F493176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1344 | 416 | 2688 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300006177|Ga0075362_10465777|Ga0075362_104657772 |
| Length | 95 |
| Sequence | VSSRTCPDWPDLLEVAPNLQFKHYTVAEARLPAEALGAIPQITSLADVAICCDLDHHVFYAKHTDPAVGVALRATHWYELAEWASSGPGGAATTD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 253 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 254 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 255 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 258 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 259 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 260 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 261 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 262 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 413 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 416 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.12 |
| Nodule | 0 |
| Rhizoplane | 5.28 |
| Rhizosphere | 92.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075362_10465777 | 3300006177 | Bacteria | 643 |
| 2 | JGI24747J21853_1022702 | 3300001978 | Unclassified | 690 |
| 3 | JGI24743J22301_10077164 | 3300001991 | Unclassified | 700 |
| 4 | JGI24748J21848_1058990 | 3300002074 | Unclassified | 510 |
| 5 | JGI24749J21850_1067275 | 3300002076 | Unclassified | 550 |
| 6 | JGI24744J21845_10004090 | 3300002077 | Bacteria | 3009 |
| 7 | JGI24742J22300_10028768 | 3300002244 | Bacteria | 965 |
| 8 | JGI25407J50210_10026260 | 3300003373 | Bacteria | 1510 |
| 9 | Ga0070658_10009263 | 3300005327 | Bacteria | 7917 |
| 10 | Ga0070658_10129479 | 3300005327 | Bacteria | 2102 |
| 11 | Ga0070683_100022239 | 3300005329 | Bacteria | 5665 |
| 12 | Ga0070683_100196273 | 3300005329 | Bacteria | 1916 |
| 13 | Ga0070683_100389897 | 3300005329 | Bacteria | 1328 |
| 14 | Ga0070683_100430785 | 3300005329 | Bacteria | 1258 |
| 15 | Ga0070683_100599085 | 3300005329 | Bacteria | 1054 |
| 16 | Ga0070683_100730016 | 3300005329 | Bacteria | 949 |
| 17 | Ga0070683_100818823 | 3300005329 | Bacteria | 893 |
| 18 | Ga0070690_100076575 | 3300005330 | Bacteria | 2183 |
| 19 | Ga0070690_100569302 | 3300005330 | Bacteria | 856 |
| 20 | Ga0070690_101673129 | 3300005330 | Unclassified | 517 |
| 21 | Ga0068869_100468872 | 3300005334 | Unclassified | 1047 |
| 22 | Ga0068869_101213929 | 3300005334 | Unclassified | 663 |
| 23 | Ga0068869_101372443 | 3300005334 | Bacteria | 625 |
| 24 | Ga0070666_10042249 | 3300005335 | Bacteria | 3050 |
| 25 | Ga0070680_100046766 | 3300005336 | Unclassified | 3521 |
| 26 | Ga0070680_100064521 | 3300005336 | Bacteria | 3001 |
| 27 | Ga0070680_100128248 | 3300005336 | Bacteria | 2121 |
| 28 | Ga0070682_100056508 | 3300005337 | Unclassified | 2468 |
| 29 | Ga0070682_100445987 | 3300005337 | Bacteria | 990 |
| 30 | Ga0068868_100679798 | 3300005338 | Bacteria | 919 |
| 31 | Ga0068868_100950332 | 3300005338 | Bacteria | 784 |
| 32 | Ga0068868_101075143 | 3300005338 | Unclassified | 739 |
| 33 | Ga0068868_101136077 | 3300005338 | Unclassified | 720 |
| 34 | Ga0068868_101645658 | 3300005338 | Bacteria | 604 |
| 35 | Ga0070660_100002553 | 3300005339 | Bacteria | 12477 |
| 36 | Ga0070660_100008218 | 3300005339 | Bacteria | 7293 |
| 37 | Ga0070660_100008664 | 3300005339 | Bacteria | 7124 |
| 38 | Ga0070660_100114436 | 3300005339 | Bacteria | 2149 |
| 39 | Ga0070660_100632176 | 3300005339 | Bacteria | 896 |
| 40 | Ga0070689_100037043 | 3300005340 | Bacteria | 3731 |
| 41 | Ga0070689_101154104 | 3300005340 | Unclassified | 694 |
| 42 | Ga0070689_101232369 | 3300005340 | Bacteria | 672 |
| 43 | Ga0070691_10064019 | 3300005341 | Bacteria | 1774 |
| 44 | Ga0070691_10278392 | 3300005341 | Bacteria | 907 |
| 45 | Ga0070691_10534596 | 3300005341 | Bacteria | 683 |
| 46 | Ga0070687_100366525 | 3300005343 | Bacteria | 934 |
| 47 | Ga0070687_100724764 | 3300005343 | Bacteria | 697 |
| 48 | Ga0070687_101211956 | 3300005343 | Unclassified | 557 |
| 49 | Ga0070661_100135993 | 3300005344 | Bacteria | 1849 |
| 50 | Ga0070661_100413132 | 3300005344 | Bacteria | 1069 |
| 51 | Ga0070661_100612365 | 3300005344 | Bacteria | 881 |
| 52 | Ga0070661_100833725 | 3300005344 | Unclassified | 758 |
| 53 | Ga0070692_10060313 | 3300005345 | Bacteria | 1997 |
| 54 | Ga0070668_100157074 | 3300005347 | Bacteria | 1843 |
| 55 | Ga0070668_100609191 | 3300005347 | Bacteria | 956 |
| 56 | Ga0070669_100361793 | 3300005353 | Bacteria | 1180 |
| 57 | Ga0070669_100756503 | 3300005353 | Bacteria | 824 |
| 58 | Ga0070675_100178886 | 3300005354 | Bacteria | 1833 |
| 59 | Ga0070675_100928269 | 3300005354 | Unclassified | 798 |
| 60 | Ga0070671_100138890 | 3300005355 | Bacteria | 2050 |
| 61 | Ga0070671_100191772 | 3300005355 | Bacteria | 1732 |
| 62 | Ga0070671_100753112 | 3300005355 | Bacteria | 847 |
| 63 | Ga0070671_101138876 | 3300005355 | Bacteria | 686 |
| 64 | Ga0070674_100029798 | 3300005356 | Unclassified | 3600 |
| 65 | Ga0070674_100343606 | 3300005356 | Unclassified | 1203 |
| 66 | Ga0070674_100778271 | 3300005356 | Unclassified | 824 |
| 67 | Ga0070673_100159727 | 3300005364 | Bacteria | 1916 |
| 68 | Ga0070688_100003339 | 3300005365 | Bacteria | 8227 |
| 69 | Ga0070659_100038645 | 3300005366 | Unclassified | 3723 |
| 70 | Ga0070659_100099301 | 3300005366 | Bacteria | 2341 |
| 71 | Ga0070659_100248350 | 3300005366 | Unclassified | 1474 |
| 72 | Ga0070667_100683233 | 3300005367 | Bacteria | 949 |
| 73 | Ga0070667_102330558 | 3300005367 | Bacteria | 504 |
| 74 | Ga0070703_10028894 | 3300005406 | Bacteria | 1660 |
| 75 | Ga0070709_10106682 | 3300005434 | Bacteria | 1876 |
| 76 | Ga0070709_11604006 | 3300005434 | Bacteria | 530 |
| 77 | Ga0070714_100007661 | 3300005435 | Bacteria | 8408 |
| 78 | Ga0070714_100064481 | 3300005435 | Bacteria | 3153 |
| 79 | Ga0070714_100091325 | 3300005435 | Bacteria | 2668 |
| 80 | Ga0070714_100227265 | 3300005435 | Unclassified | 1718 |
| 81 | Ga0070714_100370904 | 3300005435 | Bacteria | 1348 |
| 82 | Ga0070714_101003153 | 3300005435 | Bacteria | 812 |
| 83 | Ga0070714_101222910 | 3300005435 | Bacteria | 733 |
| 84 | Ga0070713_100042668 | 3300005436 | Bacteria | 3704 |
| 85 | Ga0070713_100091556 | 3300005436 | Bacteria | 2616 |
| 86 | Ga0070713_100163032 | 3300005436 | Bacteria | 1991 |
| 87 | Ga0070713_100376372 | 3300005436 | Unclassified | 1322 |
| 88 | Ga0070713_100776006 | 3300005436 | Bacteria | 918 |
| 89 | Ga0070713_100828760 | 3300005436 | Bacteria | 887 |
| 90 | Ga0070713_101492708 | 3300005436 | Unclassified | 656 |
| 91 | Ga0070710_10031366 | 3300005437 | Bacteria | 2869 |
| 92 | Ga0070710_10045884 | 3300005437 | Bacteria | 2431 |
| 93 | Ga0070710_11017430 | 3300005437 | Bacteria | 604 |
| 94 | Ga0070701_10026031 | 3300005438 | Unclassified | 2848 |
| 95 | Ga0070701_11158123 | 3300005438 | Bacteria | 547 |
| 96 | Ga0070711_100036960 | 3300005439 | Bacteria | 3274 |
| 97 | Ga0070711_100089774 | 3300005439 | Bacteria | 2211 |
| 98 | Ga0070705_100031464 | 3300005440 | Unclassified | 2938 |
| 99 | Ga0070705_100035015 | 3300005440 | Bacteria | 2811 |
| 100 | Ga0070705_100645464 | 3300005440 | Bacteria | 825 |
| 101 | Ga0070705_101289590 | 3300005440 | Unclassified | 605 |
| 102 | Ga0070700_100004091 | 3300005441 | Bacteria | 7595 |
| 103 | Ga0070700_100104506 | 3300005441 | Bacteria | 1871 |
| 104 | Ga0070700_100363445 | 3300005441 | Bacteria | 1077 |
| 105 | Ga0070700_100397774 | 3300005441 | Bacteria | 1035 |
| 106 | Ga0070700_100422517 | 3300005441 | Bacteria | 1007 |
| 107 | Ga0070700_100938841 | 3300005441 | Unclassified | 707 |
| 108 | Ga0070700_101112893 | 3300005441 | Unclassified | 655 |
| 109 | Ga0070700_101417812 | 3300005441 | Bacteria | 588 |
| 110 | Ga0070694_100176006 | 3300005444 | Bacteria | 1579 |
| 111 | Ga0070694_100456948 | 3300005444 | Bacteria | 1009 |
| 112 | Ga0070694_100980345 | 3300005444 | Bacteria | 701 |
| 113 | Ga0070694_101015920 | 3300005444 | Bacteria | 689 |
| 114 | Ga0070694_101175707 | 3300005444 | Unclassified | 642 |
| 115 | Ga0070708_100111259 | 3300005445 | Bacteria | 2517 |
| 116 | Ga0070708_100274947 | 3300005445 | Bacteria | 1584 |
| 117 | Ga0070663_100060900 | 3300005455 | Bacteria | 2717 |
| 118 | Ga0070663_100650185 | 3300005455 | Bacteria | 892 |
| 119 | Ga0070678_100033597 | 3300005456 | Bacteria | 3563 |
| 120 | Ga0070678_100235226 | 3300005456 | Bacteria | 1529 |
| 121 | Ga0070678_100257115 | 3300005456 | Bacteria | 1467 |
| 122 | Ga0070678_101269536 | 3300005456 | Unclassified | 685 |
| 123 | Ga0070662_100226193 | 3300005457 | Bacteria | 1495 |
| 124 | Ga0070662_101342567 | 3300005457 | Bacteria | 616 |
| 125 | Ga0070662_101428561 | 3300005457 | Unclassified | 596 |
| 126 | Ga0070662_101948812 | 3300005457 | Bacteria | 508 |
| 127 | Ga0070681_10089329 | 3300005458 | Bacteria | 3033 |
| 128 | Ga0070681_10201079 | 3300005458 | Bacteria | 1911 |
| 129 | Ga0070681_10208335 | 3300005458 | Bacteria | 1871 |
| 130 | Ga0070681_10784230 | 3300005458 | Bacteria | 870 |
| 131 | Ga0068867_100015764 | 3300005459 | Bacteria | 5364 |
| 132 | Ga0068867_100332208 | 3300005459 | Bacteria | 1263 |
| 133 | Ga0068867_100372597 | 3300005459 | Bacteria | 1197 |
| 134 | Ga0068867_100548541 | 3300005459 | Bacteria | 1001 |
| 135 | Ga0068867_101941476 | 3300005459 | Bacteria | 556 |
| 136 | Ga0070685_10014012 | 3300005466 | Bacteria | 4243 |
| 137 | Ga0070685_10328450 | 3300005466 | Bacteria | 1039 |
| 138 | Ga0070706_100001733 | 3300005467 | Bacteria | 22596 |
| 139 | Ga0070706_100055425 | 3300005467 | Bacteria | 3660 |
| 140 | Ga0070706_100697649 | 3300005467 | Bacteria | 941 |
| 141 | Ga0070707_100008575 | 3300005468 | Bacteria | 9499 |
| 142 | Ga0070707_100146390 | 3300005468 | Bacteria | 2299 |
| 143 | Ga0070707_100839260 | 3300005468 | Unclassified | 883 |
| 144 | Ga0070707_100880920 | 3300005468 | Unclassified | 859 |
| 145 | Ga0070707_101303215 | 3300005468 | Unclassified | 693 |
| 146 | Ga0070698_100034864 | 3300005471 | Bacteria | 5206 |
| 147 | Ga0070698_100106751 | 3300005471 | Bacteria | 2768 |
| 148 | Ga0070698_100733923 | 3300005471 | Bacteria | 930 |
| 149 | Ga0070698_101627969 | 3300005471 | Bacteria | 598 |
| 150 | Ga0070699_100036997 | 3300005518 | Bacteria | 4223 |
| 151 | Ga0070699_100093303 | 3300005518 | Bacteria | 2634 |
| 152 | Ga0070699_100543911 | 3300005518 | Bacteria | 1057 |
| 153 | Ga0070699_100925648 | 3300005518 | Bacteria | 799 |
| 154 | Ga0070699_101035334 | 3300005518 | Archaea | 753 |
| 155 | Ga0070699_101601117 | 3300005518 | Unclassified | 597 |
| 156 | Ga0070699_101884760 | 3300005518 | Unclassified | 547 |
| 157 | Ga0070699_102155435 | 3300005518 | Bacteria | 509 |
| 158 | Ga0070679_100035296 | 3300005530 | Bacteria | 4960 |
| 159 | Ga0070679_100045545 | 3300005530 | Bacteria | 4371 |
| 160 | Ga0070679_100319583 | 3300005530 | Unclassified | 1502 |
| 161 | Ga0070679_100362069 | 3300005530 | Bacteria | 1398 |
| 162 | Ga0070684_100009842 | 3300005535 | Bacteria | 7552 |
| 163 | Ga0070684_100062489 | 3300005535 | Bacteria | 3262 |
| 164 | Ga0070684_100085531 | 3300005535 | Bacteria | 2797 |
| 165 | Ga0070684_100395486 | 3300005535 | Bacteria | 1274 |
| 166 | Ga0070684_100426543 | 3300005535 | Bacteria | 1224 |
| 167 | Ga0070684_101766641 | 3300005535 | Bacteria | 584 |
| 168 | Ga0070697_100812307 | 3300005536 | Unclassified | 828 |
| 169 | Ga0070697_102059429 | 3300005536 | Bacteria | 511 |
| 170 | Ga0068853_100043446 | 3300005539 | Bacteria | 3844 |
| 171 | Ga0068853_100564676 | 3300005539 | Unclassified | 1079 |
| 172 | Ga0068853_100603347 | 3300005539 | Unclassified | 1042 |
| 173 | Ga0070672_100036966 | 3300005543 | Bacteria | 3724 |
| 174 | Ga0070672_101192856 | 3300005543 | Unclassified | 678 |
| 175 | Ga0070686_100024121 | 3300005544 | Bacteria | 3643 |
| 176 | Ga0070686_100300924 | 3300005544 | Bacteria | 1189 |
| 177 | Ga0070686_101327265 | 3300005544 | Bacteria | 601 |
| 178 | Ga0070695_100019106 | 3300005545 | Bacteria | 4168 |
| 179 | Ga0070695_100253609 | 3300005545 | Bacteria | 1282 |
| 180 | Ga0070695_101033604 | 3300005545 | Bacteria | 670 |
| 181 | Ga0070696_100124834 | 3300005546 | Bacteria | 1866 |
| 182 | Ga0070696_100155127 | 3300005546 | Bacteria | 1683 |
| 183 | Ga0070696_100198804 | 3300005546 | Bacteria | 1495 |
| 184 | Ga0070696_100407495 | 3300005546 | Bacteria | 1065 |
| 185 | Ga0070696_100627613 | 3300005546 | Bacteria | 869 |
| 186 | Ga0070696_101245739 | 3300005546 | Bacteria | 630 |
| 187 | Ga0070693_100050752 | 3300005547 | Bacteria | 2372 |
| 188 | Ga0070693_100148000 | 3300005547 | Bacteria | 1484 |
| 189 | Ga0070693_100207251 | 3300005547 | Bacteria | 1277 |
| 190 | Ga0070665_100107748 | 3300005548 | Bacteria | 2789 |
| 191 | Ga0070665_100207864 | 3300005548 | Bacteria | 1958 |
| 192 | Ga0070704_100075348 | 3300005549 | Bacteria | 2464 |
| 193 | Ga0070704_100722913 | 3300005549 | Unclassified | 885 |
| 194 | Ga0070704_101162306 | 3300005549 | Unclassified | 703 |
| 195 | Ga0070704_101372912 | 3300005549 | Bacteria | 648 |
| 196 | Ga0070704_101561017 | 3300005549 | Unclassified | 608 |
| 197 | Ga0068855_100146639 | 3300005563 | Bacteria | 2686 |
| 198 | Ga0068855_100222034 | 3300005563 | Bacteria | 2118 |
| 199 | Ga0068855_100667467 | 3300005563 | Bacteria | 1115 |
| 200 | Ga0068855_102229526 | 3300005563 | Unclassified | 549 |
| 201 | Ga0070664_100672497 | 3300005564 | Bacteria | 963 |
| 202 | Ga0070664_100688486 | 3300005564 | Bacteria | 952 |
| 203 | Ga0068857_100008383 | 3300005577 | Bacteria | 8932 |
| 204 | Ga0068857_100098618 | 3300005577 | Bacteria | 2621 |
| 205 | Ga0068857_100646842 | 3300005577 | Unclassified | 1002 |
| 206 | Ga0068854_100103048 | 3300005578 | Bacteria | 2142 |
| 207 | Ga0068854_101822559 | 3300005578 | Unclassified | 558 |
| 208 | Ga0068856_100090674 | 3300005614 | Bacteria | 3040 |
| 209 | Ga0068856_100277495 | 3300005614 | Bacteria | 1692 |
| 210 | Ga0068856_100308033 | 3300005614 | Bacteria | 1601 |
| 211 | Ga0068856_100976221 | 3300005614 | Unclassified | 866 |
| 212 | Ga0068856_101045790 | 3300005614 | Bacteria | 834 |
| 213 | Ga0068856_101081635 | 3300005614 | Bacteria | 819 |
| 214 | Ga0068856_101396314 | 3300005614 | Bacteria | 715 |
| 215 | Ga0070702_100008264 | 3300005615 | Bacteria | 5031 |
| 216 | Ga0070702_100253353 | 3300005615 | Bacteria | 1194 |
| 217 | Ga0070702_100522602 | 3300005615 | Bacteria | 876 |
| 218 | Ga0068852_100031030 | 3300005616 | Bacteria | 4405 |
| 219 | Ga0068852_100106603 | 3300005616 | Bacteria | 2541 |
| 220 | Ga0068852_102083931 | 3300005616 | Unclassified | 589 |
| 221 | Ga0068859_100356837 | 3300005617 | Bacteria | 1557 |
| 222 | Ga0068859_101907706 | 3300005617 | Bacteria | 656 |
| 223 | Ga0068859_102635885 | 3300005617 | Bacteria | 553 |
| 224 | Ga0068864_100357163 | 3300005618 | Bacteria | 1380 |
| 225 | Ga0068864_101005975 | 3300005618 | Unclassified | 827 |
| 226 | Ga0068864_102157825 | 3300005618 | Bacteria | 563 |
| 227 | Ga0068866_10037222 | 3300005718 | Bacteria | 2388 |
| 228 | Ga0068861_100111511 | 3300005719 | Unclassified | 2192 |
| 229 | Ga0068861_100439286 | 3300005719 | Bacteria | 1167 |
| 230 | Ga0068861_100726691 | 3300005719 | Unclassified | 925 |
| 231 | Ga0068861_101456828 | 3300005719 | Bacteria | 670 |
| 232 | Ga0068851_10436457 | 3300005834 | Bacteria | 776 |
| 233 | Ga0068870_10150379 | 3300005840 | Bacteria | 1371 |
| 234 | Ga0068870_10184418 | 3300005840 | Bacteria | 1255 |
| 235 | Ga0068870_10330971 | 3300005840 | Unclassified | 971 |
| 236 | Ga0068863_102393058 | 3300005841 | Bacteria | 538 |
| 237 | Ga0068858_101534447 | 3300005842 | Unclassified | 657 |
| 238 | Ga0068858_102281643 | 3300005842 | Unclassified | 535 |
| 239 | Ga0068860_100169726 | 3300005843 | Bacteria | 2107 |
| 240 | Ga0068862_100259834 | 3300005844 | Bacteria | 1585 |
| 241 | Ga0081455_10006746 | 3300005937 | Bacteria | 12254 |
| 242 | Ga0081538_10008294 | 3300005981 | Bacteria | 8848 |
| 243 | Ga0081538_10248748 | 3300005981 | Bacteria | 679 |
| 244 | Ga0081540_1030234 | 3300005983 | Bacteria | 3003 |
| 245 | Ga0081540_1172186 | 3300005983 | Unclassified | 822 |
| 246 | Ga0081539_10011738 | 3300005985 | Bacteria | 6869 |
| 247 | Ga0070717_10052705 | 3300006028 | Bacteria | 3352 |
| 248 | Ga0070717_10062424 | 3300006028 | Bacteria | 3089 |
