F492999
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1323 | 425 | 2646 | 42 |
Family's Representative Sequence
| Representative Sequence | 3300005440|Ga0070705_100227102|Ga0070705_1002271023 |
| Length | 43 |
| Sequence | MVATRRRFNPNLQKVRIQEEGGGTRRVYVCARCLKSNKVTKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 192 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 228 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 231 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 232 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 237 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 238 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 239 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 240 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 241 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 242 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 243 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 246 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 251 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 252 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 352 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 355 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 356 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 358 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 359 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 360 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 389 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 390 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 392 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 393 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 399 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 404 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 423 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.17 |
| Metatranscriptomes | 0.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.12 |
| Nodule | 0 |
| Rhizoplane | 7.71 |
| Rhizosphere | 87.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070705_100227102 | 3300005440 | Bacteria | 1296 |
| 2 | LJQas_1017724 | 3300000549 | Bacteria | 829 |
| 3 | JGI25407J50210_10000647 | 3300003373 | Bacteria | 7153 |
| 4 | JGI25407J50210_10005201 | 3300003373 | Bacteria | 3191 |
| 5 | JGI25407J50210_10022663 | 3300003373 | Bacteria | 1632 |
| 6 | JGI25407J50210_10068884 | 3300003373 | Bacteria | 884 |
| 7 | JGI25407J50210_10107413 | 3300003373 | Bacteria | 689 |
| 8 | JGI25404J52841_10057976 | 3300003659 | Bacteria | 812 |
| 9 | Ga0070658_10007864 | 3300005327 | Bacteria | 8588 |
| 10 | Ga0070658_10124271 | 3300005327 | Bacteria | 2147 |
| 11 | Ga0070683_100001059 | 3300005329 | Bacteria | 20635 |
| 12 | Ga0070683_100057240 | 3300005329 | Bacteria | 3621 |
| 13 | Ga0070683_100063493 | 3300005329 | Bacteria | 3435 |
| 14 | Ga0070683_100100993 | 3300005329 | Bacteria | 2716 |
| 15 | Ga0070683_100299884 | 3300005329 | Bacteria | 1529 |
| 16 | Ga0070683_101848547 | 3300005329 | Bacteria | 580 |
| 17 | Ga0068869_101965336 | 3300005334 | Bacteria | 525 |
| 18 | Ga0070680_100833674 | 3300005336 | Unclassified | 795 |
| 19 | Ga0070682_100714598 | 3300005337 | Bacteria | 805 |
| 20 | Ga0070682_100944089 | 3300005337 | Unclassified | 712 |
| 21 | Ga0068868_100063354 | 3300005338 | Bacteria | 2933 |
| 22 | Ga0068868_100155040 | 3300005338 | Bacteria | 1888 |
| 23 | Ga0068868_101132531 | 3300005338 | Bacteria | 721 |
| 24 | Ga0068868_101209270 | 3300005338 | Unclassified | 699 |
| 25 | Ga0070660_100010723 | 3300005339 | Bacteria | 6485 |
| 26 | Ga0070660_100015124 | 3300005339 | Bacteria | 5568 |
| 27 | Ga0070660_100142980 | 3300005339 | Bacteria | 1920 |
| 28 | Ga0070660_100319916 | 3300005339 | Bacteria | 1274 |
| 29 | Ga0070660_100615165 | 3300005339 | Bacteria | 909 |
| 30 | Ga0070660_100949883 | 3300005339 | Unclassified | 726 |
| 31 | Ga0070660_101339250 | 3300005339 | Bacteria | 608 |
| 32 | Ga0070689_100736887 | 3300005340 | Bacteria | 863 |
| 33 | Ga0070691_10024769 | 3300005341 | Bacteria | 2791 |
| 34 | Ga0070687_100792589 | 3300005343 | Bacteria | 671 |
| 35 | Ga0070661_100680876 | 3300005344 | Bacteria | 837 |
| 36 | Ga0070668_100478566 | 3300005347 | Bacteria | 1075 |
| 37 | Ga0070675_100241136 | 3300005354 | Bacteria | 1580 |
| 38 | Ga0070674_100952254 | 3300005356 | Bacteria | 751 |
| 39 | Ga0070674_101213647 | 3300005356 | Bacteria | 670 |
| 40 | Ga0070673_100954556 | 3300005364 | Unclassified | 797 |
| 41 | Ga0070667_101413814 | 3300005367 | Bacteria | 653 |
| 42 | Ga0070667_102059687 | 3300005367 | Bacteria | 538 |
| 43 | Ga0070703_10032059 | 3300005406 | Bacteria | 1594 |
| 44 | Ga0070709_10415941 | 3300005434 | Bacteria | 1006 |
| 45 | Ga0070709_10537350 | 3300005434 | Bacteria | 893 |
| 46 | Ga0070714_100001136 | 3300005435 | Bacteria | 19099 |
| 47 | Ga0070714_100065991 | 3300005435 | Bacteria | 3118 |
| 48 | Ga0070714_100078366 | 3300005435 | Bacteria | 2872 |
| 49 | Ga0070714_100120288 | 3300005435 | Bacteria | 2335 |
| 50 | Ga0070713_100104043 | 3300005436 | Bacteria | 2464 |
| 51 | Ga0070713_101608955 | 3300005436 | Bacteria | 630 |
| 52 | Ga0070701_10026041 | 3300005438 | Bacteria | 2847 |
| 53 | Ga0070701_10985559 | 3300005438 | Bacteria | 587 |
| 54 | Ga0070700_100328299 | 3300005441 | Bacteria | 1126 |
| 55 | Ga0070700_101745335 | 3300005441 | Bacteria | 535 |
| 56 | Ga0070694_100043377 | 3300005444 | Bacteria | 3007 |
| 57 | Ga0070694_100169544 | 3300005444 | Bacteria | 1607 |
| 58 | Ga0070694_100377477 | 3300005444 | Bacteria | 1105 |
| 59 | Ga0070678_100800268 | 3300005456 | Bacteria | 856 |
| 60 | Ga0070662_101328203 | 3300005457 | Bacteria | 619 |
| 61 | Ga0070681_10013572 | 3300005458 | Bacteria | 8104 |
| 62 | Ga0070681_10039257 | 3300005458 | Bacteria | 4746 |
| 63 | Ga0070681_10176122 | 3300005458 | Bacteria | 2061 |
| 64 | Ga0070681_10461811 | 3300005458 | Bacteria | 1182 |
| 65 | Ga0068867_101001567 | 3300005459 | Bacteria | 758 |
| 66 | Ga0070706_100402194 | 3300005467 | Bacteria | 1275 |
| 67 | Ga0070679_100040168 | 3300005530 | Bacteria | 4654 |
| 68 | Ga0070679_100064556 | 3300005530 | Bacteria | 3649 |
| 69 | Ga0070679_100150535 | 3300005530 | Bacteria | 2304 |
| 70 | Ga0070679_100242417 | 3300005530 | Bacteria | 1760 |
| 71 | Ga0070684_100011356 | 3300005535 | Bacteria | 7093 |
| 72 | Ga0070684_100025743 | 3300005535 | Bacteria | 4947 |
| 73 | Ga0070684_100041508 | 3300005535 | Bacteria | 3967 |
| 74 | Ga0070684_100156327 | 3300005535 | Bacteria | 2068 |
| 75 | Ga0070684_100285121 | 3300005535 | Bacteria | 1514 |
| 76 | Ga0070684_100309997 | 3300005535 | Bacteria | 1449 |
| 77 | Ga0070684_100466353 | 3300005535 | Bacteria | 1168 |
| 78 | Ga0070684_100578048 | 3300005535 | Bacteria | 1044 |
| 79 | Ga0070684_102104819 | 3300005535 | Unclassified | 532 |
| 80 | Ga0070672_100485316 | 3300005543 | Bacteria | 1067 |
| 81 | Ga0070686_100467639 | 3300005544 | Bacteria | 972 |
| 82 | Ga0070686_101591475 | 3300005544 | Bacteria | 553 |
| 83 | Ga0070695_100392892 | 3300005545 | Bacteria | 1049 |
| 84 | Ga0070695_101208308 | 3300005545 | Bacteria | 622 |
| 85 | Ga0070696_100101771 | 3300005546 | Bacteria | 2060 |
| 86 | Ga0070693_100323787 | 3300005547 | Bacteria | 1046 |
| 87 | Ga0070704_100447342 | 3300005549 | Bacteria | 1112 |
| 88 | Ga0070704_100575373 | 3300005549 | Bacteria | 987 |
| 89 | Ga0070704_101522138 | 3300005549 | Unclassified | 616 |
| 90 | Ga0068855_100102069 | 3300005563 | Bacteria | 3301 |
| 91 | Ga0068855_100171627 | 3300005563 | Bacteria | 2456 |
| 92 | Ga0070664_100223218 | 3300005564 | Bacteria | 1686 |
| 93 | Ga0070664_100345353 | 3300005564 | Bacteria | 1353 |
| 94 | Ga0068857_100003516 | 3300005577 | Bacteria | 13090 |
| 95 | Ga0068857_100757056 | 3300005577 | Bacteria | 925 |
| 96 | Ga0068854_100071784 | 3300005578 | Bacteria | 2533 |
| 97 | Ga0068854_102081360 | 3300005578 | Bacteria | 524 |
| 98 | Ga0068856_100725950 | 3300005614 | Bacteria | 1014 |
| 99 | Ga0070702_100579372 | 3300005615 | Bacteria | 838 |
| 100 | Ga0068852_100113091 | 3300005616 | Bacteria | 2472 |
| 101 | Ga0068852_102279397 | 3300005616 | Unclassified | 563 |
| 102 | Ga0068864_100026766 | 3300005618 | Bacteria | 4864 |
| 103 | Ga0068866_10096800 | 3300005718 | Bacteria | 1619 |
| 104 | Ga0068861_100052837 | 3300005719 | Bacteria | 3089 |
| 105 | Ga0068861_100590363 | 3300005719 | Bacteria | 1018 |
| 106 | Ga0068870_10045088 | 3300005840 | Bacteria | 2306 |
| 107 | Ga0068863_100024380 | 3300005841 | Bacteria | 5769 |
| 108 | Ga0068863_102459852 | 3300005841 | Bacteria | 530 |
| 109 | Ga0068858_101965791 | 3300005842 | Unclassified | 578 |
| 110 | Ga0068860_101534317 | 3300005843 | Bacteria | 688 |
| 111 | Ga0068862_100047767 | 3300005844 | Bacteria | 3654 |
| 112 | Ga0068862_100932786 | 3300005844 | Bacteria | 855 |
| 113 | Ga0081455_10014766 | 3300005937 | Bacteria | 7621 |
| 114 | Ga0081455_10016928 | 3300005937 | Bacteria | 7008 |
| 115 | Ga0081455_10026800 | 3300005937 | Bacteria | 5293 |
| 116 | Ga0081455_10040246 | 3300005937 | Bacteria | 4124 |
| 117 | Ga0081455_10052293 | 3300005937 | Bacteria | 3498 |
| 118 | Ga0081455_10081825 | 3300005937 | Bacteria | 2643 |
| 119 | Ga0081455_10207081 | 3300005937 | Bacteria | 1464 |
| 120 | Ga0081455_10242934 | 3300005937 | Bacteria | 1322 |
| 121 | Ga0081455_10764175 | 3300005937 | Bacteria | 610 |
| 122 | Ga0081538_10000686 | 3300005981 | Bacteria | 37157 |
| 123 | Ga0081538_10001097 | 3300005981 | Bacteria | 28701 |
| 124 | Ga0081538_10001861 | 3300005981 | Bacteria | 21273 |
| 125 | Ga0081538_10002388 | 3300005981 | Bacteria | 18442 |
| 126 | Ga0081538_10002813 | 3300005981 | Bacteria | 16663 |
| 127 | Ga0081538_10003603 | 3300005981 | Bacteria | 14547 |
| 128 | Ga0081538_10017552 | 3300005981 | Bacteria | 5425 |
| 129 | Ga0081538_10017844 | 3300005981 | Bacteria | 5362 |
| 130 | Ga0081538_10021571 | 3300005981 | Bacteria | 4691 |
| 131 | Ga0081538_10062508 | 3300005981 | Bacteria | 2123 |
| 132 | Ga0081538_10110686 | 3300005981 | Bacteria | 1349 |
| 133 | Ga0081538_10226752 | 3300005981 | Bacteria | 734 |
| 134 | Ga0081538_10230790 | 3300005981 | Bacteria | 723 |
| 135 | Ga0081540_1002544 | 3300005983 | Bacteria | 14794 |
| 136 | Ga0081539_10001667 | 3300005985 | Bacteria | 35954 |
| 137 | Ga0070717_10289536 | 3300006028 | Unclassified | 1454 |
| 138 | Ga0070717_11161192 | 3300006028 | Bacteria | 703 |
| 139 | Ga0075365_10462217 | 3300006038 | Bacteria | 896 |
| 140 | Ga0075365_10687895 | 3300006038 | Bacteria | 723 |
| 141 | Ga0075363_100017261 | 3300006048 | Bacteria | 3576 |
| 142 | Ga0075363_100287975 | 3300006048 | Bacteria | 951 |
| 143 | Ga0075364_10097521 | 3300006051 | Bacteria | 1955 |
| 144 | Ga0075364_10863816 | 3300006051 | Bacteria | 616 |
| 145 | Ga0075432_10006106 | 3300006058 | Bacteria | 4097 |
| 146 | Ga0070716_100712877 | 3300006173 | Bacteria | 768 |
| 147 | Ga0075367_10033149 | 3300006178 | Bacteria | 2975 |
| 148 | Ga0075367_10795167 | 3300006178 | Bacteria | 602 |
| 149 | Ga0075369_10071411 | 3300006186 | Bacteria | 1528 |
| 150 | Ga0097621_100136434 | 3300006237 | Bacteria | 2093 |
| 151 | Ga0097621_100213429 | 3300006237 | Bacteria | 1679 |
| 152 | Ga0097621_102279418 | 3300006237 | Bacteria | 518 |
| 153 | Ga0068871_100110576 | 3300006358 | Bacteria | 2311 |
| 154 | Ga0068871_100307878 | 3300006358 | Bacteria | 1392 |
| 155 | Ga0068871_101458547 | 3300006358 | Bacteria | 646 |
| 156 | Ga0075428_100046907 | 3300006844 | Bacteria | 4745 |
| 157 | Ga0075430_100147442 | 3300006846 | Bacteria | 1960 |
| 158 | Ga0075430_100491366 | 3300006846 | Bacteria | 1013 |
| 159 | Ga0075430_100690129 | 3300006846 | Bacteria | 842 |
| 160 | Ga0075430_101382667 | 3300006846 | Unclassified | 579 |
| 161 | Ga0075431_100695154 | 3300006847 | Bacteria | 995 |
| 162 | Ga0075431_100809498 | 3300006847 | Bacteria | 910 |
| 163 | Ga0075431_100820400 | 3300006847 | Bacteria | 903 |
| 164 | Ga0075431_101721097 | 3300006847 | Bacteria | 584 |
| 165 | Ga0075433_10009068 | 3300006852 | Bacteria | 7947 |
| 166 | Ga0075434_100119151 | 3300006871 | Bacteria | 2653 |
| 167 | Ga0075434_100123574 | 3300006871 | Bacteria | 2604 |
| 168 | Ga0075434_100281669 | 3300006871 | Bacteria | 1682 |
| 169 | Ga0075429_100739732 | 3300006880 | Bacteria | 861 |
| 170 | Ga0075429_100785762 | 3300006880 | Bacteria | 834 |
| 171 | Ga0075429_101859883 | 3300006880 | Bacteria | 522 |
| 172 | Ga0068865_100687067 | 3300006881 | Bacteria | 873 |
| 173 | Ga0068865_101845625 | 3300006881 | Bacteria | 547 |
| 174 | Ga0068865_101986013 | 3300006881 | Bacteria | 528 |
| 175 | Ga0075436_101264060 | 3300006914 | Bacteria | 558 |
| 176 | Ga0075436_101400980 | 3300006914 | Bacteria | 530 |
| 177 | Ga0075435_100574943 | 3300007076 | Bacteria | 977 |
| 178 | Ga0105251_10226261 | 3300009011 | Bacteria | 842 |
| 179 | Ga0105251_10466809 | 3300009011 | Bacteria | 587 |
| 180 | Ga0105240_10476961 | 3300009093 | Bacteria | 1391 |
| 181 | Ga0105240_12156159 | 3300009093 | Bacteria | 578 |
| 182 | Ga0111539_10030741 | 3300009094 | Bacteria | 6528 |
| 183 | Ga0111539_10085561 | 3300009094 | Bacteria | 3705 |
| 184 | Ga0111539_10187206 | 3300009094 | Bacteria | 2417 |
| 185 | Ga0111539_10414517 | 3300009094 | Bacteria | 1569 |
| 186 | Ga0111539_10703255 | 3300009094 | Bacteria | 1176 |
| 187 | Ga0111539_11075406 | 3300009094 | Bacteria | 935 |
| 188 | Ga0111539_11362970 | 3300009094 | Bacteria | 823 |
| 189 | Ga0111539_11441653 | 3300009094 | Bacteria | 799 |
| 190 | Ga0111539_12336295 | 3300009094 | Bacteria | 620 |
| 191 | Ga0111539_12506520 | 3300009094 | Bacteria | 598 |
| 192 | Ga0111539_12682195 | 3300009094 | Bacteria | 578 |
| 193 | Ga0111539_12793492 | 3300009094 | Bacteria | 566 |
| 194 | Ga0105245_10013217 | 3300009098 | Bacteria | 7192 |
| 195 | Ga0105245_10026250 | 3300009098 | Bacteria | 5126 |
| 196 | Ga0105245_10136477 | 3300009098 | Bacteria | 2306 |
| 197 | Ga0105245_10600306 | 3300009098 | Bacteria | 1127 |
| 198 | Ga0105245_12753727 | 3300009098 | Bacteria | 545 |
| 199 | Ga0105247_10001002 | 3300009101 | Bacteria | 21329 |
| 200 | Ga0105247_10205303 | 3300009101 | Bacteria | 1326 |
| 201 | Ga0105247_10578277 | 3300009101 | Bacteria | 830 |
| 202 | Ga0105247_10973622 | 3300009101 | Unclassified | 660 |
| 203 | Ga0114129_10118948 | 3300009147 | Bacteria | 3639 |
| 204 | Ga0114129_10291857 | 3300009147 | Bacteria | 2176 |
| 205 | Ga0114129_10673536 | 3300009147 | Bacteria | 1333 |
| 206 | Ga0114129_11252753 | 3300009147 | Bacteria | 921 |
| 207 | Ga0114129_11449562 | 3300009147 | Bacteria | 845 |
| 208 | Ga0114129_11574899 | 3300009147 | Bacteria | 805 |
| 209 | Ga0114129_12332380 | 3300009147 | Bacteria | 642 |
| 210 | Ga0114129_12660131 | 3300009147 | Bacteria | 596 |
| 211 | Ga0105243_10243238 | 3300009148 | Bacteria | 1602 |
| 212 | Ga0105243_10564805 | 3300009148 | Bacteria | 1089 |
| 213 | Ga0105243_10674720 | 3300009148 | Unclassified | 1004 |
| 214 | Ga0105243_11481960 | 3300009148 | Bacteria | 702 |
| 215 | Ga0105243_11504835 | 3300009148 | Bacteria | 697 |
| 216 | Ga0105243_12002252 | 3300009148 | Bacteria | 613 |
| 217 | Ga0105241_10737140 | 3300009174 | Bacteria | 902 |
| 218 | Ga0105241_10847260 | 3300009174 | Bacteria | 845 |
| 219 | Ga0105242_10127861 | 3300009176 | Bacteria | 2189 |
| 220 | Ga0105242_12047019 | 3300009176 | Bacteria | 616 |
| 221 | Ga0105242_12634063 | 3300009176 | Bacteria | 552 |
