga0207651_11264609 3300025960 Bacteria 663
859 Ga0207712_10140699 3300025961 Bacteria 1851
860 Ga0207712_10589382 3300025961 Bacteria 960
861 Ga0207712_11316248 3300025961 Bacteria 646
862 Ga0207668_10090248 3300025972 Bacteria 2249
863 Ga0207668_10157671 3300025972 Bacteria 1765
864 Ga0207668_10324293 3300025972 Bacteria 1279
865 Ga0207640_10007916 3300025981 Bacteria 5867
866 Ga0207640_10027553 3300025981 Bacteria 3464
867 Ga0207640_10063058 3300025981 Bacteria 2462
868 Ga0207640_10166997 3300025981 Bacteria 1635
869 Ga0207640_10377358 3300025981 Bacteria 1148
870 Ga0207658_10017274 3300025986 Bacteria 4970
871 Ga0207658_10266100 3300025986 Bacteria 1463
872 Ga0207658_10301993 3300025986 Bacteria 1380
873 Ga0207658_10899813 3300025986 Bacteria 806
874 Ga0207677_10146815 3300026023 Bacteria 1814
875 Ga0207677_10248530 3300026023 Bacteria 1443
876 Ga0207677_10314906 3300026023 Bacteria 1298
877 Ga0207677_10354030 3300026023 Bacteria 1231
878 Ga0207677_10671074 3300026023 Bacteria 917
879 Ga0207703_10014602 3300026035 Bacteria 6128
880 Ga0207703_10031326 3300026035 Bacteria 4204
881 Ga0207703_10064951 3300026035 Bacteria 2997
882 Ga0207703_10081087 3300026035 Bacteria 2704
883 Ga0207703_10089485 3300026035 Bacteria 2585
884 Ga0207703_10199695 3300026035 Bacteria 1776
885 Ga0207703_10482473 3300026035 Bacteria 1162
886 Ga0207703_10649354 3300026035 Bacteria 1001
887 Ga0207703_10692612 3300026035 Bacteria 969
888 Ga0207703_11083663 3300026035 Bacteria 769
889 Ga0207678_10019060 3300026067 Bacteria 6025
890 Ga0207678_10031920 3300026067 Bacteria 4592
891 Ga0207678_10121490 3300026067 Bacteria 2229
892 Ga0207678_10297913 3300026067 Bacteria 1386
893 Ga0207678_10404421 3300026067 Bacteria 1182
894 Ga0207678_10828427 3300026067 Bacteria 817
895 Ga0207708_10045412 3300026075 Bacteria 3348
896 Ga0207708_10067266 3300026075 Bacteria 2741
897 Ga0207708_10099383 3300026075 Bacteria 2250
898 Ga0207708_10230806 3300026075 Bacteria 1486
899 Ga0207708_10259811 3300026075 Bacteria 1401
900 Ga0207708_10456707 3300026075 Bacteria 1065
901 Ga0207708_10987406 3300026075 Bacteria 731
902 Ga0207641_10004659 3300026088 Bacteria 11834
903 Ga0207641_10047696 3300026088 Bacteria 3613
904 Ga0207641_10104555 3300026088 Bacteria 2500
905 Ga0207641_10137836 3300026088 Bacteria 2198
906 Ga0207641_10560829 3300026088 Bacteria 1115
907 Ga0207641_10840811 3300026088 Bacteria 909
908 Ga0207641_10854409 3300026088 Bacteria 902
909 Ga0207641_11152640 3300026088 Bacteria 774
910 Ga0207641_11543915 3300026088 Bacteria 666
911 Ga0207648_10001001 3300026089 Bacteria 31868
912 Ga0207648_10005858 3300026089 Bacteria 12302
913 Ga0207648_10084037 3300026089 Bacteria 2776
914 Ga0207648_10184989 3300026089 Bacteria 1845
915 Ga0207648_10217683 3300026089 Bacteria 1697
916 Ga0207648_10323095 3300026089 Bacteria 1387
917 Ga0207676_10020437 3300026095 Bacteria 4845
918 Ga0207676_10089537 3300026095 Bacteria 2522
919 Ga0207676_10191209 3300026095 Bacteria 1801
920 Ga0207676_10241308 3300026095 Bacteria 1621
921 Ga0207676_10452490 3300026095 Bacteria 1211
922 Ga0207676_10658253 3300026095 Bacteria 1011
923 Ga0207674_11055959 3300026116 Bacteria 781
924 Ga0207675_100000149 3300026118 Bacteria 61117
925 Ga0207675_100116442 3300026118 Bacteria 2525
926 Ga0207675_100164703 3300026118 Bacteria 2117
927 Ga0207675_100188963 3300026118 Bacteria 1975
928 Ga0207675_100298850 3300026118 Bacteria 1568
929 Ga0207675_100657166 3300026118 Bacteria 1055
930 Ga0207675_100735075 3300026118 Bacteria 997
931 Ga0207675_100766991 3300026118 Bacteria 976
932 Ga0207675_100797273 3300026118 Bacteria 958
933 Ga0207675_101497908 3300026118 Bacteria 695
934 Ga0207683_10007967 3300026121 Bacteria 9062
935 Ga0207683_10015260 3300026121 Bacteria 6538
936 Ga0207683_10023262 3300026121 Bacteria 5327
937 Ga0207683_10026735 3300026121 Bacteria 4984
938 Ga0207683_10216483 3300026121 Bacteria 1745
939 Ga0207683_10523740 3300026121 Bacteria 1095
940 Ga0207683_10568585 3300026121 Bacteria 1049
941 Ga0207683_10803487 3300026121 Bacteria 873
942 Ga0207698_10171883 3300026142 Bacteria 1909
943 Ga0207698_10266717 3300026142 Bacteria 1576
944 Ga0209971_1050444 3300027682 Bacteria 1005
945 Ga0209966_1026360 3300027695 Bacteria 1158
946 Ga0209974_10030828 3300027876 Bacteria 1776
947 Ga0207428_10017704 3300027907 Bacteria 6111
948 Ga0207428_10042421 3300027907 Bacteria 3679
949 Ga0207428_10062373 3300027907 Bacteria 2948
950 Ga0207428_10259180 3300027907 Bacteria 1295
951 Ga0207428_10426987 3300027907 Bacteria 968
952 Ga0268266_10009614 3300028379 Bacteria 8502
953 Ga0268266_10013632 3300028379 Bacteria 7000
954 Ga0268266_10032424 3300028379 Bacteria 4439
955 Ga0268266_10098603 3300028379 Bacteria 2571
956 Ga0268266_10212920 3300028379 Bacteria 1773
957 Ga0268266_10313379 3300028379 Bacteria 1467
958 Ga0268266_10521672 3300028379 Bacteria 1136
959 Ga0268265_10018656 3300028380 Bacteria 4810
960 Ga0268265_10034074 3300028380 Bacteria 3709
961 Ga0268265_10293566 3300028380 Bacteria 1460
962 Ga0268265_10314713 3300028380 Bacteria 1415
963 Ga0268265_10361771 3300028380 Bacteria 1329
964 Ga0268265_10485173 3300028380 Bacteria 1162
965 Ga0268265_10784113 3300028380 Bacteria 928
966 Ga0268265_11328434 3300028380 Bacteria 720
967 Ga0268265_11424550 3300028380 Bacteria 695
968 Ga0268264_10009802 3300028381 Bacteria 7928
969 Ga0268264_10067340 3300028381 Bacteria 3022
970 Ga0268264_10609760 3300028381 Bacteria 1076
971 Ga0268264_10652242 3300028381 Bacteria 1042
972 Ga0268264_10964070 3300028381 Bacteria 858
973 Ga0268264_11319983 3300028381 Bacteria 732
974 Ga0268264_11426180 3300028381 Bacteria 703
975 Ga0265316_10148524 3300031344 Bacteria 1757
976 Ga0307408_100044057 3300031548 Bacteria 3178
977 Ga0307408_100075512 3300031548 Bacteria 2504
978 Ga0307408_100248102 3300031548 Bacteria 1467
979 Ga0307405_10047324 3300031731 Bacteria 2648
980 Ga0307405_10550671 3300031731 Bacteria 933
981 Ga0307413_10019262 3300031824 Bacteria 3601
982 Ga0307413_10078963 3300031824 Bacteria 2102
983 Ga0307410_10001166 3300031852 Bacteria 11585
984 Ga0307410_10008648 3300031852 Bacteria 5659
985 Ga0307410_10174235 3300031852 Bacteria 1624
986 Ga0307410_10189358 3300031852 Bacteria 1563
987 Ga0307410_10303341 3300031852 Bacteria 1261
988 Ga0307410_10502057 3300031852 Bacteria 998
989 Ga0307406_10013799 3300031901 Bacteria 4636
990 Ga0307406_10218361 3300031901 Bacteria 1415
991 Ga0307407_10002138 3300031903 Bacteria 7602
992 Ga0307407_10023819 3300031903 Bacteria 3200
993 Ga0307407_10092135 3300031903 Bacteria 1860
994 Ga0307407_10536255 3300031903 Bacteria 863
995 Ga0307407_10588358 3300031903 Bacteria 827
996 Ga0307407_10719176 3300031903 Bacteria 754
997 Ga0307412_10084106 3300031911 Bacteria 2208
998 Ga0307412_10549420 3300031911 Bacteria 970
999 Ga0307412_10839868 3300031911 Bacteria 800
1000 Ga0307409_100002826 3300031995 Bacteria 9180
1001 Ga0307409_100078183 3300031995 Bacteria 2660
1002 Ga0307409_100193738 3300031995 Bacteria 1812
1003 Ga0307409_100205205 3300031995 Bacteria 1767
1004 Ga0307409_101398445 3300031995 Bacteria 726
1005 Ga0307416_100003201 3300032002 Bacteria 9592