| 249 | Ga0070717_10154304 | 3300006028 | Bacteria | 1988 |
| 250 | Ga0070717_10493829 | 3300006028 | Unclassified | 1106 |
| 251 | Ga0070717_10993411 | 3300006028 | Bacteria | 764 |
| 252 | Ga0070717_11177909 | 3300006028 | Unclassified | 697 |
| 253 | Ga0070717_11792510 | 3300006028 | Bacteria | 555 |
| 254 | Ga0070717_11835219 | 3300006028 | Bacteria | 548 |
| 255 | Ga0075365_10037148 | 3300006038 | Bacteria | 3160 |
| 256 | Ga0075365_10112799 | 3300006038 | Bacteria | 1870 |
| 257 | Ga0075365_10376678 | 3300006038 | Bacteria | 1001 |
| 258 | Ga0075365_10691498 | 3300006038 | Unclassified | 721 |
| 259 | Ga0075364_10017812 | 3300006051 | Bacteria | 4441 |
| 260 | Ga0075432_10008659 | 3300006058 | Bacteria | 3472 |
| 261 | Ga0075432_10041952 | 3300006058 | Bacteria | 1600 |
| 262 | Ga0075432_10508031 | 3300006058 | Unclassified | 538 |
| 263 | Ga0070715_10023266 | 3300006163 | Bacteria | 2425 |
| 264 | Ga0070715_10162596 | 3300006163 | Bacteria | 1104 |
| 265 | Ga0070716_100177509 | 3300006173 | Bacteria | 1395 |
| 266 | Ga0070716_100178327 | 3300006173 | Bacteria | 1392 |
| 267 | Ga0070716_100238161 | 3300006173 | Unclassified | 1232 |
| 268 | Ga0070712_100080584 | 3300006175 | Bacteria | 2356 |
| 269 | Ga0070712_100107903 | 3300006175 | Unclassified | 2072 |
| 270 | Ga0070712_100181196 | 3300006175 | Bacteria | 1641 |
| 271 | Ga0070712_100241547 | 3300006175 | Bacteria | 1439 |
| 272 | Ga0070712_100264051 | 3300006175 | Bacteria | 1380 |
| 273 | Ga0070712_101192909 | 3300006175 | Bacteria | 662 |
| 274 | Ga0075362_10317046 | 3300006177 | Bacteria | 776 |
| 275 | Ga0097621_100081660 | 3300006237 | Bacteria | 2691 |
| 276 | Ga0097621_100146792 | 3300006237 | Bacteria | 2020 |
| 277 | Ga0068871_100022790 | 3300006358 | Bacteria | 4833 |
| 278 | Ga0068871_100565999 | 3300006358 | Bacteria | 1030 |
| 279 | Ga0068871_100841185 | 3300006358 | Bacteria | 848 |
| 280 | Ga0075428_100235491 | 3300006844 | Bacteria | 1976 |
| 281 | Ga0075428_100319956 | 3300006844 | Unclassified | 1667 |
| 282 | Ga0075428_100783901 | 3300006844 | Bacteria | 1013 |
| 283 | Ga0075428_102425684 | 3300006844 | Unclassified | 538 |
| 284 | Ga0075428_102575833 | 3300006844 | Bacteria | 520 |
| 285 | Ga0075430_100149520 | 3300006846 | Bacteria | 1945 |
| 286 | Ga0075430_100153598 | 3300006846 | Bacteria | 1916 |
| 287 | Ga0075430_101307501 | 3300006846 | Unclassified | 596 |
| 288 | Ga0075431_100173081 | 3300006847 | Bacteria | 2218 |
| 289 | Ga0075431_100289315 | 3300006847 | Bacteria | 1658 |
| 290 | Ga0075431_100905703 | 3300006847 | Bacteria | 851 |
| 291 | Ga0075431_101786713 | 3300006847 | Bacteria | 571 |
| 292 | Ga0075433_10139896 | 3300006852 | Bacteria | 2151 |
| 293 | Ga0075433_10267633 | 3300006852 | Unclassified | 1515 |
| 294 | Ga0075433_10824869 | 3300006852 | Bacteria | 810 |
| 295 | Ga0075433_11012345 | 3300006852 | Bacteria | 724 |
| 296 | Ga0075434_100000856 | 3300006871 | Bacteria | 24284 |
| 297 | Ga0075434_100010908 | 3300006871 | Bacteria | 8543 |
| 298 | Ga0075434_100114685 | 3300006871 | Bacteria | 2707 |
| 299 | Ga0075434_100136151 | 3300006871 | Bacteria | 2475 |
| 300 | Ga0075434_100273622 | 3300006871 | Bacteria | 1708 |
| 301 | Ga0075429_100154286 | 3300006880 | Bacteria | 2011 |
| 302 | Ga0075429_100529236 | 3300006880 | Bacteria | 1033 |
| 303 | Ga0075429_100918737 | 3300006880 | Unclassified | 766 |
| 304 | Ga0068865_100234268 | 3300006881 | Bacteria | 1442 |
| 305 | Ga0068865_100590695 | 3300006881 | Bacteria | 937 |
| 306 | Ga0068865_101365838 | 3300006881 | Bacteria | 632 |
| 307 | Ga0075436_100026501 | 3300006914 | Bacteria | 3992 |
| 308 | Ga0075436_100073306 | 3300006914 | Bacteria | 2369 |
| 309 | Ga0075436_100339653 | 3300006914 | Bacteria | 1081 |
| 310 | Ga0097620_100356811 | 3300006931 | Bacteria | 1557 |
| 311 | Ga0097620_101908183 | 3300006931 | Bacteria | 656 |
| 312 | Ga0097620_102635494 | 3300006931 | Bacteria | 553 |
| 313 | Ga0075435_100005146 | 3300007076 | Bacteria | 9092 |
| 314 | Ga0075435_100042142 | 3300007076 | Bacteria | 3651 |
| 315 | Ga0075435_100135994 | 3300007076 | Bacteria | 2059 |
| 316 | Ga0075435_100269214 | 3300007076 | Bacteria | 1453 |
| 317 | Ga0075435_100698327 | 3300007076 | Bacteria | 882 |
| 318 | Ga0105240_10435805 | 3300009093 | Bacteria | 1470 |
| 319 | Ga0105240_10582362 | 3300009093 | Bacteria | 1234 |
| 320 | Ga0111539_10122337 | 3300009094 | Bacteria | 3050 |
| 321 | Ga0111539_10414662 | 3300009094 | Bacteria | 1568 |
| 322 | Ga0111539_10865845 | 3300009094 | Unclassified | 1051 |
| 323 | Ga0111539_10984534 | 3300009094 | Bacteria | 980 |
| 324 | Ga0111539_11905855 | 3300009094 | Unclassified | 689 |
| 325 | Ga0111539_13536084 | 3300009094 | Bacteria | 501 |
| 326 | Ga0105245_10000687 | 3300009098 | Bacteria | 30520 |
| 327 | Ga0105245_10187721 | 3300009098 | Bacteria | 1978 |
| 328 | Ga0105245_10454536 | 3300009098 | Unclassified | 1290 |
| 329 | Ga0105245_10584545 | 3300009098 | Bacteria | 1142 |
| 330 | Ga0105247_10064112 | 3300009101 | Bacteria | 2282 |
| 331 | Ga0114129_10061604 | 3300009147 | Bacteria | 5244 |
| 332 | Ga0114129_10137795 | 3300009147 | Bacteria | 3347 |
| 333 | Ga0114129_10208993 | 3300009147 | Bacteria | 2640 |
| 334 | Ga0114129_11040635 | 3300009147 | Bacteria | 1028 |
| 335 | Ga0114129_11259818 | 3300009147 | Unclassified | 918 |
| 336 | Ga0114129_11384497 | 3300009147 | Unclassified | 869 |
| 337 | Ga0114129_12148671 | 3300009147 | Bacteria | 672 |
| 338 | Ga0105243_10026578 | 3300009148 | Bacteria | 4431 |
| 339 | Ga0105243_10066517 | 3300009148 | Bacteria | 2899 |
| 340 | Ga0105243_10369800 | 3300009148 | Bacteria | 1322 |
| 341 | Ga0105243_10861849 | 3300009148 | Unclassified | 898 |
| 342 | Ga0105243_11613728 | 3300009148 | Unclassified | 675 |
| 343 | Ga0105243_12142385 | 3300009148 | Unclassified | 595 |
| 344 | Ga0105243_12901896 | 3300009148 | Unclassified | 520 |
| 345 | Ga0105241_10003550 | 3300009174 | Bacteria | 11604 |
| 346 | Ga0105241_12440474 | 3300009174 | Unclassified | 523 |
| 347 | Ga0105242_10005019 | 3300009176 | Bacteria | 10230 |
| 348 | Ga0105242_10349911 | 3300009176 | Bacteria | 1364 |
| 349 | Ga0105242_10419406 | 3300009176 | Bacteria | 1254 |
| 350 | Ga0105248_10132376 | 3300009177 | Bacteria | 2814 |
| 351 | Ga0105248_11959630 | 3300009177 | Bacteria | 665 |
| 352 | Ga0105237_10977293 | 3300009545 | Bacteria | 853 |
| 353 | Ga0105237_11424454 | 3300009545 | Bacteria | 699 |
| 354 | Ga0105238_10148058 | 3300009551 | Bacteria | 2324 |
| 355 | Ga0105238_10458834 | 3300009551 | Bacteria | 1272 |
| 356 | Ga0105238_11074680 | 3300009551 | Bacteria | 827 |
| 357 | Ga0105238_12930165 | 3300009551 | Bacteria | 513 |
| 358 | Ga0105249_10000455 | 3300009553 | Bacteria | 38320 |
| 359 | Ga0105249_11423456 | 3300009553 | Bacteria | 765 |
| 360 | Ga0105249_11497613 | 3300009553 | Bacteria | 747 |
| 361 | Ga0099796_10105178 | 3300010159 | Bacteria | 1067 |
| 362 | Ga0105239_10084098 | 3300010375 | Bacteria | 3505 |
| 363 | Ga0105239_10199302 | 3300010375 | Unclassified | 2242 |
| 364 | Ga0105239_10337099 | 3300010375 | Bacteria | 1701 |
| 365 | Ga0105239_10675107 | 3300010375 | Unclassified | 1181 |
| 366 | Ga0105239_11012425 | 3300010375 | Bacteria | 955 |
| 367 | Ga0105239_11274541 | 3300010375 | Unclassified | 848 |
| 368 | Ga0105239_12259535 | 3300010375 | Bacteria | 633 |
| 369 | Ga0105239_12915371 | 3300010375 | Bacteria | 558 |
| 370 | Ga0105246_10129205 | 3300011119 | Bacteria | 1884 |
| 371 | Ga0105246_10906746 | 3300011119 | Bacteria | 791 |
| 372 | Ga0105246_12448312 | 3300011119 | Unclassified | 513 |
| 373 | Ga0157338_1096686 | 3300012515 | Unclassified | 500 |
| 374 | Ga0157371_10882818 | 3300013102 | Archaea | 677 |
| 375 | Ga0157370_11079375 | 3300013104 | Unclassified | 726 |
| 376 | Ga0157369_10177558 | 3300013105 | Bacteria | 2242 |
| 377 | Ga0157369_10222986 | 3300013105 | Bacteria | 1973 |
| 378 | Ga0157374_10049042 | 3300013296 | Bacteria | 3920 |
| 379 | Ga0157374_11105222 | 3300013296 | Bacteria | 813 |
| 380 | Ga0157374_12394230 | 3300013296 | Unclassified | 555 |
| 381 | Ga0157378_10097427 | 3300013297 | Bacteria | 2680 |
| 382 | Ga0163162_10004697 | 3300013306 | Bacteria | 13174 |
| 383 | Ga0163162_10871908 | 3300013306 | Unclassified | 1014 |
| 384 | Ga0163162_12148418 | 3300013306 | Unclassified | 641 |
| 385 | Ga0157372_10129340 | 3300013307 | Bacteria | 2904 |
| 386 | Ga0157372_10221311 | 3300013307 | Bacteria | 2194 |
| 387 | Ga0157372_11756888 | 3300013307 | Bacteria | 713 |
| 388 | Ga0157375_10011947 | 3300013308 | Bacteria | 7685 |
| 389 | Ga0157375_13182275 | 3300013308 | Bacteria | 547 |
| 390 | Ga0163163_11995730 | 3300014325 | Unclassified | 640 |
| 391 | Ga0157380_10013107 | 3300014326 | Bacteria | 6034 |
| 392 | Ga0157380_11558144 | 3300014326 | Unclassified | 715 |
| 393 | Ga0157380_11880451 | 3300014326 | Unclassified | 659 |
| 394 | Ga0157380_12648376 | 3300014326 | Bacteria | 568 |
| 395 | Ga0157380_12703521 | 3300014326 | Bacteria | 563 |
| 396 | Ga0182008_10092684 | 3300014497 | Bacteria | 1490 |
| 397 | Ga0182008_10732527 | 3300014497 | Bacteria | 568 |
| 398 | Ga0182008_10801434 | 3300014497 | Unclassified | 547 |
| 399 | Ga0157377_10014251 | 3300014745 | Bacteria | 4042 |
| 400 | Ga0157379_10300816 | 3300014968 | Bacteria | 1462 |
| 401 | Ga0157376_10108121 | 3300014969 | Bacteria | 2443 |
| 402 | Ga0182007_10136450 | 3300015262 | Bacteria | 828 |
| 403 | Ga0163161_10289103 | 3300017792 | Bacteria | 1288 |
| 404 | Ga0163161_10982275 | 3300017792 | Bacteria | 720 |
| 405 | Ga0197907_10985028 | 3300020069 | Bacteria | 1288 |
| 406 | Ga0206356_10741757 | 3300020070 | Bacteria | 555 |
| 407 | Ga0206356_11611989 | 3300020070 | Bacteria | 2200 |
| 408 | Ga0206353_10459025 | 3300020082 | Bacteria | 1098 |
| 409 | Ga0206353_11846103 | 3300020082 | Bacteria | 555 |
| 410 | Ga0207653_10019534 | 3300025885 | Bacteria | 2137 |
| 411 | Ga0207653_10063552 | 3300025885 | Bacteria | 1250 |
| 412 | Ga0207653_10299772 | 3300025885 | Bacteria | 623 |
| 413 | Ga0207692_10081737 | 3300025898 | Bacteria | 1729 |
| 414 | Ga0207642_10051476 | 3300025899 | Unclassified | 1863 |
| 415 | Ga0207642_10405208 | 3300025899 | Bacteria | 817 |
| 416 | Ga0207642_11084177 | 3300025899 | Bacteria | 517 |
| 417 | Ga0207688_10491974 | 3300025901 | Unclassified | 767 |
| 418 | Ga0207688_10757785 | 3300025901 | Unclassified | 615 |
| 419 | Ga0207680_10098836 | 3300025903 | Bacteria | 1871 |
| 420 | Ga0207685_10056610 | 3300025905 | Bacteria | 1535 |
| 421 | Ga0207685_10189671 | 3300025905 | Unclassified | 959 |
| 422 | Ga0207699_10044254 | 3300025906 | Bacteria | 2591 |
| 423 | Ga0207699_10081023 | 3300025906 | Bacteria | 2012 |
| 424 | Ga0207699_10401117 | 3300025906 | Bacteria | 977 |
| 425 | Ga0207699_11342551 | 3300025906 | Bacteria | 529 |
| 426 | Ga0207643_10334441 | 3300025908 | Bacteria | 948 |
| 427 | Ga0207643_10388046 | 3300025908 | Bacteria | 881 |
| 428 | Ga0207705_10050481 | 3300025909 | Bacteria | 2994 |
| 429 | Ga0207705_10528884 | 3300025909 | Bacteria | 916 |
| 430 | Ga0207684_10055553 | 3300025910 | Bacteria | 3359 |
| 431 | Ga0207684_10133677 | 3300025910 | Bacteria | 2129 |
| 432 | Ga0207684_10545164 | 3300025910 | Unclassified | 992 |
| 433 | Ga0207684_11580355 | 3300025910 | Bacteria | 532 |
| 434 | Ga0207654_10084441 | 3300025911 | Bacteria | 1920 |
| 435 | Ga0207654_10231073 | 3300025911 | Bacteria | 1232 |
| 436 | Ga0207707_10084920 | 3300025912 | Bacteria | 2765 |
| 437 | Ga0207707_10243068 | 3300025912 | Unclassified | 1564 |
| 438 | Ga0207707_10279412 | 3300025912 | Bacteria | 1446 |
| 439 | Ga0207707_10608718 | 3300025912 | Bacteria | 924 |
| 440 | Ga0207707_10704345 | 3300025912 | Unclassified | 848 |
| 441 | Ga0207707_10831497 | 3300025912 | Unclassified | 767 |
| 442 | Ga0207695_10101227 | 3300025913 | Bacteria | 2876 |
| 443 | Ga0207695_10549217 | 3300025913 | Bacteria | 1037 |
| 444 | Ga0207693_10001893 | 3300025915 | Bacteria | 18320 |
| 445 | Ga0207693_10002044 | 3300025915 | Bacteria | 17664 |
| 446 | Ga0207693_10002912 | 3300025915 | Bacteria | 14807 |
| 447 | Ga0207693_10165423 | 3300025915 | Bacteria | 1741 |
| 448 | Ga0207693_10572933 | 3300025915 | Unclassified | 880 |
| 449 | Ga0207663_10009208 | 3300025916 | Bacteria | 5208 |
| 450 | Ga0207663_10040540 | 3300025916 | Bacteria | 2831 |
| 451 | Ga0207663_10214126 | 3300025916 | Bacteria | 1398 |
| 452 | Ga0207663_10270855 | 3300025916 | Bacteria | 1258 |
| 453 | Ga0207663_10763993 | 3300025916 | Bacteria | 768 |
| 454 | Ga0207660_10072292 | 3300025917 | Bacteria | 2511 |
| 455 | Ga0207660_10216726 | 3300025917 | Bacteria | 1501 |
| 456 | Ga0207660_10233076 | 3300025917 | Bacteria | 1448 |
| 457 | Ga0207660_10342361 | 3300025917 | Unclassified | 1197 |
| 458 | Ga0207662_10068928 | 3300025918 | Bacteria | 2137 |
| 459 | Ga0207662_10345649 | 3300025918 | Bacteria | 998 |
| 460 | Ga0207657_10007077 | 3300025919 | Bacteria | 11526 |
| 461 | Ga0207657_10021259 | 3300025919 | Bacteria | 6112 |
| 462 | Ga0207657_10058654 | 3300025919 | Bacteria | 3311 |
| 463 | Ga0207649_10069923 | 3300025920 | Bacteria | 2237 |
| 464 | Ga0207649_10546222 | 3300025920 | Bacteria | 886 |
| 465 | Ga0207649_10600771 | 3300025920 | Bacteria | 846 |
| 466 | Ga0207649_10703878 | 3300025920 | Bacteria | 784 |
| 467 | Ga0207649_11435720 | 3300025920 | Bacteria | 546 |
| 468 | Ga0207652_10051697 | 3300025921 | Bacteria | 3524 |
| 469 | Ga0207652_10125361 | 3300025921 | Bacteria | 2287 |
| 470 | Ga0207652_10130619 | 3300025921 | Bacteria | 2240 |
| 471 | Ga0207652_11008914 | 3300025921 | Bacteria | 731 |
| 472 | Ga0207646_10001907 | 3300025922 | Bacteria | 25107 |
| 473 | Ga0207646_10030917 | 3300025922 | Bacteria | 4850 |
| 474 | Ga0207646_10201000 | 3300025922 | Bacteria | 1800 |
| 475 | Ga0207646_10211003 | 3300025922 | Bacteria | 1754 |
| 476 | Ga0207646_10628041 | 3300025922 | Bacteria | 963 |
| 477 | Ga0207646_11168603 | 3300025922 | Unclassified | 676 |
| 478 | Ga0207681_11044083 | 3300025923 | Unclassified | 686 |
| 479 | Ga0207681_11204132 | 3300025923 | Bacteria | 636 |
| 480 | Ga0207694_10414005 | 3300025924 | Bacteria | 1122 |
| 481 | Ga0207659_10812070 | 3300025926 | Bacteria | 803 |
| 482 | Ga0207687_10108363 | 3300025927 | Bacteria | 2057 |
| 483 | Ga0207687_10342688 | 3300025927 | Bacteria | 1215 |
| 484 | Ga0207687_10580327 | 3300025927 | Bacteria | 943 |
| 485 | Ga0207687_10595187 | 3300025927 | Unclassified | 931 |
| 486 | Ga0207687_10923663 | 3300025927 | Unclassified | 747 |
| 487 | Ga0207700_10336815 | 3300025928 | Unclassified | 1311 |
| 488 | Ga0207700_10726166 | 3300025928 | Unclassified | 887 |
| 489 | Ga0207700_11205850 | 3300025928 | Bacteria | 675 |
| 490 | Ga0207700_11747080 | 3300025928 | Bacteria | 548 |
| 491 | Ga0207664_10006597 | 3300025929 | Bacteria | 7994 |
| 492 | Ga0207664_10008802 | 3300025929 | Bacteria | 7060 |
| 493 | Ga0207664_10020258 | 3300025929 | Bacteria | 4926 |
| 494 | Ga0207664_10054334 | 3300025929 | Bacteria | 3173 |
| 495 | Ga0207664_10160732 | 3300025929 | Bacteria | 1916 |
| 496 | Ga0207664_10229750 | 3300025929 | Bacteria | 1612 |
| 497 | Ga0207664_10497868 | 3300025929 | Bacteria | 1091 |
| 498 | Ga0207664_10509201 | 3300025929 | Bacteria | 1078 |
| 499 | Ga0207664_10589169 | 3300025929 | Bacteria | 998 |
| 500 | Ga0207664_10699627 | 3300025929 | Unclassified | 911 |
| 501 | Ga0207664_10883704 | 3300025929 | Bacteria | 803 |
| 502 | Ga0207664_11364697 | 3300025929 | Bacteria | 629 |
| 503 | Ga0207644_10215320 | 3300025931 | Bacteria | 1520 |
| 504 | Ga0207644_10219265 | 3300025931 | Unclassified | 1507 |
| 505 | Ga0207644_10438726 | 3300025931 | Bacteria | 1072 |
| 506 | Ga0207690_10081495 | 3300025932 | Bacteria | 2261 |
| 507 | Ga0207690_10317807 | 3300025932 | Bacteria | 1223 |
| 508 | Ga0207690_10329111 | 3300025932 | Unclassified | 1203 |
| 509 | Ga0207690_10654554 | 3300025932 | Bacteria | 861 |
| 510 | Ga0207690_10996582 | 3300025932 | Unclassified | 697 |
| 511 | Ga0207690_11307758 | 3300025932 | Bacteria | 606 |
| 512 | Ga0207690_11621004 | 3300025932 | Unclassified | 541 |
| 513 | Ga0207706_10231906 | 3300025933 | Bacteria | 1615 |
| 514 | Ga0207706_10269212 | 3300025933 | Bacteria | 1487 |
| 515 | Ga0207706_10772843 | 3300025933 | Unclassified | 817 |