| 222 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 223 | Ga0105248_10845470 | 3300009177 | Bacteria | 1033 |
| 224 | Ga0105237_10094470 | 3300009545 | Bacteria | 2979 |
| 225 | Ga0105237_11896741 | 3300009545 | Bacteria | 604 |
| 226 | Ga0105238_10061239 | 3300009551 | Bacteria | 3767 |
| 227 | Ga0105238_10990471 | 3300009551 | Bacteria | 861 |
| 228 | Ga0105238_11426058 | 3300009551 | Bacteria | 720 |
| 229 | Ga0105238_12051082 | 3300009551 | Unclassified | 606 |
| 230 | Ga0105249_10006751 | 3300009553 | Bacteria | 10000 |
| 231 | Ga0105249_10730959 | 3300009553 | Bacteria | 1051 |
| 232 | Ga0105249_10759692 | 3300009553 | Bacteria | 1032 |
| 233 | Ga0105147_119712 | 3300009982 | Bacteria | 573 |
| 234 | Ga0099796_10269204 | 3300010159 | Bacteria | 713 |
| 235 | Ga0105239_10132622 | 3300010375 | Bacteria | 2772 |
| 236 | Ga0105239_10274969 | 3300010375 | Bacteria | 1895 |
| 237 | Ga0105239_10623107 | 3300010375 | Bacteria | 1231 |
| 238 | Ga0105239_11043992 | 3300010375 | Bacteria | 940 |
| 239 | Ga0105239_11486293 | 3300010375 | Bacteria | 783 |
| 240 | Ga0105239_13540173 | 3300010375 | Bacteria | 507 |
| 241 | Ga0105246_10114544 | 3300011119 | Bacteria | 1987 |
| 242 | Ga0105246_10484722 | 3300011119 | Bacteria | 1047 |
| 243 | Ga0105246_10630386 | 3300011119 | Bacteria | 930 |
| 244 | Ga0105246_10678990 | 3300011119 | Bacteria | 900 |
| 245 | Ga0105246_10829267 | 3300011119 | Bacteria | 823 |
| 246 | Ga0105246_12055161 | 3300011119 | Bacteria | 552 |
| 247 | Ga0157371_10715045 | 3300013102 | Unclassified | 750 |
| 248 | Ga0157371_10927737 | 3300013102 | Bacteria | 661 |
| 249 | Ga0157371_11084341 | 3300013102 | Bacteria | 614 |
| 250 | Ga0157370_10016292 | 3300013104 | Bacteria | 7532 |
| 251 | Ga0157370_11704252 | 3300013104 | Bacteria | 566 |
| 252 | Ga0157369_10001576 | 3300013105 | Bacteria | 27893 |
| 253 | Ga0157369_10005857 | 3300013105 | Bacteria | 14280 |
| 254 | Ga0157369_10006509 | 3300013105 | Bacteria | 13536 |
| 255 | Ga0157369_11221485 | 3300013105 | Bacteria | 767 |
| 256 | Ga0157369_11498467 | 3300013105 | Bacteria | 686 |
| 257 | Ga0157374_10375831 | 3300013296 | Bacteria | 1415 |
| 258 | Ga0157374_11499049 | 3300013296 | Bacteria | 698 |
| 259 | Ga0157378_10387378 | 3300013297 | Bacteria | 1374 |
| 260 | Ga0157378_11459801 | 3300013297 | Bacteria | 728 |
| 261 | Ga0163162_10059179 | 3300013306 | Bacteria | 3862 |
| 262 | Ga0163162_11346875 | 3300013306 | Unclassified | 812 |
| 263 | Ga0163162_11391671 | 3300013306 | Bacteria | 798 |
| 264 | Ga0157372_10000882 | 3300013307 | Bacteria | 32603 |
| 265 | Ga0157372_10022389 | 3300013307 | Bacteria | 6837 |
| 266 | Ga0157372_11209569 | 3300013307 | Bacteria | 873 |
| 267 | Ga0157372_11955931 | 3300013307 | Bacteria | 674 |
| 268 | Ga0157372_12393500 | 3300013307 | Bacteria | 606 |
| 269 | Ga0157372_12495650 | 3300013307 | Bacteria | 593 |
| 270 | Ga0157372_12650347 | 3300013307 | Bacteria | 575 |
| 271 | Ga0157372_13091274 | 3300013307 | Bacteria | 531 |
| 272 | Ga0157375_10378466 | 3300013308 | Bacteria | 1582 |
| 273 | Ga0157375_10538502 | 3300013308 | Bacteria | 1330 |
| 274 | Ga0157375_12790418 | 3300013308 | Bacteria | 584 |
| 275 | Ga0163163_10242032 | 3300014325 | Bacteria | 1854 |
| 276 | Ga0163163_10521135 | 3300014325 | Bacteria | 1251 |
| 277 | Ga0163163_10703539 | 3300014325 | Bacteria | 1074 |
| 278 | Ga0157380_10029480 | 3300014326 | Bacteria | 4194 |
| 279 | Ga0157380_11015357 | 3300014326 | Bacteria | 864 |
| 280 | Ga0157380_11111899 | 3300014326 | Bacteria | 830 |
| 281 | Ga0157377_10060623 | 3300014745 | Bacteria | 2160 |
| 282 | Ga0157377_10371183 | 3300014745 | Bacteria | 966 |
| 283 | Ga0157377_10890703 | 3300014745 | Bacteria | 664 |
| 284 | Ga0157377_10983709 | 3300014745 | Bacteria | 637 |
| 285 | Ga0157377_11271770 | 3300014745 | Bacteria | 573 |
| 286 | Ga0157379_11408140 | 3300014968 | Bacteria | 676 |
| 287 | Ga0163161_10161241 | 3300017792 | Bacteria | 1710 |
| 288 | Ga0163161_11049658 | 3300017792 | Bacteria | 698 |
| 289 | Ga0197907_11454115 | 3300020069 | Bacteria | 659 |
| 290 | Ga0197907_11495825 | 3300020069 | Unclassified | 937 |
| 291 | Ga0206356_10808650 | 3300020070 | Bacteria | 1800 |
| 292 | Ga0206356_11791021 | 3300020070 | Bacteria | 583 |
| 293 | Ga0206354_11697381 | 3300020081 | Bacteria | 3467 |
| 294 | Ga0206353_10309370 | 3300020082 | Bacteria | 5643 |
| 295 | Ga0206353_11333443 | 3300020082 | Bacteria | 1396 |
| 296 | Ga0206353_11506452 | 3300020082 | Bacteria | 1101 |
| 297 | Ga0224712_10049116 | 3300022467 | Bacteria | 1632 |
| 298 | Ga0207692_10022697 | 3300025898 | Bacteria | 2892 |
| 299 | Ga0207642_10247832 | 3300025899 | Bacteria | 1009 |
| 300 | Ga0207642_10816309 | 3300025899 | Bacteria | 594 |
| 301 | Ga0207710_10000461 | 3300025900 | Bacteria | 26087 |
| 302 | Ga0207710_10700234 | 3300025900 | Unclassified | 531 |
| 303 | Ga0207688_10411166 | 3300025901 | Bacteria | 840 |
| 304 | Ga0207688_10711744 | 3300025901 | Bacteria | 635 |
| 305 | Ga0207680_10361862 | 3300025903 | Bacteria | 1020 |
| 306 | Ga0207647_10489024 | 3300025904 | Bacteria | 687 |
| 307 | Ga0207699_10149174 | 3300025906 | Bacteria | 1545 |
| 308 | Ga0207699_10156499 | 3300025906 | Bacteria | 1513 |
| 309 | Ga0207699_10160575 | 3300025906 | Bacteria | 1496 |
| 310 | Ga0207645_10287724 | 3300025907 | Bacteria | 1092 |
| 311 | Ga0207643_10258308 | 3300025908 | Bacteria | 1075 |
| 312 | Ga0207705_10062767 | 3300025909 | Bacteria | 2684 |
| 313 | Ga0207707_10012642 | 3300025912 | Bacteria | 7337 |
| 314 | Ga0207707_10188457 | 3300025912 | Bacteria | 1800 |
| 315 | Ga0207707_10207457 | 3300025912 | Bacteria | 1707 |
| 316 | Ga0207707_10419967 | 3300025912 | Bacteria | 1147 |
| 317 | Ga0207707_10586733 | 3300025912 | Unclassified | 944 |
| 318 | Ga0207707_11076919 | 3300025912 | Bacteria | 656 |
| 319 | Ga0207695_10058413 | 3300025913 | Bacteria | 4004 |
| 320 | Ga0207695_10234398 | 3300025913 | Bacteria | 1738 |
| 321 | Ga0207693_10000327 | 3300025915 | Bacteria | 43947 |
| 322 | Ga0207693_10528564 | 3300025915 | Bacteria | 920 |
| 323 | Ga0207693_10698775 | 3300025915 | Bacteria | 786 |
| 324 | Ga0207663_10011766 | 3300025916 | Bacteria | 4710 |
| 325 | Ga0207660_10023880 | 3300025917 | Bacteria | 4134 |
| 326 | Ga0207660_10283858 | 3300025917 | Bacteria | 1315 |
| 327 | Ga0207660_10291474 | 3300025917 | Bacteria | 1298 |
| 328 | Ga0207660_10362927 | 3300025917 | Bacteria | 1162 |
| 329 | Ga0207660_11148785 | 3300025917 | Unclassified | 632 |
| 330 | Ga0207657_10006978 | 3300025919 | Bacteria | 11630 |
| 331 | Ga0207657_10016594 | 3300025919 | Bacteria | 7095 |
| 332 | Ga0207657_10036776 | 3300025919 | Bacteria | 4380 |
| 333 | Ga0207657_10243831 | 3300025919 | Bacteria | 1434 |
| 334 | Ga0207657_10271938 | 3300025919 | Bacteria | 1347 |
| 335 | Ga0207657_11140495 | 3300025919 | Bacteria | 595 |
| 336 | Ga0207649_10005811 | 3300025920 | Bacteria | 6680 |
| 337 | Ga0207649_10034830 | 3300025920 | Bacteria | 3020 |
| 338 | Ga0207649_10778872 | 3300025920 | Bacteria | 746 |
| 339 | Ga0207652_10016236 | 3300025921 | Bacteria | 6074 |
| 340 | Ga0207652_10040530 | 3300025921 | Bacteria | 3955 |
| 341 | Ga0207652_10064889 | 3300025921 | Bacteria | 3160 |
| 342 | Ga0207694_11415451 | 3300025924 | Bacteria | 587 |
| 343 | Ga0207650_10490343 | 3300025925 | Bacteria | 1026 |
| 344 | Ga0207659_11864470 | 3300025926 | Unclassified | 510 |
| 345 | Ga0207687_10022371 | 3300025927 | Bacteria | 4206 |
| 346 | Ga0207687_10104131 | 3300025927 | Bacteria | 2094 |
| 347 | Ga0207687_10131564 | 3300025927 | Bacteria | 1887 |
| 348 | Ga0207687_10134242 | 3300025927 | Bacteria | 1870 |
| 349 | Ga0207687_10590791 | 3300025927 | Bacteria | 935 |
| 350 | Ga0207700_10079181 | 3300025928 | Bacteria | 2558 |
| 351 | Ga0207700_10556377 | 3300025928 | Bacteria | 1018 |
| 352 | Ga0207664_10021420 | 3300025929 | Bacteria | 4806 |
| 353 | Ga0207664_10056373 | 3300025929 | Bacteria | 3121 |
| 354 | Ga0207664_10312822 | 3300025929 | Bacteria | 1384 |
| 355 | Ga0207664_10528668 | 3300025929 | Bacteria | 1057 |
| 356 | Ga0207664_10669628 | 3300025929 | Bacteria | 933 |
| 357 | Ga0207664_10706874 | 3300025929 | Bacteria | 906 |
| 358 | Ga0207644_10425946 | 3300025931 | Bacteria | 1088 |
| 359 | Ga0207644_10815173 | 3300025931 | Bacteria | 781 |
| 360 | Ga0207690_10026917 | 3300025932 | Bacteria | 3628 |
| 361 | Ga0207690_10204475 | 3300025932 | Bacteria | 1502 |
| 362 | Ga0207690_10934577 | 3300025932 | Bacteria | 720 |
| 363 | Ga0207706_10007358 | 3300025933 | Bacteria | 10175 |
| 364 | Ga0207706_10045036 | 3300025933 | Bacteria | 3909 |
| 365 | Ga0207706_10045535 | 3300025933 | Bacteria | 3886 |
| 366 | Ga0207706_10200085 | 3300025933 | Bacteria | 1752 |
| 367 | Ga0207706_10376262 | 3300025933 | Bacteria | 1233 |
| 368 | Ga0207706_10490248 | 3300025933 | Unclassified | 1061 |
| 369 | Ga0207706_10656742 | 3300025933 | Bacteria | 898 |
| 370 | Ga0207706_10771162 | 3300025933 | Bacteria | 818 |
| 371 | Ga0207706_10798478 | 3300025933 | Bacteria | 802 |
| 372 | Ga0207706_11276858 | 3300025933 | Bacteria | 607 |
| 373 | Ga0207686_10004066 | 3300025934 | Bacteria | 7851 |
| 374 | Ga0207686_10081272 | 3300025934 | Bacteria | 2115 |
| 375 | Ga0207709_10183000 | 3300025935 | Bacteria | 1481 |
| 376 | Ga0207709_10195193 | 3300025935 | Bacteria | 1441 |
| 377 | Ga0207709_10520681 | 3300025935 | Bacteria | 931 |
| 378 | Ga0207709_10587820 | 3300025935 | Bacteria | 880 |
| 379 | Ga0207709_11127531 | 3300025935 | Bacteria | 645 |
| 380 | Ga0207709_11495567 | 3300025935 | Bacteria | 560 |
| 381 | Ga0207669_10145008 | 3300025937 | Bacteria | 1654 |
| 382 | Ga0207669_10375170 | 3300025937 | Bacteria | 1107 |
| 383 | Ga0207669_10528826 | 3300025937 | Bacteria | 948 |
| 384 | Ga0207669_10548544 | 3300025937 | Bacteria | 932 |
| 385 | Ga0207669_11340780 | 3300025937 | Bacteria | 608 |
| 386 | Ga0207704_10024207 | 3300025938 | Bacteria | 3288 |
| 387 | Ga0207704_10217462 | 3300025938 | Bacteria | 1411 |
| 388 | Ga0207704_10480177 | 3300025938 | Bacteria | 998 |
| 389 | Ga0207665_10099669 | 3300025939 | Bacteria | 2026 |
| 390 | Ga0207665_10932301 | 3300025939 | Bacteria | 689 |
| 391 | Ga0207691_10352783 | 3300025940 | Bacteria | 1258 |
| 392 | Ga0207711_10292428 | 3300025941 | Bacteria | 1502 |
| 393 | Ga0207711_10568233 | 3300025941 | Bacteria | 1058 |
| 394 | Ga0207661_10005475 | 3300025944 | Bacteria | 8954 |
| 395 | Ga0207661_10005597 | 3300025944 | Bacteria | 8857 |
| 396 | Ga0207661_10018843 | 3300025944 | Bacteria | 5135 |
| 397 | Ga0207661_10054277 | 3300025944 | Bacteria | 3210 |
| 398 | Ga0207661_11473860 | 3300025944 | Bacteria | 624 |
| 399 | Ga0207679_10033625 | 3300025945 | Bacteria | 3610 |
| 400 | Ga0207667_10270932 | 3300025949 | Bacteria | 1736 |
| 401 | Ga0207651_10790556 | 3300025960 | Bacteria | 841 |
| 402 | Ga0207651_10792629 | 3300025960 | Bacteria | 840 |
| 403 | Ga0207712_10041224 | 3300025961 | Bacteria | 3172 |
| 404 | Ga0207712_10085578 | 3300025961 | Bacteria | 2308 |
| 405 | Ga0207668_10072808 | 3300025972 | Bacteria | 2460 |
| 406 | Ga0207668_10100011 | 3300025972 | Bacteria | 2152 |
| 407 | Ga0207668_11360424 | 3300025972 | Bacteria | 640 |
| 408 | Ga0207640_10459058 | 3300025981 | Bacteria | 1052 |
| 409 | Ga0207640_10566288 | 3300025981 | Bacteria | 957 |
| 410 | Ga0207640_11086238 | 3300025981 | Bacteria | 707 |
| 411 | Ga0207640_11122257 | 3300025981 | Bacteria | 696 |
| 412 | Ga0207658_11229279 | 3300025986 | Bacteria | 685 |
| 413 | Ga0207677_10209390 | 3300026023 | Bacteria | 1556 |
| 414 | Ga0207677_10821133 | 3300026023 | Bacteria | 833 |
| 415 | Ga0207677_11231224 | 3300026023 | Bacteria | 686 |
| 416 | Ga0207639_10089943 | 3300026041 | Bacteria | 2454 |
| 417 | Ga0207678_10288265 | 3300026067 | Bacteria | 1410 |
| 418 | Ga0207678_10366332 | 3300026067 | Bacteria | 1244 |
| 419 | Ga0207678_11565124 | 3300026067 | Bacteria | 581 |
| 420 | Ga0207708_10030902 | 3300026075 | Bacteria | 4063 |
| 421 | Ga0207708_10101302 | 3300026075 | Bacteria | 2229 |
| 422 | Ga0207708_10146374 | 3300026075 | Bacteria | 1857 |
| 423 | Ga0207708_10192233 | 3300026075 | Bacteria | 1625 |
| 424 | Ga0207708_10315026 | 3300026075 | Bacteria | 1275 |
| 425 | Ga0207702_10004996 | 3300026078 | Bacteria | 11654 |
| 426 | Ga0207702_10023609 | 3300026078 | Bacteria | 5102 |
| 427 | Ga0207702_11410215 | 3300026078 | Bacteria | 690 |
| 428 | Ga0207641_10005668 | 3300026088 | Bacteria | 10630 |
| 429 | Ga0207641_10268674 | 3300026088 | Bacteria | 1600 |
| 430 | Ga0207648_11512641 | 3300026089 | Bacteria | 631 |
| 431 | Ga0207676_10069746 | 3300026095 | Bacteria | 2816 |
| 432 | Ga0207676_10388630 | 3300026095 | Bacteria | 1301 |
| 433 | Ga0207674_10126629 | 3300026116 | Bacteria | 2520 |
| 434 | Ga0207674_10504852 | 3300026116 | Bacteria | 1168 |
| 435 | Ga0207675_100001319 | 3300026118 | Bacteria | 24876 |
| 436 | Ga0207675_100130900 | 3300026118 | Bacteria | 2379 |
| 437 | Ga0207675_100911123 | 3300026118 | Bacteria | 896 |
| 438 | Ga0207675_100914427 | 3300026118 | Bacteria | 894 |
| 439 | Ga0207675_102348718 | 3300026118 | Bacteria | 546 |
| 440 | Ga0207675_102601973 | 3300026118 | Unclassified | 516 |
| 441 | Ga0207683_10274418 | 3300026121 | Bacteria | 1540 |
| 442 | Ga0207683_10564806 | 3300026121 | Bacteria | 1052 |
| 443 | Ga0207698_10090228 | 3300026142 | Bacteria | 2506 |
| 444 | Ga0207698_10143689 | 3300026142 | Bacteria | 2060 |
| 445 | Ga0209969_1069687 | 3300027360 | Unclassified | 559 |
| 446 | Ga0209970_1026438 | 3300027614 | Bacteria | 996 |
| 447 | Ga0209974_10151813 | 3300027876 | Bacteria | 836 |
| 448 | Ga0209974_10400279 | 3300027876 | Bacteria | 539 |
| 449 | Ga0207428_10038116 | 3300027907 | Bacteria | 3909 |
| 450 | Ga0207428_10244434 | 3300027907 | Bacteria | 1340 |
| 451 | Ga0207428_10323513 | 3300027907 | Bacteria | 1139 |
| 452 | Ga0207428_10510511 | 3300027907 | Unclassified | 872 |
| 453 | Ga0207428_10603190 | 3300027907 | Bacteria | 791 |
| 454 | Ga0207428_10798641 | 3300027907 | Bacteria | 670 |
| 455 | Ga0268265_10166359 | 3300028380 | Bacteria | 1880 |
| 456 | Ga0268265_10349955 | 3300028380 | Bacteria | 1349 |
| 457 | Ga0268265_12037923 | 3300028380 | Unclassified | 581 |
| 458 | Ga0268265_12583810 | 3300028380 | Bacteria | 514 |
| 459 | Ga0268264_11168013 | 3300028381 | Bacteria | 779 |
| 460 | Ga0268264_11352230 | 3300028381 | Bacteria | 723 |
| 461 | Ga0265326_10245737 | 3300028558 | Bacteria | 517 |
| 462 | Ga0265322_10235668 | 3300028654 | Unclassified | 525 |
| 463 | Ga0265338_10067558 | 3300028800 | Bacteria | 3086 |
| 464 | Ga0265338_10562644 | 3300028800 | Bacteria | 797 |
| 465 | Ga0265324_10035867 | 3300029957 | Bacteria | 1725 |
| 466 | Ga0265329_10058500 | 3300031242 | Bacteria | 1220 |
| 467 | Ga0265339_10124483 | 3300031249 | Bacteria | 1322 |
| 468 | Ga0307408_100112212 | 3300031548 | Bacteria | 2096 |
| 469 | Ga0307408_100181803 | 3300031548 | Bacteria | 1687 |
| 470 | Ga0307405_10084095 | 3300031731 | Bacteria | 2088 |
| 471 | Ga0307405_10331758 | 3300031731 | Bacteria | 1166 |
| 472 | Ga0307410_10005242 | 3300031852 | Bacteria | 6833 |
| 473 | Ga0307410_10049037 | 3300031852 | Bacteria | 2833 |
| 474 | Ga0307410_10123974 | 3300031852 | Bacteria | 1888 |
| 475 | Ga0307410_10157305 | 3300031852 | Bacteria | 1699 |
| 476 | Ga0307410_11997874 | 3300031852 | Bacteria | 517 |
| 477 | Ga0307406_10203429 | 3300031901 | Bacteria | 1459 |