1006 Ga0307416_100036776 3300032002 Bacteria 3759
1007 Ga0307416_100040785 3300032002 Bacteria 3610
1008 Ga0307416_100132560 3300032002 Bacteria 2247
1009 Ga0307416_100142544 3300032002 Bacteria 2181
1010 Ga0307416_100259048 3300032002 Bacteria 1699
1011 Ga0307416_100319423 3300032002 Bacteria 1554
1012 Ga0307416_100370716 3300032002 Bacteria 1458
1013 Ga0307416_100520692 3300032002 Bacteria 1257
1014 Ga0307414_10079366 3300032004 Bacteria 2396
1015 Ga0307414_10124734 3300032004 Bacteria 1987
1016 Ga0307414_10447765 3300032004 Bacteria 1132
1017 Ga0307411_10028142 3300032005 Bacteria 3413
1018 Ga0307415_100002523 3300032126 Bacteria 9145
1019 Ga0307415_100015355 3300032126 Bacteria 4532
1020 Ga0307415_100087886 3300032126 Bacteria 2241
1021 Ga0307415_100966841 3300032126 Bacteria 789
1022 Ga0373930_0041316 3300034816 Bacteria 983
1023 Ga0373948_0002681 3300034817 Bacteria 2658
1024 Ga0373950_0003933 3300034818 Bacteria 2157
1025 Ga0373958_0000318 3300034819 Bacteria 5819
1026 Ga0373958_0058880 3300034819 Bacteria 828
1027 Ga0373959_0001888 3300034820 Bacteria 3343
1028 Ga0373938_0107123 3300034957 Bacteria 708
1029 Ga0373928_0019703 3300035084 Bacteria 1409
1030 Ga0373928_0179214 3300035084 Bacteria 601
1031 Ga0373929_0000878 3300035085 Bacteria 5867
1032 Ga0373934_0234358 3300035086 Bacteria 758
1033 Ga0373940_0003449 3300035088 Bacteria 3231
1034 Ga0373940_0051436 3300035088 Bacteria 1158
1035 Ga0373944_0087249 3300035089 Bacteria 1038
1036 Ga0373949_0013958 3300035090 Bacteria 1786
1037 Ga0373951_0001651 3300035091 Bacteria 5853
1038 Ga0373951_0040285 3300035091 Bacteria 1125
1039 Ga0373952_0000341 3300035092 Bacteria 7886
1040 Ga0373923_0198018 3300035111 Bacteria 928
1041 Ga0373932_0169957 3300035112 Bacteria 759
1042 Ga0373936_0178535 3300035113 Bacteria 931
1043 Ga0373939_0000785 3300035114 Bacteria 7825
1044 Ga0373939_0023016 3300035114 Bacteria 1722
1045 Ga0373939_0030630 3300035114 Bacteria 1549
1046 Ga0373941_0002462 3300035115 Bacteria 4079
1047 Ga0373941_0109868 3300035115 Bacteria 971
1048 Ga0373953_0323439 3300035117 Bacteria 674
1049 Ga0373954_0371488 3300035118 Bacteria 707
1050 Ga0373956_0110746 3300035119 Bacteria 1278
1051 Ga0373960_0000213 3300035121 Bacteria 10646
1052 Ga0373960_0016508 3300035121 Bacteria 1901
1053 Ga0373943_0309232 3300035170 Bacteria 899
1054 Ga0373955_0140455 3300035172 Bacteria 1416
1055 Ga0373942_0003944 3300035207 Bacteria 3464
1056 Ga0373942_0067570 3300035207 Bacteria 1037
1057 Ga0373961_0002356 3300035241 Bacteria 4930
1058 Ga0373961_0084769 3300035241 Bacteria 1002
1059 Ga0373961_0155531 3300035241 Bacteria 782
1060 Ga0373962_0072609 3300035242 Bacteria 1031
1061 Ga0373924_0348621 3300035410 Bacteria 660
1062 Ga0373931_0006673 3300035691 Bacteria 5408
1063 Ga0373931_0031896 3300035691 Bacteria 2723
1064 Ga0373931_0177005 3300035691 Bacteria 1261
1065 Ga0373931_0503867 3300035691 Bacteria 781
1066 Ga0373935_0154076 3300035692 Bacteria 1562
1067 Ga0373935_0313407 3300035692 Bacteria 1112
1068 Ga0373927_0507686 3300035695 Bacteria 797
1069 Ga0373933_0172928 3300035724 Bacteria 1375
1070 Ga0373947_0141179 3300035725 Bacteria 1545
1071 Ga0373947_0142202 3300035725 Bacteria 1540
1072 Ga0373937_0497481 3300036401 Bacteria 1158
1073 Ga0373937_0689867 3300036401 Bacteria 967
1074 Ga0373925_0050432 3300037068 Bacteria 3104
1075 Ga0373925_0084307 3300037068 Bacteria 2422
1076 Ga0373925_0104445 3300037068 Bacteria 2182
1077 Ga0373925_0350466 3300037068 Bacteria 1199
1078 Ga0373925_0508651 3300037068 Bacteria 989
1079 Ga0395905_0342587 3300037471 Bacteria 1386
1080 Ga0436365_1147767 3300039437 Bacteria 686
1081 Ga0436365_1775937 3300039437 Bacteria 3607
1082 Ga0439453_0030295 3300041408 Bacteria 1022
1083 Ga0451853_0736272 3300041512 Bacteria 651
1084 Ga0439431_0058780 3300041997 Bacteria 1008
1085 Ga0450914_015112 3300042118 Bacteria 804
1086 Ga0450923_127305 3300042125 Bacteria 604
1087 Ga0450894_003324 3300042131 Bacteria 2110
1088 Ga0439446_0034069 3300042156 Bacteria 1481
1089 Ga0439434_0075648 3300042435 Bacteria 1064
1090 Ga0439434_0091157 3300042435 Bacteria 975
1091 Ga0439435_0014665 3300042436 Bacteria 1940
1092 Ga0439444_0009697 3300042437 Bacteria 1522
1093 Ga0450916_025882 3300042530 Bacteria 831
1094 Ga0450918_063674 3300042531 Bacteria 684
1095 Ga0466963_0287171 3300044694 Bacteria 1156
1096 Ga0453684_1354927 3300044712 Bacteria 740
1097 Ga0451576_0015844 3300045051 Bacteria 8337
1098 Ga0451576_0043767 3300045051 Bacteria 4722
1099 Ga0451576_0055333 3300045051 Bacteria 4151
1100 Ga0451576_0135488 3300045051 Bacteria 2568
1101 Ga0451576_0474513 3300045051 Bacteria 1314
1102 Ga0451576_0666035 3300045051 Bacteria 1094
1103 Ga0466967_0040278 3300045976 Bacteria 4022
1104 Ga0495592_0251057 3300046454 Bacteria 1169
1105 Ga0495603_0102662 3300046455 Bacteria 1669
1106 Ga0495629_0215989 3300046459 Bacteria 1324
1107 Ga0495629_0826989 3300046459 Bacteria 610
1108 Ga0495651_0928130 3300046462 Bacteria 531
1109 Ga0495580_0057675 3300046472 Bacteria 2733
1110 Ga0495582_0740060 3300046473 Bacteria 569
1111 Ga0495605_0196496 3300046474 Bacteria 881
1112 Ga0495639_0179043 3300046475 Bacteria 1032
1113 Ga0495639_0268012 3300046475 Bacteria 847
1114 Ga0495664_0220654 3300046477 Bacteria 1148
1115 Ga0495584_0034770 3300046491 Bacteria 2547
1116 Ga0495584_0064554 3300046491 Bacteria 1841
1117 Ga0495584_0313144 3300046491 Bacteria 797
1118 Ga0495594_0026405 3300046499 Bacteria 3124
1119 Ga0495630_0132997 3300046517 Bacteria 1890
1120 Ga0495663_0031517 3300046525 Bacteria 1575
1121 Ga0495663_0144140 3300046525 Bacteria 810
1122 Ga0495642_0017961 3300046528 Bacteria 2766
1123 Ga0495642_0367808 3300046528 Bacteria 633
1124 Ga0495665_0069321 3300046531 Bacteria 1859
1125 Ga0495640_0212327 3300046533 Bacteria 1223
1126 Ga0495640_0370758 3300046533 Bacteria 882
1127 Ga0495586_0195557 3300046535 Bacteria 1146
1128 Ga0495598_0007985 3300046537 Bacteria 2450
1129 Ga0495609_0087949 3300046538 Bacteria 1353
1130 Ga0495609_0124395 3300046538 Bacteria 1107
1131 Ga0495621_0000941 3300046539 Bacteria 7414
1132 Ga0495621_0002895 3300046539 Bacteria 4677
1133 Ga0495621_0009999 3300046539 Bacteria 2895
1134 Ga0495621_0060861 3300046539 Bacteria 1370
1135 Ga0495645_0004560 3300046543 Bacteria 9451
1136 Ga0495667_0136430 3300046559 Bacteria 1582
1137 Ga0495656_0102487 3300046615 Bacteria 1326
1138 Ga0495656_0166787 3300046615 Bacteria 1074
1139 Ga0495634_0061248 3300046642 Bacteria 2502
1140 Ga0495634_0514280 3300046642 Bacteria 701
1141 Ga0495635_0092359 3300046663 Bacteria 2070
1142 Ga0495635_0264602 3300046663 Bacteria 1157
1143 Ga0495635_0343587 3300046663 Bacteria 996
1144 Ga0495659_0005678 3300046664 Bacteria 3934
1145 Ga0495659_0021745 3300046664 Bacteria 2164
1146 Ga0495659_0042513 3300046664 Bacteria 1627
1147 Ga0495588_0068598 3300046674 Bacteria 1842
1148 Ga0495599_0361052 3300046678 Bacteria 870
1149 Ga0495599_0393545 3300046678 Bacteria 826
1150 Ga0495647_0042435 3300046681 Bacteria 1737
1151 Ga0495647_0074096 3300046681 Bacteria 1368
1152 Ga0495647_0249894 3300046681 Bacteria 789
1153 Ga0495647_0282098 3300046681 Bacteria 745