| 516 | Ga0207706_10850143 | 3300025933 | Bacteria | 773 |
| 517 | Ga0207706_11191667 | 3300025933 | Unclassified | 633 |
| 518 | Ga0207686_10175367 | 3300025934 | Bacteria | 1515 |
| 519 | Ga0207686_10487875 | 3300025934 | Bacteria | 954 |
| 520 | Ga0207686_10743981 | 3300025934 | Bacteria | 782 |
| 521 | Ga0207686_11259086 | 3300025934 | Unclassified | 606 |
| 522 | Ga0207709_10049296 | 3300025935 | Bacteria | 2570 |
| 523 | Ga0207709_10056200 | 3300025935 | Bacteria | 2435 |
| 524 | Ga0207709_10413762 | 3300025935 | Unclassified | 1034 |
| 525 | Ga0207709_10681414 | 3300025935 | Bacteria | 821 |
| 526 | Ga0207709_10778263 | 3300025935 | Bacteria | 771 |
| 527 | Ga0207709_11304312 | 3300025935 | Unclassified | 600 |
| 528 | Ga0207670_10114870 | 3300025936 | Unclassified | 1946 |
| 529 | Ga0207669_10499314 | 3300025937 | Bacteria | 973 |
| 530 | Ga0207669_10785857 | 3300025937 | Unclassified | 788 |
| 531 | Ga0207669_10906128 | 3300025937 | Bacteria | 737 |
| 532 | Ga0207669_11114652 | 3300025937 | Unclassified | 666 |
| 533 | Ga0207704_10039145 | 3300025938 | Unclassified | 2757 |
| 534 | Ga0207704_10139773 | 3300025938 | Bacteria | 1692 |
| 535 | Ga0207704_10477097 | 3300025938 | Bacteria | 1001 |
| 536 | Ga0207704_11151400 | 3300025938 | Bacteria | 660 |
| 537 | Ga0207665_10003387 | 3300025939 | Bacteria | 10673 |
| 538 | Ga0207665_10041163 | 3300025939 | Bacteria | 3084 |
| 539 | Ga0207665_10172829 | 3300025939 | Bacteria | 1561 |
| 540 | Ga0207691_10040444 | 3300025940 | Bacteria | 4307 |
| 541 | Ga0207691_10334995 | 3300025940 | Bacteria | 1296 |
| 542 | Ga0207691_10337771 | 3300025940 | Bacteria | 1290 |
| 543 | Ga0207711_10548625 | 3300025941 | Unclassified | 1078 |
| 544 | Ga0207711_10623885 | 3300025941 | Bacteria | 1006 |
| 545 | Ga0207661_10018036 | 3300025944 | Bacteria | 5239 |
| 546 | Ga0207661_10115134 | 3300025944 | Bacteria | 2281 |
| 547 | Ga0207661_10173778 | 3300025944 | Bacteria | 1877 |
| 548 | Ga0207661_10312101 | 3300025944 | Bacteria | 1412 |
| 549 | Ga0207661_10361058 | 3300025944 | Bacteria | 1312 |
| 550 | Ga0207661_11514227 | 3300025944 | Bacteria | 615 |
| 551 | Ga0207661_11533997 | 3300025944 | Bacteria | 610 |
| 552 | Ga0207661_11660837 | 3300025944 | Unclassified | 584 |
| 553 | Ga0207679_10673021 | 3300025945 | Unclassified | 937 |
| 554 | Ga0207679_10683161 | 3300025945 | Bacteria | 930 |
| 555 | Ga0207679_11230600 | 3300025945 | Bacteria | 687 |
| 556 | Ga0207667_10382184 | 3300025949 | Bacteria | 1435 |
| 557 | Ga0207667_10507134 | 3300025949 | Bacteria | 1223 |
| 558 | Ga0207667_10855665 | 3300025949 | Bacteria | 903 |
| 559 | Ga0207667_12133021 | 3300025949 | Bacteria | 518 |
| 560 | Ga0207651_10154469 | 3300025960 | Bacteria | 1791 |
| 561 | Ga0207651_11299067 | 3300025960 | Bacteria | 654 |
| 562 | Ga0207651_11481075 | 3300025960 | Bacteria | 611 |
| 563 | Ga0207712_10078201 | 3300025961 | Bacteria | 2400 |
| 564 | Ga0207668_10327328 | 3300025972 | Bacteria | 1274 |
| 565 | Ga0207668_10951859 | 3300025972 | Unclassified | 766 |
| 566 | Ga0207668_11176177 | 3300025972 | Bacteria | 689 |
| 567 | Ga0207658_11234716 | 3300025986 | Bacteria | 683 |
| 568 | Ga0207677_10131212 | 3300026023 | Unclassified | 1903 |
| 569 | Ga0207677_10146691 | 3300026023 | Bacteria | 1814 |
| 570 | Ga0207677_10597900 | 3300026023 | Unclassified | 968 |
| 571 | Ga0207677_10942172 | 3300026023 | Unclassified | 780 |
| 572 | Ga0207677_11484902 | 3300026023 | Bacteria | 626 |
| 573 | Ga0207677_12220535 | 3300026023 | Unclassified | 511 |
| 574 | Ga0207703_10871918 | 3300026035 | Bacteria | 861 |
| 575 | Ga0207703_11988273 | 3300026035 | Unclassified | 558 |
| 576 | Ga0207703_12142430 | 3300026035 | Unclassified | 535 |
| 577 | Ga0207639_10429423 | 3300026041 | Unclassified | 1196 |
| 578 | Ga0207639_10442547 | 3300026041 | Bacteria | 1178 |
| 579 | Ga0207639_10793788 | 3300026041 | Bacteria | 882 |
| 580 | Ga0207678_10032272 | 3300026067 | Bacteria | 4564 |
| 581 | Ga0207678_10178345 | 3300026067 | Bacteria | 1814 |
| 582 | Ga0207708_10000220 | 3300026075 | Bacteria | 45476 |
| 583 | Ga0207708_10090006 | 3300026075 | Bacteria | 2365 |
| 584 | Ga0207708_10116032 | 3300026075 | Bacteria | 2083 |
| 585 | Ga0207708_10188318 | 3300026075 | Bacteria | 1641 |
| 586 | Ga0207708_10227671 | 3300026075 | Bacteria | 1496 |
| 587 | Ga0207708_10275407 | 3300026075 | Bacteria | 1362 |
| 588 | Ga0207708_10605894 | 3300026075 | Bacteria | 928 |
| 589 | Ga0207708_10706177 | 3300026075 | Unclassified | 862 |
| 590 | Ga0207702_10029306 | 3300026078 | Bacteria | 4580 |
| 591 | Ga0207702_10131900 | 3300026078 | Bacteria | 2249 |
| 592 | Ga0207702_10220724 | 3300026078 | Bacteria | 1766 |
| 593 | Ga0207702_10334416 | 3300026078 | Bacteria | 1445 |
| 594 | Ga0207702_10879049 | 3300026078 | Unclassified | 888 |
| 595 | Ga0207702_10980848 | 3300026078 | Bacteria | 838 |
| 596 | Ga0207702_11203621 | 3300026078 | Bacteria | 752 |
| 597 | Ga0207702_11408675 | 3300026078 | Bacteria | 691 |
| 598 | Ga0207702_11457569 | 3300026078 | Bacteria | 678 |
| 599 | Ga0207702_11694097 | 3300026078 | Bacteria | 625 |
| 600 | Ga0207648_10000545 | 3300026089 | Bacteria | 42051 |
| 601 | Ga0207648_10334459 | 3300026089 | Bacteria | 1363 |
| 602 | Ga0207648_10484497 | 3300026089 | Bacteria | 1130 |
| 603 | Ga0207676_10280659 | 3300026095 | Bacteria | 1512 |
| 604 | Ga0207674_10273446 | 3300026116 | Bacteria | 1637 |
| 605 | Ga0207674_10366513 | 3300026116 | Unclassified | 1393 |
| 606 | Ga0207674_10462852 | 3300026116 | Unclassified | 1226 |
| 607 | Ga0207675_100029531 | 3300026118 | Bacteria | 5107 |
| 608 | Ga0207675_100109659 | 3300026118 | Bacteria | 2604 |
| 609 | Ga0207675_100112142 | 3300026118 | Bacteria | 2573 |
| 610 | Ga0207675_100121420 | 3300026118 | Bacteria | 2472 |
| 611 | Ga0207683_10000840 | 3300026121 | Bacteria | 28142 |
| 612 | Ga0207683_10018831 | 3300026121 | Bacteria | 5889 |
| 613 | Ga0207683_10086794 | 3300026121 | Bacteria | 2782 |
| 614 | Ga0207683_10096847 | 3300026121 | Bacteria | 2631 |
| 615 | Ga0207683_10402224 | 3300026121 | Bacteria | 1260 |
| 616 | Ga0207683_10762992 | 3300026121 | Bacteria | 897 |
| 617 | Ga0207683_10967613 | 3300026121 | Bacteria | 790 |
| 618 | Ga0207683_11424917 | 3300026121 | Bacteria | 640 |
| 619 | Ga0207698_10494400 | 3300026142 | Bacteria | 1189 |
| 620 | Ga0207698_11881573 | 3300026142 | Bacteria | 613 |
| 621 | Ga0207698_11956030 | 3300026142 | Unclassified | 601 |
| 622 | Ga0207428_10002288 | 3300027907 | Bacteria | 19226 |
| 623 | Ga0207428_10032866 | 3300027907 | Bacteria | 4266 |
| 624 | Ga0207428_10294424 | 3300027907 | Bacteria | 1202 |
| 625 | Ga0268266_10892900 | 3300028379 | Bacteria | 859 |
| 626 | Ga0268266_11180483 | 3300028379 | Bacteria | 740 |
| 627 | Ga0268265_10317164 | 3300028380 | Bacteria | 1410 |
| 628 | Ga0268265_10544609 | 3300028380 | Bacteria | 1101 |
| 629 | Ga0268265_11139471 | 3300028380 | Bacteria | 776 |
| 630 | Ga0265326_10217189 | 3300028558 | Unclassified | 550 |
| 631 | Ga0265319_1110239 | 3300028563 | Bacteria | 861 |
| 632 | Ga0265334_10027192 | 3300028573 | Bacteria | 2305 |
| 633 | Ga0265318_10007047 | 3300028577 | Bacteria | 5119 |
| 634 | Ga0265318_10019410 | 3300028577 | Bacteria | 2758 |
| 635 | Ga0265336_10018015 | 3300028666 | Bacteria | 2292 |
| 636 | Ga0265338_10000694 | 3300028800 | Bacteria | 57889 |
| 637 | Ga0265338_10001204 | 3300028800 | Bacteria | 42742 |
| 638 | Ga0265338_10049322 | 3300028800 | Bacteria | 3818 |
| 639 | Ga0265338_10059884 | 3300028800 | Bacteria | 3351 |
| 640 | Ga0265338_10709775 | 3300028800 | Unclassified | 693 |
| 641 | Ga0265338_10783436 | 3300028800 | Unclassified | 654 |
| 642 | Ga0265324_10008517 | 3300029957 | Bacteria | 4071 |
| 643 | Ga0265324_10018043 | 3300029957 | Bacteria | 2560 |
| 644 | Ga0265332_10024308 | 3300031238 | Bacteria | 2666 |
| 645 | Ga0265328_10013125 | 3300031239 | Bacteria | 3285 |
| 646 | Ga0265320_10029680 | 3300031240 | Bacteria | 2827 |
| 647 | Ga0265340_10034079 | 3300031247 | Bacteria | 2532 |
| 648 | Ga0265331_10017437 | 3300031250 | Bacteria | 3743 |
| 649 | Ga0265327_10086232 | 3300031251 | Bacteria | 1540 |
| 650 | Ga0265327_10409159 | 3300031251 | Unclassified | 588 |
| 651 | Ga0307408_100029936 | 3300031548 | Bacteria | 3777 |
| 652 | Ga0307408_100668966 | 3300031548 | Unclassified | 930 |
| 653 | Ga0307408_101681439 | 3300031548 | Bacteria | 604 |
| 654 | Ga0265313_10010778 | 3300031595 | Bacteria | 5744 |
| 655 | Ga0265313_10024468 | 3300031595 | Bacteria | 3225 |
| 656 | Ga0265314_10041515 | 3300031711 | Bacteria | 3291 |
| 657 | Ga0265342_10171035 | 3300031712 | Bacteria | 1195 |
| 658 | Ga0265342_10261622 | 3300031712 | Unclassified | 920 |
| 659 | Ga0307405_10039331 | 3300031731 | Bacteria | 2857 |
| 660 | Ga0307413_11499456 | 3300031824 | Bacteria | 596 |
| 661 | Ga0307413_12015571 | 3300031824 | Bacteria | 520 |
| 662 | Ga0307410_10064640 | 3300031852 | Bacteria | 2514 |
| 663 | Ga0307410_10359551 | 3300031852 | Bacteria | 1166 |
| 664 | Ga0307410_11035735 | 3300031852 | Bacteria | 709 |
| 665 | Ga0307406_10030945 | 3300031901 | Bacteria | 3255 |
| 666 | Ga0307407_10257111 | 3300031903 | Bacteria | 1199 |
| 667 | Ga0307407_10887806 | 3300031903 | Unclassified | 683 |
| 668 | Ga0307412_10021995 | 3300031911 | Bacteria | 3903 |
| 669 | Ga0307409_100028809 | 3300031995 | Bacteria | 3963 |
| 670 | Ga0307409_100055880 | 3300031995 | Bacteria | 3050 |
| 671 | Ga0307409_100365844 | 3300031995 | Bacteria | 1366 |
| 672 | Ga0307416_100094815 | 3300032002 | Bacteria | 2575 |
| 673 | Ga0307416_100112976 | 3300032002 | Bacteria | 2399 |
| 674 | Ga0307416_100125156 | 3300032002 | Bacteria | 2301 |
| 675 | Ga0307416_100228502 | 3300032002 | Bacteria | 1792 |
| 676 | Ga0307416_100535991 | 3300032002 | Bacteria | 1241 |
| 677 | Ga0307416_101172455 | 3300032002 | Unclassified | 873 |
| 678 | Ga0307416_102810267 | 3300032002 | Bacteria | 582 |
| 679 | Ga0307414_10028606 | 3300032004 | Bacteria | 3617 |
| 680 | Ga0307411_10083882 | 3300032005 | Bacteria | 2202 |
| 681 | Ga0307415_100139093 | 3300032126 | Bacteria | 1851 |
| 682 | Ga0307415_100282494 | 3300032126 | Unclassified | 1366 |
| 683 | Ga0373926_0009690 | 3300035083 | Bacteria | 3218 |
| 684 | Ga0373926_0255246 | 3300035083 | Unclassified | 680 |
| 685 | Ga0373934_0248530 | 3300035086 | Bacteria | 735 |
| 686 | Ga0373934_0267494 | 3300035086 | Unclassified | 707 |
| 687 | Ga0373944_0041395 | 3300035089 | Bacteria | 1425 |
| 688 | Ga0373944_0182756 | 3300035089 | Unclassified | 753 |
| 689 | Ga0373936_0076556 | 3300035113 | Bacteria | 1387 |
| 690 | Ga0373956_0027659 | 3300035119 | Bacteria | 2464 |
| 691 | Ga0373960_0056255 | 3300035121 | Bacteria | 1181 |
| 692 | Ga0373960_0258521 | 3300035121 | Bacteria | 635 |
| 693 | Ga0373943_0014826 | 3300035170 | Bacteria | 3535 |
| 694 | Ga0373943_0486224 | 3300035170 | Unclassified | 720 |
| 695 | Ga0373943_0653711 | 3300035170 | Unclassified | 621 |
| 696 | Ga0373946_0007357 | 3300035171 | Bacteria | 4023 |
| 697 | Ga0373946_0780841 | 3300035171 | Bacteria | 502 |
| 698 | Ga0373955_0180923 | 3300035172 | Bacteria | 1251 |
| 699 | Ga0373955_0334506 | 3300035172 | Unclassified | 916 |
| 700 | Ga0373955_0697422 | 3300035172 | Bacteria | 623 |
| 701 | Ga0373955_0907878 | 3300035172 | Bacteria | 542 |
| 702 | Ga0373942_0010924 | 3300035207 | Bacteria | 2144 |
| 703 | Ga0373935_0023354 | 3300035692 | Bacteria | 3800 |
| 704 | Ga0373935_0679100 | 3300035692 | Unclassified | 757 |
| 705 | Ga0373927_0142313 | 3300035695 | Bacteria | 1569 |
| 706 | Ga0373933_0401933 | 3300035724 | Unclassified | 894 |
| 707 | Ga0373947_0002758 | 3300035725 | Bacteria | 10509 |
| 708 | Ga0373937_0001924 | 3300036401 | Bacteria | 17364 |
| 709 | Ga0373937_0242198 | 3300036401 | Bacteria | 1699 |
| 710 | Ga0373937_1272768 | 3300036401 | Bacteria | 684 |
| 711 | Ga0373925_0032896 | 3300037068 | Bacteria | 3819 |
| 712 | Ga0373925_0448368 | 3300037068 | Unclassified | 1056 |
| 713 | Ga0395899_0035126 | 3300037312 | Bacteria | 3764 |
| 714 | Ga0395899_0049001 | 3300037312 | Bacteria | 3141 |
| 715 | Ga0395899_0134473 | 3300037312 | Unclassified | 1763 |
| 716 | Ga0395899_0187604 | 3300037312 | Bacteria | 1448 |
| 717 | Ga0395899_0213599 | 3300037312 | Bacteria | 1339 |
| 718 | Ga0395899_0214515 | 3300037312 | Bacteria | 1336 |
| 719 | Ga0395899_0425322 | 3300037312 | Bacteria | 874 |
| 720 | Ga0395899_0430840 | 3300037312 | Bacteria | 867 |
| 721 | Ga0395899_0523131 | 3300037312 | Bacteria | 766 |
| 722 | Ga0395900_0004994 | 3300037418 | Bacteria | 13941 |
| 723 | Ga0395900_0031950 | 3300037418 | Bacteria | 5411 |
| 724 | Ga0395900_0038294 | 3300037418 | Bacteria | 4942 |
| 725 | Ga0395900_0060468 | 3300037418 | Bacteria | 3898 |
| 726 | Ga0395900_0092997 | 3300037418 | Bacteria | 3098 |
| 727 | Ga0395900_0100905 | 3300037418 | Bacteria | 2964 |
| 728 | Ga0395900_0116367 | 3300037418 | Bacteria | 2743 |
| 729 | Ga0395900_0148556 | 3300037418 | Bacteria | 2395 |
| 730 | Ga0395900_0195382 | 3300037418 | Bacteria | 2050 |
| 731 | Ga0395900_0211688 | 3300037418 | Bacteria | 1957 |
| 732 | Ga0395900_0325580 | 3300037418 | Bacteria | 1516 |
| 733 | Ga0395900_0953340 | 3300037418 | Bacteria | 779 |
| 734 | Ga0395900_1792272 | 3300037418 | Unclassified | 524 |
| 735 | Ga0395900_1802833 | 3300037418 | Unclassified | 522 |
| 736 | Ga0395898_0012588 | 3300037466 | Bacteria | 8747 |
| 737 | Ga0395898_0024798 | 3300037466 | Bacteria | 6046 |
| 738 | Ga0395898_0032449 | 3300037466 | Bacteria | 5213 |
| 739 | Ga0395898_0034625 | 3300037466 | Bacteria | 5030 |
| 740 | Ga0395898_0139653 | 3300037466 | Bacteria | 2319 |
| 741 | Ga0395898_0165325 | 3300037466 | Bacteria | 2116 |
| 742 | Ga0395898_0216495 | 3300037466 | Bacteria | 1827 |
| 743 | Ga0395898_0284132 | 3300037466 | Bacteria | 1578 |
| 744 | Ga0395898_0462134 | 3300037466 | Bacteria | 1208 |
| 745 | Ga0395898_0614924 | 3300037466 | Bacteria | 1029 |
| 746 | Ga0395898_0623380 | 3300037466 | Bacteria | 1021 |
| 747 | Ga0395898_0654143 | 3300037466 | Bacteria | 993 |
| 748 | Ga0395898_0682107 | 3300037466 | Bacteria | 970 |
| 749 | Ga0395898_0778388 | 3300037466 | Bacteria | 898 |
| 750 | Ga0395898_0805374 | 3300037466 | Bacteria | 879 |
| 751 | Ga0395898_0844186 | 3300037466 | Bacteria | 855 |
| 752 | Ga0395898_1070765 | 3300037466 | Bacteria | 740 |
| 753 | Ga0395898_1202504 | 3300037466 | Unclassified | 689 |
| 754 | Ga0395898_1831864 | 3300037466 | Bacteria | 528 |
| 755 | Ga0395905_0008722 | 3300037471 | Bacteria | 9980 |
| 756 | Ga0395905_0017235 | 3300037471 | Bacteria | 6860 |
| 757 | Ga0395905_0030278 | 3300037471 | Bacteria | 5101 |
| 758 | Ga0395905_0063015 | 3300037471 | Bacteria | 3468 |
| 759 | Ga0395905_0071047 | 3300037471 | Bacteria | 3263 |
| 760 | Ga0395905_0084338 | 3300037471 | Bacteria | 2977 |
| 761 | Ga0395905_0118945 | 3300037471 | Bacteria | 2483 |
| 762 | Ga0395905_0189279 | 3300037471 | Bacteria | 1931 |
| 763 | Ga0395905_0514574 | 3300037471 | Bacteria | 1097 |
| 764 | Ga0395905_0680921 | 3300037471 | Bacteria | 931 |
| 765 | Ga0395905_1475913 | 3300037471 | Bacteria | 584 |
| 766 | Ga0395905_1590751 | 3300037471 | Bacteria | 558 |
| 767 | Ga0395905_1702839 | 3300037471 | Unclassified | 536 |
| 768 | Ga0395901_0016005 | 3300038443 | Bacteria | 7641 |
| 769 | Ga0395901_0029057 | 3300038443 | Bacteria | 5687 |
| 770 | Ga0395901_0075749 | 3300038443 | Bacteria | 3510 |
| 771 | Ga0395901_0086731 | 3300038443 | Bacteria | 3273 |
| 772 | Ga0395901_0102391 | 3300038443 | Bacteria | 3005 |
| 773 | Ga0395901_0104092 | 3300038443 | Bacteria | 2978 |
| 774 | Ga0395901_0261676 | 3300038443 | Bacteria | 1800 |
| 775 | Ga0395901_0279775 | 3300038443 | Bacteria | 1733 |
| 776 | Ga0395901_0345867 | 3300038443 | Unclassified | 1535 |
| 777 | Ga0395901_0606860 | 3300038443 | Bacteria | 1103 |
| 778 | Ga0395901_0685961 | 3300038443 | Bacteria | 1023 |
| 779 | Ga0395901_0835623 | 3300038443 | Unclassified | 907 |
| 780 | Ga0395901_0976154 | 3300038443 | Bacteria | 824 |
| 781 | Ga0395901_1109951 | 3300038443 | Bacteria | 761 |
| 782 | Ga0395901_1247415 | 3300038443 | Bacteria | 707 |
| 783 | Ga0395901_1495514 | 3300038443 | Bacteria | 631 |
| 784 | Ga0395901_1569051 | 3300038443 | Bacteria | 612 |