| 478 | Ga0307406_10256133 | 3300031901 | Bacteria | 1321 |
| 479 | Ga0307406_11410232 | 3300031901 | Bacteria | 611 |
| 480 | Ga0307406_11529735 | 3300031901 | Bacteria | 588 |
| 481 | Ga0307407_10868259 | 3300031903 | Bacteria | 690 |
| 482 | Ga0307407_10935757 | 3300031903 | Bacteria | 667 |
| 483 | Ga0307407_11264173 | 3300031903 | Bacteria | 578 |
| 484 | Ga0307412_10101667 | 3300031911 | Bacteria | 2034 |
| 485 | Ga0307412_10381700 | 3300031911 | Bacteria | 1141 |
| 486 | Ga0307412_10741449 | 3300031911 | Bacteria | 847 |
| 487 | Ga0307409_100008843 | 3300031995 | Bacteria | 6144 |
| 488 | Ga0307409_100025648 | 3300031995 | Bacteria | 4139 |
| 489 | Ga0307409_100175393 | 3300031995 | Bacteria | 1891 |
| 490 | Ga0307409_100187052 | 3300031995 | Bacteria | 1839 |
| 491 | Ga0307409_100197889 | 3300031995 | Bacteria | 1795 |
| 492 | Ga0307409_100290421 | 3300031995 | Bacteria | 1516 |
| 493 | Ga0307409_102004315 | 3300031995 | Bacteria | 608 |
| 494 | Ga0307409_102166798 | 3300031995 | Bacteria | 585 |
| 495 | Ga0307409_102538507 | 3300031995 | Bacteria | 541 |
| 496 | Ga0307409_102605410 | 3300031995 | Bacteria | 534 |
| 497 | Ga0307416_100026631 | 3300032002 | Bacteria | 4264 |
| 498 | Ga0307416_100094130 | 3300032002 | Bacteria | 2582 |
| 499 | Ga0307416_100160319 | 3300032002 | Bacteria | 2078 |
| 500 | Ga0307416_100683036 | 3300032002 | Bacteria | 1114 |
| 501 | Ga0307414_10064344 | 3300032004 | Bacteria | 2611 |
| 502 | Ga0307414_10298735 | 3300032004 | Bacteria | 1361 |
| 503 | Ga0307414_10930984 | 3300032004 | Bacteria | 798 |
| 504 | Ga0307411_10072439 | 3300032005 | Bacteria | 2340 |
| 505 | Ga0307411_10466700 | 3300032005 | Bacteria | 1060 |
| 506 | Ga0307411_10629553 | 3300032005 | Bacteria | 926 |
| 507 | Ga0307411_10706979 | 3300032005 | Bacteria | 878 |
| 508 | Ga0307415_100009432 | 3300032126 | Bacteria | 5470 |
| 509 | Ga0307415_100030417 | 3300032126 | Bacteria | 3466 |
| 510 | Ga0307415_100066821 | 3300032126 | Bacteria | 2511 |
| 511 | Ga0307415_100099339 | 3300032126 | Bacteria | 2130 |
| 512 | Ga0373959_0130916 | 3300034820 | Bacteria | 621 |
| 513 | Ga0373938_0244320 | 3300034957 | Bacteria | 511 |
| 514 | Ga0373944_0354845 | 3300035089 | Bacteria | 559 |
| 515 | Ga0373952_0191105 | 3300035092 | Bacteria | 595 |
| 516 | Ga0373923_0055064 | 3300035111 | Bacteria | 1676 |
| 517 | Ga0373923_0640915 | 3300035111 | Bacteria | 525 |
| 518 | Ga0373932_0213879 | 3300035112 | Bacteria | 690 |
| 519 | Ga0373936_0253075 | 3300035113 | Bacteria | 787 |
| 520 | Ga0373939_0053380 | 3300035114 | Bacteria | 1262 |
| 521 | Ga0373945_0410023 | 3300035116 | Bacteria | 595 |
| 522 | Ga0373953_0122897 | 3300035117 | Bacteria | 1103 |
| 523 | Ga0373954_0176765 | 3300035118 | Bacteria | 1046 |
| 524 | Ga0373956_0174209 | 3300035119 | Bacteria | 1016 |
| 525 | Ga0373957_0180599 | 3300035120 | Bacteria | 874 |
| 526 | Ga0373943_0521532 | 3300035170 | Bacteria | 696 |
| 527 | Ga0373946_0105714 | 3300035171 | Bacteria | 1268 |
| 528 | Ga0373946_0115090 | 3300035171 | Bacteria | 1222 |
| 529 | Ga0373955_0056768 | 3300035172 | Bacteria | 2149 |
| 530 | Ga0373961_0013500 | 3300035241 | Bacteria | 2061 |
| 531 | Ga0373961_0321445 | 3300035241 | Bacteria | 577 |
| 532 | Ga0373961_0335003 | 3300035241 | Bacteria | 567 |
| 533 | Ga0373962_0273281 | 3300035242 | Bacteria | 593 |
| 534 | Ga0316574_0339953 | 3300035398 | Bacteria | 951 |
| 535 | Ga0316574_0342247 | 3300035398 | Bacteria | 947 |
| 536 | Ga0373924_0104076 | 3300035410 | Bacteria | 1223 |
| 537 | Ga0373931_0085014 | 3300035691 | Bacteria | 1753 |
| 538 | Ga0373931_0864617 | 3300035691 | Bacteria | 606 |
| 539 | Ga0373935_0236129 | 3300035692 | Bacteria | 1275 |
| 540 | Ga0373935_0309056 | 3300035692 | Bacteria | 1119 |
| 541 | Ga0373927_0145994 | 3300035695 | Bacteria | 1549 |
| 542 | Ga0373933_0088640 | 3300035724 | Bacteria | 1906 |
| 543 | Ga0373933_0253597 | 3300035724 | Bacteria | 1133 |
| 544 | Ga0373947_0129699 | 3300035725 | Bacteria | 1608 |
| 545 | Ga0373937_0029481 | 3300036401 | Bacteria | 4969 |
| 546 | Ga0373925_1131286 | 3300037068 | Bacteria | 644 |
| 547 | Ga0395899_0003553 | 3300037312 | Bacteria | 12345 |
| 548 | Ga0395899_0004500 | 3300037312 | Bacteria | 10867 |
| 549 | Ga0395899_0015196 | 3300037312 | Bacteria | 5870 |
| 550 | Ga0395899_0117298 | 3300037312 | Bacteria | 1909 |
| 551 | Ga0395899_0193560 | 3300037312 | Unclassified | 1422 |
| 552 | Ga0395899_0299048 | 3300037312 | Bacteria | 1089 |
| 553 | Ga0395899_0431824 | 3300037312 | Bacteria | 866 |
| 554 | Ga0395899_0888390 | 3300037312 | Bacteria | 544 |
| 555 | Ga0395900_0001151 | 3300037418 | Bacteria | 33219 |
| 556 | Ga0395900_0003158 | 3300037418 | Bacteria | 17863 |
| 557 | Ga0395900_0029208 | 3300037418 | Bacteria | 5655 |
| 558 | Ga0395900_0032554 | 3300037418 | Bacteria | 5361 |
| 559 | Ga0395900_0049434 | 3300037418 | Bacteria | 4333 |
| 560 | Ga0395900_0099875 | 3300037418 | Bacteria | 2981 |
| 561 | Ga0395900_0248961 | 3300037418 | Unclassified | 1779 |
| 562 | Ga0395900_0653381 | 3300037418 | Bacteria | 988 |
| 563 | Ga0395900_0703105 | 3300037418 | Bacteria | 944 |
| 564 | Ga0395900_0777970 | 3300037418 | Bacteria | 886 |
| 565 | Ga0395900_1010740 | 3300037418 | Unclassified | 751 |
| 566 | Ga0395900_1314846 | 3300037418 | Bacteria | 637 |
| 567 | Ga0395900_1411199 | 3300037418 | Bacteria | 609 |
| 568 | Ga0395900_1778536 | 3300037418 | Bacteria | 527 |
| 569 | Ga0395898_0003255 | 3300037466 | Bacteria | 18259 |
| 570 | Ga0395898_0007563 | 3300037466 | Bacteria | 11531 |
| 571 | Ga0395898_0017807 | 3300037466 | Bacteria | 7249 |
| 572 | Ga0395898_0110067 | 3300037466 | Bacteria | 2641 |
| 573 | Ga0395898_0130997 | 3300037466 | Bacteria | 2402 |
| 574 | Ga0395898_0223727 | 3300037466 | Bacteria | 1795 |
| 575 | Ga0395898_0661781 | 3300037466 | Bacteria | 987 |
| 576 | Ga0395898_1053338 | 3300037466 | Bacteria | 748 |
| 577 | Ga0395898_1127117 | 3300037466 | Bacteria | 717 |
| 578 | Ga0395898_1236179 | 3300037466 | Bacteria | 677 |
| 579 | Ga0395905_0005310 | 3300037471 | Bacteria | 13169 |
| 580 | Ga0395905_0018615 | 3300037471 | Bacteria | 6587 |
| 581 | Ga0395905_0038953 | 3300037471 | Bacteria | 4459 |
| 582 | Ga0395905_0186955 | 3300037471 | Bacteria | 1944 |
| 583 | Ga0395905_1724555 | 3300037471 | Bacteria | 532 |
| 584 | Ga0436364_0058676 | 3300037853 | Bacteria | 861 |
| 585 | Ga0436364_0335112 | 3300037853 | Bacteria | 6470 |
| 586 | Ga0436364_0857259 | 3300037853 | Bacteria | 787 |
| 587 | Ga0436364_0968519 | 3300037853 | Bacteria | 1421 |
| 588 | Ga0395901_0009117 | 3300038443 | Bacteria | 10048 |
| 589 | Ga0395901_0009324 | 3300038443 | Bacteria | 9949 |
| 590 | Ga0395901_0011708 | 3300038443 | Bacteria | 8890 |
| 591 | Ga0395901_0013838 | 3300038443 | Bacteria | 8207 |
| 592 | Ga0395901_0017307 | 3300038443 | Bacteria | 7357 |
| 593 | Ga0395901_0022647 | 3300038443 | Bacteria | 6440 |
| 594 | Ga0395901_0108496 | 3300038443 | Bacteria | 2914 |
| 595 | Ga0395901_0470338 | 3300038443 | Bacteria | 1283 |
| 596 | Ga0395901_0791741 | 3300038443 | Bacteria | 938 |
| 597 | Ga0395901_0816093 | 3300038443 | Bacteria | 921 |
| 598 | Ga0395901_0847389 | 3300038443 | Bacteria | 900 |
| 599 | Ga0395901_0924487 | 3300038443 | Bacteria | 853 |
| 600 | Ga0395901_1242215 | 3300038443 | Bacteria | 709 |
| 601 | Ga0395901_1247541 | 3300038443 | Bacteria | 707 |
| 602 | Ga0436360_0309792 | 3300039438 | Bacteria | 9010 |
| 603 | Ga0436363_1685287 | 3300039450 | Bacteria | 1378 |
| 604 | Ga0436362_0196630 | 3300039453 | Bacteria | 579 |
| 605 | Ga0439453_0152042 | 3300041408 | Bacteria | 550 |
| 606 | Ga0451802_2110464 | 3300041460 | Unclassified | 690 |
| 607 | Ga0451807_1033732 | 3300041486 | Bacteria | 1799 |
| 608 | Ga0451807_1785489 | 3300041486 | Bacteria | 711 |
| 609 | Ga0451833_0562689 | 3300041491 | Bacteria | 2511 |
| 610 | Ga0451839_0129166 | 3300041496 | Bacteria | 515 |
| 611 | Ga0451845_0181262 | 3300041501 | Unclassified | 594 |
| 612 | Ga0451845_0319367 | 3300041501 | Unclassified | 541 |
| 613 | Ga0451843_1498561 | 3300041509 | Bacteria | 518 |
| 614 | Ga0451853_0358062 | 3300041512 | Bacteria | 503 |
| 615 | Ga0451853_3422080 | 3300041512 | Unclassified | 819 |
| 616 | Ga0451853_3517233 | 3300041512 | Bacteria | 1422 |
| 617 | Ga0451853_3685609 | 3300041512 | Bacteria | 673 |
| 618 | Ga0439448_0387220 | 3300042005 | Bacteria | 500 |
| 619 | Ga0439450_044045 | 3300042008 | Bacteria | 1044 |
| 620 | Ga0439450_157144 | 3300042008 | Bacteria | 598 |
| 621 | Ga0439454_020462 | 3300042011 | Bacteria | 971 |
| 622 | Ga0439455_0083711 | 3300042012 | Bacteria | 869 |
| 623 | Ga0439455_0113218 | 3300042012 | Bacteria | 756 |
| 624 | Ga0439463_137876 | 3300042016 | Bacteria | 632 |
| 625 | Ga0439463_154771 | 3300042016 | Bacteria | 594 |
| 626 | Ga0450905_021975 | 3300042142 | Bacteria | 946 |
| 627 | Ga0450910_105201 | 3300042147 | Bacteria | 509 |
| 628 | Ga0439459_0019449 | 3300042438 | Bacteria | 1287 |
| 629 | Ga0439464_0093853 | 3300042439 | Bacteria | 906 |
| 630 | Ga0439464_0208225 | 3300042439 | Bacteria | 625 |
| 631 | Ga0439460_0016281 | 3300042461 | Bacteria | 1979 |
| 632 | Ga0439460_0154203 | 3300042461 | Bacteria | 767 |
| 633 | Ga0439460_0372778 | 3300042461 | Bacteria | 505 |
| 634 | Ga0450901_018784 | 3300042533 | Bacteria | 735 |
| 635 | Ga0439440_0073182 | 3300042993 | Bacteria | 895 |
| 636 | Ga0439440_0098656 | 3300042993 | Bacteria | 792 |
| 637 | Ga0466969_0019734 | 3300044656 | Bacteria | 3499 |
| 638 | Ga0466969_0259660 | 3300044656 | Unclassified | 787 |
| 639 | Ga0466969_0284223 | 3300044656 | Bacteria | 749 |
| 640 | Ga0466969_0548685 | 3300044656 | Bacteria | 529 |
| 641 | Ga0466966_0581062 | 3300044684 | Bacteria | 674 |
| 642 | Ga0466961_0181657 | 3300044693 | Bacteria | 1306 |
| 643 | Ga0466961_0599149 | 3300044693 | Bacteria | 663 |
| 644 | Ga0466961_0705592 | 3300044693 | Bacteria | 604 |
| 645 | Ga0466963_0008740 | 3300044694 | Bacteria | 6081 |
| 646 | Ga0466963_0071439 | 3300044694 | Bacteria | 2336 |
| 647 | Ga0466963_0073797 | 3300044694 | Bacteria | 2300 |
| 648 | Ga0466963_0701092 | 3300044694 | Bacteria | 714 |
| 649 | Ga0466963_0704970 | 3300044694 | Bacteria | 712 |
| 650 | Ga0466963_1187582 | 3300044694 | Bacteria | 536 |
| 651 | Ga0466964_0251713 | 3300044706 | Bacteria | 871 |
| 652 | Ga0466964_0431635 | 3300044706 | Bacteria | 695 |
| 653 | Ga0466964_0506611 | 3300044706 | Bacteria | 649 |
| 654 | Ga0466964_0613582 | 3300044706 | Bacteria | 598 |
| 655 | Ga0466964_0865599 | 3300044706 | Bacteria | 515 |
| 656 | Ga0466971_0365992 | 3300044719 | Bacteria | 699 |
| 657 | Ga0466968_0190868 | 3300044735 | Bacteria | 956 |
| 658 | Ga0466957_0078451 | 3300044842 | Bacteria | 2053 |
| 659 | Ga0466957_0502174 | 3300044842 | Bacteria | 841 |
| 660 | Ga0466957_0563316 | 3300044842 | Bacteria | 795 |
| 661 | Ga0466960_0955541 | 3300044901 | Bacteria | 525 |
| 662 | Ga0466959_0206183 | 3300045049 | Bacteria | 1367 |
| 663 | Ga0466959_0221023 | 3300045049 | Bacteria | 1314 |
| 664 | Ga0466959_0225580 | 3300045049 | Bacteria | 1298 |
| 665 | Ga0466959_0326687 | 3300045049 | Unclassified | 1048 |
| 666 | Ga0466959_0468170 | 3300045049 | Bacteria | 853 |
| 667 | Ga0466959_0608425 | 3300045049 | Bacteria | 735 |
| 668 | Ga0466958_0051092 | 3300045836 | Bacteria | 2502 |
| 669 | Ga0466958_0056145 | 3300045836 | Bacteria | 2391 |
| 670 | Ga0466958_0089729 | 3300045836 | Bacteria | 1901 |
| 671 | Ga0466958_0107968 | 3300045836 | Bacteria | 1736 |
| 672 | Ga0466958_0356153 | 3300045836 | Bacteria | 942 |
| 673 | Ga0466958_0439066 | 3300045836 | Bacteria | 845 |
| 674 | Ga0466967_0084813 | 3300045976 | Bacteria | 2867 |
| 675 | Ga0466967_0122463 | 3300045976 | Bacteria | 2405 |
| 676 | Ga0466967_0213024 | 3300045976 | Bacteria | 1833 |
| 677 | Ga0466967_0323636 | 3300045976 | Bacteria | 1487 |
| 678 | Ga0466967_0334946 | 3300045976 | Bacteria | 1462 |
| 679 | Ga0466967_0514059 | 3300045976 | Bacteria | 1176 |
| 680 | Ga0466967_0829283 | 3300045976 | Bacteria | 919 |
| 681 | Ga0466967_1089567 | 3300045976 | Bacteria | 796 |
| 682 | Ga0466967_1205240 | 3300045976 | Bacteria | 754 |
| 683 | Ga0466967_1310825 | 3300045976 | Bacteria | 721 |
| 684 | Ga0466967_1340099 | 3300045976 | Bacteria | 713 |
| 685 | Ga0466967_1520605 | 3300045976 | Bacteria | 667 |
| 686 | Ga0466967_1554229 | 3300045976 | Bacteria | 659 |
| 687 | Ga0466967_2302087 | 3300045976 | Bacteria | 534 |
| 688 | Ga0495627_131768 | 3300046453 | Bacteria | 703 |
| 689 | Ga0495592_0009914 | 3300046454 | Bacteria | 7172 |
| 690 | Ga0495592_0172570 | 3300046454 | Bacteria | 1479 |
| 691 | Ga0495592_0954479 | 3300046454 | Unclassified | 501 |
| 692 | Ga0495603_0206203 | 3300046455 | Bacteria | 1136 |
| 693 | Ga0495603_0271293 | 3300046455 | Bacteria | 976 |
| 694 | Ga0495603_0478875 | 3300046455 | Bacteria | 713 |
| 695 | Ga0495590_0352160 | 3300046457 | Bacteria | 560 |
| 696 | Ga0495629_0001331 | 3300046459 | Bacteria | 19420 |
| 697 | Ga0495629_0009051 | 3300046459 | Bacteria | 7299 |
| 698 | Ga0495629_0038892 | 3300046459 | Bacteria | 3349 |
| 699 | Ga0495629_0042675 | 3300046459 | Bacteria | 3186 |
| 700 | Ga0495629_0097082 | 3300046459 | Bacteria | 2056 |
| 701 | Ga0495629_0270503 | 3300046459 | Bacteria | 1167 |
| 702 | Ga0495638_0352076 | 3300046460 | Bacteria | 777 |
| 703 | Ga0495641_0071444 | 3300046461 | Bacteria | 1558 |
| 704 | Ga0495641_0394246 | 3300046461 | Bacteria | 628 |
| 705 | Ga0495641_0538051 | 3300046461 | Bacteria | 533 |
| 706 | Ga0495651_0006259 | 3300046462 | Bacteria | 9102 |
| 707 | Ga0495651_0135474 | 3300046462 | Bacteria | 1792 |
| 708 | Ga0495651_0173225 | 3300046462 | Bacteria | 1535 |
| 709 | Ga0495651_0738850 | 3300046462 | Bacteria | 611 |
| 710 | Ga0495653_0032490 | 3300046463 | Bacteria | 4142 |
| 711 | Ga0495653_0154953 | 3300046463 | Bacteria | 1597 |
| 712 | Ga0495653_0458079 | 3300046463 | Bacteria | 801 |
| 713 | Ga0495653_0857280 | 3300046463 | Bacteria | 543 |
| 714 | Ga0495653_0965063 | 3300046463 | Bacteria | 505 |
| 715 | Ga0495580_0203714 | 3300046472 | Bacteria | 1363 |
| 716 | Ga0495580_0610517 | 3300046472 | Bacteria | 720 |
| 717 | Ga0495582_0148178 | 3300046473 | Bacteria | 1332 |
| 718 | Ga0495582_0503360 | 3300046473 | Bacteria | 700 |
| 719 | Ga0495605_0192695 | 3300046474 | Bacteria | 891 |
| 720 | Ga0495605_0309572 | 3300046474 | Bacteria | 667 |
| 721 | Ga0495639_0229286 | 3300046475 | Bacteria | 915 |
| 722 | Ga0495662_0113304 | 3300046476 | Bacteria | 1330 |
| 723 | Ga0495584_0205130 | 3300046491 | Bacteria | 1002 |
| 724 | Ga0495584_0235722 | 3300046491 | Bacteria | 930 |
| 725 | Ga0495594_0883079 | 3300046499 | Bacteria | 503 |
| 726 | Ga0495596_0048864 | 3300046500 | Bacteria | 1659 |
| 727 | Ga0495596_0157157 | 3300046500 | Bacteria | 883 |
| 728 | Ga0495607_0258937 | 3300046501 | Bacteria | 834 |
| 729 | Ga0495607_0492413 | 3300046501 | Bacteria | 545 |
| 730 | Ga0495608_0002443 | 3300046511 | Bacteria | 13351 |
| 731 | Ga0495608_0018553 | 3300046511 | Bacteria | 4796 |
| 732 | Ga0495608_0207189 | 3300046511 | Bacteria | 1234 |
| 733 | Ga0495616_0068551 | 3300046513 | Bacteria | 1722 |
| 734 | Ga0495618_0010592 | 3300046514 | Bacteria | 5579 |
| 735 | Ga0495618_0489905 | 3300046514 | Unclassified | 742 |
| 736 | Ga0495618_0566008 | 3300046514 | Bacteria | 679 |
| 737 | Ga0495628_0028908 | 3300046516 | Bacteria | 4499 |
| 738 | Ga0495628_0103164 | 3300046516 | Bacteria | 2199 |