1154 Ga0495658_0014052 3300046683 Bacteria 4082
1155 Ga0495658_0016673 3300046683 Bacteria 3782
1156 Ga0495658_0023241 3300046683 Bacteria 3289
1157 Ga0495658_0131325 3300046683 Bacteria 1525
1158 Ga0495658_0528396 3300046683 Bacteria 755
1159 Ga0495669_0387275 3300046684 Bacteria 677
1160 Ga0495669_0442554 3300046684 Bacteria 631
1161 Ga0495613_0060880 3300046689 Bacteria 2765
1162 Ga0495613_0220477 3300046689 Bacteria 1332
1163 Ga0495670_0338602 3300046691 Bacteria 809
1164 Ga0495600_0045046 3300046809 Bacteria 2878
1165 Ga0495600_0265401 3300046809 Bacteria 1090
1166 Ga0495581_0457139 3300047315 Bacteria 743
1167 Ga0495636_0004228 3300047318 Bacteria 5634
1168 Ga0495636_0067452 3300047318 Bacteria 1522
1169 Ga0495674_0268277 3300047319 Bacteria 1401
1170 Ga0495672_0049134 3300047320 Bacteria 2498
1171 Ga0495676_0124902 3300047321 Bacteria 1866
1172 Ga0495677_0084398 3300047445 Bacteria 1193
1173 Ga0495685_049669 3300047447 Bacteria 1424
1174 Ga0495684_0004547 3300047471 Bacteria 10837
1175 Ga0495684_0371966 3300047471 Bacteria 1010
1176 Ga0496100_0009268 3300048903 Bacteria 5528
1177 Ga0496100_0745676 3300048903 Bacteria 766
1178 Ga0496101_0000476 3300048904 Bacteria 25304
1179 Ga0496101_0093318 3300048904 Bacteria 2242
1180 Ga0496101_0291834 3300048904 Bacteria 1276
1181 Ga0496101_0551534 3300048904 Bacteria 911
1182 Ga0496102_0142621 3300048905 Bacteria 2247
1183 Ga0496102_1359164 3300048905 Bacteria 629
1184 Ga0496104_0009688 3300048907 Bacteria 8583
1185 Ga0496104_0140614 3300048907 Bacteria 2319
1186 Ga0496104_0265212 3300048907 Bacteria 1630
1187 Ga0496104_0301873 3300048907 Bacteria 1513
1188 Ga0496104_0545375 3300048907 Bacteria 1070
1189 Ga0496104_0600028 3300048907 Bacteria 1011
1190 Ga0496104_1072023 3300048907 Bacteria 709
1191 Ga0496105_0052055 3300048908 Bacteria 3381
1192 Ga0496105_0178560 3300048908 Bacteria 1739
1193 Ga0496105_0329497 3300048908 Bacteria 1222
1194 Ga0496106_0077560 3300048909 Bacteria 2548
1195 Ga0496106_0098911 3300048909 Bacteria 2261
1196 Ga0496106_0232677 3300048909 Bacteria 1471
1197 Ga0496107_0069686 3300048910 Bacteria 2553
1198 Ga0496107_0093561 3300048910 Bacteria 2198
1199 Ga0496107_0207386 3300048910 Bacteria 1457
1200 Ga0496107_0281468 3300048910 Bacteria 1238
1201 Ga0496108_0056564 3300048911 Bacteria 3296
1202 Ga0496108_0123785 3300048911 Bacteria 2219
1203 Ga0496109_0315681 3300048912 Bacteria 1475
1204 Ga0496109_0328386 3300048912 Bacteria 1444
1205 Ga0496109_1198723 3300048912 Bacteria 696
1206 Ga0496110_0042104 3300048913 Bacteria 3986
1207 Ga0496110_0065850 3300048913 Bacteria 3203
1208 Ga0496110_0130388 3300048913 Bacteria 2270
1209 Ga0496110_0927001 3300048913 Bacteria 777
1210 Ga0496111_1024379 3300048914 Bacteria 591
1211 Ga0496112_0001501 3300048915 Bacteria 17968
1212 Ga0496112_0027108 3300048915 Bacteria 5522
1213 Ga0496112_0165059 3300048915 Bacteria 2180
1214 Ga0496112_0397715 3300048915 Bacteria 1318
1215 Ga0496112_1540943 3300048915 Bacteria 578
1216 Ga0496113_0024353 3300048916 Bacteria 4301
1217 Ga0496113_0088008 3300048916 Bacteria 2389
1218 Ga0496114_0006827 3300048917 Bacteria 8989
1219 Ga0496114_0139700 3300048917 Bacteria 2096
1220 Ga0496114_0274668 3300048917 Bacteria 1485
1221 Ga0496114_0406812 3300048917 Bacteria 1205
1222 Ga0496115_0147517 3300048918 Bacteria 1942
1223 Ga0501034_0054428 3300049571 Bacteria 4028
1224 Ga0501034_0081649 3300049571 Bacteria 3235
1225 Ga0501040_0766992 3300049576 Bacteria 698
1226 Ga0501041_0227535 3300049577 Bacteria 1171
1227 Ga0501046_0345060 3300049580 Bacteria 1082
1228 Ga0501046_0614235 3300049580 Bacteria 771
1229 Ga0501047_0068122 3300049581 Bacteria 3429
1230 Ga0501047_0151633 3300049581 Bacteria 2194
1231 Ga0501048_0187060 3300049582 Bacteria 1468
1232 Ga0501048_0396001 3300049582 Bacteria 987
1233 Ga0501072_0165572 3300049588 Bacteria 1764
1234 Ga0501072_0285628 3300049588 Bacteria 1312
1235 Ga0501075_0571754 3300049591 Bacteria 862
1236 Ga0501075_1039181 3300049591 Bacteria 622
1237 Ga0501077_0143474 3300049593 Bacteria 1515
1238 Ga0501249_156187 3300049679 Bacteria 577
1239 Ga0501257_111125 3300049686 Bacteria 727
1240 Ga0501259_117910 3300049688 Bacteria 628
1241 Ga0501079_1040982 3300049741 Bacteria 645
1242 Ga0501083_0279573 3300049744 Bacteria 1086
1243 Ga0501083_0473253 3300049744 Bacteria 815
1244 nmdc:mga00v17_21073_c1 3300050491 Bacteria 3743
1245 nmdc:mga06z11_58748_c1 3300050494 Bacteria 1996
1246 nmdc:mga05p37_1291_c1 3300050507 Bacteria 29083
1247 nmdc:mga05p37_14935_c1 3300050507 Bacteria 9323
1248 nmdc:mga05p37_198675_c1 3300050507 Bacteria 2430
1249 nmdc:mga05p37_2046_c1 3300050507 Bacteria 23526
1250 nmdc:mga05p37_209055_c1 3300050507 Bacteria 2360
1251 nmdc:mga05p37_21247_c1 3300050507 Bacteria 7858
1252 nmdc:mga05p37_22617_c1 3300050507 Bacteria 7623
1253 nmdc:mga05p37_29004_c1 3300050507 Bacteria 6753
1254 nmdc:mga05p37_387612_c1 3300050507 Bacteria 1635
1255 nmdc:mga05p37_437031_c1 3300050507 Bacteria 1519
1256 nmdc:mga05p37_53365_c1 3300050507 Bacteria 4971
1257 nmdc:mga05p37_8567_c1 3300050507 Bacteria 12090
1258 nmdc:mga05p37_9617_c1 3300050507 Bacteria 11451
1259 nmdc:mga09592_146526_c1 3300050508 Bacteria 2036
1260 nmdc:mga09592_148963_c1 3300050508 Bacteria 2018
1261 nmdc:mga09592_169447_c1 3300050508 Bacteria 1888
1262 nmdc:mga09592_248725_c1 3300050508 Bacteria 1541
1263 nmdc:mga09592_389688_c1 3300050508 Bacteria 1204
1264 nmdc:mga09592_5812_c1 3300050508 Bacteria 10063
1265 nmdc:mga0qj67_25684_c1 3300050509 Bacteria 4553
1266 nmdc:mga0qj67_41499_c1 3300050509 Bacteria 3619
1267 nmdc:mga0qj67_439379_c1 3300050509 Bacteria 1051
1268 nmdc:mga0qj67_6470_c1 3300050509 Bacteria 8609
1269 nmdc:mga0qj67_65521_c1 3300050509 Bacteria 2892
1270 nmdc:mga06r32_257288_c1 3300050510 Bacteria 1733
1271 nmdc:mga06r32_437795_c1 3300050510 Bacteria 1288
1272 nmdc:mga06r32_67611_c1 3300050510 Bacteria 3450
1273 nmdc:mga08y16_10217_c1 3300050511 Bacteria 9852
1274 nmdc:mga08y16_14470_c1 3300050511 Bacteria 8300
1275 nmdc:mga08y16_271_c1 3300050511 Bacteria 37217
1276 nmdc:mga08y16_344691_c1 3300050511 Bacteria 1531
1277 nmdc:mga08y16_50932_c1 3300050511 Bacteria 4333
1278 nmdc:mga08y16_8620_c1 3300050511 Bacteria 10691
1279 nmdc:mga0n895_11526_c1 3300050512 Bacteria 7893
1280 nmdc:mga0n895_149384_c1 3300050512 Bacteria 2366
1281 nmdc:mga0n895_151455_c1 3300050512 Bacteria 2350
1282 nmdc:mga0n895_1823283_c1 3300050512 Bacteria 569
1283 nmdc:mga0n895_283249_c1 3300050512 Bacteria 1681
1284 nmdc:mga0n895_30953_c1 3300050512 Bacteria 5119
1285 nmdc:mga0n895_453448_c1 3300050512 Bacteria 1295
1286 nmdc:mga0n895_513202_c1 3300050512 Bacteria 1207
1287 nmdc:mga0n895_661977_c1 3300050512 Bacteria 1042
1288 nmdc:mga0n895_697172_c1 3300050512 Bacteria 1012
1289 nmdc:mga0n895_74627_c1 3300050512 Bacteria 3370
1290 nmdc:mga0n895_780_c1 3300050512 Bacteria 22660
1291 nmdc:mga0n895_950257_c1 3300050512 Bacteria 843
1292 nmdc:mga0n895_967786_c1 3300050512 Bacteria 834
1293 nmdc:mga0n895_96956_c1 3300050512 Bacteria 2954
1294 nmdc:mga0rr50_1089_c1 3300050513 Bacteria 14753
1295 nmdc:mga0rr50_116949_c1 3300050513 Bacteria 2117
1296 nmdc:mga0rr50_120836_c1 3300050513 Bacteria 2085