| 785 | Ga0395901_2007554 | 3300038443 | Archaea | 524 |
| 786 | Ga0395901_2168877 | 3300038443 | Unclassified | 500 |
| 787 | Ga0436363_0757383 | 3300039450 | Unclassified | 532 |
| 788 | Ga0436363_1248060 | 3300039450 | Bacteria | 721 |
| 789 | Ga0451789_0750565 | 3300041443 | Bacteria | 636 |
| 790 | Ga0451802_0868154 | 3300041460 | Bacteria | 627 |
| 791 | Ga0451804_0324483 | 3300041463 | Bacteria | 517 |
| 792 | Ga0451804_0902934 | 3300041463 | Bacteria | 903 |
| 793 | Ga0451835_0374119 | 3300041492 | Bacteria | 769 |
| 794 | Ga0451845_0032046 | 3300041501 | Bacteria | 608 |
| 795 | Ga0451847_0084372 | 3300041503 | Bacteria | 584 |
| 796 | Ga0451855_0925867 | 3300041511 | Unclassified | 536 |
| 797 | Ga0451853_0059643 | 3300041512 | Unclassified | 533 |
| 798 | Ga0451853_0985969 | 3300041512 | Bacteria | 508 |
| 799 | Ga0451853_1637661 | 3300041512 | Unclassified | 790 |
| 800 | Ga0451853_1720198 | 3300041512 | Bacteria | 671 |
| 801 | Ga0451853_3171944 | 3300041512 | Bacteria | 1573 |
| 802 | Ga0439456_049348 | 3300042013 | Unclassified | 919 |
| 803 | Ga0450920_030727 | 3300042122 | Bacteria | 1057 |
| 804 | Ga0439446_0258381 | 3300042156 | Bacteria | 602 |
| 805 | Ga0439434_0176571 | 3300042435 | Bacteria | 714 |
| 806 | Ga0439434_0178556 | 3300042435 | Bacteria | 710 |
| 807 | Ga0439434_0262141 | 3300042435 | Unclassified | 592 |
| 808 | Ga0450918_079474 | 3300042531 | Bacteria | 624 |
| 809 | Ga0439440_0088759 | 3300042993 | Unclassified | 827 |
| 810 | Ga0466969_0001492 | 3300044656 | Bacteria | 12584 |
| 811 | Ga0466969_0197465 | 3300044656 | Bacteria | 918 |
| 812 | Ga0466965_0066542 | 3300044683 | Bacteria | 1807 |
| 813 | Ga0466965_0069148 | 3300044683 | Bacteria | 1774 |
| 814 | Ga0466965_0303375 | 3300044683 | Bacteria | 867 |
| 815 | Ga0466966_0034101 | 3300044684 | Bacteria | 3294 |
| 816 | Ga0466966_0035783 | 3300044684 | Bacteria | 3207 |
| 817 | Ga0466961_0157514 | 3300044693 | Bacteria | 1416 |
| 818 | Ga0466961_0175381 | 3300044693 | Bacteria | 1332 |
| 819 | Ga0466961_0522663 | 3300044693 | Unclassified | 716 |
| 820 | Ga0466963_0000204 | 3300044694 | Bacteria | 25113 |
| 821 | Ga0466963_0014209 | 3300044694 | Bacteria | 4905 |
| 822 | Ga0466963_0015277 | 3300044694 | Bacteria | 4751 |
| 823 | Ga0466963_0017563 | 3300044694 | Bacteria | 4461 |
| 824 | Ga0466963_0024185 | 3300044694 | Bacteria | 3867 |
| 825 | Ga0466963_0029249 | 3300044694 | Bacteria | 3544 |
| 826 | Ga0466963_0085823 | 3300044694 | Bacteria | 2137 |
| 827 | Ga0466963_0118259 | 3300044694 | Unclassified | 1822 |
| 828 | Ga0466963_0166629 | 3300044694 | Bacteria | 1535 |
| 829 | Ga0466963_0211390 | 3300044694 | Bacteria | 1357 |
| 830 | Ga0466963_0252886 | 3300044694 | Bacteria | 1236 |
| 831 | Ga0466963_0290816 | 3300044694 | Bacteria | 1149 |
| 832 | Ga0466963_0311487 | 3300044694 | Bacteria | 1107 |
| 833 | Ga0466963_0335191 | 3300044694 | Bacteria | 1065 |
| 834 | Ga0466963_0509571 | 3300044694 | Bacteria | 849 |
| 835 | Ga0466963_0701268 | 3300044694 | Unclassified | 714 |
| 836 | Ga0466964_0000525 | 3300044706 | Bacteria | 11988 |
| 837 | Ga0466964_0001491 | 3300044706 | Bacteria | 8023 |
| 838 | Ga0466964_0006802 | 3300044706 | Bacteria | 4265 |
| 839 | Ga0466964_0012256 | 3300044706 | Bacteria | 3244 |
| 840 | Ga0466964_0026419 | 3300044706 | Unclassified | 2272 |
| 841 | Ga0466964_0026447 | 3300044706 | Bacteria | 2271 |
| 842 | Ga0466964_0028706 | 3300044706 | Bacteria | 2193 |
| 843 | Ga0466964_0030702 | 3300044706 | Bacteria | 2127 |
| 844 | Ga0466964_0031117 | 3300044706 | Bacteria | 2115 |
| 845 | Ga0466964_0123137 | 3300044706 | Bacteria | 1171 |
| 846 | Ga0466964_0306500 | 3300044706 | Bacteria | 802 |
| 847 | Ga0466964_0544369 | 3300044706 | Bacteria | 629 |
| 848 | Ga0466971_0011514 | 3300044719 | Bacteria | 3872 |
| 849 | Ga0466971_0012606 | 3300044719 | Bacteria | 3709 |
| 850 | Ga0466971_0025691 | 3300044719 | Bacteria | 2630 |
| 851 | Ga0466971_0253676 | 3300044719 | Bacteria | 838 |
| 852 | Ga0466968_0000801 | 3300044735 | Bacteria | 10953 |
| 853 | Ga0466968_0007015 | 3300044735 | Bacteria | 4270 |
| 854 | Ga0466968_0009682 | 3300044735 | Bacteria | 3712 |
| 855 | Ga0466968_0059075 | 3300044735 | Bacteria | 1651 |
| 856 | Ga0466968_0422442 | 3300044735 | Bacteria | 656 |
| 857 | Ga0466968_0629478 | 3300044735 | Bacteria | 543 |
| 858 | Ga0466968_0719769 | 3300044735 | Bacteria | 510 |
| 859 | Ga0466970_0014287 | 3300044765 | Bacteria | 4073 |
| 860 | Ga0466970_0020882 | 3300044765 | Bacteria | 3407 |
| 861 | Ga0466957_0002091 | 3300044842 | Bacteria | 10684 |
| 862 | Ga0466957_0011348 | 3300044842 | Bacteria | 5137 |
| 863 | Ga0466957_0015552 | 3300044842 | Bacteria | 4444 |
| 864 | Ga0466957_0030857 | 3300044842 | Bacteria | 3201 |
| 865 | Ga0466957_0049689 | 3300044842 | Bacteria | 2550 |
| 866 | Ga0466957_0054829 | 3300044842 | Bacteria | 2434 |
| 867 | Ga0466957_0128359 | 3300044842 | Bacteria | 1622 |
| 868 | Ga0466957_0159111 | 3300044842 | Bacteria | 1466 |
| 869 | Ga0466957_0261769 | 3300044842 | Bacteria | 1153 |
| 870 | Ga0466957_0525814 | 3300044842 | Bacteria | 822 |
| 871 | Ga0466960_0015379 | 3300044901 | Bacteria | 3297 |
| 872 | Ga0466960_0041353 | 3300044901 | Bacteria | 2183 |
| 873 | Ga0466960_0057075 | 3300044901 | Bacteria | 1903 |
| 874 | Ga0466960_0165768 | 3300044901 | Bacteria | 1189 |
| 875 | Ga0466959_0003181 | 3300045049 | Bacteria | 10663 |
| 876 | Ga0466959_0027682 | 3300045049 | Bacteria | 4203 |
| 877 | Ga0466959_0452544 | 3300045049 | Unclassified | 870 |
| 878 | Ga0466959_0573187 | 3300045049 | Bacteria | 760 |
| 879 | Ga0451576_2149377 | 3300045051 | Bacteria | 574 |
| 880 | Ga0466958_0001352 | 3300045836 | Bacteria | 11583 |
| 881 | Ga0466958_0003644 | 3300045836 | Bacteria | 8034 |
| 882 | Ga0466958_0005628 | 3300045836 | Bacteria | 6761 |
| 883 | Ga0466958_0018296 | 3300045836 | Bacteria | 4064 |
| 884 | Ga0466958_0026737 | 3300045836 | Bacteria | 3411 |
| 885 | Ga0466958_0045957 | 3300045836 | Bacteria | 2634 |
| 886 | Ga0466958_0094073 | 3300045836 | Bacteria | 1856 |
| 887 | Ga0466958_0353449 | 3300045836 | Bacteria | 946 |
| 888 | Ga0466958_0566881 | 3300045836 | Bacteria | 738 |
| 889 | Ga0466958_0589093 | 3300045836 | Bacteria | 723 |
| 890 | Ga0466967_0000181 | 3300045976 | Bacteria | 26132 |
| 891 | Ga0466967_0009861 | 3300045976 | Bacteria | 7122 |
| 892 | Ga0466967_0022326 | 3300045976 | Bacteria | 5160 |
| 893 | Ga0466967_0026084 | 3300045976 | Bacteria | 4833 |
| 894 | Ga0466967_0027383 | 3300045976 | Bacteria | 4740 |
| 895 | Ga0466967_0031772 | 3300045976 | Bacteria | 4450 |
| 896 | Ga0466967_0044789 | 3300045976 | Bacteria | 3840 |
| 897 | Ga0466967_0059019 | 3300045976 | Bacteria | 3394 |
| 898 | Ga0466967_0069914 | 3300045976 | Bacteria | 3139 |
| 899 | Ga0466967_0079690 | 3300045976 | Bacteria | 2953 |
| 900 | Ga0466967_0091803 | 3300045976 | Bacteria | 2760 |
| 901 | Ga0466967_0110293 | 3300045976 | Bacteria | 2527 |
| 902 | Ga0466967_0141593 | 3300045976 | Bacteria | 2240 |
| 903 | Ga0466967_0236930 | 3300045976 | Bacteria | 1739 |
| 904 | Ga0466967_0244046 | 3300045976 | Bacteria | 1714 |
| 905 | Ga0466967_0257230 | 3300045976 | Bacteria | 1669 |
| 906 | Ga0466967_0258307 | 3300045976 | Bacteria | 1666 |
| 907 | Ga0466967_0293497 | 3300045976 | Bacteria | 1562 |
| 908 | Ga0466967_0344126 | 3300045976 | Bacteria | 1442 |
| 909 | Ga0466967_0352592 | 3300045976 | Bacteria | 1424 |
| 910 | Ga0466967_0364046 | 3300045976 | Bacteria | 1401 |
| 911 | Ga0466967_0402183 | 3300045976 | Bacteria | 1332 |
| 912 | Ga0466967_0429179 | 3300045976 | Bacteria | 1289 |
| 913 | Ga0466967_0445843 | 3300045976 | Bacteria | 1264 |
| 914 | Ga0466967_0845191 | 3300045976 | Bacteria | 909 |
| 915 | Ga0466967_1258448 | 3300045976 | Bacteria | 737 |
| 916 | Ga0495592_0000855 | 3300046454 | Bacteria | 21070 |
| 917 | Ga0495592_0019518 | 3300046454 | Bacteria | 5156 |
| 918 | Ga0495592_0166496 | 3300046454 | Bacteria | 1512 |
| 919 | Ga0495592_0889016 | 3300046454 | Unclassified | 524 |
| 920 | Ga0495603_0043959 | 3300046455 | Bacteria | 2666 |
| 921 | Ga0495603_0120107 | 3300046455 | Bacteria | 1532 |
| 922 | Ga0495603_0284048 | 3300046455 | Unclassified | 951 |
| 923 | Ga0495603_0841435 | 3300046455 | Unclassified | 522 |
| 924 | Ga0495629_0012606 | 3300046459 | Bacteria | 6122 |
| 925 | Ga0495629_0674220 | 3300046459 | Bacteria | 688 |
| 926 | Ga0495641_0004595 | 3300046461 | Bacteria | 9664 |
| 927 | Ga0495641_0053815 | 3300046461 | Bacteria | 1830 |
| 928 | Ga0495641_0064101 | 3300046461 | Bacteria | 1655 |
| 929 | Ga0495641_0202339 | 3300046461 | Bacteria | 890 |
| 930 | Ga0495641_0606957 | 3300046461 | Bacteria | 500 |
| 931 | Ga0495651_0000212 | 3300046462 | Bacteria | 44502 |
| 932 | Ga0495651_0020811 | 3300046462 | Bacteria | 5092 |
| 933 | Ga0495651_0141278 | 3300046462 | Bacteria | 1746 |
| 934 | Ga0495651_0176284 | 3300046462 | Bacteria | 1517 |
| 935 | Ga0495651_0723137 | 3300046462 | Bacteria | 619 |
| 936 | Ga0495653_0001446 | 3300046463 | Bacteria | 18517 |
| 937 | Ga0495653_0018289 | 3300046463 | Bacteria | 5695 |
| 938 | Ga0495653_0036085 | 3300046463 | Bacteria | 3897 |
| 939 | Ga0495653_0203660 | 3300046463 | Bacteria | 1341 |
| 940 | Ga0495653_0316241 | 3300046463 | Bacteria | 1013 |
| 941 | Ga0495653_0806554 | 3300046463 | Bacteria | 564 |
| 942 | Ga0495653_0887915 | 3300046463 | Unclassified | 532 |
| 943 | Ga0495580_0009316 | 3300046472 | Bacteria | 7727 |
| 944 | Ga0495580_0431534 | 3300046472 | Bacteria | 886 |
| 945 | Ga0495582_0002767 | 3300046473 | Bacteria | 9783 |
| 946 | Ga0495582_0040748 | 3300046473 | Bacteria | 2558 |
| 947 | Ga0495582_0065365 | 3300046473 | Bacteria | 2009 |
| 948 | Ga0495582_0144955 | 3300046473 | Bacteria | 1347 |
| 949 | Ga0495582_0526489 | 3300046473 | Bacteria | 683 |
| 950 | Ga0495605_0023411 | 3300046474 | Bacteria | 3249 |
| 951 | Ga0495662_0015241 | 3300046476 | Bacteria | 3734 |
| 952 | Ga0495662_0350949 | 3300046476 | Bacteria | 725 |
| 953 | Ga0495664_0015079 | 3300046477 | Bacteria | 4390 |
| 954 | Ga0495664_0071234 | 3300046477 | Bacteria | 2076 |
| 955 | Ga0495664_0285336 | 3300046477 | Bacteria | 997 |
| 956 | Ga0495664_0806816 | 3300046477 | Bacteria | 551 |
| 957 | Ga0495584_0017106 | 3300046491 | Bacteria | 3697 |
| 958 | Ga0495584_0032208 | 3300046491 | Bacteria | 2654 |
| 959 | Ga0495584_0372359 | 3300046491 | Bacteria | 725 |
| 960 | Ga0495584_0541669 | 3300046491 | Unclassified | 593 |
| 961 | Ga0495585_0045267 | 3300046492 | Bacteria | 2457 |
| 962 | Ga0495585_0156981 | 3300046492 | Bacteria | 1183 |
| 963 | Ga0495594_0555887 | 3300046499 | Bacteria | 651 |
| 964 | Ga0495596_0263583 | 3300046500 | Bacteria | 669 |
| 965 | Ga0495607_0052632 | 3300046501 | Bacteria | 2357 |
| 966 | Ga0495608_0060308 | 3300046511 | Bacteria | 2496 |
| 967 | Ga0495608_0090046 | 3300046511 | Bacteria | 1985 |
| 968 | Ga0495608_0121447 | 3300046511 | Bacteria | 1675 |
| 969 | Ga0495618_0002172 | 3300046514 | Bacteria | 12829 |
| 970 | Ga0495618_0026233 | 3300046514 | Bacteria | 3621 |
| 971 | Ga0495618_0119567 | 3300046514 | Bacteria | 1687 |
| 972 | Ga0495618_0734055 | 3300046514 | Bacteria | 579 |
| 973 | Ga0495628_0007369 | 3300046516 | Bacteria | 9522 |
| 974 | Ga0495628_0009418 | 3300046516 | Bacteria | 8336 |
| 975 | Ga0495628_0308092 | 3300046516 | Bacteria | 1171 |
| 976 | Ga0495628_0388628 | 3300046516 | Bacteria | 1021 |
| 977 | Ga0495630_0029839 | 3300046517 | Bacteria | 4054 |
| 978 | Ga0495630_0170267 | 3300046517 | Bacteria | 1659 |
| 979 | Ga0495630_0927101 | 3300046517 | Bacteria | 663 |
| 980 | Ga0495631_0080982 | 3300046518 | Bacteria | 1401 |
| 981 | Ga0495631_0277414 | 3300046518 | Bacteria | 714 |
| 982 | Ga0495631_0311193 | 3300046518 | Unclassified | 670 |
| 983 | Ga0495631_0315750 | 3300046518 | Bacteria | 665 |
| 984 | Ga0495632_0480601 | 3300046519 | Unclassified | 537 |
| 985 | Ga0495637_0131085 | 3300046520 | Bacteria | 957 |
| 986 | Ga0495637_0139995 | 3300046520 | Bacteria | 919 |
| 987 | Ga0495637_0188131 | 3300046520 | Unclassified | 763 |
| 988 | Ga0495644_0026161 | 3300046523 | Bacteria | 2215 |
| 989 | Ga0495644_0051978 | 3300046523 | Bacteria | 1538 |
| 990 | Ga0495663_0039660 | 3300046525 | Bacteria | 1427 |
| 991 | Ga0495663_0109571 | 3300046525 | Bacteria | 916 |
| 992 | Ga0495666_0001893 | 3300046526 | Bacteria | 10331 |
| 993 | Ga0495666_0303552 | 3300046526 | Bacteria | 722 |
| 994 | Ga0495642_0034245 | 3300046528 | Bacteria | 2045 |
| 995 | Ga0495642_0119157 | 3300046528 | Bacteria | 1132 |
| 996 | Ga0495652_0003999 | 3300046529 | Bacteria | 14269 |
| 997 | Ga0495652_0021274 | 3300046529 | Bacteria | 5767 |
| 998 | Ga0495652_0175255 | 3300046529 | Bacteria | 1651 |
| 999 | Ga0495652_0413911 | 3300046529 | Bacteria | 951 |
| 1000 | Ga0495665_0005635 | 3300046531 | Bacteria | 6752 |
| 1001 | Ga0495665_0060705 | 3300046531 | Bacteria | 1996 |
| 1002 | Ga0495640_0268452 | 3300046533 | Bacteria | 1064 |
| 1003 | Ga0495640_0697446 | 3300046533 | Unclassified | 609 |
| 1004 | Ga0495586_0003441 | 3300046535 | Bacteria | 8483 |
| 1005 | Ga0495586_0174613 | 3300046535 | Bacteria | 1214 |
| 1006 | Ga0495586_0669445 | 3300046535 | Bacteria | 599 |
| 1007 | Ga0495587_0000222 | 3300046536 | Bacteria | 42224 |
| 1008 | Ga0495587_0099147 | 3300046536 | Bacteria | 1679 |
| 1009 | Ga0495598_0242878 | 3300046537 | Bacteria | 664 |
| 1010 | Ga0495609_0054736 | 3300046538 | Bacteria | 1771 |
| 1011 | Ga0495609_0217645 | 3300046538 | Unclassified | 794 |
| 1012 | Ga0495609_0285816 | 3300046538 | Unclassified | 674 |
| 1013 | Ga0495645_0000046 | 3300046543 | Bacteria | 89390 |
| 1014 | Ga0495645_0095030 | 3300046543 | Bacteria | 2125 |
| 1015 | Ga0495645_0106024 | 3300046543 | Bacteria | 1993 |
| 1016 | Ga0495645_0700834 | 3300046543 | Bacteria | 615 |
| 1017 | Ga0495622_0378658 | 3300046557 | Unclassified | 611 |
| 1018 | Ga0495667_0028470 | 3300046559 | Bacteria | 3762 |
| 1019 | Ga0495667_0078025 | 3300046559 | Bacteria | 2153 |
| 1020 | Ga0495667_0384299 | 3300046559 | Bacteria | 885 |
| 1021 | Ga0495667_0390873 | 3300046559 | Bacteria | 876 |
| 1022 | Ga0495667_0545631 | 3300046559 | Bacteria | 724 |
| 1023 | Ga0495656_0012605 | 3300046615 | Bacteria | 3125 |
| 1024 | Ga0495656_0045250 | 3300046615 | Bacteria | 1857 |
| 1025 | Ga0495656_0507572 | 3300046615 | Unclassified | 640 |
| 1026 | Ga0495656_0615010 | 3300046615 | Bacteria | 582 |
| 1027 | Ga0495634_0122156 | 3300046642 | Bacteria | 1667 |
| 1028 | Ga0495634_0390201 | 3300046642 | Bacteria | 828 |
| 1029 | Ga0495634_0624083 | 3300046642 | Bacteria | 624 |
| 1030 | Ga0495611_0147802 | 3300046648 | Bacteria | 1097 |
| 1031 | Ga0495611_0169759 | 3300046648 | Bacteria | 1020 |
| 1032 | Ga0495611_0216880 | 3300046648 | Unclassified | 891 |
| 1033 | Ga0495611_0303564 | 3300046648 | Unclassified | 736 |
| 1034 | Ga0495611_0394721 | 3300046648 | Unclassified | 633 |
| 1035 | Ga0495635_0022233 | 3300046663 | Bacteria | 4416 |
| 1036 | Ga0495635_0083552 | 3300046663 | Bacteria | 2185 |
| 1037 | Ga0495635_0347709 | 3300046663 | Bacteria | 989 |
| 1038 | Ga0495635_0379613 | 3300046663 | Bacteria | 940 |
| 1039 | Ga0495659_0037005 | 3300046664 | Bacteria | 1727 |
| 1040 | Ga0495659_0230790 | 3300046664 | Unclassified | 767 |
| 1041 | Ga0495661_0221249 | 3300046665 | Bacteria | 981 |
| 1042 | Ga0495661_0560457 | 3300046665 | Bacteria | 540 |
| 1043 | Ga0495588_0294629 | 3300046674 | Bacteria | 854 |
| 1044 | Ga0495588_0549730 | 3300046674 | Unclassified | 605 |
| 1045 | Ga0495657_0024246 | 3300046675 | Bacteria | 4324 |
| 1046 | Ga0495657_0041434 | 3300046675 | Bacteria | 3151 |
| 1047 | Ga0495657_0048953 | 3300046675 | Bacteria | 2849 |
| 1048 | Ga0495657_0110267 | 3300046675 | Bacteria | 1744 |
| 1049 | Ga0495657_0212395 | 3300046675 | Bacteria | 1176 |
| 1050 | Ga0495657_0529325 | 3300046675 | Unclassified | 686 |
| 1051 | Ga0495657_0695244 | 3300046675 | Archaea | 585 |
| 1052 | Ga0495599_0000639 | 3300046678 | Bacteria | 19790 |
| 1053 | Ga0495599_0115213 | 3300046678 | Bacteria | 1672 |
| 1054 | Ga0495599_0183936 | 3300046678 | Bacteria | 1287 |
| 1055 | Ga0495599_0384988 | 3300046678 | Bacteria | 837 |
| 1056 | Ga0495599_0390522 | 3300046678 | Bacteria | 830 |
| 1057 | Ga0495623_0000251 | 3300046679 | Bacteria | 34583 |