| 739 | Ga0495628_0290645 | 3300046516 | Bacteria | 1212 |
| 740 | Ga0495628_0542566 | 3300046516 | Bacteria | 836 |
| 741 | Ga0495628_0597128 | 3300046516 | Bacteria | 789 |
| 742 | Ga0495630_0017787 | 3300046517 | Bacteria | 5212 |
| 743 | Ga0495630_0077462 | 3300046517 | Bacteria | 2507 |
| 744 | Ga0495630_0117572 | 3300046517 | Bacteria | 2016 |
| 745 | Ga0495630_0240360 | 3300046517 | Bacteria | 1384 |
| 746 | Ga0495630_0366001 | 3300046517 | Bacteria | 1104 |
| 747 | Ga0495630_0872066 | 3300046517 | Bacteria | 686 |
| 748 | Ga0495630_1023257 | 3300046517 | Bacteria | 627 |
| 749 | Ga0495631_0242917 | 3300046518 | Bacteria | 768 |
| 750 | Ga0495643_0195022 | 3300046522 | Bacteria | 976 |
| 751 | Ga0495644_0205406 | 3300046523 | Bacteria | 760 |
| 752 | Ga0495663_0086851 | 3300046525 | Bacteria | 1014 |
| 753 | Ga0495666_0514434 | 3300046526 | Bacteria | 535 |
| 754 | Ga0495642_0367815 | 3300046528 | Bacteria | 633 |
| 755 | Ga0495652_0089134 | 3300046529 | Bacteria | 2526 |
| 756 | Ga0495652_0110230 | 3300046529 | Bacteria | 2214 |
| 757 | Ga0495652_0370401 | 3300046529 | Bacteria | 1021 |
| 758 | Ga0495665_0477825 | 3300046531 | Bacteria | 629 |
| 759 | Ga0495640_0014053 | 3300046533 | Bacteria | 6072 |
| 760 | Ga0495640_0191253 | 3300046533 | Bacteria | 1301 |
| 761 | Ga0495640_0902010 | 3300046533 | Unclassified | 524 |
| 762 | Ga0495586_0006171 | 3300046535 | Bacteria | 6407 |
| 763 | Ga0495586_0057979 | 3300046535 | Bacteria | 2102 |
| 764 | Ga0495586_0145228 | 3300046535 | Bacteria | 1333 |
| 765 | Ga0495586_0436151 | 3300046535 | Bacteria | 755 |
| 766 | Ga0495587_0031382 | 3300046536 | Bacteria | 3217 |
| 767 | Ga0495587_0137673 | 3300046536 | Bacteria | 1394 |
| 768 | Ga0495587_0492652 | 3300046536 | Bacteria | 678 |
| 769 | Ga0495609_0275415 | 3300046538 | Bacteria | 689 |
| 770 | Ga0495621_0413179 | 3300046539 | Bacteria | 574 |
| 771 | Ga0495621_0484841 | 3300046539 | Bacteria | 532 |
| 772 | Ga0495597_0365910 | 3300046542 | Bacteria | 552 |
| 773 | Ga0495645_0148375 | 3300046543 | Bacteria | 1631 |
| 774 | Ga0495645_0202215 | 3300046543 | Bacteria | 1346 |
| 775 | Ga0495645_0535191 | 3300046543 | Bacteria | 728 |
| 776 | Ga0495622_0000618 | 3300046557 | Bacteria | 20626 |
| 777 | Ga0495667_0013676 | 3300046559 | Bacteria | 5484 |
| 778 | Ga0495667_0678069 | 3300046559 | Bacteria | 639 |
| 779 | Ga0495667_0698128 | 3300046559 | Unclassified | 629 |
| 780 | Ga0495656_0276167 | 3300046615 | Bacteria | 855 |
| 781 | Ga0495656_0542211 | 3300046615 | Bacteria | 619 |
| 782 | Ga0495668_0767732 | 3300046616 | Bacteria | 534 |
| 783 | Ga0495634_0025585 | 3300046642 | Bacteria | 4126 |
| 784 | Ga0495634_0206720 | 3300046642 | Unclassified | 1217 |
| 785 | Ga0495634_0218712 | 3300046642 | Bacteria | 1177 |
| 786 | Ga0495635_0052206 | 3300046663 | Bacteria | 2816 |
| 787 | Ga0495635_0064066 | 3300046663 | Bacteria | 2524 |
| 788 | Ga0495659_0451222 | 3300046664 | Bacteria | 560 |
| 789 | Ga0495661_0574088 | 3300046665 | Bacteria | 532 |
| 790 | Ga0495657_0017591 | 3300046675 | Bacteria | 5185 |
| 791 | Ga0495657_0034335 | 3300046675 | Bacteria | 3523 |
| 792 | Ga0495657_0173474 | 3300046675 | Unclassified | 1327 |
| 793 | Ga0495599_0048531 | 3300046678 | Bacteria | 2661 |
| 794 | Ga0495623_0165216 | 3300046679 | Bacteria | 1297 |
| 795 | Ga0495646_0084378 | 3300046680 | Bacteria | 1844 |
| 796 | Ga0495646_0202527 | 3300046680 | Bacteria | 1080 |
| 797 | Ga0495647_0192574 | 3300046681 | Bacteria | 891 |
| 798 | Ga0495647_0242949 | 3300046681 | Bacteria | 800 |
| 799 | Ga0495647_0567081 | 3300046681 | Unclassified | 532 |
| 800 | Ga0495658_0063434 | 3300046683 | Bacteria | 2126 |
| 801 | Ga0495658_0106840 | 3300046683 | Bacteria | 1678 |
| 802 | Ga0495613_0099039 | 3300046689 | Bacteria | 2106 |
| 803 | Ga0495613_0261950 | 3300046689 | Bacteria | 1204 |
| 804 | Ga0495613_0384789 | 3300046689 | Bacteria | 959 |
| 805 | Ga0495613_0539701 | 3300046689 | Bacteria | 781 |
| 806 | Ga0495613_0648388 | 3300046689 | Bacteria | 699 |
| 807 | Ga0495624_0138274 | 3300046690 | Bacteria | 1493 |
| 808 | Ga0495624_0186663 | 3300046690 | Unclassified | 1262 |
| 809 | Ga0495670_0622905 | 3300046691 | Bacteria | 588 |
| 810 | Ga0495671_0151509 | 3300046692 | Bacteria | 1129 |
| 811 | Ga0495589_0229233 | 3300046794 | Bacteria | 871 |
| 812 | Ga0495589_0458134 | 3300046794 | Bacteria | 583 |
| 813 | Ga0495589_0581263 | 3300046794 | Bacteria | 510 |
| 814 | Ga0495600_0019723 | 3300046809 | Bacteria | 4309 |
| 815 | Ga0495600_0317205 | 3300046809 | Bacteria | 981 |
| 816 | Ga0495600_0686512 | 3300046809 | Bacteria | 617 |
| 817 | Ga0495660_0181988 | 3300046810 | Unclassified | 1016 |
| 818 | Ga0495581_0676510 | 3300047315 | Bacteria | 596 |
| 819 | Ga0495604_0007191 | 3300047317 | Bacteria | 8818 |
| 820 | Ga0495674_0046218 | 3300047319 | Bacteria | 3864 |
| 821 | Ga0495674_0299567 | 3300047319 | Bacteria | 1314 |
| 822 | Ga0495674_0304214 | 3300047319 | Bacteria | 1302 |
| 823 | Ga0495674_0307077 | 3300047319 | Bacteria | 1295 |
| 824 | Ga0495674_0483629 | 3300047319 | Bacteria | 992 |
| 825 | Ga0495676_0208839 | 3300047321 | Bacteria | 1352 |
| 826 | Ga0495676_0347648 | 3300047321 | Bacteria | 992 |
| 827 | Ga0495676_0498672 | 3300047321 | Bacteria | 799 |
| 828 | Ga0495680_0040313 | 3300047322 | Bacteria | 3721 |
| 829 | Ga0495680_0100314 | 3300047322 | Bacteria | 2157 |
| 830 | Ga0495680_0113827 | 3300047322 | Bacteria | 2002 |
| 831 | Ga0495680_0189934 | 3300047322 | Bacteria | 1478 |
| 832 | Ga0495680_0604795 | 3300047322 | Bacteria | 733 |
| 833 | Ga0495683_0237355 | 3300047323 | Bacteria | 806 |
| 834 | Ga0495675_0092107 | 3300047444 | Bacteria | 1902 |
| 835 | Ga0495675_0245406 | 3300047444 | Bacteria | 1077 |
| 836 | Ga0495677_0277924 | 3300047445 | Bacteria | 657 |
| 837 | Ga0495685_301535 | 3300047447 | Bacteria | 503 |
| 838 | Ga0495684_0018945 | 3300047471 | Bacteria | 5299 |
| 839 | Ga0495686_0154850 | 3300047472 | Bacteria | 1343 |
| 840 | Ga0495686_0184938 | 3300047472 | Bacteria | 1205 |
| 841 | Ga0495593_0059544 | 3300047673 | Bacteria | 2001 |
| 842 | Ga0495593_0078628 | 3300047673 | Bacteria | 1708 |
| 843 | Ga0495593_0397648 | 3300047673 | Bacteria | 689 |
| 844 | Ga0495602_0013661 | 3300048088 | Bacteria | 8285 |
| 845 | Ga0495614_0262917 | 3300048089 | Bacteria | 791 |
| 846 | Ga0495615_0251658 | 3300048090 | Bacteria | 560 |
| 847 | Ga0496100_0102913 | 3300048903 | Bacteria | 1971 |
| 848 | Ga0496100_0484371 | 3300048903 | Bacteria | 952 |
| 849 | Ga0496100_0821023 | 3300048903 | Bacteria | 729 |
| 850 | Ga0496101_0007125 | 3300048904 | Bacteria | 7233 |
| 851 | Ga0496101_0290688 | 3300048904 | Bacteria | 1279 |
| 852 | Ga0496101_0628628 | 3300048904 | Bacteria | 849 |
| 853 | Ga0496101_0631588 | 3300048904 | Bacteria | 846 |
| 854 | Ga0496102_0001083 | 3300048905 | Bacteria | 25208 |
| 855 | Ga0496102_0244270 | 3300048905 | Bacteria | 1693 |
| 856 | Ga0496102_0305088 | 3300048905 | Bacteria | 1500 |
| 857 | Ga0496102_0425033 | 3300048905 | Bacteria | 1248 |
| 858 | Ga0496102_0616362 | 3300048905 | Bacteria | 1008 |
| 859 | Ga0496102_1077364 | 3300048905 | Bacteria | 724 |
| 860 | Ga0496102_1099577 | 3300048905 | Bacteria | 715 |
| 861 | Ga0496102_1736499 | 3300048905 | Bacteria | 542 |
| 862 | Ga0496103_0000031 | 3300048906 | Bacteria | 204016 |
| 863 | Ga0496103_0474501 | 3300048906 | Bacteria | 801 |
| 864 | Ga0496103_0905823 | 3300048906 | Bacteria | 552 |
| 865 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 866 | Ga0496104_0131282 | 3300048907 | Bacteria | 2406 |
| 867 | Ga0496104_0172586 | 3300048907 | Bacteria | 2073 |
| 868 | Ga0496104_0213847 | 3300048907 | Bacteria | 1839 |
| 869 | Ga0496104_0479397 | 3300048907 | Bacteria | 1155 |
| 870 | Ga0496104_0624982 | 3300048907 | Bacteria | 987 |
| 871 | Ga0496104_0673842 | 3300048907 | Bacteria | 942 |
| 872 | Ga0496104_1037721 | 3300048907 | Bacteria | 724 |
| 873 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 874 | Ga0496105_0000401 | 3300048908 | Bacteria | 28464 |
| 875 | Ga0496105_0047865 | 3300048908 | Bacteria | 3528 |
| 876 | Ga0496105_0057371 | 3300048908 | Bacteria | 3215 |
| 877 | Ga0496105_0120866 | 3300048908 | Bacteria | 2160 |
| 878 | Ga0496105_0121766 | 3300048908 | Bacteria | 2151 |
| 879 | Ga0496105_0140355 | 3300048908 | Bacteria | 1989 |
| 880 | Ga0496105_0752326 | 3300048908 | Bacteria | 744 |
| 881 | Ga0496105_0954516 | 3300048908 | Bacteria | 644 |
| 882 | Ga0496105_1267082 | 3300048908 | Bacteria | 540 |
| 883 | Ga0496106_0320286 | 3300048909 | Bacteria | 1244 |
| 884 | Ga0496106_0404394 | 3300048909 | Bacteria | 1097 |
| 885 | Ga0496106_0838125 | 3300048909 | Bacteria | 728 |
| 886 | Ga0496107_0640619 | 3300048910 | Bacteria | 784 |
| 887 | Ga0496107_1187512 | 3300048910 | Unclassified | 549 |
| 888 | Ga0496108_0000026 | 3300048911 | Bacteria | 172399 |
| 889 | Ga0496108_0001551 | 3300048911 | Bacteria | 18179 |
| 890 | Ga0496108_0008908 | 3300048911 | Bacteria | 8132 |
| 891 | Ga0496108_0130646 | 3300048911 | Bacteria | 2159 |
| 892 | Ga0496108_0146695 | 3300048911 | Bacteria | 2035 |
| 893 | Ga0496108_0234017 | 3300048911 | Bacteria | 1598 |
| 894 | Ga0496108_0254951 | 3300048911 | Bacteria | 1526 |
| 895 | Ga0496108_0258925 | 3300048911 | Bacteria | 1514 |
| 896 | Ga0496108_0674445 | 3300048911 | Bacteria | 897 |
| 897 | Ga0496108_0696625 | 3300048911 | Bacteria | 881 |
| 898 | Ga0496108_0745430 | 3300048911 | Bacteria | 847 |
| 899 | Ga0496108_0790348 | 3300048911 | Bacteria | 819 |
| 900 | Ga0496108_0981392 | 3300048911 | Bacteria | 722 |
| 901 | Ga0496108_1154651 | 3300048911 | Bacteria | 656 |
| 902 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 903 | Ga0496109_0004905 | 3300048912 | Bacteria | 11170 |
| 904 | Ga0496109_0078503 | 3300048912 | Bacteria | 3040 |
| 905 | Ga0496109_0296733 | 3300048912 | Bacteria | 1524 |
| 906 | Ga0496109_0435083 | 3300048912 | Bacteria | 1239 |
| 907 | Ga0496109_0557157 | 3300048912 | Bacteria | 1081 |
| 908 | Ga0496109_1034826 | 3300048912 | Bacteria | 758 |
| 909 | Ga0496109_1486429 | 3300048912 | Bacteria | 612 |
| 910 | Ga0496109_1611694 | 3300048912 | Bacteria | 583 |
| 911 | Ga0496110_0011382 | 3300048913 | Bacteria | 7279 |
| 912 | Ga0496110_0049641 | 3300048913 | Bacteria | 3682 |
| 913 | Ga0496110_0058708 | 3300048913 | Bacteria | 3389 |
| 914 | Ga0496110_0174428 | 3300048913 | Bacteria | 1951 |
| 915 | Ga0496110_0811040 | 3300048913 | Bacteria | 840 |
| 916 | Ga0496110_0869038 | 3300048913 | Bacteria | 807 |
| 917 | Ga0496110_1221608 | 3300048913 | Bacteria | 661 |
| 918 | Ga0496110_1225241 | 3300048913 | Unclassified | 659 |
| 919 | Ga0496111_0001050 | 3300048914 | Bacteria | 15205 |
| 920 | Ga0496111_0142391 | 3300048914 | Bacteria | 1777 |
| 921 | Ga0496111_0170928 | 3300048914 | Bacteria | 1615 |
| 922 | Ga0496111_0629296 | 3300048914 | Bacteria | 784 |
| 923 | Ga0496111_0785501 | 3300048914 | Bacteria | 690 |
| 924 | Ga0496112_0011438 | 3300048915 | Bacteria | 8104 |
| 925 | Ga0496112_0014164 | 3300048915 | Bacteria | 7389 |
| 926 | Ga0496112_0179080 | 3300048915 | Bacteria | 2084 |
| 927 | Ga0496112_0366422 | 3300048915 | Bacteria | 1382 |
| 928 | Ga0496112_0744460 | 3300048915 | Bacteria | 907 |
| 929 | Ga0496112_1210192 | 3300048915 | Bacteria | 672 |
| 930 | Ga0496112_1248410 | 3300048915 | Bacteria | 659 |
| 931 | Ga0496112_1830085 | 3300048915 | Bacteria | 519 |
| 932 | Ga0496113_0041886 | 3300048916 | Bacteria | 3382 |
| 933 | Ga0496113_0095118 | 3300048916 | Bacteria | 2302 |
| 934 | Ga0496113_0126370 | 3300048916 | Bacteria | 2003 |
| 935 | Ga0496113_0168365 | 3300048916 | Bacteria | 1735 |
| 936 | Ga0496113_0391588 | 3300048916 | Bacteria | 1115 |
| 937 | Ga0496113_0851786 | 3300048916 | Bacteria | 722 |
| 938 | Ga0496113_1394292 | 3300048916 | Bacteria | 543 |
| 939 | Ga0496114_0035168 | 3300048917 | Bacteria | 4136 |
| 940 | Ga0496114_0125652 | 3300048917 | Bacteria | 2211 |
| 941 | Ga0496114_0283639 | 3300048917 | Bacteria | 1460 |
| 942 | Ga0496114_0784809 | 3300048917 | Bacteria | 831 |
| 943 | Ga0496114_1020619 | 3300048917 | Bacteria | 711 |
| 944 | Ga0496115_0010148 | 3300048918 | Bacteria | 7027 |
| 945 | Ga0496115_0140402 | 3300048918 | Bacteria | 1993 |
| 946 | Ga0496116_0000360 | 3300048919 | Bacteria | 70849 |
| 947 | Ga0496118_0184896 | 3300048921 | Bacteria | 1254 |
| 948 | Ga0496118_0208221 | 3300048921 | Bacteria | 1150 |
| 949 | Ga0496119_0003375 | 3300048922 | Bacteria | 16614 |
| 950 | Ga0496119_0019417 | 3300048922 | Bacteria | 5007 |
| 951 | Ga0496119_0110770 | 3300048922 | Bacteria | 1524 |
| 952 | Ga0496120_0008036 | 3300048923 | Bacteria | 7760 |
| 953 | Ga0496120_0140610 | 3300048923 | Bacteria | 1226 |
| 954 | Ga0496121_0003947 | 3300048924 | Bacteria | 20501 |
| 955 | Ga0496121_0036929 | 3300048924 | Bacteria | 4346 |
| 956 | Ga0496121_0073431 | 3300048924 | Bacteria | 2741 |
| 957 | Ga0496121_0258296 | 3300048924 | Bacteria | 1204 |
| 958 | Ga0496121_0592756 | 3300048924 | Bacteria | 685 |
| 959 | Ga0496124_0318342 | 3300048927 | Bacteria | 1115 |
| 960 | Ga0496124_0843861 | 3300048927 | Bacteria | 562 |
| 961 | Ga0496125_0140842 | 3300048928 | Bacteria | 1677 |
| 962 | Ga0495678_091463 | 3300049459 | Bacteria | 1071 |
| 963 | Ga0501291_079710 | 3300049514 | Bacteria | 650 |
| 964 | Ga0501296_068715 | 3300049519 | Bacteria | 546 |
| 965 | Ga0501299_148816 | 3300049522 | Bacteria | 589 |
| 966 | Ga0501311_105996 | 3300049527 | Bacteria | 502 |
| 967 | Ga0501318_055619 | 3300049534 | Bacteria | 597 |
| 968 | Ga0501031_0000518 | 3300049568 | Bacteria | 22531 |
| 969 | Ga0501031_0036646 | 3300049568 | Bacteria | 3199 |
| 970 | Ga0501031_0168873 | 3300049568 | Bacteria | 1429 |
| 971 | Ga0501031_0172799 | 3300049568 | Bacteria | 1412 |
| 972 | Ga0501031_0813652 | 3300049568 | Bacteria | 599 |
| 973 | Ga0501031_0991037 | 3300049568 | Bacteria | 537 |
| 974 | Ga0501032_0005293 | 3300049569 | Bacteria | 9596 |
| 975 | Ga0501032_0077286 | 3300049569 | Bacteria | 2216 |
| 976 | Ga0501032_0840122 | 3300049569 | Bacteria | 579 |
| 977 | Ga0501033_0002948 | 3300049570 | Bacteria | 14221 |
| 978 | Ga0501033_0031433 | 3300049570 | Bacteria | 3989 |
| 979 | Ga0501033_0272238 | 3300049570 | Bacteria | 1197 |
| 980 | Ga0501033_0277794 | 3300049570 | Bacteria | 1183 |
| 981 | Ga0501033_0699581 | 3300049570 | Bacteria | 690 |
| 982 | Ga0501033_1039326 | 3300049570 | Bacteria | 546 |
| 983 | Ga0501034_0033847 | 3300049571 | Bacteria | 5180 |
| 984 | Ga0501034_0358911 | 3300049571 | Bacteria | 1385 |
| 985 | Ga0501036_0000227 | 3300049572 | Bacteria | 37896 |
| 986 | Ga0501036_0003861 | 3300049572 | Bacteria | 12026 |
| 987 | Ga0501036_0037260 | 3300049572 | Bacteria | 4114 |
| 988 | Ga0501036_0155948 | 3300049572 | Bacteria | 1926 |
| 989 | Ga0501036_0239472 | 3300049572 | Bacteria | 1522 |
| 990 | Ga0501036_0812535 | 3300049572 | Bacteria | 770 |
| 991 | Ga0501036_1067536 | 3300049572 | Bacteria | 660 |
| 992 | Ga0501036_1263097 | 3300049572 | Bacteria | 601 |
| 993 | Ga0501036_1689421 | 3300049572 | Bacteria | 510 |
| 994 | Ga0501037_0031355 | 3300049573 | Bacteria | 3924 |
| 995 | Ga0501037_0244342 | 3300049573 | Bacteria | 1257 |
| 996 | Ga0501037_0402665 | 3300049573 | Bacteria | 938 |
| 997 | Ga0501037_0862856 | 3300049573 | Bacteria | 595 |
| 998 | Ga0501038_0002331 | 3300049574 | Bacteria | 17683 |
| 999 | Ga0501038_0023699 | 3300049574 | Bacteria | 5485 |