1297 nmdc:mga0rr50_134420_c1 3300050513 Bacteria 1984
1298 nmdc:mga0rr50_135946_c1 3300050513 Bacteria 1973
1299 nmdc:mga0rr50_16_c1 3300050513 Bacteria 175739
1300 nmdc:mga0rr50_281183_c1 3300050513 Bacteria 1388
1301 nmdc:mga0rr50_486230_c1 3300050513 Bacteria 1049
1302 nmdc:mga0rr50_7088_c1 3300050513 Bacteria 6885
1303 nmdc:mga0rr50_85049_c1 3300050513 Bacteria 2451
1304 nmdc:mga0rr50_8665_c1 3300050513 Bacteria 6341
1305 nmdc:mga08x19_101290_c1 3300050514 Bacteria 1912
1306 nmdc:mga08x19_1131092_c1 3300050514 Bacteria 555
1307 nmdc:mga08x19_113190_c1 3300050514 Bacteria 1812
1308 nmdc:mga08x19_137_c1 3300050514 Bacteria 65227
1309 nmdc:mga08x19_152505_c1 3300050514 Bacteria 1566
1310 nmdc:mga08x19_338259_c1 3300050514 Bacteria 1050
1311 nmdc:mga08x19_346486_c1 3300050514 Bacteria 1037
1312 nmdc:mga08x19_7915_c1 3300050514 Bacteria 6314
1313 nmdc:mga0a205_123996_c1 3300050515 Bacteria 2483
1314 nmdc:mga0a205_140461_c1 3300050515 Bacteria 2316
1315 nmdc:mga0a205_172059_c1 3300050515 Bacteria 2062
1316 nmdc:mga0a205_174118_c1 3300050515 Bacteria 2048
1317 nmdc:mga0a205_192679_c1 3300050515 Bacteria 1930
1318 nmdc:mga0a205_277_c1 3300050515 Bacteria 37358
1319 nmdc:mga0a205_431995_c1 3300050515 Bacteria 1178
1320 nmdc:mga0a205_461918_c1 3300050515 Bacteria 1129
1321 nmdc:mga0a205_8237_c2 3300050515 Bacteria 7691
1322 Ga0495601_0069867 3300053077 Bacteria 2240
1323 Ga0495601_0176566 3300053077 Bacteria 1396
1324 Ga0495601_0268172 3300053077 Bacteria 1114
1325 Ga0495601_0355071 3300053077 Bacteria 953
1326 Ga0495612_0137791 3300053078 Bacteria 1057
1327 Ga0495595_0096189 3300053084 Bacteria 1425
1328 Ga0495595_0168821 3300053084 Bacteria 1082
1329 Ga0495619_0003559 3300053085 Bacteria 10049
1330 Ga0495619_0010615 3300053085 Bacteria 5795
1331 Ga0495619_0073179 3300053085 Bacteria 2296
1332 Ga0495619_0253701 3300053085 Bacteria 1219
1333 Ga0495619_0705944 3300053085 Bacteria 686
1334 Ga0501084_0286631 3300054114 Bacteria 1391
1335 Ga0501084_0578952 3300054114 Bacteria 949
1336 Ga0590071_000076 3300059421 Bacteria 26729
1337 Ga0590071_037943 3300059421 Bacteria 1156
1338 Ga0590075_002613 3300059424 Bacteria 4302
1339 Ga0590075_003545 3300059424 Bacteria 3704
1340 Ga0590075_043351 3300059424 Bacteria 1151
1341 Ga0590077_000554 3300059426 Bacteria 10326
1342 Ga0590077_013470 3300059426 Bacteria 1700
1343 Ga0501082_0112412 3300060353 Bacteria 2358
1344 Ga0501082_0344446 3300060353 Bacteria 1299
1345 Ga0501082_1347119 3300060353 Bacteria 623
1346 Ga0530510_0254438 3300061734 Bacteria 1309
1347 Ga0530510_0486817 3300061734 Bacteria 935
1348 Ga0070690_100018642
1349 JGI24746J21847_1041811
1350 JGI24751J29686_10039665
1351 JGI25406J46586_10048172
1352 Ga0065714_10184703
1353 Ga0065704_10101672
1354 Ga0065712_10000240
1355 Ga0065712_10005522
1356 Ga0065712_10026914
1357 Ga0065712_10070470
1358 Ga0065712_10371044
1359 Ga0065715_10000461
1360 Ga0065715_10064798
1361 Ga0065715_10112114
1362 Ga0065715_10145692
1363 Ga0065715_10163795
1364 Ga0065715_10194886
1365 Ga0065715_10213819
1366 Ga0065715_10307168
1367 Ga0065715_10317030
1368 Ga0065715_10331912
1369 Ga0065715_10578623
1370 Ga0065715_10830841
1371 Ga0065715_10914311
1372 Ga0065707_10094204
1373 Ga0065707_10099522
1374 Ga0065707_10146627
1375 Ga0065707_10228561
1376 Ga0065707_10276085
1377 Ga0065707_10279954
1378 Ga0070658_10089100
1379 Ga0070676_10005503
1380 Ga0070676_10014434
1381 Ga0070676_10033396
1382 Ga0070676_10140714
1383 Ga0070676_10159697
1384 Ga0070676_10333764
1385 Ga0070676_10359539
1386 Ga0070676_10668308
1387 Ga0070683_100018004
1388 Ga0070683_100100664
1389 Ga0070683_100213646
1390 Ga0070683_100275344
1391 Ga0070683_100519512
1392 Ga0070683_100563121
1393 Ga0070683_101301167
1394 Ga0070690_100005505
1395 Ga0070690_100014126
1396 Ga0070690_100264304
1397 Ga0070690_100331355
1398 Ga0070690_100455087
1399 Ga0070690_100753635
1400 Ga0070670_100001520
1401 Ga0070670_100004554
1402 Ga0070670_100029058
1403 Ga0070670_100180505
1404 Ga0070670_100193933
1405 Ga0070670_100197968
1406 Ga0070670_100247051
1407 Ga0070670_100283972
1408 Ga0070670_100506819
1409 Ga0070670_100688794
1410 Ga0070670_100991579
1411 Ga0070670_101007238
1412 Ga0070677_10126897
1413 Ga0070677_10212763
1414 Ga0070677_10372149
1415 Ga0070677_10469447
1416 Ga0070677_10493093
1417 Ga0068869_100007617
1418 Ga0068869_100074764
1419 Ga0068869_100092676
1420 Ga0068869_100205813
1421 Ga0068869_100557010
1422 Ga0070666_10021991
1423 Ga0070666_10118968
1424 Ga0070666_10222441
1425 Ga0070666_10237195
1426 Ga0070666_10266242
1427 Ga0070666_10281560
1428 Ga0070666_10305377
1429 Ga0070666_10399075
1430 Ga0070680_100142020
1431 Ga0070680_100345938
1432 Ga0070680_100424081
1433 Ga0070680_100691247
1434 Ga0070680_100855950
1435 Ga0070682_100170275
1436 Ga0068868_100013464
1437 Ga0068868_100141767
1438 Ga0068868_100179376
1439 Ga0068868_100398950
1440 Ga0068868_100543730
1441 Ga0068868_100806987
1442 Ga0070660_100116844
1443 Ga0070660_100235303
1444 Ga0070660_100495897
1445 Ga0070689_100022262
1446 Ga0070689_100039962
1447 Ga0070689_100098694
1448 Ga0070689_100273205
1449 Ga0070689_100351368
1450 Ga0070691_10110122
1451 Ga0070691_10157253
1452 Ga0070691_10343511
1453 Ga0070687_100043586
1454 Ga0070661_100122208
1455 Ga0070661_100423015
1456 Ga0070661_100553510
1457 Ga0070661_101258539
1458 Ga0070692_10622877
1459 Ga0070668_100083339
1460 Ga0070668_100201570
1461 Ga0070668_100278583
1462 Ga0070668_100469874
1463 Ga0070668_100625792
1464 Ga0070668_100774676
1465 Ga0070669_100030897
1466 Ga0070669_100249214
1467 Ga0070669_100261556
1468 Ga0070669_100295507
1469 Ga0070669_100353396
1470 Ga0070669_100406663
1471 Ga0070669_100434364
1472 Ga0070675_100000126
1473 Ga0070675_100003326
1474 Ga0070675_100007860
1475 Ga0070675_100023380
1476 Ga0070675_100041763
1477 Ga0070675_100053441
1478 Ga0070675_100073515
1479 Ga0070675_100139745
1480 Ga0070675_100233143
1481 Ga0070675_100414821
1482 Ga0070675_100782055
1483 Ga0070675_101298423
1484 Ga0070671_100001545
1485 Ga0070671_100182780
1486 Ga0070671_100324215
1487 Ga0070671_100372969
1488 Ga0070671_100526860
1489 Ga0070671_101058609
1490 Ga0070674_100013172
1491 Ga0070674_100052538
1492 Ga0070674_100096038
1493 Ga0070674_100246238
1494 Ga0070674_100418671
1495 Ga0070674_100666634
1496 Ga0070673_100000690
1497 Ga0070673_100037832
1498 Ga0070673_100060303
1499 Ga0070673_100095114
1500 Ga0070673_100129850
1501 Ga0070673_100178025
1502 Ga0070673_100396736
1503 Ga0070673_100766536
1504 Ga0070673_100897923
1505 Ga0070673_101454703
1506 Ga0070688_100017879
1507 Ga0070688_100020144
1508 Ga0070688_100069081
1509 Ga0070688_100132335
1510 Ga0070688_100146247
1511 Ga0070688_100237521
1512 Ga0070659_100027011
1513 Ga0070659_100660401
1514 Ga0070667_100046326
1515 Ga0070667_100389215
1516 Ga0070667_100624619
1517 Ga0070667_101255110
1518 Ga0070710_10625798
1519 Ga0070701_10027018
1520 Ga0070701_10070153
1521 Ga0070701_10109401
1522 Ga0070701_10117512
1523 Ga0070701_10600514
1524 Ga0070701_10839436
1525 Ga0070711_100280936
1526 Ga0070705_100000680
1527 Ga0070705_100173502
1528 Ga0070705_100187543
1529 Ga0070705_100462112
1530 Ga0070705_101231647