| 1058 | Ga0495623_0338667 | 3300046679 | Bacteria | 822 |
| 1059 | Ga0495646_0000422 | 3300046680 | Bacteria | 22381 |
| 1060 | Ga0495646_0015120 | 3300046680 | Bacteria | 4903 |
| 1061 | Ga0495646_0102796 | 3300046680 | Bacteria | 1636 |
| 1062 | Ga0495647_0000834 | 3300046681 | Bacteria | 9215 |
| 1063 | Ga0495647_0045139 | 3300046681 | Bacteria | 1692 |
| 1064 | Ga0495647_0234429 | 3300046681 | Unclassified | 813 |
| 1065 | Ga0495658_0102412 | 3300046683 | Bacteria | 1711 |
| 1066 | Ga0495658_0115358 | 3300046683 | Bacteria | 1619 |
| 1067 | Ga0495658_0942690 | 3300046683 | Archaea | 552 |
| 1068 | Ga0495613_0013430 | 3300046689 | Bacteria | 6083 |
| 1069 | Ga0495613_0098739 | 3300046689 | Bacteria | 2110 |
| 1070 | Ga0495613_0403375 | 3300046689 | Bacteria | 932 |
| 1071 | Ga0495613_0820291 | 3300046689 | Unclassified | 606 |
| 1072 | Ga0495624_0008296 | 3300046690 | Bacteria | 7261 |
| 1073 | Ga0495624_0163365 | 3300046690 | Bacteria | 1360 |
| 1074 | Ga0495624_0628742 | 3300046690 | Bacteria | 639 |
| 1075 | Ga0495670_0139049 | 3300046691 | Bacteria | 1269 |
| 1076 | Ga0495670_0264854 | 3300046691 | Unclassified | 918 |
| 1077 | Ga0495671_0174386 | 3300046692 | Bacteria | 1045 |
| 1078 | Ga0495671_0354862 | 3300046692 | Unclassified | 703 |
| 1079 | Ga0495671_0493397 | 3300046692 | Bacteria | 584 |
| 1080 | Ga0495589_0119319 | 3300046794 | Bacteria | 1271 |
| 1081 | Ga0495589_0158296 | 3300046794 | Bacteria | 1079 |
| 1082 | Ga0495600_0024213 | 3300046809 | Bacteria | 3907 |
| 1083 | Ga0495600_0189657 | 3300046809 | Bacteria | 1322 |
| 1084 | Ga0495600_0543855 | 3300046809 | Bacteria | 710 |
| 1085 | Ga0495660_0296903 | 3300046810 | Unclassified | 734 |
| 1086 | Ga0495581_0002332 | 3300047315 | Bacteria | 10698 |
| 1087 | Ga0495581_0009997 | 3300047315 | Bacteria | 5486 |
| 1088 | Ga0495581_0037945 | 3300047315 | Bacteria | 2788 |
| 1089 | Ga0495581_0106297 | 3300047315 | Bacteria | 1631 |
| 1090 | Ga0495604_0000060 | 3300047317 | Bacteria | 95444 |
| 1091 | Ga0495604_0114920 | 3300047317 | Bacteria | 1957 |
| 1092 | Ga0495636_0210153 | 3300047318 | Bacteria | 891 |
| 1093 | Ga0495636_0219862 | 3300047318 | Unclassified | 872 |
| 1094 | Ga0495636_0259134 | 3300047318 | Bacteria | 806 |
| 1095 | Ga0495674_0018747 | 3300047319 | Bacteria | 6440 |
| 1096 | Ga0495674_0069586 | 3300047319 | Bacteria | 3043 |
| 1097 | Ga0495674_0099406 | 3300047319 | Bacteria | 2477 |
| 1098 | Ga0495674_0451212 | 3300047319 | Bacteria | 1033 |
| 1099 | Ga0495674_0451557 | 3300047319 | Bacteria | 1033 |
| 1100 | Ga0495674_0721913 | 3300047319 | Bacteria | 780 |
| 1101 | Ga0495676_0162697 | 3300047321 | Bacteria | 1577 |
| 1102 | Ga0495676_0327785 | 3300047321 | Bacteria | 1027 |
| 1103 | Ga0495676_0533090 | 3300047321 | Bacteria | 768 |
| 1104 | Ga0495676_1052380 | 3300047321 | Unclassified | 518 |
| 1105 | Ga0495680_0008960 | 3300047322 | Bacteria | 9042 |
| 1106 | Ga0495680_0146339 | 3300047322 | Bacteria | 1725 |
| 1107 | Ga0495680_0307237 | 3300047322 | Bacteria | 1112 |
| 1108 | Ga0495680_0615690 | 3300047322 | Bacteria | 725 |
| 1109 | Ga0495680_1044839 | 3300047322 | Bacteria | 519 |
| 1110 | Ga0495675_0000945 | 3300047444 | Bacteria | 17618 |
| 1111 | Ga0495675_0186877 | 3300047444 | Bacteria | 1266 |
| 1112 | Ga0495677_0097533 | 3300047445 | Unclassified | 1111 |
| 1113 | Ga0495677_0177237 | 3300047445 | Bacteria | 826 |
| 1114 | Ga0495677_0243447 | 3300047445 | Bacteria | 703 |
| 1115 | Ga0495685_049568 | 3300047447 | Bacteria | 1426 |
| 1116 | Ga0495684_0021330 | 3300047471 | Bacteria | 4987 |
| 1117 | Ga0495684_0112846 | 3300047471 | Bacteria | 2049 |
| 1118 | Ga0495684_0157972 | 3300047471 | Bacteria | 1693 |
| 1119 | Ga0495684_0186308 | 3300047471 | Bacteria | 1536 |
| 1120 | Ga0495684_0473075 | 3300047471 | Unclassified | 867 |
| 1121 | Ga0495684_0614504 | 3300047471 | Bacteria | 732 |
| 1122 | Ga0495593_0020568 | 3300047673 | Bacteria | 3695 |
| 1123 | Ga0495602_0000075 | 3300048088 | Bacteria | 95851 |
| 1124 | Ga0495602_0154588 | 3300048088 | Bacteria | 1798 |
| 1125 | Ga0495602_0192851 | 3300048088 | Bacteria | 1560 |
| 1126 | Ga0495602_0404607 | 3300048088 | Unclassified | 973 |
| 1127 | Ga0495602_1165545 | 3300048088 | Unclassified | 503 |
| 1128 | Ga0495614_0002887 | 3300048089 | Bacteria | 7650 |
| 1129 | Ga0495614_0263898 | 3300048089 | Bacteria | 790 |
| 1130 | Ga0495615_0071890 | 3300048090 | Bacteria | 934 |
| 1131 | Ga0495615_0112308 | 3300048090 | Bacteria | 781 |
| 1132 | Ga0496100_0102279 | 3300048903 | Bacteria | 1977 |
| 1133 | Ga0496100_0185088 | 3300048903 | Unclassified | 1508 |
| 1134 | Ga0496100_0957761 | 3300048903 | Bacteria | 673 |
| 1135 | Ga0496101_0089534 | 3300048904 | Bacteria | 2287 |
| 1136 | Ga0496101_0229499 | 3300048904 | Bacteria | 1442 |
| 1137 | Ga0496101_0443865 | 3300048904 | Bacteria | 1024 |
| 1138 | Ga0496101_0512107 | 3300048904 | Bacteria | 948 |
| 1139 | Ga0496101_0718085 | 3300048904 | Bacteria | 789 |
| 1140 | Ga0496101_1372174 | 3300048904 | Bacteria | 552 |
| 1141 | Ga0496101_1591152 | 3300048904 | Bacteria | 508 |
| 1142 | Ga0496102_0028607 | 3300048905 | Bacteria | 4979 |
| 1143 | Ga0496102_0258175 | 3300048905 | Bacteria | 1643 |
| 1144 | Ga0496102_0539834 | 3300048905 | Bacteria | 1089 |
| 1145 | Ga0496102_0550000 | 3300048905 | Bacteria | 1077 |
| 1146 | Ga0496102_0589406 | 3300048905 | Unclassified | 1035 |
| 1147 | Ga0496103_0247088 | 3300048906 | Bacteria | 1148 |
| 1148 | Ga0496103_0665987 | 3300048906 | Bacteria | 661 |
| 1149 | Ga0496104_0004956 | 3300048907 | Bacteria | 11619 |
| 1150 | Ga0496104_0555769 | 3300048907 | Unclassified | 1058 |
| 1151 | Ga0496104_0762598 | 3300048907 | Bacteria | 874 |
| 1152 | Ga0496104_0896662 | 3300048907 | Unclassified | 792 |
| 1153 | Ga0496105_0102049 | 3300048908 | Bacteria | 2369 |
| 1154 | Ga0496105_0112441 | 3300048908 | Bacteria | 2247 |
| 1155 | Ga0496105_1018211 | 3300048908 | Bacteria | 619 |
| 1156 | Ga0496106_0723615 | 3300048909 | Archaea | 792 |
| 1157 | Ga0496107_0010503 | 3300048910 | Bacteria | 6434 |
| 1158 | Ga0496107_0184911 | 3300048910 | Bacteria | 1548 |
| 1159 | Ga0496107_0778797 | 3300048910 | Bacteria | 701 |
| 1160 | Ga0496107_0863376 | 3300048910 | Bacteria | 661 |
| 1161 | Ga0496107_1185857 | 3300048910 | Unclassified | 549 |
| 1162 | Ga0496108_0010095 | 3300048911 | Bacteria | 7662 |
| 1163 | Ga0496108_0088154 | 3300048911 | Bacteria | 2636 |
| 1164 | Ga0496108_0133480 | 3300048911 | Bacteria | 2134 |
| 1165 | Ga0496108_0159613 | 3300048911 | Bacteria | 1948 |
| 1166 | Ga0496108_0333171 | 3300048911 | Bacteria | 1324 |
| 1167 | Ga0496108_1430922 | 3300048911 | Bacteria | 577 |
| 1168 | Ga0496109_0007693 | 3300048912 | Bacteria | 9132 |
| 1169 | Ga0496109_0117632 | 3300048912 | Bacteria | 2474 |
| 1170 | Ga0496109_0205153 | 3300048912 | Bacteria | 1853 |
| 1171 | Ga0496109_0370744 | 3300048912 | Bacteria | 1352 |
| 1172 | Ga0496109_1018014 | 3300048912 | Unclassified | 766 |
| 1173 | Ga0496110_0102414 | 3300048913 | Bacteria | 2568 |
| 1174 | Ga0496110_0140288 | 3300048913 | Bacteria | 2185 |
| 1175 | Ga0496110_0235387 | 3300048913 | Bacteria | 1666 |
| 1176 | Ga0496110_0278944 | 3300048913 | Bacteria | 1522 |
| 1177 | Ga0496110_0431264 | 3300048913 | Bacteria | 1201 |
| 1178 | Ga0496111_0017701 | 3300048914 | Bacteria | 4928 |
| 1179 | Ga0496111_0053276 | 3300048914 | Bacteria | 2923 |
| 1180 | Ga0496111_0125478 | 3300048914 | Bacteria | 1897 |
| 1181 | Ga0496111_0215581 | 3300048914 | Bacteria | 1426 |
| 1182 | Ga0496111_0357568 | 3300048914 | Bacteria | 1081 |
| 1183 | Ga0496111_1171519 | 3300048914 | Bacteria | 546 |
| 1184 | Ga0496112_0000923 | 3300048915 | Bacteria | 21243 |
| 1185 | Ga0496112_0021521 | 3300048915 | Bacteria | 6134 |
| 1186 | Ga0496112_0869388 | 3300048915 | Bacteria | 824 |
| 1187 | Ga0496112_1911966 | 3300048915 | Unclassified | 505 |
| 1188 | Ga0496113_0002105 | 3300048916 | Bacteria | 11473 |
| 1189 | Ga0496113_0044117 | 3300048916 | Bacteria | 3302 |
| 1190 | Ga0496113_0284113 | 3300048916 | Bacteria | 1323 |
| 1191 | Ga0496113_0443233 | 3300048916 | Unclassified | 1043 |
| 1192 | Ga0496113_0469181 | 3300048916 | Bacteria | 1011 |
| 1193 | Ga0496114_0024644 | 3300048917 | Bacteria | 4911 |
| 1194 | Ga0496114_0037533 | 3300048917 | Bacteria | 4007 |
| 1195 | Ga0496114_1327037 | 3300048917 | Bacteria | 606 |
| 1196 | Ga0496115_0016488 | 3300048918 | Bacteria | 5627 |
| 1197 | Ga0496115_0068132 | 3300048918 | Unclassified | 2880 |
| 1198 | Ga0496115_0518945 | 3300048918 | Bacteria | 955 |
| 1199 | Ga0501031_0001012 | 3300049568 | Bacteria | 17044 |
| 1200 | Ga0501031_0937198 | 3300049568 | Bacteria | 554 |
| 1201 | Ga0501032_0025165 | 3300049569 | Bacteria | 4104 |
| 1202 | Ga0501032_0909172 | 3300049569 | Bacteria | 554 |
| 1203 | Ga0501033_0008261 | 3300049570 | Bacteria | 8061 |
| 1204 | Ga0501033_1038555 | 3300049570 | Bacteria | 547 |
| 1205 | Ga0501034_0009842 | 3300049571 | Bacteria | 9996 |
| 1206 | Ga0501036_0271251 | 3300049572 | Bacteria | 1420 |
| 1207 | Ga0501037_0012138 | 3300049573 | Bacteria | 6343 |
| 1208 | Ga0501038_0024708 | 3300049574 | Bacteria | 5357 |
| 1209 | Ga0501038_0650641 | 3300049574 | Unclassified | 793 |
| 1210 | Ga0501039_0041164 | 3300049575 | Bacteria | 3567 |
| 1211 | Ga0501039_0849484 | 3300049575 | Bacteria | 711 |
| 1212 | Ga0501040_0045509 | 3300049576 | Bacteria | 2993 |
| 1213 | Ga0501040_0305629 | 3300049576 | Bacteria | 1137 |
| 1214 | Ga0501040_0938449 | 3300049576 | Unclassified | 627 |
| 1215 | Ga0501041_0028936 | 3300049577 | Bacteria | 3343 |
| 1216 | Ga0501042_0132929 | 3300049578 | Bacteria | 1793 |
| 1217 | Ga0501042_1268652 | 3300049578 | Bacteria | 537 |
| 1218 | Ga0501046_1239182 | 3300049580 | Bacteria | 511 |
| 1219 | Ga0501047_0049836 | 3300049581 | Bacteria | 4043 |
| 1220 | Ga0501047_0296434 | 3300049581 | Bacteria | 1460 |
| 1221 | Ga0501047_0594998 | 3300049581 | Bacteria | 928 |
| 1222 | Ga0501048_0365509 | 3300049582 | Bacteria | 1029 |
| 1223 | Ga0501048_0762751 | 3300049582 | Unclassified | 695 |
| 1224 | Ga0501067_0157682 | 3300049583 | Bacteria | 1264 |
| 1225 | Ga0501067_0470692 | 3300049583 | Bacteria | 702 |
| 1226 | Ga0501067_0693793 | 3300049583 | Bacteria | 572 |
| 1227 | Ga0501067_0714745 | 3300049583 | Unclassified | 563 |
| 1228 | Ga0501068_0033680 | 3300049584 | Bacteria | 3051 |
| 1229 | Ga0501069_0003683 | 3300049585 | Bacteria | 7886 |
| 1230 | Ga0501069_0006399 | 3300049585 | Bacteria | 6161 |
| 1231 | Ga0501069_0433818 | 3300049585 | Bacteria | 780 |
| 1232 | Ga0501070_0008092 | 3300049586 | Bacteria | 8899 |
| 1233 | Ga0501070_0009660 | 3300049586 | Bacteria | 8156 |
| 1234 | Ga0501070_0023376 | 3300049586 | Bacteria | 5178 |
| 1235 | Ga0501070_1282437 | 3300049586 | Unclassified | 560 |
| 1236 | Ga0501071_0115574 | 3300049587 | Bacteria | 1985 |
| 1237 | Ga0501071_0521338 | 3300049587 | Unclassified | 912 |
| 1238 | Ga0501071_0712498 | 3300049587 | Bacteria | 773 |
| 1239 | Ga0501072_0019588 | 3300049588 | Bacteria | 5232 |
| 1240 | Ga0501072_0086998 | 3300049588 | Bacteria | 2480 |
| 1241 | Ga0501072_0304032 | 3300049588 | Bacteria | 1268 |
| 1242 | Ga0501072_0310286 | 3300049588 | Bacteria | 1254 |
| 1243 | Ga0501072_0685305 | 3300049588 | Bacteria | 806 |
| 1244 | Ga0501072_1520489 | 3300049588 | Bacteria | 516 |
| 1245 | Ga0501073_0021497 | 3300049589 | Bacteria | 4652 |
| 1246 | Ga0501073_0080734 | 3300049589 | Bacteria | 2262 |
| 1247 | Ga0501073_0133816 | 3300049589 | Bacteria | 1718 |
| 1248 | Ga0501074_0027051 | 3300049590 | Bacteria | 4156 |
| 1249 | Ga0501074_0044167 | 3300049590 | Bacteria | 3226 |
| 1250 | Ga0501074_0203330 | 3300049590 | Bacteria | 1411 |
| 1251 | Ga0501074_0458335 | 3300049590 | Bacteria | 904 |
| 1252 | Ga0501075_0029501 | 3300049591 | Bacteria | 4057 |
| 1253 | Ga0501075_0714169 | 3300049591 | Bacteria | 763 |
| 1254 | Ga0501076_0266662 | 3300049592 | Bacteria | 1402 |
| 1255 | Ga0501076_0295043 | 3300049592 | Bacteria | 1328 |
| 1256 | Ga0501076_0441948 | 3300049592 | Bacteria | 1071 |
| 1257 | Ga0501077_0020612 | 3300049593 | Bacteria | 4173 |
| 1258 | Ga0501077_0387732 | 3300049593 | Bacteria | 893 |
| 1259 | Ga0501079_0036147 | 3300049741 | Bacteria | 3804 |
| 1260 | Ga0501079_0050361 | 3300049741 | Bacteria | 3215 |
| 1261 | Ga0501079_0117715 | 3300049741 | Bacteria | 2065 |
| 1262 | Ga0501079_0145933 | 3300049741 | Bacteria | 1844 |
| 1263 | Ga0501079_0573396 | 3300049741 | Bacteria | 888 |
| 1264 | Ga0501079_0591796 | 3300049741 | Bacteria | 873 |
| 1265 | Ga0501079_1401655 | 3300049741 | Unclassified | 550 |
| 1266 | Ga0501080_0001641 | 3300049742 | Bacteria | 19043 |
| 1267 | Ga0501080_0065360 | 3300049742 | Bacteria | 3383 |
| 1268 | Ga0501080_0306917 | 3300049742 | Bacteria | 1438 |
| 1269 | Ga0501080_1045156 | 3300049742 | Bacteria | 707 |
| 1270 | Ga0501080_1823550 | 3300049742 | Unclassified | 511 |
| 1271 | Ga0501081_0877501 | 3300049743 | Bacteria | 676 |
| 1272 | Ga0501081_1388693 | 3300049743 | Unclassified | 533 |
| 1273 | Ga0501083_0003877 | 3300049744 | Bacteria | 10504 |
| 1274 | Ga0501083_0019333 | 3300049744 | Bacteria | 4745 |
| 1275 | Ga0501035_0258020 | 3300049822 | Bacteria | 1478 |
| 1276 | Ga0501044_0505690 | 3300049823 | Bacteria | 1109 |
| 1277 | Ga0501045_0162683 | 3300049824 | Bacteria | 1662 |
| 1278 | Ga0501045_0362956 | 3300049824 | Bacteria | 1078 |
| 1279 | Ga0501045_1241571 | 3300049824 | Unclassified | 543 |
| 1280 | Ga0501045_1307571 | 3300049824 | Unclassified | 528 |
| 1281 | nmdc:mga03683_563279_c1 | 3300050489 | Bacteria | 555 |
| 1282 | nmdc:mga00v17_14681_c1 | 3300050491 | Bacteria | 4380 |
| 1283 | nmdc:mga0yw44_139203_c1 | 3300050492 | Bacteria | 1576 |
| 1284 | nmdc:mga0yw44_378205_c1 | 3300050492 | Bacteria | 956 |
| 1285 | nmdc:mga0yw44_457609_c1 | 3300050492 | Bacteria | 865 |
| 1286 | nmdc:mga0yw44_766966_c1 | 3300050492 | Unclassified | 655 |
| 1287 | nmdc:mga0yw44_92898_c1 | 3300050492 | Bacteria | 1910 |
| 1288 | nmdc:mga05p37_113407_c1 | 3300050507 | Bacteria | 3333 |
| 1289 | nmdc:mga05p37_114104_c1 | 3300050507 | Bacteria | 3321 |
| 1290 | nmdc:mga05p37_189606_c1 | 3300050507 | Bacteria | 2497 |
| 1291 | nmdc:mga05p37_73071_c1 | 3300050507 | Bacteria | 4221 |
| 1292 | nmdc:mga05p37_86224_c1 | 3300050507 | Bacteria | 3870 |
| 1293 | nmdc:mga09592_216280_c1 | 3300050508 | Bacteria | 1660 |
| 1294 | nmdc:mga09592_41366_c1 | 3300050508 | Bacteria | 3876 |
| 1295 | nmdc:mga09592_450367_c1 | 3300050508 | Bacteria | 1110 |
| 1296 | nmdc:mga09592_88586_c1 | 3300050508 | Bacteria | 2643 |
| 1297 | nmdc:mga0qj67_182705_c1 | 3300050509 | Bacteria | 1703 |
| 1298 | nmdc:mga0qj67_19339_c1 | 3300050509 | Bacteria | 5202 |
| 1299 | nmdc:mga0qj67_971948_c1 | 3300050509 | Unclassified | 667 |
| 1300 | nmdc:mga06r32_1689327_c1 | 3300050510 | Bacteria | 570 |
| 1301 | nmdc:mga06r32_386229_c1 | 3300050510 | Bacteria | 1383 |
| 1302 | nmdc:mga08y16_1013556_c1 | 3300050511 | Bacteria | 809 |
| 1303 | nmdc:mga08y16_1229767_c1 | 3300050511 | Bacteria | 718 |
| 1304 | nmdc:mga08y16_280347_c1 | 3300050511 | Bacteria | 1719 |
| 1305 | nmdc:mga08y16_334453_c1 | 3300050511 | Bacteria | 1557 |
| 1306 | nmdc:mga08y16_47338_c1 | 3300050511 | Bacteria | 4501 |
| 1307 | nmdc:mga08y16_74491_c1 | 3300050511 | Bacteria | 3537 |
| 1308 | nmdc:mga0n895_1413768_c1 | 3300050512 | Bacteria | 664 |
| 1309 | nmdc:mga0n895_22609_c1 | 3300050512 | Bacteria | 5898 |
| 1310 | nmdc:mga0rr50_246891_c1 | 3300050513 | Unclassified | 1481 |
| 1311 | nmdc:mga08x19_1198664_c1 | 3300050514 | Bacteria | 538 |
| 1312 | nmdc:mga08x19_1206499_c1 | 3300050514 | Unclassified | 536 |
| 1313 | nmdc:mga08x19_387963_c1 | 3300050514 | Bacteria | 978 |
| 1314 | nmdc:mga08x19_900738_c1 | 3300050514 | Unclassified | 628 |
| 1315 | Ga0495601_0005580 | 3300053077 | Bacteria | 7338 |
| 1316 | Ga0495601_0033955 | 3300053077 | Bacteria | 3179 |
| 1317 | Ga0495601_0166223 | 3300053077 | Bacteria | 1442 |
| 1318 | Ga0495601_0402423 | 3300053077 | Bacteria | 887 |
| 1319 | Ga0495601_0416364 | 3300053077 | Unclassified | 870 |
| 1320 | Ga0495612_0002185 | 3300053078 | Bacteria | 8049 |
| 1321 | Ga0495612_0049024 | 3300053078 | Bacteria | 1732 |
| 1322 | Ga0495612_0054344 | 3300053078 | Bacteria | 1650 |