| 1000 | Ga0501038_0054198 | 3300049574 | Bacteria | 3449 |
| 1001 | Ga0501038_0464016 | 3300049574 | Bacteria | 972 |
| 1002 | Ga0501038_0740346 | 3300049574 | Bacteria | 734 |
| 1003 | Ga0501038_1056520 | 3300049574 | Unclassified | 594 |
| 1004 | Ga0501038_1159161 | 3300049574 | Bacteria | 562 |
| 1005 | Ga0501038_1187185 | 3300049574 | Bacteria | 554 |
| 1006 | Ga0501039_0000817 | 3300049575 | Bacteria | 22459 |
| 1007 | Ga0501039_0024988 | 3300049575 | Bacteria | 4588 |
| 1008 | Ga0501039_0039399 | 3300049575 | Bacteria | 3649 |
| 1009 | Ga0501039_0080713 | 3300049575 | Bacteria | 2531 |
| 1010 | Ga0501039_0125165 | 3300049575 | Bacteria | 2016 |
| 1011 | Ga0501039_0150816 | 3300049575 | Bacteria | 1826 |
| 1012 | Ga0501039_0432122 | 3300049575 | Bacteria | 1034 |
| 1013 | Ga0501039_0995014 | 3300049575 | Bacteria | 652 |
| 1014 | Ga0501039_1319638 | 3300049575 | Bacteria | 556 |
| 1015 | Ga0501040_0026259 | 3300049576 | Bacteria | 3916 |
| 1016 | Ga0501040_0051067 | 3300049576 | Bacteria | 2829 |
| 1017 | Ga0501040_0129819 | 3300049576 | Bacteria | 1771 |
| 1018 | Ga0501040_0243793 | 3300049576 | Bacteria | 1281 |
| 1019 | Ga0501040_0245241 | 3300049576 | Bacteria | 1277 |
| 1020 | Ga0501040_0363283 | 3300049576 | Bacteria | 1038 |
| 1021 | Ga0501040_0407802 | 3300049576 | Bacteria | 976 |
| 1022 | Ga0501040_0491104 | 3300049576 | Bacteria | 885 |
| 1023 | Ga0501040_0568775 | 3300049576 | Bacteria | 818 |
| 1024 | Ga0501041_0000836 | 3300049577 | Bacteria | 16532 |
| 1025 | Ga0501041_0018099 | 3300049577 | Bacteria | 4196 |
| 1026 | Ga0501041_0023356 | 3300049577 | Bacteria | 3708 |
| 1027 | Ga0501041_0024566 | 3300049577 | Bacteria | 3618 |
| 1028 | Ga0501041_0080386 | 3300049577 | Bacteria | 2007 |
| 1029 | Ga0501041_0148607 | 3300049577 | Bacteria | 1462 |
| 1030 | Ga0501041_0358718 | 3300049577 | Bacteria | 922 |
| 1031 | Ga0501041_0360609 | 3300049577 | Bacteria | 919 |
| 1032 | Ga0501042_0000314 | 3300049578 | Bacteria | 24226 |
| 1033 | Ga0501042_0022170 | 3300049578 | Bacteria | 4435 |
| 1034 | Ga0501042_0085843 | 3300049578 | Bacteria | 2257 |
| 1035 | Ga0501042_0153946 | 3300049578 | Bacteria | 1658 |
| 1036 | Ga0501042_0214517 | 3300049578 | Bacteria | 1388 |
| 1037 | Ga0501042_0276895 | 3300049578 | Bacteria | 1211 |
| 1038 | Ga0501042_0411699 | 3300049578 | Bacteria | 980 |
| 1039 | Ga0501042_0532834 | 3300049578 | Bacteria | 853 |
| 1040 | Ga0501042_0657545 | 3300049578 | Bacteria | 762 |
| 1041 | Ga0501042_0899245 | 3300049578 | Bacteria | 645 |
| 1042 | Ga0501042_1267122 | 3300049578 | Bacteria | 538 |
| 1043 | Ga0501043_0001251 | 3300049579 | Bacteria | 22398 |
| 1044 | Ga0501043_0619961 | 3300049579 | Bacteria | 797 |
| 1045 | Ga0501043_0683112 | 3300049579 | Bacteria | 751 |
| 1046 | Ga0501043_0820577 | 3300049579 | Bacteria | 671 |
| 1047 | Ga0501043_1038934 | 3300049579 | Bacteria | 581 |
| 1048 | Ga0501043_1091158 | 3300049579 | Bacteria | 564 |
| 1049 | Ga0501046_0000158 | 3300049580 | Bacteria | 70218 |
| 1050 | Ga0501046_0047802 | 3300049580 | Bacteria | 3391 |
| 1051 | Ga0501046_0196490 | 3300049580 | Bacteria | 1502 |
| 1052 | Ga0501046_0208714 | 3300049580 | Bacteria | 1451 |
| 1053 | Ga0501046_0250560 | 3300049580 | Bacteria | 1303 |
| 1054 | Ga0501046_0352181 | 3300049580 | Bacteria | 1069 |
| 1055 | Ga0501046_0527553 | 3300049580 | Bacteria | 843 |
| 1056 | Ga0501046_0958905 | 3300049580 | Bacteria | 595 |
| 1057 | Ga0501047_0004798 | 3300049581 | Bacteria | 12724 |
| 1058 | Ga0501047_0013835 | 3300049581 | Bacteria | 7660 |
| 1059 | Ga0501047_0045884 | 3300049581 | Bacteria | 4224 |
| 1060 | Ga0501047_0266058 | 3300049581 | Bacteria | 1561 |
| 1061 | Ga0501047_0491553 | 3300049581 | Bacteria | 1054 |
| 1062 | Ga0501048_0002270 | 3300049582 | Bacteria | 14668 |
| 1063 | Ga0501048_0016574 | 3300049582 | Bacteria | 5433 |
| 1064 | Ga0501048_0026492 | 3300049582 | Bacteria | 4221 |
| 1065 | Ga0501048_0060046 | 3300049582 | Bacteria | 2694 |
| 1066 | Ga0501048_0061923 | 3300049582 | Bacteria | 2649 |
| 1067 | Ga0501048_0078909 | 3300049582 | Bacteria | 2323 |
| 1068 | Ga0501048_0196142 | 3300049582 | Bacteria | 1431 |
| 1069 | Ga0501048_0225396 | 3300049582 | Bacteria | 1330 |
| 1070 | Ga0501048_0685944 | 3300049582 | Archaea | 735 |
| 1071 | Ga0501067_0037989 | 3300049583 | Bacteria | 2674 |
| 1072 | Ga0501067_0225543 | 3300049583 | Bacteria | 1043 |
| 1073 | Ga0501067_0570789 | 3300049583 | Bacteria | 634 |
| 1074 | Ga0501068_0000071 | 3300049584 | Bacteria | 40485 |
| 1075 | Ga0501068_0024532 | 3300049584 | Bacteria | 3542 |
| 1076 | Ga0501068_0149301 | 3300049584 | Bacteria | 1468 |
| 1077 | Ga0501068_0320791 | 3300049584 | Bacteria | 993 |
| 1078 | Ga0501068_0355666 | 3300049584 | Bacteria | 942 |
| 1079 | Ga0501068_0408591 | 3300049584 | Bacteria | 876 |
| 1080 | Ga0501068_0697808 | 3300049584 | Bacteria | 664 |
| 1081 | Ga0501068_0921233 | 3300049584 | Bacteria | 575 |
| 1082 | Ga0501068_1050190 | 3300049584 | Bacteria | 538 |
| 1083 | Ga0501069_0041260 | 3300049585 | Bacteria | 2550 |
| 1084 | Ga0501069_0090250 | 3300049585 | Bacteria | 1732 |
| 1085 | Ga0501069_0557678 | 3300049585 | Bacteria | 686 |
| 1086 | Ga0501070_0003160 | 3300049586 | Bacteria | 14326 |
| 1087 | Ga0501070_0028261 | 3300049586 | Bacteria | 4702 |
| 1088 | Ga0501070_0042224 | 3300049586 | Bacteria | 3798 |
| 1089 | Ga0501070_0095031 | 3300049586 | Bacteria | 2466 |
| 1090 | Ga0501070_0168238 | 3300049586 | Bacteria | 1806 |
| 1091 | Ga0501070_0212313 | 3300049586 | Bacteria | 1588 |
| 1092 | Ga0501070_0561717 | 3300049586 | Bacteria | 913 |
| 1093 | Ga0501071_0000705 | 3300049587 | Bacteria | 17524 |
| 1094 | Ga0501071_0051603 | 3300049587 | Bacteria | 2964 |
| 1095 | Ga0501071_0180626 | 3300049587 | Bacteria | 1581 |
| 1096 | Ga0501071_0291320 | 3300049587 | Bacteria | 1236 |
| 1097 | Ga0501071_0421814 | 3300049587 | Bacteria | 1020 |
| 1098 | Ga0501071_0698152 | 3300049587 | Bacteria | 781 |
| 1099 | Ga0501071_0976560 | 3300049587 | Bacteria | 654 |
| 1100 | Ga0501071_0985252 | 3300049587 | Bacteria | 651 |
| 1101 | Ga0501071_1031514 | 3300049587 | Bacteria | 635 |
| 1102 | Ga0501071_1053749 | 3300049587 | Bacteria | 628 |
| 1103 | Ga0501071_1132190 | 3300049587 | Bacteria | 605 |
| 1104 | Ga0501072_0034360 | 3300049588 | Bacteria | 3973 |
| 1105 | Ga0501072_0041682 | 3300049588 | Bacteria | 3607 |
| 1106 | Ga0501072_0047943 | 3300049588 | Bacteria | 3364 |
| 1107 | Ga0501072_0083174 | 3300049588 | Bacteria | 2537 |
| 1108 | Ga0501072_0100613 | 3300049588 | Bacteria | 2298 |
| 1109 | Ga0501072_0222262 | 3300049588 | Bacteria | 1505 |
| 1110 | Ga0501072_0256918 | 3300049588 | Bacteria | 1391 |
| 1111 | Ga0501072_0500303 | 3300049588 | Bacteria | 961 |
| 1112 | Ga0501072_0844853 | 3300049588 | Bacteria | 716 |
| 1113 | Ga0501072_1106661 | 3300049588 | Bacteria | 616 |
| 1114 | Ga0501072_1317677 | 3300049588 | Bacteria | 559 |
| 1115 | Ga0501073_0021965 | 3300049589 | Bacteria | 4597 |
| 1116 | Ga0501073_0287458 | 3300049589 | Bacteria | 1134 |
| 1117 | Ga0501074_0000343 | 3300049590 | Bacteria | 27140 |
| 1118 | Ga0501074_0080020 | 3300049590 | Bacteria | 2345 |
| 1119 | Ga0501074_0101814 | 3300049590 | Bacteria | 2056 |
| 1120 | Ga0501074_0164810 | 3300049590 | Bacteria | 1582 |
| 1121 | Ga0501074_0235296 | 3300049590 | Bacteria | 1303 |
| 1122 | Ga0501074_0959757 | 3300049590 | Bacteria | 601 |
| 1123 | Ga0501074_1057272 | 3300049590 | Bacteria | 570 |
| 1124 | Ga0501075_0023003 | 3300049591 | Bacteria | 4558 |
| 1125 | Ga0501075_0143366 | 3300049591 | Bacteria | 1821 |
| 1126 | Ga0501075_0242049 | 3300049591 | Bacteria | 1375 |
| 1127 | Ga0501075_0242112 | 3300049591 | Bacteria | 1375 |
| 1128 | Ga0501075_0304916 | 3300049591 | Bacteria | 1213 |
| 1129 | Ga0501075_0424638 | 3300049591 | Bacteria | 1013 |
| 1130 | Ga0501075_0873288 | 3300049591 | Bacteria | 684 |
| 1131 | Ga0501075_1521141 | 3300049591 | Bacteria | 506 |
| 1132 | Ga0501076_0023264 | 3300049592 | Bacteria | 4774 |
| 1133 | Ga0501076_0025133 | 3300049592 | Bacteria | 4607 |
| 1134 | Ga0501076_0263560 | 3300049592 | Bacteria | 1411 |
| 1135 | Ga0501076_0285723 | 3300049592 | Bacteria | 1351 |
| 1136 | Ga0501076_0305889 | 3300049592 | Bacteria | 1303 |
| 1137 | Ga0501076_0620478 | 3300049592 | Bacteria | 892 |
| 1138 | Ga0501076_0794592 | 3300049592 | Bacteria | 781 |
| 1139 | Ga0501076_0868656 | 3300049592 | Bacteria | 744 |
| 1140 | Ga0501076_1252170 | 3300049592 | Unclassified | 610 |
| 1141 | Ga0501077_0003562 | 3300049593 | Bacteria | 9358 |
| 1142 | Ga0501077_0009374 | 3300049593 | Bacteria | 6081 |
| 1143 | Ga0501077_0021261 | 3300049593 | Bacteria | 4106 |
| 1144 | Ga0501077_0154197 | 3300049593 | Bacteria | 1458 |
| 1145 | Ga0501077_0388296 | 3300049593 | Bacteria | 892 |
| 1146 | Ga0501077_0741995 | 3300049593 | Bacteria | 631 |
| 1147 | Ga0501077_1139119 | 3300049593 | Bacteria | 502 |
| 1148 | Ga0501208_100171 | 3300049655 | Bacteria | 620 |
| 1149 | Ga0501214_028591 | 3300049659 | Bacteria | 753 |
| 1150 | Ga0501227_136317 | 3300049665 | Bacteria | 671 |
| 1151 | Ga0501233_278268 | 3300049668 | Bacteria | 511 |
| 1152 | Ga0501243_140184 | 3300049675 | Unclassified | 510 |
| 1153 | Ga0501261_128874 | 3300049690 | Bacteria | 508 |
| 1154 | Ga0501079_0006091 | 3300049741 | Bacteria | 9040 |
| 1155 | Ga0501079_0033127 | 3300049741 | Bacteria | 3973 |
| 1156 | Ga0501079_0057049 | 3300049741 | Bacteria | 3013 |
| 1157 | Ga0501079_0057535 | 3300049741 | Bacteria | 3000 |
| 1158 | Ga0501079_0074477 | 3300049741 | Bacteria | 2624 |
| 1159 | Ga0501079_0102218 | 3300049741 | Bacteria | 2223 |
| 1160 | Ga0501079_0123145 | 3300049741 | Bacteria | 2017 |
| 1161 | Ga0501079_0213081 | 3300049741 | Bacteria | 1509 |
| 1162 | Ga0501079_0311365 | 3300049741 | Bacteria | 1232 |
| 1163 | Ga0501079_0921663 | 3300049741 | Bacteria | 688 |
| 1164 | Ga0501080_0007150 | 3300049742 | Bacteria | 10074 |
| 1165 | Ga0501080_0387969 | 3300049742 | Bacteria | 1257 |
| 1166 | Ga0501080_0435817 | 3300049742 | Bacteria | 1176 |
| 1167 | Ga0501080_0686385 | 3300049742 | Bacteria | 904 |
| 1168 | Ga0501080_1152724 | 3300049742 | Bacteria | 668 |
| 1169 | Ga0501080_1529446 | 3300049742 | Bacteria | 566 |
| 1170 | Ga0501081_0001597 | 3300049743 | Bacteria | 13984 |
| 1171 | Ga0501081_0018220 | 3300049743 | Bacteria | 4661 |
| 1172 | Ga0501081_0235445 | 3300049743 | Bacteria | 1334 |
| 1173 | Ga0501081_0372786 | 3300049743 | Bacteria | 1054 |
| 1174 | Ga0501081_0482849 | 3300049743 | Bacteria | 922 |
| 1175 | Ga0501081_0688173 | 3300049743 | Bacteria | 767 |
| 1176 | Ga0501081_0712738 | 3300049743 | Bacteria | 753 |
| 1177 | Ga0501081_0981403 | 3300049743 | Bacteria | 638 |
| 1178 | Ga0501083_0000141 | 3300049744 | Bacteria | 49193 |
| 1179 | Ga0501083_0472707 | 3300049744 | Bacteria | 816 |
| 1180 | Ga0501083_0785264 | 3300049744 | Bacteria | 620 |
| 1181 | Ga0501266_034847 | 3300049763 | Bacteria | 730 |
| 1182 | Ga0501268_173605 | 3300049765 | Bacteria | 510 |
| 1183 | Ga0501035_0000856 | 3300049822 | Bacteria | 32437 |
| 1184 | Ga0501035_0070715 | 3300049822 | Bacteria | 3090 |
| 1185 | Ga0501035_1284377 | 3300049822 | Bacteria | 565 |
| 1186 | Ga0501044_0005849 | 3300049823 | Bacteria | 13622 |
| 1187 | Ga0501044_0286045 | 3300049823 | Bacteria | 1581 |
| 1188 | Ga0501044_0614279 | 3300049823 | Bacteria | 979 |
| 1189 | Ga0501044_0705799 | 3300049823 | Bacteria | 894 |
| 1190 | Ga0501044_1082381 | 3300049823 | Bacteria | 671 |
| 1191 | Ga0501044_1647580 | 3300049823 | Bacteria | 506 |
| 1192 | Ga0501044_1659627 | 3300049823 | Bacteria | 504 |
| 1193 | Ga0501045_0002026 | 3300049824 | Bacteria | 13700 |
| 1194 | Ga0501045_0025350 | 3300049824 | Bacteria | 4262 |
| 1195 | Ga0501045_0043941 | 3300049824 | Bacteria | 3254 |
| 1196 | Ga0501045_0059132 | 3300049824 | Bacteria | 2807 |
| 1197 | Ga0501045_0345611 | 3300049824 | Bacteria | 1107 |
| 1198 | Ga0501045_0571790 | 3300049824 | Bacteria | 838 |
| 1199 | Ga0501045_0756404 | 3300049824 | Bacteria | 716 |
| 1200 | Ga0501045_0882159 | 3300049824 | Bacteria | 657 |
| 1201 | Ga0501212_046437 | 3300049851 | Bacteria | 728 |
| 1202 | nmdc:mga03n38_449329_c1 | 3300050490 | Bacteria | 717 |
| 1203 | nmdc:mga03n38_793286_c1 | 3300050490 | Bacteria | 551 |
| 1204 | nmdc:mga03n38_86593_c1 | 3300050490 | Bacteria | 1483 |
| 1205 | nmdc:mga00v17_155506_c1 | 3300050491 | Bacteria | 1470 |
| 1206 | nmdc:mga00v17_309015_c1 | 3300050491 | Bacteria | 1027 |
| 1207 | nmdc:mga00v17_661337_c1 | 3300050491 | Bacteria | 671 |
| 1208 | nmdc:mga0yw44_1002328_c1 | 3300050492 | Bacteria | 565 |
| 1209 | nmdc:mga0yw44_1199744_c1 | 3300050492 | Bacteria | 512 |
| 1210 | nmdc:mga0yw44_251594_c1 | 3300050492 | Bacteria | 1176 |
| 1211 | nmdc:mga0yw44_259902_c1 | 3300050492 | Bacteria | 1157 |
| 1212 | nmdc:mga0yw44_266377_c1 | 3300050492 | Bacteria | 1143 |
| 1213 | nmdc:mga0yw44_396704_c1 | 3300050492 | Bacteria | 932 |
| 1214 | nmdc:mga0yw44_580315_c1 | 3300050492 | Bacteria | 761 |
| 1215 | nmdc:mga06z11_177386_c1 | 3300050494 | Bacteria | 1227 |
| 1216 | nmdc:mga06z11_448720_c1 | 3300050494 | Bacteria | 779 |
| 1217 | nmdc:mga06z11_776114_c1 | 3300050494 | Bacteria | 584 |
| 1218 | nmdc:mga06z11_930471_c1 | 3300050494 | Bacteria | 530 |
| 1219 | nmdc:mga05p37_1169559_c1 | 3300050507 | Bacteria | 798 |
| 1220 | nmdc:mga05p37_151862_c1 | 3300050507 | Bacteria | 2832 |
| 1221 | nmdc:mga05p37_19978_c1 | 3300050507 | Bacteria | 8105 |
| 1222 | nmdc:mga05p37_379328_c1 | 3300050507 | Bacteria | 1657 |
| 1223 | nmdc:mga05p37_387230_c1 | 3300050507 | Bacteria | 1636 |
| 1224 | nmdc:mga05p37_782329_c1 | 3300050507 | Bacteria | 1047 |
| 1225 | nmdc:mga05p37_903395_c1 | 3300050507 | Bacteria | 952 |
| 1226 | nmdc:mga09592_1531842_c1 | 3300050508 | Bacteria | 542 |
| 1227 | nmdc:mga09592_545257_c1 | 3300050508 | Bacteria | 996 |
| 1228 | nmdc:mga09592_602038_c1 | 3300050508 | Bacteria | 941 |
| 1229 | nmdc:mga09592_717760_c1 | 3300050508 | Bacteria | 850 |
| 1230 | nmdc:mga09592_793983_c1 | 3300050508 | Bacteria | 801 |
| 1231 | nmdc:mga09592_795797_c1 | 3300050508 | Bacteria | 800 |
| 1232 | nmdc:mga09592_8067_c1 | 3300050508 | Bacteria | 8566 |
| 1233 | nmdc:mga0qj67_1032502_c1 | 3300050509 | Unclassified | 644 |
| 1234 | nmdc:mga0qj67_1084712_c1 | 3300050509 | Bacteria | 626 |
| 1235 | nmdc:mga0qj67_1446744_c1 | 3300050509 | Bacteria | 529 |
| 1236 | nmdc:mga0qj67_190095_c1 | 3300050509 | Bacteria | 1669 |
| 1237 | nmdc:mga0qj67_215457_c1 | 3300050509 | Bacteria | 1559 |
| 1238 | nmdc:mga0qj67_315227_c1 | 3300050509 | Bacteria | 1266 |
| 1239 | nmdc:mga0qj67_357506_c1 | 3300050509 | Bacteria | 1180 |
| 1240 | nmdc:mga0qj67_48093_c1 | 3300050509 | Bacteria | 3369 |
| 1241 | nmdc:mga0qj67_900372_c1 | 3300050509 | Bacteria | 697 |
| 1242 | nmdc:mga06r32_1793642_c1 | 3300050510 | Bacteria | 549 |
| 1243 | nmdc:mga06r32_27650_c1 | 3300050510 | Bacteria | 5302 |
| 1244 | nmdc:mga06r32_337834_c1 | 3300050510 | Bacteria | 1491 |
| 1245 | nmdc:mga06r32_527204_c1 | 3300050510 | Bacteria | 1156 |
| 1246 | nmdc:mga06r32_56393_c1 | 3300050510 | Bacteria | 3772 |
| 1247 | nmdc:mga06r32_658143_c1 | 3300050510 | Bacteria | 1015 |
| 1248 | nmdc:mga06r32_930487_c1 | 3300050510 | Bacteria | 824 |
| 1249 | nmdc:mga08y16_1113610_c1 | 3300050511 | Bacteria | 764 |
| 1250 | nmdc:mga08y16_1404907_c1 | 3300050511 | Bacteria | 661 |
| 1251 | nmdc:mga08y16_1445402_c1 | 3300050511 | Bacteria | 649 |