1531 Ga0070700_100034040
1532 Ga0070700_100055981
1533 Ga0070700_100207361
1534 Ga0070700_100482863
1535 Ga0070700_100658650
1536 Ga0070694_100006774
1537 Ga0070694_100044907
1538 Ga0070694_100063598
1539 Ga0070694_100123107
1540 Ga0070694_100169787
1541 Ga0070694_100206570
1542 Ga0070694_100340744
1543 Ga0070694_100859678
1544 Ga0070708_100031961
1545 Ga0070708_100661858
1546 Ga0070708_100730200
1547 Ga0070708_101323328
1548 Ga0070663_100066957
1549 Ga0070663_100144362
1550 Ga0070678_100004340
1551 Ga0070678_100135625
1552 Ga0070678_100552197
1553 Ga0070678_100592467
1554 Ga0070678_100955161
1555 Ga0070678_101605623
1556 Ga0070662_100151156
1557 Ga0070662_100219691
1558 Ga0070662_100219998
1559 Ga0070662_100248910
1560 Ga0070662_100266352
1561 Ga0070662_100366917
1562 Ga0070662_100536470
1563 Ga0070662_100967423
1564 Ga0070681_10021192
1565 Ga0070681_10083175
1566 Ga0070681_10211278
1567 Ga0070681_10238377
1568 Ga0070681_10802843
1569 Ga0068867_100002261
1570 Ga0068867_100283344
1571 Ga0068867_100299779
1572 Ga0068867_100383231
1573 Ga0068867_100466036
1574 Ga0068867_101612259
1575 Ga0070685_10003607
1576 Ga0070685_10467536
1577 Ga0070685_10494207
1578 Ga0070706_100199536
1579 Ga0070706_100293009
1580 Ga0070706_100416918
1581 Ga0070706_100690614
1582 Ga0070707_100043580
1583 Ga0070707_100237663
1584 Ga0070707_100306268
1585 Ga0070707_100408713
1586 Ga0070698_100009236
1587 Ga0070698_100167566
1588 Ga0070698_100229712
1589 Ga0070698_100323196
1590 Ga0070698_100777578
1591 Ga0070698_101688872
1592 Ga0070699_100009305
1593 Ga0070699_100073511
1594 Ga0070699_100183126
1595 Ga0070699_100329184
1596 Ga0070699_100417218
1597 Ga0070679_100010924
1598 Ga0070679_100106332
1599 Ga0070679_100183062
1600 Ga0070684_100053249
1601 Ga0070684_100078170
1602 Ga0070684_100189390
1603 Ga0070697_100039640
1604 Ga0070697_100041400
1605 Ga0070697_100072419
1606 Ga0070697_100453942
1607 Ga0070697_100789868
1608 Ga0070697_100892027
1609 Ga0070697_100931937
1610 Ga0070697_101069763
1611 Ga0070697_101419677
1612 Ga0068853_100219864
1613 Ga0068853_100771361
1614 Ga0070672_100017929
1615 Ga0070672_100027960
1616 Ga0070672_100056768
1617 Ga0070672_100069451
1618 Ga0070672_100080293
1619 Ga0070672_100203611
1620 Ga0070672_100357082
1621 Ga0070672_100377457
1622 Ga0070672_100379500
1623 Ga0070672_100639362
1624 Ga0070672_100662583
1625 Ga0070686_100044521
1626 Ga0070686_100128432
1627 Ga0070686_100238538
1628 Ga0070686_100410575
1629 Ga0070695_100000031
1630 Ga0070695_100003224
1631 Ga0070695_100044059
1632 Ga0070695_100156145
1633 Ga0070695_100347849
1634 Ga0070695_100457061
1635 Ga0070695_100695368
1636 Ga0070696_100003109
1637 Ga0070696_100038755
1638 Ga0070696_100097038
1639 Ga0070696_100155336
1640 Ga0070696_100192271
1641 Ga0070696_100323931
1642 Ga0070696_100373261
1643 Ga0070696_100555146
1644 Ga0070696_100602768
1645 Ga0070696_100795914
1646 Ga0070693_100191081
1647 Ga0070693_100484980
1648 Ga0070665_100022156
1649 Ga0070665_100128541
1650 Ga0070665_100261816
1651 Ga0070665_100424751
1652 Ga0070665_101659199
1653 Ga0070704_100019765
1654 Ga0070704_100176454
1655 Ga0070704_100392204
1656 Ga0070704_100421913
1657 Ga0070704_100472899
1658 Ga0070704_100501845
1659 Ga0070704_100561090
1660 Ga0068855_100857735
1661 Ga0070664_100019238
1662 Ga0070664_100041229
1663 Ga0070664_100124761
1664 Ga0070664_100261840
1665 Ga0070664_100280757
1666 Ga0070664_100379572
1667 Ga0070664_100413365
1668 Ga0070664_100444437
1669 Ga0070664_100474456
1670 Ga0070664_100596854
1671 Ga0068857_101582180
1672 Ga0068854_100016855
1673 Ga0068854_100026705
1674 Ga0068854_100132776
1675 Ga0068854_100186137
1676 Ga0068856_100026269
1677 Ga0068856_100695622
1678 Ga0070702_100000460
1679 Ga0070702_100210470
1680 Ga0070702_100658458
1681 Ga0068852_100009316
1682 Ga0068852_100317470
1683 Ga0068852_100585006
1684 Ga0068859_100006510
1685 Ga0068859_100067705
1686 Ga0068859_100234179
1687 Ga0068859_100350703
1688 Ga0068859_100430111
1689 Ga0068859_100442126
1690 Ga0068859_100697893
1691 Ga0068859_100725153
1692 Ga0068859_101272626
1693 Ga0068859_101536273
1694 Ga0068864_100004169
1695 Ga0068864_100021080
1696 Ga0068864_100162912
1697 Ga0068864_100270407
1698 Ga0068864_100500744
1699 Ga0068864_100824145
1700 Ga0068864_101381185
1701 Ga0068866_10095462
1702 Ga0068866_10236387
1703 Ga0068866_10380714
1704 Ga0068866_10561546
1705 Ga0068861_100004634
1706 Ga0068861_100137986
1707 Ga0068861_100157076
1708 Ga0068861_100188601
1709 Ga0068861_100412120
1710 Ga0068861_100501662
1711 Ga0068861_101082166
1712 Ga0068861_101606016
1713 Ga0068851_10148780
1714 Ga0068870_10110901
1715 Ga0068870_10575843
1716 Ga0068870_10621337
1717 Ga0068863_100020030
1718 Ga0068863_100031383
1719 Ga0068863_100206555
1720 Ga0068863_100243057
1721 Ga0068863_100357183
1722 Ga0068863_100464303
1723 Ga0068863_100890646
1724 Ga0068858_100011089
1725 Ga0068858_100032694
1726 Ga0068858_100043870
1727 Ga0068858_100069082
1728 Ga0068858_100096160
1729 Ga0068858_100110035
1730 Ga0068858_100206491
1731 Ga0068858_100330655
1732 Ga0068858_100532217
1733 Ga0068858_100723501
1734 Ga0068860_100030217
1735 Ga0068860_100031570
1736 Ga0068860_100187292
1737 Ga0068860_100258861
1738 Ga0068860_100309844
1739 Ga0068860_100335039
1740 Ga0068860_100471152
1741 Ga0068860_100551557
1742 Ga0068860_100991600
1743 Ga0068862_100003771
1744 Ga0068862_100118946
1745 Ga0068862_100141069
1746 Ga0068862_100702580
1747 Ga0068862_100703845
1748 Ga0068862_101036202
1749 Ga0068862_101599725
1750 Ga0081455_10032518
1751 Ga0081539_10011631
1752 Ga0075364_10001175
1753 Ga0070715_10148861
1754 Ga0070716_100141970
1755 Ga0070712_100336622
1756 Ga0075367_10078003
1757 Ga0097621_100000646
1758 Ga0097621_100057369
1759 Ga0097621_100074576
1760 Ga0097621_100092048
1761 Ga0097621_100116803
1762 Ga0097621_100121483
1763 Ga0097621_100127825
1764 Ga0097621_100247333
1765 Ga0097621_100286015
1766 Ga0097621_100312628
1767 Ga0097621_100322879
1768 Ga0097621_101030519
1769 Ga0068871_100000958
1770 Ga0068871_100015651
1771 Ga0068871_100086620
1772 Ga0068871_100102706
1773 Ga0068871_100124392
1774 Ga0068871_100216299
1775 Ga0068871_100282503
1776 Ga0068871_100308324
1777 Ga0068871_100398626
1778 Ga0068871_100400882
1779 Ga0068871_100405985
1780 Ga0068871_100621822
1781 Ga0068871_100835359
1782 Ga0075428_100004388
1783 Ga0075428_100016696
1784 Ga0075428_100109939
1785 Ga0075428_100134607
1786 Ga0075428_100260668
1787 Ga0075428_100284409
1788 Ga0075430_100033863
1789 Ga0075430_100079109
1790 Ga0075430_100183058
1791 Ga0075430_100726437
1792 Ga0075431_100124505
1793 Ga0075433_10000410
1794 Ga0075433_10032578
1795 Ga0075433_10041447
1796 Ga0075433_10104151
1797 Ga0075433_10227262
1798 Ga0075433_10478873
1799 Ga0075434_100002649
1800 Ga0075434_100010265
1801 Ga0075434_100016691
1802 Ga0075434_100043489
1803 Ga0075434_100060461
1804 Ga0075434_100067384
1805 Ga0075434_100160624
1806 Ga0075434_100441610
1807 Ga0075434_100462824
1808 Ga0075429_100019101
1809 Ga0075429_100023000
1810 Ga0075429_100105538
1811 Ga0075429_100206805
1812 Ga0075429_100328372
1813 Ga0068865_100058565
1814 Ga0068865_100161970
1815 Ga0068865_100330149