| 1323 | Ga0495595_0010692 | 3300053084 | Bacteria | 3822 |
| 1324 | Ga0495595_0020029 | 3300053084 | Bacteria | 2908 |
| 1325 | Ga0495595_0164363 | 3300053084 | Bacteria | 1096 |
| 1326 | Ga0495595_0390251 | 3300053084 | Bacteria | 705 |
| 1327 | Ga0495619_0001216 | 3300053085 | Bacteria | 16868 |
| 1328 | Ga0495619_0004788 | 3300053085 | Bacteria | 8603 |
| 1329 | Ga0495619_0367569 | 3300053085 | Unclassified | 994 |
| 1330 | Ga0495619_1085748 | 3300053085 | Bacteria | 533 |
| 1331 | Ga0500566_0045947 | 3300053094 | Bacteria | 2511 |
| 1332 | Ga0501084_0054255 | 3300054114 | Bacteria | 3352 |
| 1333 | Ga0501084_0377208 | 3300054114 | Bacteria | 1198 |
| 1334 | Ga0501084_0380565 | 3300054114 | Bacteria | 1193 |
| 1335 | Ga0501082_0161373 | 3300060353 | Bacteria | 1948 |
| 1336 | Ga0501082_0242459 | 3300060353 | Bacteria | 1569 |
| 1337 | Ga0501082_0379608 | 3300060353 | Bacteria | 1233 |
| 1338 | Ga0501082_0400102 | 3300060353 | Bacteria | 1198 |
| 1339 | Ga0466962_0003673 | 3300061719 | Bacteria | 7315 |
| 1340 | Ga0466962_0006283 | 3300061719 | Bacteria | 5708 |
| 1341 | Ga0466962_0024877 | 3300061719 | Bacteria | 2875 |
| 1342 | Ga0530510_0183049 | 3300061734 | Bacteria | 1554 |
| 1343 | Ga0530510_0284309 | 3300061734 | Unclassified | 1236 |
| 1344 | Ga0530510_1239007 | 3300061734 | Unclassified | 572 |
| 1345 | Ga0075362_10465777 | |||
| 1346 | JGI24747J21853_1022702 | |||
| 1347 | JGI24743J22301_10077164 | |||
| 1348 | JGI24748J21848_1058990 | |||
| 1349 | JGI24749J21850_1067275 | |||
| 1350 | JGI24744J21845_10004090 | |||
| 1351 | JGI24742J22300_10028768 | |||
| 1352 | JGI25407J50210_10026260 | |||
| 1353 | Ga0070658_10009263 | |||
| 1354 | Ga0070658_10129479 | |||
| 1355 | Ga0070683_100022239 | |||
| 1356 | Ga0070683_100196273 | |||
| 1357 | Ga0070683_100389897 | |||
| 1358 | Ga0070683_100430785 | |||
| 1359 | Ga0070683_100599085 | |||
| 1360 | Ga0070683_100730016 | |||
| 1361 | Ga0070683_100818823 | |||
| 1362 | Ga0070690_100076575 | |||
| 1363 | Ga0070690_100569302 | |||
| 1364 | Ga0070690_101673129 | |||
| 1365 | Ga0068869_100468872 | |||
| 1366 | Ga0068869_101213929 | |||
| 1367 | Ga0068869_101372443 | |||
| 1368 | Ga0070666_10042249 | |||
| 1369 | Ga0070680_100046766 | |||
| 1370 | Ga0070680_100064521 | |||
| 1371 | Ga0070680_100128248 | |||
| 1372 | Ga0070682_100056508 | |||
| 1373 | Ga0070682_100445987 | |||
| 1374 | Ga0068868_100679798 | |||
| 1375 | Ga0068868_100950332 | |||
| 1376 | Ga0068868_101075143 | |||
| 1377 | Ga0068868_101136077 | |||
| 1378 | Ga0068868_101645658 | |||
| 1379 | Ga0070660_100002553 | |||
| 1380 | Ga0070660_100008218 | |||
| 1381 | Ga0070660_100008664 | |||
| 1382 | Ga0070660_100114436 | |||
| 1383 | Ga0070660_100632176 | |||
| 1384 | Ga0070689_100037043 | |||
| 1385 | Ga0070689_101154104 | |||
| 1386 | Ga0070689_101232369 | |||
| 1387 | Ga0070691_10064019 | |||
| 1388 | Ga0070691_10278392 | |||
| 1389 | Ga0070691_10534596 | |||
| 1390 | Ga0070687_100366525 | |||
| 1391 | Ga0070687_100724764 | |||
| 1392 | Ga0070687_101211956 | |||
| 1393 | Ga0070661_100135993 | |||
| 1394 | Ga0070661_100413132 | |||
| 1395 | Ga0070661_100612365 | |||
| 1396 | Ga0070661_100833725 | |||
| 1397 | Ga0070692_10060313 | |||
| 1398 | Ga0070668_100157074 | |||
| 1399 | Ga0070668_100609191 | |||
| 1400 | Ga0070669_100361793 | |||
| 1401 | Ga0070669_100756503 | |||
| 1402 | Ga0070675_100178886 | |||
| 1403 | Ga0070675_100928269 | |||
| 1404 | Ga0070671_100138890 | |||
| 1405 | Ga0070671_100191772 | |||
| 1406 | Ga0070671_100753112 | |||
| 1407 | Ga0070671_101138876 | |||
| 1408 | Ga0070674_100029798 | |||
| 1409 | Ga0070674_100343606 | |||
| 1410 | Ga0070674_100778271 | |||
| 1411 | Ga0070673_100159727 | |||
| 1412 | Ga0070688_100003339 | |||
| 1413 | Ga0070659_100038645 | |||
| 1414 | Ga0070659_100099301 | |||
| 1415 | Ga0070659_100248350 | |||
| 1416 | Ga0070667_100683233 | |||
| 1417 | Ga0070667_102330558 | |||
| 1418 | Ga0070703_10028894 | |||
| 1419 | Ga0070709_10106682 | |||
| 1420 | Ga0070709_11604006 | |||
| 1421 | Ga0070714_100007661 | |||
| 1422 | Ga0070714_100064481 | |||
| 1423 | Ga0070714_100091325 | |||
| 1424 | Ga0070714_100227265 | |||
| 1425 | Ga0070714_100370904 | |||
| 1426 | Ga0070714_101003153 | |||
| 1427 | Ga0070714_101222910 | |||
| 1428 | Ga0070713_100042668 | |||
| 1429 | Ga0070713_100091556 | |||
| 1430 | Ga0070713_100163032 | |||
| 1431 | Ga0070713_100376372 | |||
| 1432 | Ga0070713_100776006 | |||
| 1433 | Ga0070713_100828760 | |||
| 1434 | Ga0070713_101492708 | |||
| 1435 | Ga0070710_10031366 | |||
| 1436 | Ga0070710_10045884 | |||
| 1437 | Ga0070710_11017430 | |||
| 1438 | Ga0070701_10026031 | |||
| 1439 | Ga0070701_11158123 | |||
| 1440 | Ga0070711_100036960 | |||
| 1441 | Ga0070711_100089774 | |||
| 1442 | Ga0070705_100031464 | |||
| 1443 | Ga0070705_100035015 | |||
| 1444 | Ga0070705_100645464 | |||
| 1445 | Ga0070705_101289590 | |||
| 1446 | Ga0070700_100004091 | |||
| 1447 | Ga0070700_100104506 | |||
| 1448 | Ga0070700_100363445 | |||
| 1449 | Ga0070700_100397774 | |||
| 1450 | Ga0070700_100422517 | |||
| 1451 | Ga0070700_100938841 | |||
| 1452 | Ga0070700_101112893 | |||
| 1453 | Ga0070700_101417812 | |||
| 1454 | Ga0070694_100176006 | |||
| 1455 | Ga0070694_100456948 | |||
| 1456 | Ga0070694_100980345 | |||
| 1457 | Ga0070694_101015920 | |||
| 1458 | Ga0070694_101175707 | |||
| 1459 | Ga0070708_100111259 | |||
| 1460 | Ga0070708_100274947 | |||
| 1461 | Ga0070663_100060900 | |||
| 1462 | Ga0070663_100650185 | |||
| 1463 | Ga0070678_100033597 | |||
| 1464 | Ga0070678_100235226 | |||
| 1465 | Ga0070678_100257115 | |||
| 1466 | Ga0070678_101269536 | |||
| 1467 | Ga0070662_100226193 | |||
| 1468 | Ga0070662_101342567 | |||
| 1469 | Ga0070662_101428561 | |||
| 1470 | Ga0070662_101948812 | |||
| 1471 | Ga0070681_10089329 | |||
| 1472 | Ga0070681_10201079 | |||
| 1473 | Ga0070681_10208335 | |||
| 1474 | Ga0070681_10784230 | |||
| 1475 | Ga0068867_100015764 | |||
| 1476 | Ga0068867_100332208 | |||
| 1477 | Ga0068867_100372597 | |||
| 1478 | Ga0068867_100548541 | |||
| 1479 | Ga0068867_101941476 | |||
| 1480 | Ga0070685_10014012 | |||
| 1481 | Ga0070685_10328450 | |||
| 1482 | Ga0070706_100001733 | |||
| 1483 | Ga0070706_100055425 | |||
| 1484 | Ga0070706_100697649 | |||
| 1485 | Ga0070707_100008575 | |||
| 1486 | Ga0070707_100146390 | |||
| 1487 | Ga0070707_100839260 | |||
| 1488 | Ga0070707_100880920 | |||
| 1489 | Ga0070707_101303215 | |||
| 1490 | Ga0070698_100034864 | |||
| 1491 | Ga0070698_100106751 | |||
| 1492 | Ga0070698_100733923 | |||
| 1493 | Ga0070698_101627969 | |||
| 1494 | Ga0070699_100036997 | |||
| 1495 | Ga0070699_100093303 | |||
| 1496 | Ga0070699_100543911 | |||
| 1497 | Ga0070699_100925648 | |||
| 1498 | Ga0070699_101035334 | |||
| 1499 | Ga0070699_101601117 | |||
| 1500 | Ga0070699_101884760 | |||
| 1501 | Ga0070699_102155435 | |||
| 1502 | Ga0070679_100035296 | |||
| 1503 | Ga0070679_100045545 | |||
| 1504 | Ga0070679_100319583 | |||
| 1505 | Ga0070679_100362069 | |||
| 1506 | Ga0070684_100009842 | |||
| 1507 | Ga0070684_100062489 | |||
| 1508 | Ga0070684_100085531 | |||
| 1509 | Ga0070684_100395486 | |||
| 1510 | Ga0070684_100426543 | |||
| 1511 | Ga0070684_101766641 | |||
| 1512 | Ga0070697_100812307 | |||
| 1513 | Ga0070697_102059429 | |||
| 1514 | Ga0068853_100043446 | |||
| 1515 | Ga0068853_100564676 | |||
| 1516 | Ga0068853_100603347 | |||
| 1517 | Ga0070672_100036966 | |||
| 1518 | Ga0070672_101192856 | |||
| 1519 | Ga0070686_100024121 | |||
| 1520 | Ga0070686_100300924 | |||
| 1521 | Ga0070686_101327265 | |||
| 1522 | Ga0070695_100019106 | |||
| 1523 | Ga0070695_100253609 | |||
| 1524 | Ga0070695_101033604 | |||
| 1525 | Ga0070696_100124834 | |||
| 1526 | Ga0070696_100155127 | |||
| 1527 | Ga0070696_100198804 | |||
| 1528 | Ga0070696_100407495 | |||
| 1529 | Ga0070696_100627613 | |||
| 1530 | Ga0070696_101245739 | |||
| 1531 | Ga0070693_100050752 | |||
| 1532 | Ga0070693_100148000 | |||
| 1533 | Ga0070693_100207251 | |||
| 1534 | Ga0070665_100107748 | |||
| 1535 | Ga0070665_100207864 | |||
| 1536 | Ga0070704_100075348 | |||
| 1537 | Ga0070704_100722913 | |||
| 1538 | Ga0070704_101162306 | |||
| 1539 | Ga0070704_101372912 | |||
| 1540 | Ga0070704_101561017 | |||
| 1541 | Ga0068855_100146639 | |||
| 1542 | Ga0068855_100222034 | |||
| 1543 | Ga0068855_100667467 | |||
| 1544 | Ga0068855_102229526 | |||
| 1545 | Ga0070664_100672497 | |||
| 1546 | Ga0070664_100688486 | |||
| 1547 | Ga0068857_100008383 | |||
| 1548 | Ga0068857_100098618 | |||
| 1549 | Ga0068857_100646842 | |||
| 1550 | Ga0068854_100103048 | |||
| 1551 | Ga0068854_101822559 | |||
| 1552 | Ga0068856_100090674 | |||
| 1553 | Ga0068856_100277495 | |||
| 1554 | Ga0068856_100308033 | |||
| 1555 | Ga0068856_100976221 | |||
| 1556 | Ga0068856_101045790 | |||
| 1557 | Ga0068856_101081635 | |||
| 1558 | Ga0068856_101396314 | |||
| 1559 | Ga0070702_100008264 | |||
| 1560 | Ga0070702_100253353 | |||
| 1561 | Ga0070702_100522602 | |||
| 1562 | Ga0068852_100031030 | |||
| 1563 | Ga0068852_100106603 | |||
| 1564 | Ga0068852_102083931 | |||
| 1565 | Ga0068859_100356837 | |||
| 1566 | Ga0068859_101907706 | |||
| 1567 | Ga0068859_102635885 | |||
| 1568 | Ga0068864_100357163 | |||
| 1569 | Ga0068864_101005975 | |||
| 1570 | Ga0068864_102157825 | |||
| 1571 | Ga0068866_10037222 | |||
| 1572 | Ga0068861_100111511 | |||
| 1573 | Ga0068861_100439286 | |||
| 1574 | Ga0068861_100726691 | |||
| 1575 | Ga0068861_101456828 | |||
| 1576 | Ga0068851_10436457 | |||
| 1577 | Ga0068870_10150379 | |||
| 1578 | Ga0068870_10184418 | |||
| 1579 | Ga0068870_10330971 | |||
| 1580 | Ga0068863_102393058 | |||
| 1581 | Ga0068858_101534447 | |||
| 1582 | Ga0068858_102281643 | |||
| 1583 | Ga0068860_100169726 | |||
| 1584 | Ga0068862_100259834 | |||
| 1585 | Ga0081455_10006746 | |||
| 1586 | Ga0081538_10008294 | |||
| 1587 | Ga0081538_10248748 | |||
| 1588 | Ga0081540_1030234 | |||
| 1589 | Ga0081540_1172186 | |||
| 1590 | Ga0081539_10011738 | |||
| 1591 | Ga0070717_10052705 | |||
| 1592 | Ga0070717_10062424 | |||
| 1593 | Ga0070717_10154304 | |||
| 1594 | Ga0070717_10493829 | |||
| 1595 | Ga0070717_10993411 | |||
| 1596 | Ga0070717_11177909 | |||
| 1597 | Ga0070717_11792510 | |||
| 1598 | Ga0070717_11835219 | |||
| 1599 | Ga0075365_10037148 | |||
| 1600 | Ga0075365_10112799 | |||
| 1601 | Ga0075365_10376678 | |||
| 1602 | Ga0075365_10691498 | |||
| 1603 | Ga0075364_10017812 | |||
| 1604 | Ga0075432_10008659 | |||
| 1605 | Ga0075432_10041952 | |||
| 1606 | Ga0075432_10508031 | |||
| 1607 | Ga0070715_10023266 | |||
| 1608 | Ga0070715_10162596 | |||
| 1609 | Ga0070716_100177509 | |||
| 1610 | Ga0070716_100178327 | |||
| 1611 | Ga0070716_100238161 | |||
| 1612 | Ga0070712_100080584 | |||
| 1613 | Ga0070712_100107903 | |||
| 1614 | Ga0070712_100181196 | |||
| 1615 | Ga0070712_100241547 | |||
| 1616 | Ga0070712_100264051 | |||
| 1617 | Ga0070712_101192909 | |||
| 1618 | Ga0075362_10317046 | |||
| 1619 | Ga0097621_100081660 | |||
| 1620 | Ga0097621_100146792 | |||
| 1621 | Ga0068871_100022790 | |||
| 1622 | Ga0068871_100565999 | |||
| 1623 | Ga0068871_100841185 | |||
| 1624 | Ga0075428_100235491 | |||
| 1625 | Ga0075428_100319956 | |||
| 1626 | Ga0075428_100783901 | |||
| 1627 | Ga0075428_102425684 | |||
| 1628 | Ga0075428_102575833 | |||
| 1629 | Ga0075430_100149520 | |||
| 1630 | Ga0075430_100153598 | |||
| 1631 | Ga0075430_101307501 | |||
| 1632 | Ga0075431_100173081 | |||
| 1633 | Ga0075431_100289315 | |||
| 1634 | Ga0075431_100905703 | |||
| 1635 | Ga0075431_101786713 | |||
| 1636 | Ga0075433_10139896 | |||
| 1637 | Ga0075433_10267633 | |||
| 1638 | Ga0075433_10824869 | |||
| 1639 | Ga0075433_11012345 | |||
| 1640 | Ga0075434_100000856 | |||
| 1641 | Ga0075434_100010908 | |||
| 1642 | Ga0075434_100114685 | |||
| 1643 | Ga0075434_100136151 | |||
| 1644 | Ga0075434_100273622 | |||
| 1645 | Ga0075429_100154286 | |||
| 1646 | Ga0075429_100529236 | |||
| 1647 | Ga0075429_100918737 | |||
| 1648 | Ga0068865_100234268 | |||
| 1649 | Ga0068865_100590695 | |||
| 1650 | Ga0068865_101365838 | |||
| 1651 | Ga0075436_100026501 | |||
| 1652 | Ga0075436_100073306 | |||
| 1653 | Ga0075436_100339653 | |||
| 1654 | Ga0097620_100356811 | |||
| 1655 | Ga0097620_101908183 | |||
| 1656 | Ga0097620_102635494 | |||
| 1657 | Ga0075435_100005146 | |||
| 1658 | Ga0075435_100042142 | |||
| 1659 | Ga0075435_100135994 | |||
| 1660 | Ga0075435_100269214 | |||
| 1661 | Ga0075435_100698327 | |||
| 1662 | Ga0105240_10435805 | |||
| 1663 | Ga0105240_10582362 | |||
| 1664 | Ga0111539_10122337 | |||
| 1665 | Ga0111539_10414662 | |||
| 1666 | Ga0111539_10865845 | |||
| 1667 | Ga0111539_10984534 | |||
| 1668 | Ga0111539_11905855 | |||
| 1669 | Ga0111539_13536084 | |||
| 1670 | Ga0105245_10000687 | |||
| 1671 | Ga0105245_10187721 | |||
| 1672 | Ga0105245_10454536 | |||
| 1673 | Ga0105245_10584545 | |||
| 1674 | Ga0105247_10064112 | |||
| 1675 | Ga0114129_10061604 | |||
| 1676 | Ga0114129_10137795 | |||
| 1677 | Ga0114129_10208993 | |||
| 1678 | Ga0114129_11040635 | |||
| 1679 | Ga0114129_11259818 | |||
| 1680 | Ga0114129_11384497 | |||
| 1681 | Ga0114129_12148671 | |||
| 1682 | Ga0105243_10026578 | |||
| 1683 | Ga0105243_10066517 | |||
| 1684 | Ga0105243_10369800 | |||
| 1685 | Ga0105243_10861849 | |||
| 1686 | Ga0105243_11613728 | |||
| 1687 | Ga0105243_12142385 | |||
| 1688 | Ga0105243_12901896 | |||
| 1689 | Ga0105241_10003550 | |||
| 1690 | Ga0105241_12440474 | |||
| 1691 | Ga0105242_10005019 | |||
| 1692 | Ga0105242_10349911 | |||
| 1693 | Ga0105242_10419406 | |||
| 1694 | Ga0105248_10132376 | |||
| 1695 | Ga0105248_11959630 | |||
| 1696 | Ga0105237_10977293 | |||
| 1697 | Ga0105237_11424454 | |||
| 1698 | Ga0105238_10148058 | |||
| 1699 | Ga0105238_10458834 | |||
| 1700 | Ga0105238_11074680 | |||
| 1701 | Ga0105238_12930165 | |||
| 1702 | Ga0105249_10000455 | |||
| 1703 | Ga0105249_11423456 | |||
| 1704 | Ga0105249_11497613 | |||
| 1705 | Ga0099796_10105178 | |||
| 1706 | Ga0105239_10084098 | |||
| 1707 | Ga0105239_10199302 | |||
| 1708 | Ga0105239_10337099 | |||
| 1709 | Ga0105239_10675107 | |||
| 1710 | Ga0105239_11012425 | |||
| 1711 | Ga0105239_11274541 | |||
| 1712 | Ga0105239_12259535 | |||
| 1713 | Ga0105239_12915371 | |||
| 1714 | Ga0105246_10129205 | |||
| 1715 | Ga0105246_10906746 | |||
| 1716 | Ga0105246_12448312 | |||
| 1717 | Ga0157338_1096686 | |||
| 1718 | Ga0157371_10882818 | |||
| 1719 | Ga0157370_11079375 | |||
| 1720 | Ga0157369_10177558 | |||
| 1721 | Ga0157369_10222986 | |||
| 1722 | Ga0157374_10049042 | |||
| 1723 | Ga0157374_11105222 | |||
| 1724 | Ga0157374_12394230 | |||
| 1725 | Ga0157378_10097427 | |||
| 1726 | Ga0163162_10004697 | |||
| 1727 | Ga0163162_10871908 | |||
| 1728 | Ga0163162_12148418 | |||
| 1729 | Ga0157372_10129340 | |||
| 1730 | Ga0157372_10221311 | |||
| 1731 | Ga0157372_11756888 | |||
| 1732 | Ga0157375_10011947 | |||
| 1733 | Ga0157375_13182275 | |||
| 1734 | Ga0163163_11995730 | |||
| 1735 | Ga0157380_10013107 | |||
| 1736 | Ga0157380_11558144 | |||
| 1737 | Ga0157380_11880451 | |||
| 1738 | Ga0157380_12648376 | |||
| 1739 | Ga0157380_12703521 | |||
| 1740 | Ga0182008_10092684 | |||
| 1741 | Ga0182008_10732527 | |||
| 1742 | Ga0182008_10801434 | |||
| 1743 | Ga0157377_10014251 | |||
| 1744 | Ga0157379_10300816 | |||
| 1745 | Ga0157376_10108121 | |||
| 1746 | Ga0182007_10136450 | |||
| 1747 | Ga0163161_10289103 | |||
| 1748 | Ga0163161_10982275 | |||
| 1749 | Ga0197907_10985028 | |||
| 1750 | Ga0206356_10741757 | |||
| 1751 | Ga0206356_11611989 | |||
| 1752 | Ga0206353_10459025 | |||
| 1753 | Ga0206353_11846103 | |||
| 1754 | Ga0207653_10019534 | |||
| 1755 | Ga0207653_10063552 | |||
| 1756 | Ga0207653_10299772 | |||
| 1757 | Ga0207692_10081737 | |||
| 1758 | Ga0207642_10051476 | |||
| 1759 | Ga0207642_10405208 | |||
| 1760 | Ga0207642_11084177 | |||
| 1761 | Ga0207688_10491974 | |||
| 1762 | Ga0207688_10757785 | |||
| 1763 | Ga0207680_10098836 | |||
| 1764 | Ga0207685_10056610 | |||
| 1765 | Ga0207685_10189671 | |||
| 1766 | Ga0207699_10044254 | |||
| 1767 | Ga0207699_10081023 | |||
| 1768 | Ga0207699_10401117 | |||
| 1769 | Ga0207699_11342551 | |||
| 1770 | Ga0207643_10334441 | |||
| 1771 | Ga0207643_10388046 | |||
| 1772 | Ga0207705_10050481 | |||