| 1252 | nmdc:mga08y16_1486473_c1 | 3300050511 | Bacteria | 638 |
| 1253 | nmdc:mga08y16_1502181_c1 | 3300050511 | Bacteria | 634 |
| 1254 | nmdc:mga08y16_1504756_c1 | 3300050511 | Bacteria | 633 |
| 1255 | nmdc:mga08y16_1556581_c1 | 3300050511 | Bacteria | 620 |
| 1256 | nmdc:mga08y16_1891581_c1 | 3300050511 | Bacteria | 548 |
| 1257 | nmdc:mga08y16_2171636_c1 | 3300050511 | Bacteria | 502 |
| 1258 | nmdc:mga08y16_228365_c1 | 3300050511 | Bacteria | 1925 |
| 1259 | nmdc:mga08y16_248578_c1 | 3300050511 | Bacteria | 1838 |
| 1260 | nmdc:mga08y16_299298_c1 | 3300050511 | Bacteria | 1658 |
| 1261 | nmdc:mga08y16_30358_c2 | 3300050511 | Bacteria | 4521 |
| 1262 | nmdc:mga08y16_321786_c1 | 3300050511 | Bacteria | 1592 |
| 1263 | nmdc:mga08y16_624192_c1 | 3300050511 | Bacteria | 1084 |
| 1264 | nmdc:mga08y16_782842_c1 | 3300050511 | Bacteria | 948 |
| 1265 | nmdc:mga08y16_938886_c1 | 3300050511 | Bacteria | 849 |
| 1266 | nmdc:mga0n895_2216051_c1 | 3300050512 | Bacteria | 505 |
| 1267 | nmdc:mga0n895_72932_c1 | 3300050512 | Bacteria | 3407 |
| 1268 | nmdc:mga0rr50_1166875_c1 | 3300050513 | Bacteria | 655 |
| 1269 | nmdc:mga0rr50_1327563_c1 | 3300050513 | Bacteria | 610 |
| 1270 | nmdc:mga0rr50_1804684_c1 | 3300050513 | Bacteria | 515 |
| 1271 | nmdc:mga0a205_1060203_c1 | 3300050515 | Bacteria | 658 |
| 1272 | nmdc:mga0a205_398163_c1 | 3300050515 | Bacteria | 1241 |
| 1273 | nmdc:mga0a205_697796_c1 | 3300050515 | Bacteria | 865 |
| 1274 | nmdc:mga0a205_791316_c1 | 3300050515 | Bacteria | 796 |
| 1275 | nmdc:mga0a205_994862_c1 | 3300050515 | Bacteria | 685 |
| 1276 | nmdc:mga0sz30_44171_c1 | 3300050516 | Bacteria | 1876 |
| 1277 | Ga0495601_0052039 | 3300053077 | Bacteria | 2585 |
| 1278 | Ga0495601_0870213 | 3300053077 | Bacteria | 570 |
| 1279 | Ga0495601_0966206 | 3300053077 | Bacteria | 536 |
| 1280 | Ga0495601_1030595 | 3300053077 | Unclassified | 517 |
| 1281 | Ga0495612_0144616 | 3300053078 | Bacteria | 1033 |
| 1282 | Ga0495612_0536400 | 3300053078 | Unclassified | 538 |
| 1283 | Ga0495655_0000006 | 3300053083 | Bacteria | 201200 |
| 1284 | Ga0495655_0019506 | 3300053083 | Bacteria | 1506 |
| 1285 | Ga0495655_0199145 | 3300053083 | Bacteria | 654 |
| 1286 | Ga0495655_0217168 | 3300053083 | Bacteria | 631 |
| 1287 | Ga0495655_0227285 | 3300053083 | Bacteria | 620 |
| 1288 | Ga0495595_0068620 | 3300053084 | Bacteria | 1672 |
| 1289 | Ga0495595_0520933 | 3300053084 | Bacteria | 606 |
| 1290 | Ga0495595_0718709 | 3300053084 | Bacteria | 512 |
| 1291 | Ga0495619_0000037 | 3300053085 | Bacteria | 124007 |
| 1292 | Ga0495619_0016599 | 3300053085 | Bacteria | 4661 |
| 1293 | Ga0495619_0016985 | 3300053085 | Bacteria | 4611 |
| 1294 | Ga0495619_0392621 | 3300053085 | Bacteria | 958 |
| 1295 | Ga0495619_0690138 | 3300053085 | Bacteria | 695 |
| 1296 | Ga0495619_0699157 | 3300053085 | Bacteria | 689 |
| 1297 | Ga0495619_1064166 | 3300053085 | Bacteria | 539 |
| 1298 | Ga0500628_000052 | 3300053129 | Bacteria | 38627 |
| 1299 | Ga0501084_0009083 | 3300054114 | Bacteria | 8224 |
| 1300 | Ga0501084_0012528 | 3300054114 | Bacteria | 7023 |
| 1301 | Ga0501084_0027122 | 3300054114 | Bacteria | 4786 |
| 1302 | Ga0501084_0041016 | 3300054114 | Bacteria | 3872 |
| 1303 | Ga0501084_0089774 | 3300054114 | Bacteria | 2579 |
| 1304 | Ga0501084_0290254 | 3300054114 | Bacteria | 1381 |
| 1305 | Ga0501084_0828035 | 3300054114 | Bacteria | 779 |
| 1306 | Ga0501084_0865173 | 3300054114 | Bacteria | 760 |
| 1307 | Ga0501084_0946118 | 3300054114 | Bacteria | 724 |
| 1308 | Ga0501082_0000605 | 3300060353 | Bacteria | 31641 |
| 1309 | Ga0501082_0002483 | 3300060353 | Bacteria | 16162 |
| 1310 | Ga0501082_0144272 | 3300060353 | Bacteria | 2066 |
| 1311 | Ga0501082_0149257 | 3300060353 | Bacteria | 2030 |
| 1312 | Ga0501082_0258957 | 3300060353 | Bacteria | 1513 |
| 1313 | Ga0501082_0368909 | 3300060353 | Bacteria | 1252 |
| 1314 | Ga0501082_0532336 | 3300060353 | Bacteria | 1027 |
| 1315 | Ga0501082_1998489 | 3300060353 | Bacteria | 505 |
| 1316 | Ga0530510_0003067 | 3300061734 | Bacteria | 11472 |
| 1317 | Ga0530510_0003278 | 3300061734 | Bacteria | 11137 |
| 1318 | Ga0530510_0006984 | 3300061734 | Bacteria | 7866 |
| 1319 | Ga0530510_0051193 | 3300061734 | Bacteria | 2983 |
| 1320 | Ga0530510_0111850 | 3300061734 | Bacteria | 2001 |
| 1321 | Ga0530510_0559862 | 3300061734 | Bacteria | 868 |
| 1322 | Ga0530510_0796517 | 3300061734 | Bacteria | 721 |
| 1323 | Ga0530510_1528356 | 3300061734 | Bacteria | 513 |
| 1324 | Ga0070705_100227102 | |||
| 1325 | LJQas_1017724 | |||
| 1326 | JGI25407J50210_10000647 | |||
| 1327 | JGI25407J50210_10005201 | |||
| 1328 | JGI25407J50210_10022663 | |||
| 1329 | JGI25407J50210_10068884 | |||
| 1330 | JGI25407J50210_10107413 | |||
| 1331 | JGI25404J52841_10057976 | |||
| 1332 | Ga0070658_10007864 | |||
| 1333 | Ga0070658_10124271 | |||
| 1334 | Ga0070683_100001059 | |||
| 1335 | Ga0070683_100057240 | |||
| 1336 | Ga0070683_100063493 | |||
| 1337 | Ga0070683_100100993 | |||
| 1338 | Ga0070683_100299884 | |||
| 1339 | Ga0070683_101848547 | |||
| 1340 | Ga0068869_101965336 | |||
| 1341 | Ga0070680_100833674 | |||
| 1342 | Ga0070682_100714598 | |||
| 1343 | Ga0070682_100944089 | |||
| 1344 | Ga0068868_100063354 | |||
| 1345 | Ga0068868_100155040 | |||
| 1346 | Ga0068868_101132531 | |||
| 1347 | Ga0068868_101209270 | |||
| 1348 | Ga0070660_100010723 | |||
| 1349 | Ga0070660_100015124 | |||
| 1350 | Ga0070660_100142980 | |||
| 1351 | Ga0070660_100319916 | |||
| 1352 | Ga0070660_100615165 | |||
| 1353 | Ga0070660_100949883 | |||
| 1354 | Ga0070660_101339250 | |||
| 1355 | Ga0070689_100736887 | |||
| 1356 | Ga0070691_10024769 | |||
| 1357 | Ga0070687_100792589 | |||
| 1358 | Ga0070661_100680876 | |||
| 1359 | Ga0070668_100478566 | |||
| 1360 | Ga0070675_100241136 | |||
| 1361 | Ga0070674_100952254 | |||
| 1362 | Ga0070674_101213647 | |||
| 1363 | Ga0070673_100954556 | |||
| 1364 | Ga0070667_101413814 | |||
| 1365 | Ga0070667_102059687 | |||
| 1366 | Ga0070703_10032059 | |||
| 1367 | Ga0070709_10415941 | |||
| 1368 | Ga0070709_10537350 | |||
| 1369 | Ga0070714_100001136 | |||
| 1370 | Ga0070714_100065991 | |||
| 1371 | Ga0070714_100078366 | |||
| 1372 | Ga0070714_100120288 | |||
| 1373 | Ga0070713_100104043 | |||
| 1374 | Ga0070713_101608955 | |||
| 1375 | Ga0070701_10026041 | |||
| 1376 | Ga0070701_10985559 | |||
| 1377 | Ga0070700_100328299 | |||
| 1378 | Ga0070700_101745335 | |||
| 1379 | Ga0070694_100043377 | |||
| 1380 | Ga0070694_100169544 | |||
| 1381 | Ga0070694_100377477 | |||
| 1382 | Ga0070678_100800268 | |||
| 1383 | Ga0070662_101328203 | |||
| 1384 | Ga0070681_10013572 | |||
| 1385 | Ga0070681_10039257 | |||
| 1386 | Ga0070681_10176122 | |||
| 1387 | Ga0070681_10461811 | |||
| 1388 | Ga0068867_101001567 | |||
| 1389 | Ga0070706_100402194 | |||
| 1390 | Ga0070679_100040168 | |||
| 1391 | Ga0070679_100064556 | |||
| 1392 | Ga0070679_100150535 | |||
| 1393 | Ga0070679_100242417 | |||
| 1394 | Ga0070684_100011356 | |||
| 1395 | Ga0070684_100025743 | |||
| 1396 | Ga0070684_100041508 | |||
| 1397 | Ga0070684_100156327 | |||
| 1398 | Ga0070684_100285121 | |||
| 1399 | Ga0070684_100309997 | |||
| 1400 | Ga0070684_100466353 | |||
| 1401 | Ga0070684_100578048 | |||
| 1402 | Ga0070684_102104819 | |||
| 1403 | Ga0070672_100485316 | |||
| 1404 | Ga0070686_100467639 | |||
| 1405 | Ga0070686_101591475 | |||
| 1406 | Ga0070695_100392892 | |||
| 1407 | Ga0070695_101208308 | |||
| 1408 | Ga0070696_100101771 | |||
| 1409 | Ga0070693_100323787 | |||
| 1410 | Ga0070704_100447342 | |||
| 1411 | Ga0070704_100575373 | |||
| 1412 | Ga0070704_101522138 | |||
| 1413 | Ga0068855_100102069 | |||
| 1414 | Ga0068855_100171627 | |||
| 1415 | Ga0070664_100223218 | |||
| 1416 | Ga0070664_100345353 | |||
| 1417 | Ga0068857_100003516 | |||
| 1418 | Ga0068857_100757056 | |||
| 1419 | Ga0068854_100071784 | |||
| 1420 | Ga0068854_102081360 | |||
| 1421 | Ga0068856_100725950 | |||
| 1422 | Ga0070702_100579372 | |||
| 1423 | Ga0068852_100113091 | |||
| 1424 | Ga0068852_102279397 | |||
| 1425 | Ga0068864_100026766 | |||
| 1426 | Ga0068866_10096800 | |||
| 1427 | Ga0068861_100052837 | |||
| 1428 | Ga0068861_100590363 | |||
| 1429 | Ga0068870_10045088 | |||
| 1430 | Ga0068863_100024380 | |||
| 1431 | Ga0068863_102459852 | |||
| 1432 | Ga0068858_101965791 | |||
| 1433 | Ga0068860_101534317 | |||
| 1434 | Ga0068862_100047767 | |||
| 1435 | Ga0068862_100932786 | |||
| 1436 | Ga0081455_10014766 | |||
| 1437 | Ga0081455_10016928 | |||
| 1438 | Ga0081455_10026800 | |||
| 1439 | Ga0081455_10040246 | |||
| 1440 | Ga0081455_10052293 | |||
| 1441 | Ga0081455_10081825 | |||
| 1442 | Ga0081455_10207081 | |||
| 1443 | Ga0081455_10242934 | |||
| 1444 | Ga0081455_10764175 | |||
| 1445 | Ga0081538_10000686 | |||
| 1446 | Ga0081538_10001097 | |||
| 1447 | Ga0081538_10001861 | |||
| 1448 | Ga0081538_10002388 | |||
| 1449 | Ga0081538_10002813 | |||
| 1450 | Ga0081538_10003603 | |||
| 1451 | Ga0081538_10017552 | |||
| 1452 | Ga0081538_10017844 | |||
| 1453 | Ga0081538_10021571 | |||
| 1454 | Ga0081538_10062508 | |||
| 1455 | Ga0081538_10110686 | |||
| 1456 | Ga0081538_10226752 | |||
| 1457 | Ga0081538_10230790 | |||
| 1458 | Ga0081540_1002544 | |||
| 1459 | Ga0081539_10001667 | |||
| 1460 | Ga0070717_10289536 | |||
| 1461 | Ga0070717_11161192 | |||
| 1462 | Ga0075365_10462217 | |||
| 1463 | Ga0075365_10687895 | |||
| 1464 | Ga0075363_100017261 | |||
| 1465 | Ga0075363_100287975 | |||
| 1466 | Ga0075364_10097521 | |||
| 1467 | Ga0075364_10863816 | |||
| 1468 | Ga0075432_10006106 | |||
| 1469 | Ga0070716_100712877 | |||
| 1470 | Ga0075367_10033149 | |||
| 1471 | Ga0075367_10795167 | |||
| 1472 | Ga0075369_10071411 | |||
| 1473 | Ga0097621_100136434 | |||
| 1474 | Ga0097621_100213429 | |||
| 1475 | Ga0097621_102279418 | |||
| 1476 | Ga0068871_100110576 | |||
| 1477 | Ga0068871_100307878 | |||
| 1478 | Ga0068871_101458547 | |||
| 1479 | Ga0075428_100046907 | |||
| 1480 | Ga0075430_100147442 | |||
| 1481 | Ga0075430_100491366 | |||
| 1482 | Ga0075430_100690129 | |||
| 1483 | Ga0075430_101382667 | |||
| 1484 | Ga0075431_100695154 | |||
| 1485 | Ga0075431_100809498 | |||
| 1486 | Ga0075431_100820400 | |||
| 1487 | Ga0075431_101721097 | |||
| 1488 | Ga0075433_10009068 | |||
| 1489 | Ga0075434_100119151 | |||
| 1490 | Ga0075434_100123574 | |||
| 1491 | Ga0075434_100281669 | |||
| 1492 | Ga0075429_100739732 | |||
| 1493 | Ga0075429_100785762 | |||
| 1494 | Ga0075429_101859883 | |||
| 1495 | Ga0068865_100687067 | |||
| 1496 | Ga0068865_101845625 | |||
| 1497 | Ga0068865_101986013 | |||
| 1498 | Ga0075436_101264060 | |||
| 1499 | Ga0075436_101400980 | |||
| 1500 | Ga0075435_100574943 | |||
| 1501 | Ga0105251_10226261 | |||
| 1502 | Ga0105251_10466809 | |||
| 1503 | Ga0105240_10476961 | |||
| 1504 | Ga0105240_12156159 | |||
| 1505 | Ga0111539_10030741 | |||
| 1506 | Ga0111539_10085561 | |||
| 1507 | Ga0111539_10187206 | |||
| 1508 | Ga0111539_10414517 | |||
| 1509 | Ga0111539_10703255 | |||
| 1510 | Ga0111539_11075406 | |||
| 1511 | Ga0111539_11362970 | |||
| 1512 | Ga0111539_11441653 | |||
| 1513 | Ga0111539_12336295 | |||
| 1514 | Ga0111539_12506520 | |||
| 1515 | Ga0111539_12682195 | |||
| 1516 | Ga0111539_12793492 | |||
| 1517 | Ga0105245_10013217 | |||
| 1518 | Ga0105245_10026250 | |||
| 1519 | Ga0105245_10136477 | |||
| 1520 | Ga0105245_10600306 | |||
| 1521 | Ga0105245_12753727 | |||
| 1522 | Ga0105247_10001002 | |||
| 1523 | Ga0105247_10205303 | |||
| 1524 | Ga0105247_10578277 | |||
| 1525 | Ga0105247_10973622 | |||
| 1526 | Ga0114129_10118948 | |||
| 1527 | Ga0114129_10291857 | |||
| 1528 | Ga0114129_10673536 | |||
| 1529 | Ga0114129_11252753 | |||
| 1530 | Ga0114129_11449562 | |||
| 1531 | Ga0114129_11574899 | |||
| 1532 | Ga0114129_12332380 | |||
| 1533 | Ga0114129_12660131 | |||
| 1534 | Ga0105243_10243238 | |||
| 1535 | Ga0105243_10564805 | |||
| 1536 | Ga0105243_10674720 | |||
| 1537 | Ga0105243_11481960 | |||
| 1538 | Ga0105243_11504835 | |||
| 1539 | Ga0105243_12002252 | |||
| 1540 | Ga0105241_10737140 | |||
| 1541 | Ga0105241_10847260 | |||
| 1542 | Ga0105242_10127861 | |||
| 1543 | Ga0105242_12047019 | |||
| 1544 | Ga0105242_12634063 | |||
| 1545 | Ga0105248_10000008 | |||
| 1546 | Ga0105248_10845470 | |||
| 1547 | Ga0105237_10094470 | |||
| 1548 | Ga0105237_11896741 | |||
| 1549 | Ga0105238_10061239 | |||
| 1550 | Ga0105238_10990471 | |||
| 1551 | Ga0105238_11426058 | |||
| 1552 | Ga0105238_12051082 | |||
| 1553 | Ga0105249_10006751 | |||
| 1554 | Ga0105249_10730959 | |||
| 1555 | Ga0105249_10759692 | |||
| 1556 | Ga0105147_119712 | |||
| 1557 | Ga0099796_10269204 | |||
| 1558 | Ga0105239_10132622 | |||
| 1559 | Ga0105239_10274969 | |||
| 1560 | Ga0105239_10623107 | |||
| 1561 | Ga0105239_11043992 | |||
| 1562 | Ga0105239_11486293 | |||
| 1563 | Ga0105239_13540173 | |||
| 1564 | Ga0105246_10114544 | |||
| 1565 | Ga0105246_10484722 | |||
| 1566 | Ga0105246_10630386 | |||
| 1567 | Ga0105246_10678990 | |||
| 1568 | Ga0105246_10829267 | |||
| 1569 | Ga0105246_12055161 | |||
| 1570 | Ga0157371_10715045 | |||
| 1571 | Ga0157371_10927737 | |||
| 1572 | Ga0157371_11084341 | |||
| 1573 | Ga0157370_10016292 | |||
| 1574 | Ga0157370_11704252 | |||
| 1575 | Ga0157369_10001576 | |||
| 1576 | Ga0157369_10005857 | |||
| 1577 | Ga0157369_10006509 | |||
| 1578 | Ga0157369_11221485 | |||
| 1579 | Ga0157369_11498467 | |||
| 1580 | Ga0157374_10375831 | |||
| 1581 | Ga0157374_11499049 | |||
| 1582 | Ga0157378_10387378 | |||
| 1583 | Ga0157378_11459801 | |||
| 1584 | Ga0163162_10059179 | |||
| 1585 | Ga0163162_11346875 | |||
| 1586 | Ga0163162_11391671 | |||
| 1587 | Ga0157372_10000882 | |||
| 1588 | Ga0157372_10022389 | |||
| 1589 | Ga0157372_11209569 | |||
| 1590 | Ga0157372_11955931 | |||
| 1591 | Ga0157372_12393500 | |||
| 1592 | Ga0157372_12495650 | |||
| 1593 | Ga0157372_12650347 | |||
| 1594 | Ga0157372_13091274 | |||
| 1595 | Ga0157375_10378466 | |||
| 1596 | Ga0157375_10538502 | |||
| 1597 | Ga0157375_12790418 | |||
| 1598 | Ga0163163_10242032 | |||
| 1599 | Ga0163163_10521135 | |||
| 1600 | Ga0163163_10703539 | |||
| 1601 | Ga0157380_10029480 | |||
| 1602 | Ga0157380_11015357 | |||
| 1603 | Ga0157380_11111899 | |||
| 1604 | Ga0157377_10060623 | |||
| 1605 | Ga0157377_10371183 | |||
| 1606 | Ga0157377_10890703 | |||
| 1607 | Ga0157377_10983709 | |||
| 1608 | Ga0157377_11271770 | |||
| 1609 | Ga0157379_11408140 | |||
| 1610 | Ga0163161_10161241 | |||
| 1611 | Ga0163161_11049658 | |||
| 1612 | Ga0197907_11454115 | |||
| 1613 | Ga0197907_11495825 | |||
| 1614 | Ga0206356_10808650 | |||
| 1615 | Ga0206356_11791021 | |||
| 1616 | Ga0206354_11697381 | |||
| 1617 | Ga0206353_10309370 | |||
| 1618 | Ga0206353_11333443 | |||
| 1619 | Ga0206353_11506452 | |||
| 1620 | Ga0224712_10049116 | |||
| 1621 | Ga0207692_10022697 | |||
| 1622 | Ga0207642_10247832 | |||
| 1623 | Ga0207642_10816309 | |||
| 1624 | Ga0207710_10000461 | |||
| 1625 | Ga0207710_10700234 | |||
| 1626 | Ga0207688_10411166 | |||
| 1627 | Ga0207688_10711744 | |||
| 1628 | Ga0207680_10361862 | |||
| 1629 | Ga0207647_10489024 | |||
| 1630 | Ga0207699_10149174 | |||
| 1631 | Ga0207699_10156499 | |||
| 1632 | Ga0207699_10160575 | |||
| 1633 | Ga0207645_10287724 | |||
| 1634 | Ga0207643_10258308 | |||
| 1635 | Ga0207705_10062767 | |||
| 1636 | Ga0207707_10012642 | |||
| 1637 | Ga0207707_10188457 | |||
| 1638 | Ga0207707_10207457 | |||