1816 Ga0068865_100441636
1817 Ga0068865_100491087
1818 Ga0068865_100754984
1819 Ga0068865_100846877
1820 Ga0068865_100940308
1821 Ga0075436_100003619
1822 Ga0075436_100005691
1823 Ga0075436_100009419
1824 Ga0075436_100017953
1825 Ga0075436_100028119
1826 Ga0075436_100352500
1827 Ga0075436_100367401
1828 Ga0097620_100006510
1829 Ga0097620_100067705
1830 Ga0097620_100234167
1831 Ga0097620_100350699
1832 Ga0097620_100430095
1833 Ga0097620_100442128
1834 Ga0097620_100478463
1835 Ga0097620_100697882
1836 Ga0097620_100725164
1837 Ga0097620_101272564
1838 Ga0097620_101536670
1839 Ga0075435_100000177
1840 Ga0075435_100000511
1841 Ga0075435_100000948
1842 Ga0075435_100010836
1843 Ga0075435_100022074
1844 Ga0075435_100027736
1845 Ga0075435_100055969
1846 Ga0075435_100064419
1847 Ga0075435_100102306
1848 Ga0075435_100117559
1849 Ga0075435_100208146
1850 Ga0075435_100334610
1851 Ga0075435_100646487
1852 Ga0075435_100855095
1853 Ga0075435_101014131
1854 Ga0099795_10230239
1855 Ga0105240_10026350
1856 Ga0105240_10082475
1857 Ga0105240_10099671
1858 Ga0105240_10176666
1859 Ga0105240_10939089
1860 Ga0111539_10000282
1861 Ga0111539_10002116
1862 Ga0111539_10013636
1863 Ga0111539_10026941
1864 Ga0111539_10048552
1865 Ga0111539_10319787
1866 Ga0111539_10404725
1867 Ga0111539_10669366
1868 Ga0111539_10756812
1869 Ga0111539_11219210
1870 Ga0105245_10010813
1871 Ga0105245_10050221
1872 Ga0105245_10183411
1873 Ga0105245_10917310
1874 Ga0105245_11038599
1875 Ga0105245_11390841
1876 Ga0105245_11828249
1877 Ga0105247_10056647
1878 Ga0105247_11302611
1879 Ga0114129_10003573
1880 Ga0114129_10004190
1881 Ga0114129_10014054
1882 Ga0114129_10014093
1883 Ga0114129_10018498
1884 Ga0114129_10031673
1885 Ga0114129_10044870
1886 Ga0114129_10057177
1887 Ga0114129_10058076
1888 Ga0114129_10058845
1889 Ga0114129_10082700
1890 Ga0114129_10104046
1891 Ga0114129_10265864
1892 Ga0114129_10293507
1893 Ga0114129_10600237
1894 Ga0114129_10680533
1895 Ga0114129_10776011
1896 Ga0105243_10035459
1897 Ga0105243_10059961
1898 Ga0105243_10115129
1899 Ga0105243_10238482
1900 Ga0105243_10420464
1901 Ga0105243_10586968
1902 Ga0105243_12345986
1903 Ga0105241_10173253
1904 Ga0105241_10188803
1905 Ga0105241_10522734
1906 Ga0105242_10002492
1907 Ga0105242_10081765
1908 Ga0105242_10084593
1909 Ga0105242_10137478
1910 Ga0105242_10347997
1911 Ga0105242_10711529
1912 Ga0105248_10020126
1913 Ga0105248_10069824
1914 Ga0105248_10070905
1915 Ga0105248_10090779
1916 Ga0105248_10101253
1917 Ga0105248_10127825
1918 Ga0105248_10158871
1919 Ga0105248_10263125
1920 Ga0105248_10332765
1921 Ga0105248_10396148
1922 Ga0105248_10884236
1923 Ga0105248_11024909
1924 Ga0105237_10172459
1925 Ga0105237_11045192
1926 Ga0105238_10024987
1927 Ga0105238_10393500
1928 Ga0105238_10425864
1929 Ga0105249_10262533
1930 Ga0105249_10517591
1931 Ga0105249_10533276
1932 Ga0105249_10693025
1933 Ga0105249_10943379
1934 Ga0105249_11282939
1935 Ga0105239_10186410
1936 Ga0105239_10467547
1937 Ga0105239_10493066
1938 Ga0105246_10048810
1939 Ga0105246_10167361
1940 Ga0105246_10311839
1941 Ga0105246_10346591
1942 Ga0105246_10790199
1943 Ga0105246_11541779
1944 Ga0157338_1008432
1945 Ga0157374_10192833
1946 Ga0157374_10204087
1947 Ga0157374_10340989
1948 Ga0157374_10539200
1949 Ga0157374_10832917
1950 Ga0157378_10012769
1951 Ga0157378_10161424
1952 Ga0157378_10200340
1953 Ga0157378_10339317
1954 Ga0157378_10781398
1955 Ga0157378_11976714
1956 Ga0163162_10067943
1957 Ga0163162_10094830
1958 Ga0163162_10194131
1959 Ga0163162_10434928
1960 Ga0163162_10990504
1961 Ga0163162_11596565
1962 Ga0157372_11649718
1963 Ga0157375_10149988
1964 Ga0157375_10174945
1965 Ga0157375_10204411
1966 Ga0157375_10429887
1967 Ga0157375_10434553
1968 Ga0157375_11375098
1969 Ga0163163_10005196
1970 Ga0163163_10018766
1971 Ga0163163_10032453
1972 Ga0163163_10048391
1973 Ga0163163_10128949
1974 Ga0163163_10152698
1975 Ga0163163_10185791
1976 Ga0163163_10299530
1977 Ga0163163_10549148
1978 Ga0157380_10048153
1979 Ga0157380_10048852
1980 Ga0157380_10067426
1981 Ga0157380_10089867
1982 Ga0157380_10280433
1983 Ga0157380_10418269
1984 Ga0157377_10010613
1985 Ga0157377_10376081
1986 Ga0157377_10460443
1987 Ga0157377_10522712
1988 Ga0157377_10594996
1989 Ga0157379_10023958
1990 Ga0157379_10110882
1991 Ga0157379_10185004
1992 Ga0157379_10300632
1993 Ga0157379_10579596
1994 Ga0157379_10731281
1995 Ga0157376_10029841
1996 Ga0157376_10066676
1997 Ga0157376_10128399
1998 Ga0157376_10176220
1999 Ga0157376_10310036
2000 Ga0157376_10354541
2001 Ga0157376_10411794
2002 Ga0157376_10492328
2003 Ga0157376_10984558
2004 Ga0163161_10017118
2005 Ga0163161_10041079
2006 Ga0163161_10180239
2007 Ga0213876_10172729
2008 Ga0207697_10046780
2009 Ga0207697_10062387
2010 Ga0207697_10190440
2011 Ga0207682_10043301
2012 Ga0207682_10178417
2013 Ga0207682_10214588
2014 Ga0207682_10248304
2015 Ga0207642_10025151
2016 Ga0207642_10080014
2017 Ga0207642_10105605
2018 Ga0207642_10149054
2019 Ga0207642_10225855
2020 Ga0207642_10332613
2021 Ga0207710_10035406
2022 Ga0207710_10381475
2023 Ga0207688_10051028
2024 Ga0207688_10121837
2025 Ga0207688_10177531
2026 Ga0207688_10181973
2027 Ga0207688_10187522
2028 Ga0207688_10252524
2029 Ga0207680_10087679
2030 Ga0207680_10136644
2031 Ga0207680_10184477
2032 Ga0207680_10220982
2033 Ga0207680_10287847
2034 Ga0207680_10298911
2035 Ga0207680_10365326
2036 Ga0207680_10899920
2037 Ga0207685_10178670
2038 Ga0207685_10278841
2039 Ga0207699_10114676
2040 Ga0207645_10010770
2041 Ga0207645_10015244
2042 Ga0207645_10057974
2043 Ga0207645_10123382
2044 Ga0207645_10219413
2045 Ga0207645_10430296
2046 Ga0207645_10506459
2047 Ga0207643_10011395
2048 Ga0207643_10069371
2049 Ga0207643_10422751
2050 Ga0207684_10397363
2051 Ga0207684_10973129
2052 Ga0207654_10138054
2053 Ga0207654_10621436
2054 Ga0207707_10054129
2055 Ga0207707_10244670
2056 Ga0207707_10288882
2057 Ga0207707_10288976
2058 Ga0207707_10831008
2059 Ga0207695_10100723
2060 Ga0207695_10145218
2061 Ga0207671_10156397
2062 Ga0207660_10436516
2063 Ga0207660_10620515
2064 Ga0207662_10010431
2065 Ga0207662_10016049
2066 Ga0207657_10027231
2067 Ga0207657_10327945
2068 Ga0207657_10513651
2069 Ga0207649_10069567
2070 Ga0207649_10106517
2071 Ga0207649_10403973
2072 Ga0207652_10182675
2073 Ga0207652_11132307
2074 Ga0207646_10040980
2075 Ga0207646_10064873
2076 Ga0207646_10179402
2077 Ga0207646_10188644
2078 Ga0207681_10059308
2079 Ga0207681_10119336
2080 Ga0207681_10175915
2081 Ga0207681_10580728
2082 Ga0207681_10585620
2083 Ga0207681_10646553
2084 Ga0207681_11014121
2085 Ga0207694_10003652
2086 Ga0207650_10016323
2087 Ga0207650_10016409
2088 Ga0207650_10030902
2089 Ga0207650_10058067
2090 Ga0207650_10083356
2091 Ga0207650_10114907
2092 Ga0207650_10190944
2093 Ga0207650_10205730
2094 Ga0207650_10220038
2095 Ga0207659_10005817
2096 Ga0207659_10013442
2097 Ga0207659_10014731
2098 Ga0207659_10024786
2099 Ga0207659_10026603
2100 Ga0207659_10047932
2101 Ga0207659_10058334
2102 Ga0207659_10085346
2103 Ga0207659_10119654
2104 Ga0207659_10560340
2105 Ga0207659_10620968
2106 Ga0207687_10006141
2107 Ga0207687_10128353
2108 Ga0207687_10165816
2109 Ga0207687_10262199