| 1773 | Ga0207705_10528884 | |||
| 1774 | Ga0207684_10055553 | |||
| 1775 | Ga0207684_10133677 | |||
| 1776 | Ga0207684_10545164 | |||
| 1777 | Ga0207684_11580355 | |||
| 1778 | Ga0207654_10084441 | |||
| 1779 | Ga0207654_10231073 | |||
| 1780 | Ga0207707_10084920 | |||
| 1781 | Ga0207707_10243068 | |||
| 1782 | Ga0207707_10279412 | |||
| 1783 | Ga0207707_10608718 | |||
| 1784 | Ga0207707_10704345 | |||
| 1785 | Ga0207707_10831497 | |||
| 1786 | Ga0207695_10101227 | |||
| 1787 | Ga0207695_10549217 | |||
| 1788 | Ga0207693_10001893 | |||
| 1789 | Ga0207693_10002044 | |||
| 1790 | Ga0207693_10002912 | |||
| 1791 | Ga0207693_10165423 | |||
| 1792 | Ga0207693_10572933 | |||
| 1793 | Ga0207663_10009208 | |||
| 1794 | Ga0207663_10040540 | |||
| 1795 | Ga0207663_10214126 | |||
| 1796 | Ga0207663_10270855 | |||
| 1797 | Ga0207663_10763993 | |||
| 1798 | Ga0207660_10072292 | |||
| 1799 | Ga0207660_10216726 | |||
| 1800 | Ga0207660_10233076 | |||
| 1801 | Ga0207660_10342361 | |||
| 1802 | Ga0207662_10068928 | |||
| 1803 | Ga0207662_10345649 | |||
| 1804 | Ga0207657_10007077 | |||
| 1805 | Ga0207657_10021259 | |||
| 1806 | Ga0207657_10058654 | |||
| 1807 | Ga0207649_10069923 | |||
| 1808 | Ga0207649_10546222 | |||
| 1809 | Ga0207649_10600771 | |||
| 1810 | Ga0207649_10703878 | |||
| 1811 | Ga0207649_11435720 | |||
| 1812 | Ga0207652_10051697 | |||
| 1813 | Ga0207652_10125361 | |||
| 1814 | Ga0207652_10130619 | |||
| 1815 | Ga0207652_11008914 | |||
| 1816 | Ga0207646_10001907 | |||
| 1817 | Ga0207646_10030917 | |||
| 1818 | Ga0207646_10201000 | |||
| 1819 | Ga0207646_10211003 | |||
| 1820 | Ga0207646_10628041 | |||
| 1821 | Ga0207646_11168603 | |||
| 1822 | Ga0207681_11044083 | |||
| 1823 | Ga0207681_11204132 | |||
| 1824 | Ga0207694_10414005 | |||
| 1825 | Ga0207659_10812070 | |||
| 1826 | Ga0207687_10108363 | |||
| 1827 | Ga0207687_10342688 | |||
| 1828 | Ga0207687_10580327 | |||
| 1829 | Ga0207687_10595187 | |||
| 1830 | Ga0207687_10923663 | |||
| 1831 | Ga0207700_10336815 | |||
| 1832 | Ga0207700_10726166 | |||
| 1833 | Ga0207700_11205850 | |||
| 1834 | Ga0207700_11747080 | |||
| 1835 | Ga0207664_10006597 | |||
| 1836 | Ga0207664_10008802 | |||
| 1837 | Ga0207664_10020258 | |||
| 1838 | Ga0207664_10054334 | |||
| 1839 | Ga0207664_10160732 | |||
| 1840 | Ga0207664_10229750 | |||
| 1841 | Ga0207664_10497868 | |||
| 1842 | Ga0207664_10509201 | |||
| 1843 | Ga0207664_10589169 | |||
| 1844 | Ga0207664_10699627 | |||
| 1845 | Ga0207664_10883704 | |||
| 1846 | Ga0207664_11364697 | |||
| 1847 | Ga0207644_10215320 | |||
| 1848 | Ga0207644_10219265 | |||
| 1849 | Ga0207644_10438726 | |||
| 1850 | Ga0207690_10081495 | |||
| 1851 | Ga0207690_10317807 | |||
| 1852 | Ga0207690_10329111 | |||
| 1853 | Ga0207690_10654554 | |||
| 1854 | Ga0207690_10996582 | |||
| 1855 | Ga0207690_11307758 | |||
| 1856 | Ga0207690_11621004 | |||
| 1857 | Ga0207706_10231906 | |||
| 1858 | Ga0207706_10269212 | |||
| 1859 | Ga0207706_10772843 | |||
| 1860 | Ga0207706_10850143 | |||
| 1861 | Ga0207706_11191667 | |||
| 1862 | Ga0207686_10175367 | |||
| 1863 | Ga0207686_10487875 | |||
| 1864 | Ga0207686_10743981 | |||
| 1865 | Ga0207686_11259086 | |||
| 1866 | Ga0207709_10049296 | |||
| 1867 | Ga0207709_10056200 | |||
| 1868 | Ga0207709_10413762 | |||
| 1869 | Ga0207709_10681414 | |||
| 1870 | Ga0207709_10778263 | |||
| 1871 | Ga0207709_11304312 | |||
| 1872 | Ga0207670_10114870 | |||
| 1873 | Ga0207669_10499314 | |||
| 1874 | Ga0207669_10785857 | |||
| 1875 | Ga0207669_10906128 | |||
| 1876 | Ga0207669_11114652 | |||
| 1877 | Ga0207704_10039145 | |||
| 1878 | Ga0207704_10139773 | |||
| 1879 | Ga0207704_10477097 | |||
| 1880 | Ga0207704_11151400 | |||
| 1881 | Ga0207665_10003387 | |||
| 1882 | Ga0207665_10041163 | |||
| 1883 | Ga0207665_10172829 | |||
| 1884 | Ga0207691_10040444 | |||
| 1885 | Ga0207691_10334995 | |||
| 1886 | Ga0207691_10337771 | |||
| 1887 | Ga0207711_10548625 | |||
| 1888 | Ga0207711_10623885 | |||
| 1889 | Ga0207661_10018036 | |||
| 1890 | Ga0207661_10115134 | |||
| 1891 | Ga0207661_10173778 | |||
| 1892 | Ga0207661_10312101 | |||
| 1893 | Ga0207661_10361058 | |||
| 1894 | Ga0207661_11514227 | |||
| 1895 | Ga0207661_11533997 | |||
| 1896 | Ga0207661_11660837 | |||
| 1897 | Ga0207679_10673021 | |||
| 1898 | Ga0207679_10683161 | |||
| 1899 | Ga0207679_11230600 | |||
| 1900 | Ga0207667_10382184 | |||
| 1901 | Ga0207667_10507134 | |||
| 1902 | Ga0207667_10855665 | |||
| 1903 | Ga0207667_12133021 | |||
| 1904 | Ga0207651_10154469 | |||
| 1905 | Ga0207651_11299067 | |||
| 1906 | Ga0207651_11481075 | |||
| 1907 | Ga0207712_10078201 | |||
| 1908 | Ga0207668_10327328 | |||
| 1909 | Ga0207668_10951859 | |||
| 1910 | Ga0207668_11176177 | |||
| 1911 | Ga0207658_11234716 | |||
| 1912 | Ga0207677_10131212 | |||
| 1913 | Ga0207677_10146691 | |||
| 1914 | Ga0207677_10597900 | |||
| 1915 | Ga0207677_10942172 | |||
| 1916 | Ga0207677_11484902 | |||
| 1917 | Ga0207677_12220535 | |||
| 1918 | Ga0207703_10871918 | |||
| 1919 | Ga0207703_11988273 | |||
| 1920 | Ga0207703_12142430 | |||
| 1921 | Ga0207639_10429423 | |||
| 1922 | Ga0207639_10442547 | |||
| 1923 | Ga0207639_10793788 | |||
| 1924 | Ga0207678_10032272 | |||
| 1925 | Ga0207678_10178345 | |||
| 1926 | Ga0207708_10000220 | |||
| 1927 | Ga0207708_10090006 | |||
| 1928 | Ga0207708_10116032 | |||
| 1929 | Ga0207708_10188318 | |||
| 1930 | Ga0207708_10227671 | |||
| 1931 | Ga0207708_10275407 | |||
| 1932 | Ga0207708_10605894 | |||
| 1933 | Ga0207708_10706177 | |||
| 1934 | Ga0207702_10029306 | |||
| 1935 | Ga0207702_10131900 | |||
| 1936 | Ga0207702_10220724 | |||
| 1937 | Ga0207702_10334416 | |||
| 1938 | Ga0207702_10879049 | |||
| 1939 | Ga0207702_10980848 | |||
| 1940 | Ga0207702_11203621 | |||
| 1941 | Ga0207702_11408675 | |||
| 1942 | Ga0207702_11457569 | |||
| 1943 | Ga0207702_11694097 | |||
| 1944 | Ga0207648_10000545 | |||
| 1945 | Ga0207648_10334459 | |||
| 1946 | Ga0207648_10484497 | |||
| 1947 | Ga0207676_10280659 | |||
| 1948 | Ga0207674_10273446 | |||
| 1949 | Ga0207674_10366513 | |||
| 1950 | Ga0207674_10462852 | |||
| 1951 | Ga0207675_100029531 | |||
| 1952 | Ga0207675_100109659 | |||
| 1953 | Ga0207675_100112142 | |||
| 1954 | Ga0207675_100121420 | |||
| 1955 | Ga0207683_10000840 | |||
| 1956 | Ga0207683_10018831 | |||
| 1957 | Ga0207683_10086794 | |||
| 1958 | Ga0207683_10096847 | |||
| 1959 | Ga0207683_10402224 | |||
| 1960 | Ga0207683_10762992 | |||
| 1961 | Ga0207683_10967613 | |||
| 1962 | Ga0207683_11424917 | |||
| 1963 | Ga0207698_10494400 | |||
| 1964 | Ga0207698_11881573 | |||
| 1965 | Ga0207698_11956030 | |||
| 1966 | Ga0207428_10002288 | |||
| 1967 | Ga0207428_10032866 | |||
| 1968 | Ga0207428_10294424 | |||
| 1969 | Ga0268266_10892900 | |||
| 1970 | Ga0268266_11180483 | |||
| 1971 | Ga0268265_10317164 | |||
| 1972 | Ga0268265_10544609 | |||
| 1973 | Ga0268265_11139471 | |||
| 1974 | Ga0265326_10217189 | |||
| 1975 | Ga0265319_1110239 | |||
| 1976 | Ga0265334_10027192 | |||
| 1977 | Ga0265318_10007047 | |||
| 1978 | Ga0265318_10019410 | |||
| 1979 | Ga0265336_10018015 | |||
| 1980 | Ga0265338_10000694 | |||
| 1981 | Ga0265338_10001204 | |||
| 1982 | Ga0265338_10049322 | |||
| 1983 | Ga0265338_10059884 | |||
| 1984 | Ga0265338_10709775 | |||
| 1985 | Ga0265338_10783436 | |||
| 1986 | Ga0265324_10008517 | |||
| 1987 | Ga0265324_10018043 | |||
| 1988 | Ga0265332_10024308 | |||
| 1989 | Ga0265328_10013125 | |||
| 1990 | Ga0265320_10029680 | |||
| 1991 | Ga0265340_10034079 | |||
| 1992 | Ga0265331_10017437 | |||
| 1993 | Ga0265327_10086232 | |||
| 1994 | Ga0265327_10409159 | |||
| 1995 | Ga0307408_100029936 | |||
| 1996 | Ga0307408_100668966 | |||
| 1997 | Ga0307408_101681439 | |||
| 1998 | Ga0265313_10010778 | |||
| 1999 | Ga0265313_10024468 | |||
| 2000 | Ga0265314_10041515 | |||
| 2001 | Ga0265342_10171035 | |||
| 2002 | Ga0265342_10261622 | |||
| 2003 | Ga0307405_10039331 | |||
| 2004 | Ga0307413_11499456 | |||
| 2005 | Ga0307413_12015571 | |||
| 2006 | Ga0307410_10064640 | |||
| 2007 | Ga0307410_10359551 | |||
| 2008 | Ga0307410_11035735 | |||
| 2009 | Ga0307406_10030945 | |||
| 2010 | Ga0307407_10257111 | |||
| 2011 | Ga0307407_10887806 | |||
| 2012 | Ga0307412_10021995 | |||
| 2013 | Ga0307409_100028809 | |||
| 2014 | Ga0307409_100055880 | |||
| 2015 | Ga0307409_100365844 | |||
| 2016 | Ga0307416_100094815 | |||
| 2017 | Ga0307416_100112976 | |||
| 2018 | Ga0307416_100125156 | |||
| 2019 | Ga0307416_100228502 | |||
| 2020 | Ga0307416_100535991 | |||
| 2021 | Ga0307416_101172455 | |||
| 2022 | Ga0307416_102810267 | |||
| 2023 | Ga0307414_10028606 | |||
| 2024 | Ga0307411_10083882 | |||
| 2025 | Ga0307415_100139093 | |||
| 2026 | Ga0307415_100282494 | |||
| 2027 | Ga0373926_0009690 | |||
| 2028 | Ga0373926_0255246 | |||
| 2029 | Ga0373934_0248530 | |||
| 2030 | Ga0373934_0267494 | |||
| 2031 | Ga0373944_0041395 | |||
| 2032 | Ga0373944_0182756 | |||
| 2033 | Ga0373936_0076556 | |||
| 2034 | Ga0373956_0027659 | |||
| 2035 | Ga0373960_0056255 | |||
| 2036 | Ga0373960_0258521 | |||
| 2037 | Ga0373943_0014826 | |||
| 2038 | Ga0373943_0486224 | |||
| 2039 | Ga0373943_0653711 | |||
| 2040 | Ga0373946_0007357 | |||
| 2041 | Ga0373946_0780841 | |||
| 2042 | Ga0373955_0180923 | |||
| 2043 | Ga0373955_0334506 | |||
| 2044 | Ga0373955_0697422 | |||
| 2045 | Ga0373955_0907878 | |||
| 2046 | Ga0373942_0010924 | |||
| 2047 | Ga0373935_0023354 | |||
| 2048 | Ga0373935_0679100 | |||
| 2049 | Ga0373927_0142313 | |||
| 2050 | Ga0373933_0401933 | |||
| 2051 | Ga0373947_0002758 | |||
| 2052 | Ga0373937_0001924 | |||
| 2053 | Ga0373937_0242198 | |||
| 2054 | Ga0373937_1272768 | |||
| 2055 | Ga0373925_0032896 | |||
| 2056 | Ga0373925_0448368 | |||
| 2057 | Ga0395899_0035126 | |||
| 2058 | Ga0395899_0049001 | |||
| 2059 | Ga0395899_0134473 | |||
| 2060 | Ga0395899_0187604 | |||
| 2061 | Ga0395899_0213599 | |||
| 2062 | Ga0395899_0214515 | |||
| 2063 | Ga0395899_0425322 | |||
| 2064 | Ga0395899_0430840 | |||
| 2065 | Ga0395899_0523131 | |||
| 2066 | Ga0395900_0004994 | |||
| 2067 | Ga0395900_0031950 | |||
| 2068 | Ga0395900_0038294 | |||
| 2069 | Ga0395900_0060468 | |||
| 2070 | Ga0395900_0092997 | |||
| 2071 | Ga0395900_0100905 | |||
| 2072 | Ga0395900_0116367 | |||
| 2073 | Ga0395900_0148556 | |||
| 2074 | Ga0395900_0195382 | |||
| 2075 | Ga0395900_0211688 | |||
| 2076 | Ga0395900_0325580 | |||
| 2077 | Ga0395900_0953340 | |||
| 2078 | Ga0395900_1792272 | |||
| 2079 | Ga0395900_1802833 | |||
| 2080 | Ga0395898_0012588 | |||
| 2081 | Ga0395898_0024798 | |||
| 2082 | Ga0395898_0032449 | |||
| 2083 | Ga0395898_0034625 | |||
| 2084 | Ga0395898_0139653 | |||
| 2085 | Ga0395898_0165325 | |||
| 2086 | Ga0395898_0216495 | |||
| 2087 | Ga0395898_0284132 | |||
| 2088 | Ga0395898_0462134 | |||
| 2089 | Ga0395898_0614924 | |||
| 2090 | Ga0395898_0623380 | |||
| 2091 | Ga0395898_0654143 | |||
| 2092 | Ga0395898_0682107 | |||
| 2093 | Ga0395898_0778388 | |||
| 2094 | Ga0395898_0805374 | |||
| 2095 | Ga0395898_0844186 | |||
| 2096 | Ga0395898_1070765 | |||
| 2097 | Ga0395898_1202504 | |||
| 2098 | Ga0395898_1831864 | |||
| 2099 | Ga0395905_0008722 | |||
| 2100 | Ga0395905_0017235 | |||
| 2101 | Ga0395905_0030278 | |||
| 2102 | Ga0395905_0063015 | |||
| 2103 | Ga0395905_0071047 | |||
| 2104 | Ga0395905_0084338 | |||
| 2105 | Ga0395905_0118945 | |||
| 2106 | Ga0395905_0189279 | |||
| 2107 | Ga0395905_0514574 | |||
| 2108 | Ga0395905_0680921 | |||
| 2109 | Ga0395905_1475913 | |||
| 2110 | Ga0395905_1590751 | |||
| 2111 | Ga0395905_1702839 | |||
| 2112 | Ga0395901_0016005 | |||
| 2113 | Ga0395901_0029057 | |||
| 2114 | Ga0395901_0075749 | |||
| 2115 | Ga0395901_0086731 | |||
| 2116 | Ga0395901_0102391 | |||
| 2117 | Ga0395901_0104092 | |||
| 2118 | Ga0395901_0261676 | |||
| 2119 | Ga0395901_0279775 | |||
| 2120 | Ga0395901_0345867 | |||
| 2121 | Ga0395901_0606860 | |||
| 2122 | Ga0395901_0685961 | |||
| 2123 | Ga0395901_0835623 | |||
| 2124 | Ga0395901_0976154 | |||
| 2125 | Ga0395901_1109951 | |||
| 2126 | Ga0395901_1247415 | |||
| 2127 | Ga0395901_1495514 | |||
| 2128 | Ga0395901_1569051 | |||
| 2129 | Ga0395901_2007554 | |||
| 2130 | Ga0395901_2168877 | |||
| 2131 | Ga0436363_0757383 | |||
| 2132 | Ga0436363_1248060 | |||
| 2133 | Ga0451789_0750565 | |||
| 2134 | Ga0451802_0868154 | |||
| 2135 | Ga0451804_0324483 | |||
| 2136 | Ga0451804_0902934 | |||
| 2137 | Ga0451835_0374119 | |||
| 2138 | Ga0451845_0032046 | |||
| 2139 | Ga0451847_0084372 | |||
| 2140 | Ga0451855_0925867 | |||
| 2141 | Ga0451853_0059643 | |||
| 2142 | Ga0451853_0985969 | |||
| 2143 | Ga0451853_1637661 | |||
| 2144 | Ga0451853_1720198 | |||
| 2145 | Ga0451853_3171944 | |||
| 2146 | Ga0439456_049348 | |||
| 2147 | Ga0450920_030727 | |||
| 2148 | Ga0439446_0258381 | |||
| 2149 | Ga0439434_0176571 | |||
| 2150 | Ga0439434_0178556 | |||
| 2151 | Ga0439434_0262141 | |||
| 2152 | Ga0450918_079474 | |||
| 2153 | Ga0439440_0088759 | |||
| 2154 | Ga0466969_0001492 | |||
| 2155 | Ga0466969_0197465 | |||
| 2156 | Ga0466965_0066542 | |||
| 2157 | Ga0466965_0069148 | |||
| 2158 | Ga0466965_0303375 | |||
| 2159 | Ga0466966_0034101 | |||
| 2160 | Ga0466966_0035783 | |||
| 2161 | Ga0466961_0157514 | |||
| 2162 | Ga0466961_0175381 | |||
| 2163 | Ga0466961_0522663 | |||
| 2164 | Ga0466963_0000204 | |||
| 2165 | Ga0466963_0014209 | |||
| 2166 | Ga0466963_0015277 | |||
| 2167 | Ga0466963_0017563 | |||
| 2168 | Ga0466963_0024185 | |||
| 2169 | Ga0466963_0029249 | |||
| 2170 | Ga0466963_0085823 | |||
| 2171 | Ga0466963_0118259 | |||
| 2172 | Ga0466963_0166629 | |||
| 2173 | Ga0466963_0211390 | |||
| 2174 | Ga0466963_0252886 | |||
| 2175 | Ga0466963_0290816 | |||
| 2176 | Ga0466963_0311487 | |||
| 2177 | Ga0466963_0335191 | |||
| 2178 | Ga0466963_0509571 | |||
| 2179 | Ga0466963_0701268 | |||
| 2180 | Ga0466964_0000525 | |||
| 2181 | Ga0466964_0001491 | |||
| 2182 | Ga0466964_0006802 | |||
| 2183 | Ga0466964_0012256 | |||
| 2184 | Ga0466964_0026419 | |||
| 2185 | Ga0466964_0026447 | |||
| 2186 | Ga0466964_0028706 | |||
| 2187 | Ga0466964_0030702 | |||
| 2188 | Ga0466964_0031117 | |||
| 2189 | Ga0466964_0123137 | |||
| 2190 | Ga0466964_0306500 | |||
| 2191 | Ga0466964_0544369 | |||
| 2192 | Ga0466971_0011514 | |||
| 2193 | Ga0466971_0012606 | |||
| 2194 | Ga0466971_0025691 | |||
| 2195 | Ga0466971_0253676 | |||
| 2196 | Ga0466968_0000801 | |||
| 2197 | Ga0466968_0007015 | |||
| 2198 | Ga0466968_0009682 | |||
| 2199 | Ga0466968_0059075 | |||
| 2200 | Ga0466968_0422442 | |||
| 2201 | Ga0466968_0629478 | |||
| 2202 | Ga0466968_0719769 | |||
| 2203 | Ga0466970_0014287 | |||
| 2204 | Ga0466970_0020882 | |||
| 2205 | Ga0466957_0002091 | |||
| 2206 | Ga0466957_0011348 | |||
| 2207 | Ga0466957_0015552 | |||
| 2208 | Ga0466957_0030857 | |||
| 2209 | Ga0466957_0049689 | |||
| 2210 | Ga0466957_0054829 | |||
| 2211 | Ga0466957_0128359 | |||
| 2212 | Ga0466957_0159111 | |||
| 2213 | Ga0466957_0261769 | |||
| 2214 | Ga0466957_0525814 | |||
| 2215 | Ga0466960_0015379 | |||
| 2216 | Ga0466960_0041353 | |||
| 2217 | Ga0466960_0057075 | |||
| 2218 | Ga0466960_0165768 | |||
| 2219 | Ga0466959_0003181 | |||
| 2220 | Ga0466959_0027682 | |||
| 2221 | Ga0466959_0452544 | |||
| 2222 | Ga0466959_0573187 | |||
| 2223 | Ga0451576_2149377 | |||
| 2224 | Ga0466958_0001352 | |||
| 2225 | Ga0466958_0003644 | |||
| 2226 | Ga0466958_0005628 | |||
| 2227 | Ga0466958_0018296 | |||
| 2228 | Ga0466958_0026737 | |||
| 2229 | Ga0466958_0045957 | |||
| 2230 | Ga0466958_0094073 | |||
| 2231 | Ga0466958_0353449 | |||
| 2232 | Ga0466958_0566881 | |||
| 2233 | Ga0466958_0589093 | |||
| 2234 | Ga0466967_0000181 | |||
| 2235 | Ga0466967_0009861 | |||
| 2236 | Ga0466967_0022326 | |||
| 2237 | Ga0466967_0026084 | |||
| 2238 | Ga0466967_0027383 | |||
| 2239 | Ga0466967_0031772 | |||
| 2240 | Ga0466967_0044789 | |||
| 2241 | Ga0466967_0059019 | |||
| 2242 | Ga0466967_0069914 | |||
| 2243 | Ga0466967_0079690 | |||
| 2244 | Ga0466967_0091803 | |||
| 2245 | Ga0466967_0110293 | |||
| 2246 | Ga0466967_0141593 | |||
| 2247 | Ga0466967_0236930 | |||
| 2248 | Ga0466967_0244046 | |||
| 2249 | Ga0466967_0257230 | |||
| 2250 | Ga0466967_0258307 | |||
| 2251 | Ga0466967_0293497 | |||
| 2252 | Ga0466967_0344126 | |||
| 2253 | Ga0466967_0352592 | |||
| 2254 | Ga0466967_0364046 | |||