| 1639 | Ga0207707_10419967 | |||
| 1640 | Ga0207707_10586733 | |||
| 1641 | Ga0207707_11076919 | |||
| 1642 | Ga0207695_10058413 | |||
| 1643 | Ga0207695_10234398 | |||
| 1644 | Ga0207693_10000327 | |||
| 1645 | Ga0207693_10528564 | |||
| 1646 | Ga0207693_10698775 | |||
| 1647 | Ga0207663_10011766 | |||
| 1648 | Ga0207660_10023880 | |||
| 1649 | Ga0207660_10283858 | |||
| 1650 | Ga0207660_10291474 | |||
| 1651 | Ga0207660_10362927 | |||
| 1652 | Ga0207660_11148785 | |||
| 1653 | Ga0207657_10006978 | |||
| 1654 | Ga0207657_10016594 | |||
| 1655 | Ga0207657_10036776 | |||
| 1656 | Ga0207657_10243831 | |||
| 1657 | Ga0207657_10271938 | |||
| 1658 | Ga0207657_11140495 | |||
| 1659 | Ga0207649_10005811 | |||
| 1660 | Ga0207649_10034830 | |||
| 1661 | Ga0207649_10778872 | |||
| 1662 | Ga0207652_10016236 | |||
| 1663 | Ga0207652_10040530 | |||
| 1664 | Ga0207652_10064889 | |||
| 1665 | Ga0207694_11415451 | |||
| 1666 | Ga0207650_10490343 | |||
| 1667 | Ga0207659_11864470 | |||
| 1668 | Ga0207687_10022371 | |||
| 1669 | Ga0207687_10104131 | |||
| 1670 | Ga0207687_10131564 | |||
| 1671 | Ga0207687_10134242 | |||
| 1672 | Ga0207687_10590791 | |||
| 1673 | Ga0207700_10079181 | |||
| 1674 | Ga0207700_10556377 | |||
| 1675 | Ga0207664_10021420 | |||
| 1676 | Ga0207664_10056373 | |||
| 1677 | Ga0207664_10312822 | |||
| 1678 | Ga0207664_10528668 | |||
| 1679 | Ga0207664_10669628 | |||
| 1680 | Ga0207664_10706874 | |||
| 1681 | Ga0207644_10425946 | |||
| 1682 | Ga0207644_10815173 | |||
| 1683 | Ga0207690_10026917 | |||
| 1684 | Ga0207690_10204475 | |||
| 1685 | Ga0207690_10934577 | |||
| 1686 | Ga0207706_10007358 | |||
| 1687 | Ga0207706_10045036 | |||
| 1688 | Ga0207706_10045535 | |||
| 1689 | Ga0207706_10200085 | |||
| 1690 | Ga0207706_10376262 | |||
| 1691 | Ga0207706_10490248 | |||
| 1692 | Ga0207706_10656742 | |||
| 1693 | Ga0207706_10771162 | |||
| 1694 | Ga0207706_10798478 | |||
| 1695 | Ga0207706_11276858 | |||
| 1696 | Ga0207686_10004066 | |||
| 1697 | Ga0207686_10081272 | |||
| 1698 | Ga0207709_10183000 | |||
| 1699 | Ga0207709_10195193 | |||
| 1700 | Ga0207709_10520681 | |||
| 1701 | Ga0207709_10587820 | |||
| 1702 | Ga0207709_11127531 | |||
| 1703 | Ga0207709_11495567 | |||
| 1704 | Ga0207669_10145008 | |||
| 1705 | Ga0207669_10375170 | |||
| 1706 | Ga0207669_10528826 | |||
| 1707 | Ga0207669_10548544 | |||
| 1708 | Ga0207669_11340780 | |||
| 1709 | Ga0207704_10024207 | |||
| 1710 | Ga0207704_10217462 | |||
| 1711 | Ga0207704_10480177 | |||
| 1712 | Ga0207665_10099669 | |||
| 1713 | Ga0207665_10932301 | |||
| 1714 | Ga0207691_10352783 | |||
| 1715 | Ga0207711_10292428 | |||
| 1716 | Ga0207711_10568233 | |||
| 1717 | Ga0207661_10005475 | |||
| 1718 | Ga0207661_10005597 | |||
| 1719 | Ga0207661_10018843 | |||
| 1720 | Ga0207661_10054277 | |||
| 1721 | Ga0207661_11473860 | |||
| 1722 | Ga0207679_10033625 | |||
| 1723 | Ga0207667_10270932 | |||
| 1724 | Ga0207651_10790556 | |||
| 1725 | Ga0207651_10792629 | |||
| 1726 | Ga0207712_10041224 | |||
| 1727 | Ga0207712_10085578 | |||
| 1728 | Ga0207668_10072808 | |||
| 1729 | Ga0207668_10100011 | |||
| 1730 | Ga0207668_11360424 | |||
| 1731 | Ga0207640_10459058 | |||
| 1732 | Ga0207640_10566288 | |||
| 1733 | Ga0207640_11086238 | |||
| 1734 | Ga0207640_11122257 | |||
| 1735 | Ga0207658_11229279 | |||
| 1736 | Ga0207677_10209390 | |||
| 1737 | Ga0207677_10821133 | |||
| 1738 | Ga0207677_11231224 | |||
| 1739 | Ga0207639_10089943 | |||
| 1740 | Ga0207678_10288265 | |||
| 1741 | Ga0207678_10366332 | |||
| 1742 | Ga0207678_11565124 | |||
| 1743 | Ga0207708_10030902 | |||
| 1744 | Ga0207708_10101302 | |||
| 1745 | Ga0207708_10146374 | |||
| 1746 | Ga0207708_10192233 | |||
| 1747 | Ga0207708_10315026 | |||
| 1748 | Ga0207702_10004996 | |||
| 1749 | Ga0207702_10023609 | |||
| 1750 | Ga0207702_11410215 | |||
| 1751 | Ga0207641_10005668 | |||
| 1752 | Ga0207641_10268674 | |||
| 1753 | Ga0207648_11512641 | |||
| 1754 | Ga0207676_10069746 | |||
| 1755 | Ga0207676_10388630 | |||
| 1756 | Ga0207674_10126629 | |||
| 1757 | Ga0207674_10504852 | |||
| 1758 | Ga0207675_100001319 | |||
| 1759 | Ga0207675_100130900 | |||
| 1760 | Ga0207675_100911123 | |||
| 1761 | Ga0207675_100914427 | |||
| 1762 | Ga0207675_102348718 | |||
| 1763 | Ga0207675_102601973 | |||
| 1764 | Ga0207683_10274418 | |||
| 1765 | Ga0207683_10564806 | |||
| 1766 | Ga0207698_10090228 | |||
| 1767 | Ga0207698_10143689 | |||
| 1768 | Ga0209969_1069687 | |||
| 1769 | Ga0209970_1026438 | |||
| 1770 | Ga0209974_10151813 | |||
| 1771 | Ga0209974_10400279 | |||
| 1772 | Ga0207428_10038116 | |||
| 1773 | Ga0207428_10244434 | |||
| 1774 | Ga0207428_10323513 | |||
| 1775 | Ga0207428_10510511 | |||
| 1776 | Ga0207428_10603190 | |||
| 1777 | Ga0207428_10798641 | |||
| 1778 | Ga0268265_10166359 | |||
| 1779 | Ga0268265_10349955 | |||
| 1780 | Ga0268265_12037923 | |||
| 1781 | Ga0268265_12583810 | |||
| 1782 | Ga0268264_11168013 | |||
| 1783 | Ga0268264_11352230 | |||
| 1784 | Ga0265326_10245737 | |||
| 1785 | Ga0265322_10235668 | |||
| 1786 | Ga0265338_10067558 | |||
| 1787 | Ga0265338_10562644 | |||
| 1788 | Ga0265324_10035867 | |||
| 1789 | Ga0265329_10058500 | |||
| 1790 | Ga0265339_10124483 | |||
| 1791 | Ga0307408_100112212 | |||
| 1792 | Ga0307408_100181803 | |||
| 1793 | Ga0307405_10084095 | |||
| 1794 | Ga0307405_10331758 | |||
| 1795 | Ga0307410_10005242 | |||
| 1796 | Ga0307410_10049037 | |||
| 1797 | Ga0307410_10123974 | |||
| 1798 | Ga0307410_10157305 | |||
| 1799 | Ga0307410_11997874 | |||
| 1800 | Ga0307406_10203429 | |||
| 1801 | Ga0307406_10256133 | |||
| 1802 | Ga0307406_11410232 | |||
| 1803 | Ga0307406_11529735 | |||
| 1804 | Ga0307407_10868259 | |||
| 1805 | Ga0307407_10935757 | |||
| 1806 | Ga0307407_11264173 | |||
| 1807 | Ga0307412_10101667 | |||
| 1808 | Ga0307412_10381700 | |||
| 1809 | Ga0307412_10741449 | |||
| 1810 | Ga0307409_100008843 | |||
| 1811 | Ga0307409_100025648 | |||
| 1812 | Ga0307409_100175393 | |||
| 1813 | Ga0307409_100187052 | |||
| 1814 | Ga0307409_100197889 | |||
| 1815 | Ga0307409_100290421 | |||
| 1816 | Ga0307409_102004315 | |||
| 1817 | Ga0307409_102166798 | |||
| 1818 | Ga0307409_102538507 | |||
| 1819 | Ga0307409_102605410 | |||
| 1820 | Ga0307416_100026631 | |||
| 1821 | Ga0307416_100094130 | |||
| 1822 | Ga0307416_100160319 | |||
| 1823 | Ga0307416_100683036 | |||
| 1824 | Ga0307414_10064344 | |||
| 1825 | Ga0307414_10298735 | |||
| 1826 | Ga0307414_10930984 | |||
| 1827 | Ga0307411_10072439 | |||
| 1828 | Ga0307411_10466700 | |||
| 1829 | Ga0307411_10629553 | |||
| 1830 | Ga0307411_10706979 | |||
| 1831 | Ga0307415_100009432 | |||
| 1832 | Ga0307415_100030417 | |||
| 1833 | Ga0307415_100066821 | |||
| 1834 | Ga0307415_100099339 | |||
| 1835 | Ga0373959_0130916 | |||
| 1836 | Ga0373938_0244320 | |||
| 1837 | Ga0373944_0354845 | |||
| 1838 | Ga0373952_0191105 | |||
| 1839 | Ga0373923_0055064 | |||
| 1840 | Ga0373923_0640915 | |||
| 1841 | Ga0373932_0213879 | |||
| 1842 | Ga0373936_0253075 | |||
| 1843 | Ga0373939_0053380 | |||
| 1844 | Ga0373945_0410023 | |||
| 1845 | Ga0373953_0122897 | |||
| 1846 | Ga0373954_0176765 | |||
| 1847 | Ga0373956_0174209 | |||
| 1848 | Ga0373957_0180599 | |||
| 1849 | Ga0373943_0521532 | |||
| 1850 | Ga0373946_0105714 | |||
| 1851 | Ga0373946_0115090 | |||
| 1852 | Ga0373955_0056768 | |||
| 1853 | Ga0373961_0013500 | |||
| 1854 | Ga0373961_0321445 | |||
| 1855 | Ga0373961_0335003 | |||
| 1856 | Ga0373962_0273281 | |||
| 1857 | Ga0316574_0339953 | |||
| 1858 | Ga0316574_0342247 | |||
| 1859 | Ga0373924_0104076 | |||
| 1860 | Ga0373931_0085014 | |||
| 1861 | Ga0373931_0864617 | |||
| 1862 | Ga0373935_0236129 | |||
| 1863 | Ga0373935_0309056 | |||
| 1864 | Ga0373927_0145994 | |||
| 1865 | Ga0373933_0088640 | |||
| 1866 | Ga0373933_0253597 | |||
| 1867 | Ga0373947_0129699 | |||
| 1868 | Ga0373937_0029481 | |||
| 1869 | Ga0373925_1131286 | |||
| 1870 | Ga0395899_0003553 | |||
| 1871 | Ga0395899_0004500 | |||
| 1872 | Ga0395899_0015196 | |||
| 1873 | Ga0395899_0117298 | |||
| 1874 | Ga0395899_0193560 | |||
| 1875 | Ga0395899_0299048 | |||
| 1876 | Ga0395899_0431824 | |||
| 1877 | Ga0395899_0888390 | |||
| 1878 | Ga0395900_0001151 | |||
| 1879 | Ga0395900_0003158 | |||
| 1880 | Ga0395900_0029208 | |||
| 1881 | Ga0395900_0032554 | |||
| 1882 | Ga0395900_0049434 | |||
| 1883 | Ga0395900_0099875 | |||
| 1884 | Ga0395900_0248961 | |||
| 1885 | Ga0395900_0653381 | |||
| 1886 | Ga0395900_0703105 | |||
| 1887 | Ga0395900_0777970 | |||
| 1888 | Ga0395900_1010740 | |||
| 1889 | Ga0395900_1314846 | |||
| 1890 | Ga0395900_1411199 | |||
| 1891 | Ga0395900_1778536 | |||
| 1892 | Ga0395898_0003255 | |||
| 1893 | Ga0395898_0007563 | |||
| 1894 | Ga0395898_0017807 | |||
| 1895 | Ga0395898_0110067 | |||
| 1896 | Ga0395898_0130997 | |||
| 1897 | Ga0395898_0223727 | |||
| 1898 | Ga0395898_0661781 | |||
| 1899 | Ga0395898_1053338 | |||
| 1900 | Ga0395898_1127117 | |||
| 1901 | Ga0395898_1236179 | |||
| 1902 | Ga0395905_0005310 | |||
| 1903 | Ga0395905_0018615 | |||
| 1904 | Ga0395905_0038953 | |||
| 1905 | Ga0395905_0186955 | |||
| 1906 | Ga0395905_1724555 | |||
| 1907 | Ga0436364_0058676 | |||
| 1908 | Ga0436364_0335112 | |||
| 1909 | Ga0436364_0857259 | |||
| 1910 | Ga0436364_0968519 | |||
| 1911 | Ga0395901_0009117 | |||
| 1912 | Ga0395901_0009324 | |||
| 1913 | Ga0395901_0011708 | |||
| 1914 | Ga0395901_0013838 | |||
| 1915 | Ga0395901_0017307 | |||
| 1916 | Ga0395901_0022647 | |||
| 1917 | Ga0395901_0108496 | |||
| 1918 | Ga0395901_0470338 | |||
| 1919 | Ga0395901_0791741 | |||
| 1920 | Ga0395901_0816093 | |||
| 1921 | Ga0395901_0847389 | |||
| 1922 | Ga0395901_0924487 | |||
| 1923 | Ga0395901_1242215 | |||
| 1924 | Ga0395901_1247541 | |||
| 1925 | Ga0436360_0309792 | |||
| 1926 | Ga0436363_1685287 | |||
| 1927 | Ga0436362_0196630 | |||
| 1928 | Ga0439453_0152042 | |||
| 1929 | Ga0451802_2110464 | |||
| 1930 | Ga0451807_1033732 | |||
| 1931 | Ga0451807_1785489 | |||
| 1932 | Ga0451833_0562689 | |||
| 1933 | Ga0451839_0129166 | |||
| 1934 | Ga0451845_0181262 | |||
| 1935 | Ga0451845_0319367 | |||
| 1936 | Ga0451843_1498561 | |||
| 1937 | Ga0451853_0358062 | |||
| 1938 | Ga0451853_3422080 | |||
| 1939 | Ga0451853_3517233 | |||
| 1940 | Ga0451853_3685609 | |||
| 1941 | Ga0439448_0387220 | |||
| 1942 | Ga0439450_044045 | |||
| 1943 | Ga0439450_157144 | |||
| 1944 | Ga0439454_020462 | |||
| 1945 | Ga0439455_0083711 | |||
| 1946 | Ga0439455_0113218 | |||
| 1947 | Ga0439463_137876 | |||
| 1948 | Ga0439463_154771 | |||
| 1949 | Ga0450905_021975 | |||
| 1950 | Ga0450910_105201 | |||
| 1951 | Ga0439459_0019449 | |||
| 1952 | Ga0439464_0093853 | |||
| 1953 | Ga0439464_0208225 | |||
| 1954 | Ga0439460_0016281 | |||
| 1955 | Ga0439460_0154203 | |||
| 1956 | Ga0439460_0372778 | |||
| 1957 | Ga0450901_018784 | |||
| 1958 | Ga0439440_0073182 | |||
| 1959 | Ga0439440_0098656 | |||
| 1960 | Ga0466969_0019734 | |||
| 1961 | Ga0466969_0259660 | |||
| 1962 | Ga0466969_0284223 | |||
| 1963 | Ga0466969_0548685 | |||
| 1964 | Ga0466966_0581062 | |||
| 1965 | Ga0466961_0181657 | |||
| 1966 | Ga0466961_0599149 | |||
| 1967 | Ga0466961_0705592 | |||
| 1968 | Ga0466963_0008740 | |||
| 1969 | Ga0466963_0071439 | |||
| 1970 | Ga0466963_0073797 | |||
| 1971 | Ga0466963_0701092 | |||
| 1972 | Ga0466963_0704970 | |||
| 1973 | Ga0466963_1187582 | |||
| 1974 | Ga0466964_0251713 | |||
| 1975 | Ga0466964_0431635 | |||
| 1976 | Ga0466964_0506611 | |||
| 1977 | Ga0466964_0613582 | |||
| 1978 | Ga0466964_0865599 | |||
| 1979 | Ga0466971_0365992 | |||
| 1980 | Ga0466968_0190868 | |||
| 1981 | Ga0466957_0078451 | |||
| 1982 | Ga0466957_0502174 | |||
| 1983 | Ga0466957_0563316 | |||
| 1984 | Ga0466960_0955541 | |||
| 1985 | Ga0466959_0206183 | |||
| 1986 | Ga0466959_0221023 | |||
| 1987 | Ga0466959_0225580 | |||
| 1988 | Ga0466959_0326687 | |||
| 1989 | Ga0466959_0468170 | |||
| 1990 | Ga0466959_0608425 | |||
| 1991 | Ga0466958_0051092 | |||
| 1992 | Ga0466958_0056145 | |||
| 1993 | Ga0466958_0089729 | |||
| 1994 | Ga0466958_0107968 | |||
| 1995 | Ga0466958_0356153 | |||
| 1996 | Ga0466958_0439066 | |||
| 1997 | Ga0466967_0084813 | |||
| 1998 | Ga0466967_0122463 | |||
| 1999 | Ga0466967_0213024 | |||
| 2000 | Ga0466967_0323636 | |||
| 2001 | Ga0466967_0334946 | |||
| 2002 | Ga0466967_0514059 | |||
| 2003 | Ga0466967_0829283 | |||
| 2004 | Ga0466967_1089567 | |||
| 2005 | Ga0466967_1205240 | |||
| 2006 | Ga0466967_1310825 | |||
| 2007 | Ga0466967_1340099 | |||
| 2008 | Ga0466967_1520605 | |||
| 2009 | Ga0466967_1554229 | |||
| 2010 | Ga0466967_2302087 | |||
| 2011 | Ga0495627_131768 | |||
| 2012 | Ga0495592_0009914 | |||
| 2013 | Ga0495592_0172570 | |||
| 2014 | Ga0495592_0954479 | |||
| 2015 | Ga0495603_0206203 | |||
| 2016 | Ga0495603_0271293 | |||
| 2017 | Ga0495603_0478875 | |||
| 2018 | Ga0495590_0352160 | |||
| 2019 | Ga0495629_0001331 | |||
| 2020 | Ga0495629_0009051 | |||
| 2021 | Ga0495629_0038892 | |||
| 2022 | Ga0495629_0042675 | |||
| 2023 | Ga0495629_0097082 | |||
| 2024 | Ga0495629_0270503 | |||
| 2025 | Ga0495638_0352076 | |||
| 2026 | Ga0495641_0071444 | |||
| 2027 | Ga0495641_0394246 | |||
| 2028 | Ga0495641_0538051 | |||
| 2029 | Ga0495651_0006259 | |||
| 2030 | Ga0495651_0135474 | |||
| 2031 | Ga0495651_0173225 | |||
| 2032 | Ga0495651_0738850 | |||
| 2033 | Ga0495653_0032490 | |||
| 2034 | Ga0495653_0154953 | |||
| 2035 | Ga0495653_0458079 | |||
| 2036 | Ga0495653_0857280 | |||
| 2037 | Ga0495653_0965063 | |||
| 2038 | Ga0495580_0203714 | |||
| 2039 | Ga0495580_0610517 | |||
| 2040 | Ga0495582_0148178 | |||
| 2041 | Ga0495582_0503360 | |||
| 2042 | Ga0495605_0192695 | |||
| 2043 | Ga0495605_0309572 | |||
| 2044 | Ga0495639_0229286 | |||
| 2045 | Ga0495662_0113304 | |||
| 2046 | Ga0495584_0205130 | |||
| 2047 | Ga0495584_0235722 | |||
| 2048 | Ga0495594_0883079 | |||
| 2049 | Ga0495596_0048864 | |||
| 2050 | Ga0495596_0157157 | |||
| 2051 | Ga0495607_0258937 | |||
| 2052 | Ga0495607_0492413 | |||
| 2053 | Ga0495608_0002443 | |||
| 2054 | Ga0495608_0018553 | |||
| 2055 | Ga0495608_0207189 | |||
| 2056 | Ga0495616_0068551 | |||
| 2057 | Ga0495618_0010592 | |||
| 2058 | Ga0495618_0489905 | |||
| 2059 | Ga0495618_0566008 | |||
| 2060 | Ga0495628_0028908 | |||
| 2061 | Ga0495628_0103164 | |||
| 2062 | Ga0495628_0290645 | |||
| 2063 | Ga0495628_0542566 | |||
| 2064 | Ga0495628_0597128 | |||
| 2065 | Ga0495630_0017787 | |||
| 2066 | Ga0495630_0077462 | |||
| 2067 | Ga0495630_0117572 | |||
| 2068 | Ga0495630_0240360 | |||
| 2069 | Ga0495630_0366001 | |||
| 2070 | Ga0495630_0872066 | |||
| 2071 | Ga0495630_1023257 | |||
| 2072 | Ga0495631_0242917 | |||
| 2073 | Ga0495643_0195022 | |||
| 2074 | Ga0495644_0205406 | |||
| 2075 | Ga0495663_0086851 | |||
| 2076 | Ga0495666_0514434 | |||
| 2077 | Ga0495642_0367815 | |||
| 2078 | Ga0495652_0089134 | |||
| 2079 | Ga0495652_0110230 | |||
| 2080 | Ga0495652_0370401 | |||
| 2081 | Ga0495665_0477825 | |||
| 2082 | Ga0495640_0014053 | |||
| 2083 | Ga0495640_0191253 | |||
| 2084 | Ga0495640_0902010 | |||
| 2085 | Ga0495586_0006171 | |||
| 2086 | Ga0495586_0057979 | |||
| 2087 | Ga0495586_0145228 | |||
| 2088 | Ga0495586_0436151 | |||
| 2089 | Ga0495587_0031382 | |||
| 2090 | Ga0495587_0137673 | |||
| 2091 | Ga0495587_0492652 | |||
| 2092 | Ga0495609_0275415 | |||
| 2093 | Ga0495621_0413179 | |||
| 2094 | Ga0495621_0484841 | |||
| 2095 | Ga0495597_0365910 | |||
| 2096 | Ga0495645_0148375 | |||
| 2097 | Ga0495645_0202215 | |||