2110 Ga0207644_10041359
2111 Ga0207644_10046712
2112 Ga0207644_10058311
2113 Ga0207644_10092838
2114 Ga0207644_10189544
2115 Ga0207690_10508823
2116 Ga0207690_10813369
2117 Ga0207706_10027640
2118 Ga0207706_10172829
2119 Ga0207706_10208208
2120 Ga0207706_10228865
2121 Ga0207706_10262333
2122 Ga0207706_10349206
2123 Ga0207706_10376242
2124 Ga0207706_11180752
2125 Ga0207706_11303762
2126 Ga0207686_10004134
2127 Ga0207686_10004419
2128 Ga0207686_10055949
2129 Ga0207686_10074842
2130 Ga0207709_10015349
2131 Ga0207709_10057968
2132 Ga0207709_10119652
2133 Ga0207709_10220055
2134 Ga0207709_10355536
2135 Ga0207670_10040873
2136 Ga0207670_10082130
2137 Ga0207670_10172695
2138 Ga0207670_10379384
2139 Ga0207669_10008736
2140 Ga0207669_10072734
2141 Ga0207669_10257683
2142 Ga0207669_10295911
2143 Ga0207669_10310429
2144 Ga0207669_10547433
2145 Ga0207704_10053344
2146 Ga0207704_10064086
2147 Ga0207704_10130818
2148 Ga0207704_10137113
2149 Ga0207704_10458283
2150 Ga0207704_10458989
2151 Ga0207704_10509359
2152 Ga0207704_10798962
2153 Ga0207665_10076235
2154 Ga0207691_10019196
2155 Ga0207691_10020028
2156 Ga0207691_10046633
2157 Ga0207691_10047190
2158 Ga0207691_10075019
2159 Ga0207691_10088896
2160 Ga0207691_10107811
2161 Ga0207691_10123301
2162 Ga0207691_10143040
2163 Ga0207691_10153427
2164 Ga0207691_10157443
2165 Ga0207691_10574184
2166 Ga0207691_10951179
2167 Ga0207711_10002123
2168 Ga0207711_10028025
2169 Ga0207711_10031580
2170 Ga0207711_10060421
2171 Ga0207711_10083634
2172 Ga0207711_10172107
2173 Ga0207711_10213689
2174 Ga0207711_10568841
2175 Ga0207711_10639438
2176 Ga0207711_11037468
2177 Ga0207711_11172651
2178 Ga0207689_10014164
2179 Ga0207689_10103375
2180 Ga0207689_10149368
2181 Ga0207689_10179651
2182 Ga0207689_10197891
2183 Ga0207689_10751062
2184 Ga0207661_10048674
2185 Ga0207661_10211406
2186 Ga0207661_10388520
2187 Ga0207661_10761455
2188 Ga0207679_10024884
2189 Ga0207679_10146741
2190 Ga0207679_10162214
2191 Ga0207679_10162690
2192 Ga0207679_10538374
2193 Ga0207679_10812347
2194 Ga0207667_10428769
2195 Ga0207651_10024415
2196 Ga0207651_10030996
2197 Ga0207651_10034980
2198 Ga0207651_10055436
2199 Ga0207651_10066190
2200 Ga0207651_10132166
2201 Ga0207651_10190590
2202 Ga0207651_10252212
2203 Ga0207651_10271767
2204 Ga0207651_10504504
2205 Ga0207651_11264609
2206 Ga0207712_10140699
2207 Ga0207712_10589382
2208 Ga0207712_11316248
2209 Ga0207668_10090248
2210 Ga0207668_10157671
2211 Ga0207668_10324293
2212 Ga0207640_10007916
2213 Ga0207640_10027553
2214 Ga0207640_10063058
2215 Ga0207640_10166997
2216 Ga0207640_10377358
2217 Ga0207658_10017274
2218 Ga0207658_10266100
2219 Ga0207658_10301993
2220 Ga0207658_10899813
2221 Ga0207677_10146815
2222 Ga0207677_10248530
2223 Ga0207677_10314906
2224 Ga0207677_10354030
2225 Ga0207677_10671074
2226 Ga0207703_10014602
2227 Ga0207703_10031326
2228 Ga0207703_10064951
2229 Ga0207703_10081087
2230 Ga0207703_10089485
2231 Ga0207703_10199695
2232 Ga0207703_10482473
2233 Ga0207703_10649354
2234 Ga0207703_10692612
2235 Ga0207703_11083663
2236 Ga0207678_10019060
2237 Ga0207678_10031920
2238 Ga0207678_10121490
2239 Ga0207678_10297913
2240 Ga0207678_10404421
2241 Ga0207678_10828427
2242 Ga0207708_10045412
2243 Ga0207708_10067266
2244 Ga0207708_10099383
2245 Ga0207708_10230806
2246 Ga0207708_10259811
2247 Ga0207708_10456707
2248 Ga0207708_10987406
2249 Ga0207641_10004659
2250 Ga0207641_10047696
2251 Ga0207641_10104555
2252 Ga0207641_10137836
2253 Ga0207641_10560829
2254 Ga0207641_10840811
2255 Ga0207641_10854409
2256 Ga0207641_11152640
2257 Ga0207641_11543915
2258 Ga0207648_10001001
2259 Ga0207648_10005858
2260 Ga0207648_10084037
2261 Ga0207648_10184989
2262 Ga0207648_10217683
2263 Ga0207648_10323095
2264 Ga0207676_10020437
2265 Ga0207676_10089537
2266 Ga0207676_10191209
2267 Ga0207676_10241308
2268 Ga0207676_10452490
2269 Ga0207676_10658253
2270 Ga0207674_11055959
2271 Ga0207675_100000149
2272 Ga0207675_100116442
2273 Ga0207675_100164703
2274 Ga0207675_100188963
2275 Ga0207675_100298850
2276 Ga0207675_100657166
2277 Ga0207675_100735075
2278 Ga0207675_100766991
2279 Ga0207675_100797273
2280 Ga0207675_101497908
2281 Ga0207683_10007967
2282 Ga0207683_10015260
2283 Ga0207683_10023262
2284 Ga0207683_10026735
2285 Ga0207683_10216483
2286 Ga0207683_10523740
2287 Ga0207683_10568585
2288 Ga0207683_10803487
2289 Ga0207698_10171883
2290 Ga0207698_10266717
2291 Ga0209971_1050444
2292 Ga0209966_1026360
2293 Ga0209974_10030828
2294 Ga0207428_10017704
2295 Ga0207428_10042421
2296 Ga0207428_10062373
2297 Ga0207428_10259180
2298 Ga0207428_10426987
2299 Ga0268266_10009614
2300 Ga0268266_10013632
2301 Ga0268266_10032424
2302 Ga0268266_10098603
2303 Ga0268266_10212920
2304 Ga0268266_10313379
2305 Ga0268266_10521672
2306 Ga0268265_10018656
2307 Ga0268265_10034074
2308 Ga0268265_10293566
2309 Ga0268265_10314713
2310 Ga0268265_10361771
2311 Ga0268265_10485173
2312 Ga0268265_10784113
2313 Ga0268265_11328434
2314 Ga0268265_11424550
2315 Ga0268264_10009802
2316 Ga0268264_10067340
2317 Ga0268264_10609760
2318 Ga0268264_10652242
2319 Ga0268264_10964070
2320 Ga0268264_11319983
2321 Ga0268264_11426180
2322 Ga0265316_10148524
2323 Ga0307408_100044057
2324 Ga0307408_100075512
2325 Ga0307408_100248102
2326 Ga0307405_10047324
2327 Ga0307405_10550671
2328 Ga0307413_10019262
2329 Ga0307413_10078963
2330 Ga0307410_10001166
2331 Ga0307410_10008648
2332 Ga0307410_10174235
2333 Ga0307410_10189358
2334 Ga0307410_10303341
2335 Ga0307410_10502057
2336 Ga0307406_10013799
2337 Ga0307406_10218361
2338 Ga0307407_10002138
2339 Ga0307407_10023819
2340 Ga0307407_10092135
2341 Ga0307407_10536255
2342 Ga0307407_10588358
2343 Ga0307407_10719176
2344 Ga0307412_10084106
2345 Ga0307412_10549420
2346 Ga0307412_10839868
2347 Ga0307409_100002826
2348 Ga0307409_100078183
2349 Ga0307409_100193738
2350 Ga0307409_100205205
2351 Ga0307409_101398445
2352 Ga0307416_100003201
2353 Ga0307416_100036776
2354 Ga0307416_100040785
2355 Ga0307416_100132560
2356 Ga0307416_100142544
2357 Ga0307416_100259048
2358 Ga0307416_100319423
2359 Ga0307416_100370716
2360 Ga0307416_100520692
2361 Ga0307414_10079366
2362 Ga0307414_10124734
2363 Ga0307414_10447765
2364 Ga0307411_10028142
2365 Ga0307415_100002523
2366 Ga0307415_100015355
2367 Ga0307415_100087886
2368 Ga0307415_100966841
2369 Ga0373930_0041316
2370 Ga0373948_0002681
2371 Ga0373950_0003933
2372 Ga0373958_0000318
2373 Ga0373958_0058880
2374 Ga0373959_0001888
2375 Ga0373938_0107123
2376 Ga0373928_0019703
2377 Ga0373928_0179214
2378 Ga0373929_0000878
2379 Ga0373934_0234358
2380 Ga0373940_0003449
2381 Ga0373940_0051436
2382 Ga0373944_0087249
2383 Ga0373949_0013958
2384 Ga0373951_0001651
2385 Ga0373951_0040285
2386 Ga0373952_0000341
2387 Ga0373923_0198018
2388 Ga0373932_0169957
2389 Ga0373936_0178535
2390 Ga0373939_0000785
2391 Ga0373939_0023016
2392 Ga0373939_0030630
2393 Ga0373941_0002462
2394 Ga0373941_0109868
2395 Ga0373953_0323439
2396 Ga0373954_0371488
2397 Ga0373956_0110746
2398 Ga0373960_0000213
2399 Ga0373960_0016508
2400 Ga0373943_0309232
2401 Ga0373955_0140455
2402 Ga0373942_0003944
2403 Ga0373942_0067570
2404 Ga0373961_0002356
2405 Ga0373961_0084769
2406 Ga0373961_0155531