| 2255 | Ga0466967_0402183 | |||
| 2256 | Ga0466967_0429179 | |||
| 2257 | Ga0466967_0445843 | |||
| 2258 | Ga0466967_0845191 | |||
| 2259 | Ga0466967_1258448 | |||
| 2260 | Ga0495592_0000855 | |||
| 2261 | Ga0495592_0019518 | |||
| 2262 | Ga0495592_0166496 | |||
| 2263 | Ga0495592_0889016 | |||
| 2264 | Ga0495603_0043959 | |||
| 2265 | Ga0495603_0120107 | |||
| 2266 | Ga0495603_0284048 | |||
| 2267 | Ga0495603_0841435 | |||
| 2268 | Ga0495629_0012606 | |||
| 2269 | Ga0495629_0674220 | |||
| 2270 | Ga0495641_0004595 | |||
| 2271 | Ga0495641_0053815 | |||
| 2272 | Ga0495641_0064101 | |||
| 2273 | Ga0495641_0202339 | |||
| 2274 | Ga0495641_0606957 | |||
| 2275 | Ga0495651_0000212 | |||
| 2276 | Ga0495651_0020811 | |||
| 2277 | Ga0495651_0141278 | |||
| 2278 | Ga0495651_0176284 | |||
| 2279 | Ga0495651_0723137 | |||
| 2280 | Ga0495653_0001446 | |||
| 2281 | Ga0495653_0018289 | |||
| 2282 | Ga0495653_0036085 | |||
| 2283 | Ga0495653_0203660 | |||
| 2284 | Ga0495653_0316241 | |||
| 2285 | Ga0495653_0806554 | |||
| 2286 | Ga0495653_0887915 | |||
| 2287 | Ga0495580_0009316 | |||
| 2288 | Ga0495580_0431534 | |||
| 2289 | Ga0495582_0002767 | |||
| 2290 | Ga0495582_0040748 | |||
| 2291 | Ga0495582_0065365 | |||
| 2292 | Ga0495582_0144955 | |||
| 2293 | Ga0495582_0526489 | |||
| 2294 | Ga0495605_0023411 | |||
| 2295 | Ga0495662_0015241 | |||
| 2296 | Ga0495662_0350949 | |||
| 2297 | Ga0495664_0015079 | |||
| 2298 | Ga0495664_0071234 | |||
| 2299 | Ga0495664_0285336 | |||
| 2300 | Ga0495664_0806816 | |||
| 2301 | Ga0495584_0017106 | |||
| 2302 | Ga0495584_0032208 | |||
| 2303 | Ga0495584_0372359 | |||
| 2304 | Ga0495584_0541669 | |||
| 2305 | Ga0495585_0045267 | |||
| 2306 | Ga0495585_0156981 | |||
| 2307 | Ga0495594_0555887 | |||
| 2308 | Ga0495596_0263583 | |||
| 2309 | Ga0495607_0052632 | |||
| 2310 | Ga0495608_0060308 | |||
| 2311 | Ga0495608_0090046 | |||
| 2312 | Ga0495608_0121447 | |||
| 2313 | Ga0495618_0002172 | |||
| 2314 | Ga0495618_0026233 | |||
| 2315 | Ga0495618_0119567 | |||
| 2316 | Ga0495618_0734055 | |||
| 2317 | Ga0495628_0007369 | |||
| 2318 | Ga0495628_0009418 | |||
| 2319 | Ga0495628_0308092 | |||
| 2320 | Ga0495628_0388628 | |||
| 2321 | Ga0495630_0029839 | |||
| 2322 | Ga0495630_0170267 | |||
| 2323 | Ga0495630_0927101 | |||
| 2324 | Ga0495631_0080982 | |||
| 2325 | Ga0495631_0277414 | |||
| 2326 | Ga0495631_0311193 | |||
| 2327 | Ga0495631_0315750 | |||
| 2328 | Ga0495632_0480601 | |||
| 2329 | Ga0495637_0131085 | |||
| 2330 | Ga0495637_0139995 | |||
| 2331 | Ga0495637_0188131 | |||
| 2332 | Ga0495644_0026161 | |||
| 2333 | Ga0495644_0051978 | |||
| 2334 | Ga0495663_0039660 | |||
| 2335 | Ga0495663_0109571 | |||
| 2336 | Ga0495666_0001893 | |||
| 2337 | Ga0495666_0303552 | |||
| 2338 | Ga0495642_0034245 | |||
| 2339 | Ga0495642_0119157 | |||
| 2340 | Ga0495652_0003999 | |||
| 2341 | Ga0495652_0021274 | |||
| 2342 | Ga0495652_0175255 | |||
| 2343 | Ga0495652_0413911 | |||
| 2344 | Ga0495665_0005635 | |||
| 2345 | Ga0495665_0060705 | |||
| 2346 | Ga0495640_0268452 | |||
| 2347 | Ga0495640_0697446 | |||
| 2348 | Ga0495586_0003441 | |||
| 2349 | Ga0495586_0174613 | |||
| 2350 | Ga0495586_0669445 | |||
| 2351 | Ga0495587_0000222 | |||
| 2352 | Ga0495587_0099147 | |||
| 2353 | Ga0495598_0242878 | |||
| 2354 | Ga0495609_0054736 | |||
| 2355 | Ga0495609_0217645 | |||
| 2356 | Ga0495609_0285816 | |||
| 2357 | Ga0495645_0000046 | |||
| 2358 | Ga0495645_0095030 | |||
| 2359 | Ga0495645_0106024 | |||
| 2360 | Ga0495645_0700834 | |||
| 2361 | Ga0495622_0378658 | |||
| 2362 | Ga0495667_0028470 | |||
| 2363 | Ga0495667_0078025 | |||
| 2364 | Ga0495667_0384299 | |||
| 2365 | Ga0495667_0390873 | |||
| 2366 | Ga0495667_0545631 | |||
| 2367 | Ga0495656_0012605 | |||
| 2368 | Ga0495656_0045250 | |||
| 2369 | Ga0495656_0507572 | |||
| 2370 | Ga0495656_0615010 | |||
| 2371 | Ga0495634_0122156 | |||
| 2372 | Ga0495634_0390201 | |||
| 2373 | Ga0495634_0624083 | |||
| 2374 | Ga0495611_0147802 | |||
| 2375 | Ga0495611_0169759 | |||
| 2376 | Ga0495611_0216880 | |||
| 2377 | Ga0495611_0303564 | |||
| 2378 | Ga0495611_0394721 | |||
| 2379 | Ga0495635_0022233 | |||
| 2380 | Ga0495635_0083552 | |||
| 2381 | Ga0495635_0347709 | |||
| 2382 | Ga0495635_0379613 | |||
| 2383 | Ga0495659_0037005 | |||
| 2384 | Ga0495659_0230790 | |||
| 2385 | Ga0495661_0221249 | |||
| 2386 | Ga0495661_0560457 | |||
| 2387 | Ga0495588_0294629 | |||
| 2388 | Ga0495588_0549730 | |||
| 2389 | Ga0495657_0024246 | |||
| 2390 | Ga0495657_0041434 | |||
| 2391 | Ga0495657_0048953 | |||
| 2392 | Ga0495657_0110267 | |||
| 2393 | Ga0495657_0212395 | |||
| 2394 | Ga0495657_0529325 | |||
| 2395 | Ga0495657_0695244 | |||
| 2396 | Ga0495599_0000639 | |||
| 2397 | Ga0495599_0115213 | |||
| 2398 | Ga0495599_0183936 | |||
| 2399 | Ga0495599_0384988 | |||
| 2400 | Ga0495599_0390522 | |||
| 2401 | Ga0495623_0000251 | |||
| 2402 | Ga0495623_0338667 | |||
| 2403 | Ga0495646_0000422 | |||
| 2404 | Ga0495646_0015120 | |||
| 2405 | Ga0495646_0102796 | |||
| 2406 | Ga0495647_0000834 | |||
| 2407 | Ga0495647_0045139 | |||
| 2408 | Ga0495647_0234429 | |||
| 2409 | Ga0495658_0102412 | |||
| 2410 | Ga0495658_0115358 | |||
| 2411 | Ga0495658_0942690 | |||
| 2412 | Ga0495613_0013430 | |||
| 2413 | Ga0495613_0098739 | |||
| 2414 | Ga0495613_0403375 | |||
| 2415 | Ga0495613_0820291 | |||
| 2416 | Ga0495624_0008296 | |||
| 2417 | Ga0495624_0163365 | |||
| 2418 | Ga0495624_0628742 | |||
| 2419 | Ga0495670_0139049 | |||
| 2420 | Ga0495670_0264854 | |||
| 2421 | Ga0495671_0174386 | |||
| 2422 | Ga0495671_0354862 | |||
| 2423 | Ga0495671_0493397 | |||
| 2424 | Ga0495589_0119319 | |||
| 2425 | Ga0495589_0158296 | |||
| 2426 | Ga0495600_0024213 | |||
| 2427 | Ga0495600_0189657 | |||
| 2428 | Ga0495600_0543855 | |||
| 2429 | Ga0495660_0296903 | |||
| 2430 | Ga0495581_0002332 | |||
| 2431 | Ga0495581_0009997 | |||
| 2432 | Ga0495581_0037945 | |||
| 2433 | Ga0495581_0106297 | |||
| 2434 | Ga0495604_0000060 | |||
| 2435 | Ga0495604_0114920 | |||
| 2436 | Ga0495636_0210153 | |||
| 2437 | Ga0495636_0219862 | |||
| 2438 | Ga0495636_0259134 | |||
| 2439 | Ga0495674_0018747 | |||
| 2440 | Ga0495674_0069586 | |||
| 2441 | Ga0495674_0099406 | |||
| 2442 | Ga0495674_0451212 | |||
| 2443 | Ga0495674_0451557 | |||
| 2444 | Ga0495674_0721913 | |||
| 2445 | Ga0495676_0162697 | |||
| 2446 | Ga0495676_0327785 | |||
| 2447 | Ga0495676_0533090 | |||
| 2448 | Ga0495676_1052380 | |||
| 2449 | Ga0495680_0008960 | |||
| 2450 | Ga0495680_0146339 | |||
| 2451 | Ga0495680_0307237 | |||
| 2452 | Ga0495680_0615690 | |||
| 2453 | Ga0495680_1044839 | |||
| 2454 | Ga0495675_0000945 | |||
| 2455 | Ga0495675_0186877 | |||
| 2456 | Ga0495677_0097533 | |||
| 2457 | Ga0495677_0177237 | |||
| 2458 | Ga0495677_0243447 | |||
| 2459 | Ga0495685_049568 | |||
| 2460 | Ga0495684_0021330 | |||
| 2461 | Ga0495684_0112846 | |||
| 2462 | Ga0495684_0157972 | |||
| 2463 | Ga0495684_0186308 | |||
| 2464 | Ga0495684_0473075 | |||
| 2465 | Ga0495684_0614504 | |||
| 2466 | Ga0495593_0020568 | |||
| 2467 | Ga0495602_0000075 | |||
| 2468 | Ga0495602_0154588 | |||
| 2469 | Ga0495602_0192851 | |||
| 2470 | Ga0495602_0404607 | |||
| 2471 | Ga0495602_1165545 | |||
| 2472 | Ga0495614_0002887 | |||
| 2473 | Ga0495614_0263898 | |||
| 2474 | Ga0495615_0071890 | |||
| 2475 | Ga0495615_0112308 | |||
| 2476 | Ga0496100_0102279 | |||
| 2477 | Ga0496100_0185088 | |||
| 2478 | Ga0496100_0957761 | |||
| 2479 | Ga0496101_0089534 | |||
| 2480 | Ga0496101_0229499 | |||
| 2481 | Ga0496101_0443865 | |||
| 2482 | Ga0496101_0512107 | |||
| 2483 | Ga0496101_0718085 | |||
| 2484 | Ga0496101_1372174 | |||
| 2485 | Ga0496101_1591152 | |||
| 2486 | Ga0496102_0028607 | |||
| 2487 | Ga0496102_0258175 | |||
| 2488 | Ga0496102_0539834 | |||
| 2489 | Ga0496102_0550000 | |||
| 2490 | Ga0496102_0589406 | |||
| 2491 | Ga0496103_0247088 | |||
| 2492 | Ga0496103_0665987 | |||
| 2493 | Ga0496104_0004956 | |||
| 2494 | Ga0496104_0555769 | |||
| 2495 | Ga0496104_0762598 | |||
| 2496 | Ga0496104_0896662 | |||
| 2497 | Ga0496105_0102049 | |||
| 2498 | Ga0496105_0112441 | |||
| 2499 | Ga0496105_1018211 | |||
| 2500 | Ga0496106_0723615 | |||
| 2501 | Ga0496107_0010503 | |||
| 2502 | Ga0496107_0184911 | |||
| 2503 | Ga0496107_0778797 | |||
| 2504 | Ga0496107_0863376 | |||
| 2505 | Ga0496107_1185857 | |||
| 2506 | Ga0496108_0010095 | |||
| 2507 | Ga0496108_0088154 | |||
| 2508 | Ga0496108_0133480 | |||
| 2509 | Ga0496108_0159613 | |||
| 2510 | Ga0496108_0333171 | |||
| 2511 | Ga0496108_1430922 | |||
| 2512 | Ga0496109_0007693 | |||
| 2513 | Ga0496109_0117632 | |||
| 2514 | Ga0496109_0205153 | |||
| 2515 | Ga0496109_0370744 | |||
| 2516 | Ga0496109_1018014 | |||
| 2517 | Ga0496110_0102414 | |||
| 2518 | Ga0496110_0140288 | |||
| 2519 | Ga0496110_0235387 | |||
| 2520 | Ga0496110_0278944 | |||
| 2521 | Ga0496110_0431264 | |||
| 2522 | Ga0496111_0017701 | |||
| 2523 | Ga0496111_0053276 | |||
| 2524 | Ga0496111_0125478 | |||
| 2525 | Ga0496111_0215581 | |||
| 2526 | Ga0496111_0357568 | |||
| 2527 | Ga0496111_1171519 | |||
| 2528 | Ga0496112_0000923 | |||
| 2529 | Ga0496112_0021521 | |||
| 2530 | Ga0496112_0869388 | |||
| 2531 | Ga0496112_1911966 | |||
| 2532 | Ga0496113_0002105 | |||
| 2533 | Ga0496113_0044117 | |||
| 2534 | Ga0496113_0284113 | |||
| 2535 | Ga0496113_0443233 | |||
| 2536 | Ga0496113_0469181 | |||
| 2537 | Ga0496114_0024644 | |||
| 2538 | Ga0496114_0037533 | |||
| 2539 | Ga0496114_1327037 | |||
| 2540 | Ga0496115_0016488 | |||
| 2541 | Ga0496115_0068132 | |||
| 2542 | Ga0496115_0518945 | |||
| 2543 | Ga0501031_0001012 | |||
| 2544 | Ga0501031_0937198 | |||
| 2545 | Ga0501032_0025165 | |||
| 2546 | Ga0501032_0909172 | |||
| 2547 | Ga0501033_0008261 | |||
| 2548 | Ga0501033_1038555 | |||
| 2549 | Ga0501034_0009842 | |||
| 2550 | Ga0501036_0271251 | |||
| 2551 | Ga0501037_0012138 | |||
| 2552 | Ga0501038_0024708 | |||
| 2553 | Ga0501038_0650641 | |||
| 2554 | Ga0501039_0041164 | |||
| 2555 | Ga0501039_0849484 | |||
| 2556 | Ga0501040_0045509 | |||
| 2557 | Ga0501040_0305629 | |||
| 2558 | Ga0501040_0938449 | |||
| 2559 | Ga0501041_0028936 | |||
| 2560 | Ga0501042_0132929 | |||
| 2561 | Ga0501042_1268652 | |||
| 2562 | Ga0501046_1239182 | |||
| 2563 | Ga0501047_0049836 | |||
| 2564 | Ga0501047_0296434 | |||
| 2565 | Ga0501047_0594998 | |||
| 2566 | Ga0501048_0365509 | |||
| 2567 | Ga0501048_0762751 | |||
| 2568 | Ga0501067_0157682 | |||
| 2569 | Ga0501067_0470692 | |||
| 2570 | Ga0501067_0693793 | |||
| 2571 | Ga0501067_0714745 | |||
| 2572 | Ga0501068_0033680 | |||
| 2573 | Ga0501069_0003683 | |||
| 2574 | Ga0501069_0006399 | |||
| 2575 | Ga0501069_0433818 | |||
| 2576 | Ga0501070_0008092 | |||
| 2577 | Ga0501070_0009660 | |||
| 2578 | Ga0501070_0023376 | |||
| 2579 | Ga0501070_1282437 | |||
| 2580 | Ga0501071_0115574 | |||
| 2581 | Ga0501071_0521338 | |||
| 2582 | Ga0501071_0712498 | |||
| 2583 | Ga0501072_0019588 | |||
| 2584 | Ga0501072_0086998 | |||
| 2585 | Ga0501072_0304032 | |||
| 2586 | Ga0501072_0310286 | |||
| 2587 | Ga0501072_0685305 | |||
| 2588 | Ga0501072_1520489 | |||
| 2589 | Ga0501073_0021497 | |||
| 2590 | Ga0501073_0080734 | |||
| 2591 | Ga0501073_0133816 | |||
| 2592 | Ga0501074_0027051 | |||
| 2593 | Ga0501074_0044167 | |||
| 2594 | Ga0501074_0203330 | |||
| 2595 | Ga0501074_0458335 | |||
| 2596 | Ga0501075_0029501 | |||
| 2597 | Ga0501075_0714169 | |||
| 2598 | Ga0501076_0266662 | |||
| 2599 | Ga0501076_0295043 | |||
| 2600 | Ga0501076_0441948 | |||
| 2601 | Ga0501077_0020612 | |||
| 2602 | Ga0501077_0387732 | |||
| 2603 | Ga0501079_0036147 | |||
| 2604 | Ga0501079_0050361 | |||
| 2605 | Ga0501079_0117715 | |||
| 2606 | Ga0501079_0145933 | |||
| 2607 | Ga0501079_0573396 | |||
| 2608 | Ga0501079_0591796 | |||
| 2609 | Ga0501079_1401655 | |||
| 2610 | Ga0501080_0001641 | |||
| 2611 | Ga0501080_0065360 | |||
| 2612 | Ga0501080_0306917 | |||
| 2613 | Ga0501080_1045156 | |||
| 2614 | Ga0501080_1823550 | |||
| 2615 | Ga0501081_0877501 | |||
| 2616 | Ga0501081_1388693 | |||
| 2617 | Ga0501083_0003877 | |||
| 2618 | Ga0501083_0019333 | |||
| 2619 | Ga0501035_0258020 | |||
| 2620 | Ga0501044_0505690 | |||
| 2621 | Ga0501045_0162683 | |||
| 2622 | Ga0501045_0362956 | |||
| 2623 | Ga0501045_1241571 | |||
| 2624 | Ga0501045_1307571 | |||
| 2625 | nmdc:mga03683_563279_c1 | |||
| 2626 | nmdc:mga00v17_14681_c1 | |||
| 2627 | nmdc:mga0yw44_139203_c1 | |||
| 2628 | nmdc:mga0yw44_378205_c1 | |||
| 2629 | nmdc:mga0yw44_457609_c1 | |||
| 2630 | nmdc:mga0yw44_766966_c1 | |||
| 2631 | nmdc:mga0yw44_92898_c1 | |||
| 2632 | nmdc:mga05p37_113407_c1 | |||
| 2633 | nmdc:mga05p37_114104_c1 | |||
| 2634 | nmdc:mga05p37_189606_c1 | |||
| 2635 | nmdc:mga05p37_73071_c1 | |||
| 2636 | nmdc:mga05p37_86224_c1 | |||
| 2637 | nmdc:mga09592_216280_c1 | |||
| 2638 | nmdc:mga09592_41366_c1 | |||
| 2639 | nmdc:mga09592_450367_c1 | |||
| 2640 | nmdc:mga09592_88586_c1 | |||
| 2641 | nmdc:mga0qj67_182705_c1 | |||
| 2642 | nmdc:mga0qj67_19339_c1 | |||
| 2643 | nmdc:mga0qj67_971948_c1 | |||
| 2644 | nmdc:mga06r32_1689327_c1 | |||
| 2645 | nmdc:mga06r32_386229_c1 | |||
| 2646 | nmdc:mga08y16_1013556_c1 | |||
| 2647 | nmdc:mga08y16_1229767_c1 | |||
| 2648 | nmdc:mga08y16_280347_c1 | |||
| 2649 | nmdc:mga08y16_334453_c1 | |||
| 2650 | nmdc:mga08y16_47338_c1 | |||
| 2651 | nmdc:mga08y16_74491_c1 | |||
| 2652 | nmdc:mga0n895_1413768_c1 | |||
| 2653 | nmdc:mga0n895_22609_c1 | |||
| 2654 | nmdc:mga0rr50_246891_c1 | |||
| 2655 | nmdc:mga08x19_1198664_c1 | |||
| 2656 | nmdc:mga08x19_1206499_c1 | |||
| 2657 | nmdc:mga08x19_387963_c1 | |||
| 2658 | nmdc:mga08x19_900738_c1 | |||
| 2659 | Ga0495601_0005580 | |||
| 2660 | Ga0495601_0033955 | |||
| 2661 | Ga0495601_0166223 | |||
| 2662 | Ga0495601_0402423 | |||
| 2663 | Ga0495601_0416364 | |||
| 2664 | Ga0495612_0002185 | |||
| 2665 | Ga0495612_0049024 | |||
| 2666 | Ga0495612_0054344 | |||
| 2667 | Ga0495595_0010692 | |||
| 2668 | Ga0495595_0020029 | |||
| 2669 | Ga0495595_0164363 | |||
| 2670 | Ga0495595_0390251 | |||
| 2671 | Ga0495619_0001216 | |||
| 2672 | Ga0495619_0004788 | |||
| 2673 | Ga0495619_0367569 | |||
| 2674 | Ga0495619_1085748 | |||
| 2675 | Ga0500566_0045947 | |||
| 2676 | Ga0501084_0054255 | |||
| 2677 | Ga0501084_0377208 | |||
| 2678 | Ga0501084_0380565 | |||
| 2679 | Ga0501082_0161373 | |||
| 2680 | Ga0501082_0242459 | |||
| 2681 | Ga0501082_0379608 | |||
| 2682 | Ga0501082_0400102 | |||
| 2683 | Ga0466962_0003673 | |||
| 2684 | Ga0466962_0006283 | |||
| 2685 | Ga0466962_0024877 | |||
| 2686 | Ga0530510_0183049 | |||
| 2687 | Ga0530510_0284309 | |||
| 2688 | Ga0530510_1239007 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xt9-assembly1.cif.gz_A | crystal structure of den1 in complex with nedd8 | 0.451 | 47 | 78 |
| 8isk-assembly1.cif.gz_B | pr conformer of zea mays phytochrome a1 - zmphya1-pr | 0.3982 | 8 | 55 |
| 8isj-assembly1.cif.gz_A | pr conformer of arabidopsis thaliana phytochrome a - atphya-pr | 0.3682 | 6 | 55 |
| 2gvk-assembly1.cif.gz_A | crystal structure of a dye-decolorizing peroxidase (dyp) from bacteroides thetaiotaomicron vpi-5482 at 1.6 a resolution | 0.3663 | 9 | 41 |
| 5cnx-assembly1.cif.gz_C | crystal structure of xaa-pro aminopeptidase from escherichia coli k12 | 0.3462 | 8 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0J7V1_31_407_3.40.50.12780 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.6447 | 57 | 91 | 3.40.50.12780 |
| af_P11458_25_111_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.6097 | 54 | 78 | 3.40.50.10800 |
| af_Q6XFQ1_960_1123_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.5364 | 18 | 55 | 3.30.565.10 |
| af_C1PHB8_964_1129_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.5054 | 18 | 55 | 3.30.565.10 |
| af_Q09732_2_101_2.60.40.4370 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.4969 | 6 | 52 | 2.60.40.4370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9L0S4-F1-model_v4 | Uncharacterized protein | 0.9553 | 1 | 85 |
|
| AF-A0A7V8XI54-F1-model_v4 | Uncharacterized protein | 0.9499 | 4 | 89 |
|
| AF-A0A1F2XT51-F1-model_v4 | Uncharacterized protein | 0.9384 | 1 | 89 |
|
| AF-A0A7V9G1P9-F1-model_v4 | Uncharacterized protein | 0.9241 | 1 | 92 |
|
| AF-A0A7V9G1P9-F1-model_v4 | Uncharacterized protein | 0.9143 | 1 | 92 |
|