2407 Ga0373962_0072609
2408 Ga0373924_0348621
2409 Ga0373931_0006673
2410 Ga0373931_0031896
2411 Ga0373931_0177005
2412 Ga0373931_0503867
2413 Ga0373935_0154076
2414 Ga0373935_0313407
2415 Ga0373927_0507686
2416 Ga0373933_0172928
2417 Ga0373947_0141179
2418 Ga0373947_0142202
2419 Ga0373937_0497481
2420 Ga0373937_0689867
2421 Ga0373925_0050432
2422 Ga0373925_0084307
2423 Ga0373925_0104445
2424 Ga0373925_0350466
2425 Ga0373925_0508651
2426 Ga0395905_0342587
2427 Ga0436365_1147767
2428 Ga0436365_1775937
2429 Ga0439453_0030295
2430 Ga0451853_0736272
2431 Ga0439431_0058780
2432 Ga0450914_015112
2433 Ga0450923_127305
2434 Ga0450894_003324
2435 Ga0439446_0034069
2436 Ga0439434_0075648
2437 Ga0439434_0091157
2438 Ga0439435_0014665
2439 Ga0439444_0009697
2440 Ga0450916_025882
2441 Ga0450918_063674
2442 Ga0466963_0287171
2443 Ga0453684_1354927
2444 Ga0451576_0015844
2445 Ga0451576_0043767
2446 Ga0451576_0055333
2447 Ga0451576_0135488
2448 Ga0451576_0474513
2449 Ga0451576_0666035
2450 Ga0466967_0040278
2451 Ga0495592_0251057
2452 Ga0495603_0102662
2453 Ga0495629_0215989
2454 Ga0495629_0826989
2455 Ga0495651_0928130
2456 Ga0495580_0057675
2457 Ga0495582_0740060
2458 Ga0495605_0196496
2459 Ga0495639_0179043
2460 Ga0495639_0268012
2461 Ga0495664_0220654
2462 Ga0495584_0034770
2463 Ga0495584_0064554
2464 Ga0495584_0313144
2465 Ga0495594_0026405
2466 Ga0495630_0132997
2467 Ga0495663_0031517
2468 Ga0495663_0144140
2469 Ga0495642_0017961
2470 Ga0495642_0367808
2471 Ga0495665_0069321
2472 Ga0495640_0212327
2473 Ga0495640_0370758
2474 Ga0495586_0195557
2475 Ga0495598_0007985
2476 Ga0495609_0087949
2477 Ga0495609_0124395
2478 Ga0495621_0000941
2479 Ga0495621_0002895
2480 Ga0495621_0009999
2481 Ga0495621_0060861
2482 Ga0495645_0004560
2483 Ga0495667_0136430
2484 Ga0495656_0102487
2485 Ga0495656_0166787
2486 Ga0495634_0061248
2487 Ga0495634_0514280
2488 Ga0495635_0092359
2489 Ga0495635_0264602
2490 Ga0495635_0343587
2491 Ga0495659_0005678
2492 Ga0495659_0021745
2493 Ga0495659_0042513
2494 Ga0495588_0068598
2495 Ga0495599_0361052
2496 Ga0495599_0393545
2497 Ga0495647_0042435
2498 Ga0495647_0074096
2499 Ga0495647_0249894
2500 Ga0495647_0282098
2501 Ga0495658_0014052
2502 Ga0495658_0016673
2503 Ga0495658_0023241
2504 Ga0495658_0131325
2505 Ga0495658_0528396
2506 Ga0495669_0387275
2507 Ga0495669_0442554
2508 Ga0495613_0060880
2509 Ga0495613_0220477
2510 Ga0495670_0338602
2511 Ga0495600_0045046
2512 Ga0495600_0265401
2513 Ga0495581_0457139
2514 Ga0495636_0004228
2515 Ga0495636_0067452
2516 Ga0495674_0268277
2517 Ga0495672_0049134
2518 Ga0495676_0124902
2519 Ga0495677_0084398
2520 Ga0495685_049669
2521 Ga0495684_0004547
2522 Ga0495684_0371966
2523 Ga0496100_0009268
2524 Ga0496100_0745676
2525 Ga0496101_0000476
2526 Ga0496101_0093318
2527 Ga0496101_0291834
2528 Ga0496101_0551534
2529 Ga0496102_0142621
2530 Ga0496102_1359164
2531 Ga0496104_0009688
2532 Ga0496104_0140614
2533 Ga0496104_0265212
2534 Ga0496104_0301873
2535 Ga0496104_0545375
2536 Ga0496104_0600028
2537 Ga0496104_1072023
2538 Ga0496105_0052055
2539 Ga0496105_0178560
2540 Ga0496105_0329497
2541 Ga0496106_0077560
2542 Ga0496106_0098911
2543 Ga0496106_0232677
2544 Ga0496107_0069686
2545 Ga0496107_0093561
2546 Ga0496107_0207386
2547 Ga0496107_0281468
2548 Ga0496108_0056564
2549 Ga0496108_0123785
2550 Ga0496109_0315681
2551 Ga0496109_0328386
2552 Ga0496109_1198723
2553 Ga0496110_0042104
2554 Ga0496110_0065850
2555 Ga0496110_0130388
2556 Ga0496110_0927001
2557 Ga0496111_1024379
2558 Ga0496112_0001501
2559 Ga0496112_0027108
2560 Ga0496112_0165059
2561 Ga0496112_0397715
2562 Ga0496112_1540943
2563 Ga0496113_0024353
2564 Ga0496113_0088008
2565 Ga0496114_0006827
2566 Ga0496114_0139700
2567 Ga0496114_0274668
2568 Ga0496114_0406812
2569 Ga0496115_0147517
2570 Ga0501034_0054428
2571 Ga0501034_0081649
2572 Ga0501040_0766992
2573 Ga0501041_0227535
2574 Ga0501046_0345060
2575 Ga0501046_0614235
2576 Ga0501047_0068122
2577 Ga0501047_0151633
2578 Ga0501048_0187060
2579 Ga0501048_0396001
2580 Ga0501072_0165572
2581 Ga0501072_0285628
2582 Ga0501075_0571754
2583 Ga0501075_1039181
2584 Ga0501077_0143474
2585 Ga0501249_156187
2586 Ga0501257_111125
2587 Ga0501259_117910
2588 Ga0501079_1040982
2589 Ga0501083_0279573
2590 Ga0501083_0473253
2591 nmdc:mga00v17_21073_c1
2592 nmdc:mga06z11_58748_c1
2593 nmdc:mga05p37_1291_c1
2594 nmdc:mga05p37_14935_c1
2595 nmdc:mga05p37_198675_c1
2596 nmdc:mga05p37_2046_c1
2597 nmdc:mga05p37_209055_c1
2598 nmdc:mga05p37_21247_c1
2599 nmdc:mga05p37_22617_c1
2600 nmdc:mga05p37_29004_c1
2601 nmdc:mga05p37_387612_c1
2602 nmdc:mga05p37_437031_c1
2603 nmdc:mga05p37_53365_c1
2604 nmdc:mga05p37_8567_c1
2605 nmdc:mga05p37_9617_c1
2606 nmdc:mga09592_146526_c1
2607 nmdc:mga09592_148963_c1
2608 nmdc:mga09592_169447_c1
2609 nmdc:mga09592_248725_c1
2610 nmdc:mga09592_389688_c1
2611 nmdc:mga09592_5812_c1
2612 nmdc:mga0qj67_25684_c1
2613 nmdc:mga0qj67_41499_c1
2614 nmdc:mga0qj67_439379_c1
2615 nmdc:mga0qj67_6470_c1
2616 nmdc:mga0qj67_65521_c1
2617 nmdc:mga06r32_257288_c1
2618 nmdc:mga06r32_437795_c1
2619 nmdc:mga06r32_67611_c1
2620 nmdc:mga08y16_10217_c1
2621 nmdc:mga08y16_14470_c1
2622 nmdc:mga08y16_271_c1
2623 nmdc:mga08y16_344691_c1
2624 nmdc:mga08y16_50932_c1
2625 nmdc:mga08y16_8620_c1
2626 nmdc:mga0n895_11526_c1
2627 nmdc:mga0n895_149384_c1
2628 nmdc:mga0n895_151455_c1
2629 nmdc:mga0n895_1823283_c1
2630 nmdc:mga0n895_283249_c1
2631 nmdc:mga0n895_30953_c1
2632 nmdc:mga0n895_453448_c1
2633 nmdc:mga0n895_513202_c1
2634 nmdc:mga0n895_661977_c1
2635 nmdc:mga0n895_697172_c1
2636 nmdc:mga0n895_74627_c1
2637 nmdc:mga0n895_780_c1
2638 nmdc:mga0n895_950257_c1
2639 nmdc:mga0n895_967786_c1
2640 nmdc:mga0n895_96956_c1
2641 nmdc:mga0rr50_1089_c1
2642 nmdc:mga0rr50_116949_c1
2643 nmdc:mga0rr50_120836_c1
2644 nmdc:mga0rr50_134420_c1
2645 nmdc:mga0rr50_135946_c1
2646 nmdc:mga0rr50_16_c1
2647 nmdc:mga0rr50_281183_c1
2648 nmdc:mga0rr50_486230_c1
2649 nmdc:mga0rr50_7088_c1
2650 nmdc:mga0rr50_85049_c1
2651 nmdc:mga0rr50_8665_c1
2652 nmdc:mga08x19_101290_c1
2653 nmdc:mga08x19_1131092_c1
2654 nmdc:mga08x19_113190_c1
2655 nmdc:mga08x19_137_c1
2656 nmdc:mga08x19_152505_c1
2657 nmdc:mga08x19_338259_c1
2658 nmdc:mga08x19_346486_c1
2659 nmdc:mga08x19_7915_c1
2660 nmdc:mga0a205_123996_c1
2661 nmdc:mga0a205_140461_c1
2662 nmdc:mga0a205_172059_c1
2663 nmdc:mga0a205_174118_c1
2664 nmdc:mga0a205_192679_c1
2665 nmdc:mga0a205_277_c1
2666 nmdc:mga0a205_431995_c1
2667 nmdc:mga0a205_461918_c1
2668 nmdc:mga0a205_8237_c2
2669 Ga0495601_0069867
2670 Ga0495601_0176566
2671 Ga0495601_0268172
2672 Ga0495601_0355071
2673 Ga0495612_0137791
2674 Ga0495595_0096189
2675 Ga0495595_0168821
2676 Ga0495619_0003559
2677 Ga0495619_0010615
2678 Ga0495619_0073179
2679 Ga0495619_0253701
2680 Ga0495619_0705944
2681 Ga0501084_0286631
2682 Ga0501084_0578952
2683 Ga0590071_000076
2684 Ga0590071_037943
2685 Ga0590075_002613
2686 Ga0590075_003545
2687 Ga0590075_043351
2688 Ga0590077_000554
2689 Ga0590077_013470
2690 Ga0501082_0112412
2691 Ga0501082_0344446
2692 Ga0501082_1347119
2693 Ga0530510_0254438
2694 Ga0530510_0486817

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

17

165

0.81

Map