| 2098 | Ga0495645_0535191 | |||
| 2099 | Ga0495622_0000618 | |||
| 2100 | Ga0495667_0013676 | |||
| 2101 | Ga0495667_0678069 | |||
| 2102 | Ga0495667_0698128 | |||
| 2103 | Ga0495656_0276167 | |||
| 2104 | Ga0495656_0542211 | |||
| 2105 | Ga0495668_0767732 | |||
| 2106 | Ga0495634_0025585 | |||
| 2107 | Ga0495634_0206720 | |||
| 2108 | Ga0495634_0218712 | |||
| 2109 | Ga0495635_0052206 | |||
| 2110 | Ga0495635_0064066 | |||
| 2111 | Ga0495659_0451222 | |||
| 2112 | Ga0495661_0574088 | |||
| 2113 | Ga0495657_0017591 | |||
| 2114 | Ga0495657_0034335 | |||
| 2115 | Ga0495657_0173474 | |||
| 2116 | Ga0495599_0048531 | |||
| 2117 | Ga0495623_0165216 | |||
| 2118 | Ga0495646_0084378 | |||
| 2119 | Ga0495646_0202527 | |||
| 2120 | Ga0495647_0192574 | |||
| 2121 | Ga0495647_0242949 | |||
| 2122 | Ga0495647_0567081 | |||
| 2123 | Ga0495658_0063434 | |||
| 2124 | Ga0495658_0106840 | |||
| 2125 | Ga0495613_0099039 | |||
| 2126 | Ga0495613_0261950 | |||
| 2127 | Ga0495613_0384789 | |||
| 2128 | Ga0495613_0539701 | |||
| 2129 | Ga0495613_0648388 | |||
| 2130 | Ga0495624_0138274 | |||
| 2131 | Ga0495624_0186663 | |||
| 2132 | Ga0495670_0622905 | |||
| 2133 | Ga0495671_0151509 | |||
| 2134 | Ga0495589_0229233 | |||
| 2135 | Ga0495589_0458134 | |||
| 2136 | Ga0495589_0581263 | |||
| 2137 | Ga0495600_0019723 | |||
| 2138 | Ga0495600_0317205 | |||
| 2139 | Ga0495600_0686512 | |||
| 2140 | Ga0495660_0181988 | |||
| 2141 | Ga0495581_0676510 | |||
| 2142 | Ga0495604_0007191 | |||
| 2143 | Ga0495674_0046218 | |||
| 2144 | Ga0495674_0299567 | |||
| 2145 | Ga0495674_0304214 | |||
| 2146 | Ga0495674_0307077 | |||
| 2147 | Ga0495674_0483629 | |||
| 2148 | Ga0495676_0208839 | |||
| 2149 | Ga0495676_0347648 | |||
| 2150 | Ga0495676_0498672 | |||
| 2151 | Ga0495680_0040313 | |||
| 2152 | Ga0495680_0100314 | |||
| 2153 | Ga0495680_0113827 | |||
| 2154 | Ga0495680_0189934 | |||
| 2155 | Ga0495680_0604795 | |||
| 2156 | Ga0495683_0237355 | |||
| 2157 | Ga0495675_0092107 | |||
| 2158 | Ga0495675_0245406 | |||
| 2159 | Ga0495677_0277924 | |||
| 2160 | Ga0495685_301535 | |||
| 2161 | Ga0495684_0018945 | |||
| 2162 | Ga0495686_0154850 | |||
| 2163 | Ga0495686_0184938 | |||
| 2164 | Ga0495593_0059544 | |||
| 2165 | Ga0495593_0078628 | |||
| 2166 | Ga0495593_0397648 | |||
| 2167 | Ga0495602_0013661 | |||
| 2168 | Ga0495614_0262917 | |||
| 2169 | Ga0495615_0251658 | |||
| 2170 | Ga0496100_0102913 | |||
| 2171 | Ga0496100_0484371 | |||
| 2172 | Ga0496100_0821023 | |||
| 2173 | Ga0496101_0007125 | |||
| 2174 | Ga0496101_0290688 | |||
| 2175 | Ga0496101_0628628 | |||
| 2176 | Ga0496101_0631588 | |||
| 2177 | Ga0496102_0001083 | |||
| 2178 | Ga0496102_0244270 | |||
| 2179 | Ga0496102_0305088 | |||
| 2180 | Ga0496102_0425033 | |||
| 2181 | Ga0496102_0616362 | |||
| 2182 | Ga0496102_1077364 | |||
| 2183 | Ga0496102_1099577 | |||
| 2184 | Ga0496102_1736499 | |||
| 2185 | Ga0496103_0000031 | |||
| 2186 | Ga0496103_0474501 | |||
| 2187 | Ga0496103_0905823 | |||
| 2188 | Ga0496104_0000009 | |||
| 2189 | Ga0496104_0131282 | |||
| 2190 | Ga0496104_0172586 | |||
| 2191 | Ga0496104_0213847 | |||
| 2192 | Ga0496104_0479397 | |||
| 2193 | Ga0496104_0624982 | |||
| 2194 | Ga0496104_0673842 | |||
| 2195 | Ga0496104_1037721 | |||
| 2196 | Ga0496105_0000007 | |||
| 2197 | Ga0496105_0000401 | |||
| 2198 | Ga0496105_0047865 | |||
| 2199 | Ga0496105_0057371 | |||
| 2200 | Ga0496105_0120866 | |||
| 2201 | Ga0496105_0121766 | |||
| 2202 | Ga0496105_0140355 | |||
| 2203 | Ga0496105_0752326 | |||
| 2204 | Ga0496105_0954516 | |||
| 2205 | Ga0496105_1267082 | |||
| 2206 | Ga0496106_0320286 | |||
| 2207 | Ga0496106_0404394 | |||
| 2208 | Ga0496106_0838125 | |||
| 2209 | Ga0496107_0640619 | |||
| 2210 | Ga0496107_1187512 | |||
| 2211 | Ga0496108_0000026 | |||
| 2212 | Ga0496108_0001551 | |||
| 2213 | Ga0496108_0008908 | |||
| 2214 | Ga0496108_0130646 | |||
| 2215 | Ga0496108_0146695 | |||
| 2216 | Ga0496108_0234017 | |||
| 2217 | Ga0496108_0254951 | |||
| 2218 | Ga0496108_0258925 | |||
| 2219 | Ga0496108_0674445 | |||
| 2220 | Ga0496108_0696625 | |||
| 2221 | Ga0496108_0745430 | |||
| 2222 | Ga0496108_0790348 | |||
| 2223 | Ga0496108_0981392 | |||
| 2224 | Ga0496108_1154651 | |||
| 2225 | Ga0496109_0000012 | |||
| 2226 | Ga0496109_0004905 | |||
| 2227 | Ga0496109_0078503 | |||
| 2228 | Ga0496109_0296733 | |||
| 2229 | Ga0496109_0435083 | |||
| 2230 | Ga0496109_0557157 | |||
| 2231 | Ga0496109_1034826 | |||
| 2232 | Ga0496109_1486429 | |||
| 2233 | Ga0496109_1611694 | |||
| 2234 | Ga0496110_0011382 | |||
| 2235 | Ga0496110_0049641 | |||
| 2236 | Ga0496110_0058708 | |||
| 2237 | Ga0496110_0174428 | |||
| 2238 | Ga0496110_0811040 | |||
| 2239 | Ga0496110_0869038 | |||
| 2240 | Ga0496110_1221608 | |||
| 2241 | Ga0496110_1225241 | |||
| 2242 | Ga0496111_0001050 | |||
| 2243 | Ga0496111_0142391 | |||
| 2244 | Ga0496111_0170928 | |||
| 2245 | Ga0496111_0629296 | |||
| 2246 | Ga0496111_0785501 | |||
| 2247 | Ga0496112_0011438 | |||
| 2248 | Ga0496112_0014164 | |||
| 2249 | Ga0496112_0179080 | |||
| 2250 | Ga0496112_0366422 | |||
| 2251 | Ga0496112_0744460 | |||
| 2252 | Ga0496112_1210192 | |||
| 2253 | Ga0496112_1248410 | |||
| 2254 | Ga0496112_1830085 | |||
| 2255 | Ga0496113_0041886 | |||
| 2256 | Ga0496113_0095118 | |||
| 2257 | Ga0496113_0126370 | |||
| 2258 | Ga0496113_0168365 | |||
| 2259 | Ga0496113_0391588 | |||
| 2260 | Ga0496113_0851786 | |||
| 2261 | Ga0496113_1394292 | |||
| 2262 | Ga0496114_0035168 | |||
| 2263 | Ga0496114_0125652 | |||
| 2264 | Ga0496114_0283639 | |||
| 2265 | Ga0496114_0784809 | |||
| 2266 | Ga0496114_1020619 | |||
| 2267 | Ga0496115_0010148 | |||
| 2268 | Ga0496115_0140402 | |||
| 2269 | Ga0496116_0000360 | |||
| 2270 | Ga0496118_0184896 | |||
| 2271 | Ga0496118_0208221 | |||
| 2272 | Ga0496119_0003375 | |||
| 2273 | Ga0496119_0019417 | |||
| 2274 | Ga0496119_0110770 | |||
| 2275 | Ga0496120_0008036 | |||
| 2276 | Ga0496120_0140610 | |||
| 2277 | Ga0496121_0003947 | |||
| 2278 | Ga0496121_0036929 | |||
| 2279 | Ga0496121_0073431 | |||
| 2280 | Ga0496121_0258296 | |||
| 2281 | Ga0496121_0592756 | |||
| 2282 | Ga0496124_0318342 | |||
| 2283 | Ga0496124_0843861 | |||
| 2284 | Ga0496125_0140842 | |||
| 2285 | Ga0495678_091463 | |||
| 2286 | Ga0501291_079710 | |||
| 2287 | Ga0501296_068715 | |||
| 2288 | Ga0501299_148816 | |||
| 2289 | Ga0501311_105996 | |||
| 2290 | Ga0501318_055619 | |||
| 2291 | Ga0501031_0000518 | |||
| 2292 | Ga0501031_0036646 | |||
| 2293 | Ga0501031_0168873 | |||
| 2294 | Ga0501031_0172799 | |||
| 2295 | Ga0501031_0813652 | |||
| 2296 | Ga0501031_0991037 | |||
| 2297 | Ga0501032_0005293 | |||
| 2298 | Ga0501032_0077286 | |||
| 2299 | Ga0501032_0840122 | |||
| 2300 | Ga0501033_0002948 | |||
| 2301 | Ga0501033_0031433 | |||
| 2302 | Ga0501033_0272238 | |||
| 2303 | Ga0501033_0277794 | |||
| 2304 | Ga0501033_0699581 | |||
| 2305 | Ga0501033_1039326 | |||
| 2306 | Ga0501034_0033847 | |||
| 2307 | Ga0501034_0358911 | |||
| 2308 | Ga0501036_0000227 | |||
| 2309 | Ga0501036_0003861 | |||
| 2310 | Ga0501036_0037260 | |||
| 2311 | Ga0501036_0155948 | |||
| 2312 | Ga0501036_0239472 | |||
| 2313 | Ga0501036_0812535 | |||
| 2314 | Ga0501036_1067536 | |||
| 2315 | Ga0501036_1263097 | |||
| 2316 | Ga0501036_1689421 | |||
| 2317 | Ga0501037_0031355 | |||
| 2318 | Ga0501037_0244342 | |||
| 2319 | Ga0501037_0402665 | |||
| 2320 | Ga0501037_0862856 | |||
| 2321 | Ga0501038_0002331 | |||
| 2322 | Ga0501038_0023699 | |||
| 2323 | Ga0501038_0054198 | |||
| 2324 | Ga0501038_0464016 | |||
| 2325 | Ga0501038_0740346 | |||
| 2326 | Ga0501038_1056520 | |||
| 2327 | Ga0501038_1159161 | |||
| 2328 | Ga0501038_1187185 | |||
| 2329 | Ga0501039_0000817 | |||
| 2330 | Ga0501039_0024988 | |||
| 2331 | Ga0501039_0039399 | |||
| 2332 | Ga0501039_0080713 | |||
| 2333 | Ga0501039_0125165 | |||
| 2334 | Ga0501039_0150816 | |||
| 2335 | Ga0501039_0432122 | |||
| 2336 | Ga0501039_0995014 | |||
| 2337 | Ga0501039_1319638 | |||
| 2338 | Ga0501040_0026259 | |||
| 2339 | Ga0501040_0051067 | |||
| 2340 | Ga0501040_0129819 | |||
| 2341 | Ga0501040_0243793 | |||
| 2342 | Ga0501040_0245241 | |||
| 2343 | Ga0501040_0363283 | |||
| 2344 | Ga0501040_0407802 | |||
| 2345 | Ga0501040_0491104 | |||
| 2346 | Ga0501040_0568775 | |||
| 2347 | Ga0501041_0000836 | |||
| 2348 | Ga0501041_0018099 | |||
| 2349 | Ga0501041_0023356 | |||
| 2350 | Ga0501041_0024566 | |||
| 2351 | Ga0501041_0080386 | |||
| 2352 | Ga0501041_0148607 | |||
| 2353 | Ga0501041_0358718 | |||
| 2354 | Ga0501041_0360609 | |||
| 2355 | Ga0501042_0000314 | |||
| 2356 | Ga0501042_0022170 | |||
| 2357 | Ga0501042_0085843 | |||
| 2358 | Ga0501042_0153946 | |||
| 2359 | Ga0501042_0214517 | |||
| 2360 | Ga0501042_0276895 | |||
| 2361 | Ga0501042_0411699 | |||
| 2362 | Ga0501042_0532834 | |||
| 2363 | Ga0501042_0657545 | |||
| 2364 | Ga0501042_0899245 | |||
| 2365 | Ga0501042_1267122 | |||
| 2366 | Ga0501043_0001251 | |||
| 2367 | Ga0501043_0619961 | |||
| 2368 | Ga0501043_0683112 | |||
| 2369 | Ga0501043_0820577 | |||
| 2370 | Ga0501043_1038934 | |||
| 2371 | Ga0501043_1091158 | |||
| 2372 | Ga0501046_0000158 | |||
| 2373 | Ga0501046_0047802 | |||
| 2374 | Ga0501046_0196490 | |||
| 2375 | Ga0501046_0208714 | |||
| 2376 | Ga0501046_0250560 | |||
| 2377 | Ga0501046_0352181 | |||
| 2378 | Ga0501046_0527553 | |||
| 2379 | Ga0501046_0958905 | |||
| 2380 | Ga0501047_0004798 | |||
| 2381 | Ga0501047_0013835 | |||
| 2382 | Ga0501047_0045884 | |||
| 2383 | Ga0501047_0266058 | |||
| 2384 | Ga0501047_0491553 | |||
| 2385 | Ga0501048_0002270 | |||
| 2386 | Ga0501048_0016574 | |||
| 2387 | Ga0501048_0026492 | |||
| 2388 | Ga0501048_0060046 | |||
| 2389 | Ga0501048_0061923 | |||
| 2390 | Ga0501048_0078909 | |||
| 2391 | Ga0501048_0196142 | |||
| 2392 | Ga0501048_0225396 | |||
| 2393 | Ga0501048_0685944 | |||
| 2394 | Ga0501067_0037989 | |||
| 2395 | Ga0501067_0225543 | |||
| 2396 | Ga0501067_0570789 | |||
| 2397 | Ga0501068_0000071 | |||
| 2398 | Ga0501068_0024532 | |||
| 2399 | Ga0501068_0149301 | |||
| 2400 | Ga0501068_0320791 | |||
| 2401 | Ga0501068_0355666 | |||
| 2402 | Ga0501068_0408591 | |||
| 2403 | Ga0501068_0697808 | |||
| 2404 | Ga0501068_0921233 | |||
| 2405 | Ga0501068_1050190 | |||
| 2406 | Ga0501069_0041260 | |||
| 2407 | Ga0501069_0090250 | |||
| 2408 | Ga0501069_0557678 | |||
| 2409 | Ga0501070_0003160 | |||
| 2410 | Ga0501070_0028261 | |||
| 2411 | Ga0501070_0042224 | |||
| 2412 | Ga0501070_0095031 | |||
| 2413 | Ga0501070_0168238 | |||
| 2414 | Ga0501070_0212313 | |||
| 2415 | Ga0501070_0561717 | |||
| 2416 | Ga0501071_0000705 | |||
| 2417 | Ga0501071_0051603 | |||
| 2418 | Ga0501071_0180626 | |||
| 2419 | Ga0501071_0291320 | |||
| 2420 | Ga0501071_0421814 | |||
| 2421 | Ga0501071_0698152 | |||
| 2422 | Ga0501071_0976560 | |||
| 2423 | Ga0501071_0985252 | |||
| 2424 | Ga0501071_1031514 | |||
| 2425 | Ga0501071_1053749 | |||
| 2426 | Ga0501071_1132190 | |||
| 2427 | Ga0501072_0034360 | |||
| 2428 | Ga0501072_0041682 | |||
| 2429 | Ga0501072_0047943 | |||
| 2430 | Ga0501072_0083174 | |||
| 2431 | Ga0501072_0100613 | |||
| 2432 | Ga0501072_0222262 | |||
| 2433 | Ga0501072_0256918 | |||
| 2434 | Ga0501072_0500303 | |||
| 2435 | Ga0501072_0844853 | |||
| 2436 | Ga0501072_1106661 | |||
| 2437 | Ga0501072_1317677 | |||
| 2438 | Ga0501073_0021965 | |||
| 2439 | Ga0501073_0287458 | |||
| 2440 | Ga0501074_0000343 | |||
| 2441 | Ga0501074_0080020 | |||
| 2442 | Ga0501074_0101814 | |||
| 2443 | Ga0501074_0164810 | |||
| 2444 | Ga0501074_0235296 | |||
| 2445 | Ga0501074_0959757 | |||
| 2446 | Ga0501074_1057272 | |||
| 2447 | Ga0501075_0023003 | |||
| 2448 | Ga0501075_0143366 | |||
| 2449 | Ga0501075_0242049 | |||
| 2450 | Ga0501075_0242112 | |||
| 2451 | Ga0501075_0304916 | |||
| 2452 | Ga0501075_0424638 | |||
| 2453 | Ga0501075_0873288 | |||
| 2454 | Ga0501075_1521141 | |||
| 2455 | Ga0501076_0023264 | |||
| 2456 | Ga0501076_0025133 | |||
| 2457 | Ga0501076_0263560 | |||
| 2458 | Ga0501076_0285723 | |||
| 2459 | Ga0501076_0305889 | |||
| 2460 | Ga0501076_0620478 | |||
| 2461 | Ga0501076_0794592 | |||
| 2462 | Ga0501076_0868656 | |||
| 2463 | Ga0501076_1252170 | |||
| 2464 | Ga0501077_0003562 | |||
| 2465 | Ga0501077_0009374 | |||
| 2466 | Ga0501077_0021261 | |||
| 2467 | Ga0501077_0154197 | |||
| 2468 | Ga0501077_0388296 | |||
| 2469 | Ga0501077_0741995 | |||
| 2470 | Ga0501077_1139119 | |||
| 2471 | Ga0501208_100171 | |||
| 2472 | Ga0501214_028591 | |||
| 2473 | Ga0501227_136317 | |||
| 2474 | Ga0501233_278268 | |||
| 2475 | Ga0501243_140184 | |||
| 2476 | Ga0501261_128874 | |||
| 2477 | Ga0501079_0006091 | |||
| 2478 | Ga0501079_0033127 | |||
| 2479 | Ga0501079_0057049 | |||
| 2480 | Ga0501079_0057535 | |||
| 2481 | Ga0501079_0074477 | |||
| 2482 | Ga0501079_0102218 | |||
| 2483 | Ga0501079_0123145 | |||
| 2484 | Ga0501079_0213081 | |||
| 2485 | Ga0501079_0311365 | |||
| 2486 | Ga0501079_0921663 | |||
| 2487 | Ga0501080_0007150 | |||
| 2488 | Ga0501080_0387969 | |||
| 2489 | Ga0501080_0435817 | |||
| 2490 | Ga0501080_0686385 | |||
| 2491 | Ga0501080_1152724 | |||
| 2492 | Ga0501080_1529446 | |||
| 2493 | Ga0501081_0001597 | |||
| 2494 | Ga0501081_0018220 | |||
| 2495 | Ga0501081_0235445 | |||
| 2496 | Ga0501081_0372786 | |||
| 2497 | Ga0501081_0482849 | |||
| 2498 | Ga0501081_0688173 | |||
| 2499 | Ga0501081_0712738 | |||
| 2500 | Ga0501081_0981403 | |||
| 2501 | Ga0501083_0000141 | |||
| 2502 | Ga0501083_0472707 | |||
| 2503 | Ga0501083_0785264 | |||
| 2504 | Ga0501266_034847 | |||
| 2505 | Ga0501268_173605 | |||
| 2506 | Ga0501035_0000856 | |||
| 2507 | Ga0501035_0070715 | |||
| 2508 | Ga0501035_1284377 | |||
| 2509 | Ga0501044_0005849 | |||
| 2510 | Ga0501044_0286045 | |||
| 2511 | Ga0501044_0614279 | |||
| 2512 | Ga0501044_0705799 | |||
| 2513 | Ga0501044_1082381 | |||
| 2514 | Ga0501044_1647580 | |||
| 2515 | Ga0501044_1659627 | |||
| 2516 | Ga0501045_0002026 | |||
| 2517 | Ga0501045_0025350 | |||
| 2518 | Ga0501045_0043941 | |||
| 2519 | Ga0501045_0059132 | |||
| 2520 | Ga0501045_0345611 | |||
| 2521 | Ga0501045_0571790 | |||
| 2522 | Ga0501045_0756404 | |||
| 2523 | Ga0501045_0882159 | |||
| 2524 | Ga0501212_046437 | |||
| 2525 | nmdc:mga03n38_449329_c1 | |||
| 2526 | nmdc:mga03n38_793286_c1 | |||
| 2527 | nmdc:mga03n38_86593_c1 | |||
| 2528 | nmdc:mga00v17_155506_c1 | |||
| 2529 | nmdc:mga00v17_309015_c1 | |||
| 2530 | nmdc:mga00v17_661337_c1 | |||
| 2531 | nmdc:mga0yw44_1002328_c1 | |||
| 2532 | nmdc:mga0yw44_1199744_c1 | |||
| 2533 | nmdc:mga0yw44_251594_c1 | |||
| 2534 | nmdc:mga0yw44_259902_c1 | |||
| 2535 | nmdc:mga0yw44_266377_c1 | |||
| 2536 | nmdc:mga0yw44_396704_c1 | |||
| 2537 | nmdc:mga0yw44_580315_c1 | |||
| 2538 | nmdc:mga06z11_177386_c1 | |||
| 2539 | nmdc:mga06z11_448720_c1 | |||
| 2540 | nmdc:mga06z11_776114_c1 | |||
| 2541 | nmdc:mga06z11_930471_c1 | |||
| 2542 | nmdc:mga05p37_1169559_c1 | |||
| 2543 | nmdc:mga05p37_151862_c1 | |||
| 2544 | nmdc:mga05p37_19978_c1 | |||
| 2545 | nmdc:mga05p37_379328_c1 | |||
| 2546 | nmdc:mga05p37_387230_c1 | |||
| 2547 | nmdc:mga05p37_782329_c1 | |||
| 2548 | nmdc:mga05p37_903395_c1 | |||
| 2549 | nmdc:mga09592_1531842_c1 | |||
| 2550 | nmdc:mga09592_545257_c1 | |||
| 2551 | nmdc:mga09592_602038_c1 | |||
| 2552 | nmdc:mga09592_717760_c1 | |||
| 2553 | nmdc:mga09592_793983_c1 | |||
| 2554 | nmdc:mga09592_795797_c1 | |||
| 2555 | nmdc:mga09592_8067_c1 | |||
| 2556 | nmdc:mga0qj67_1032502_c1 | |||
| 2557 | nmdc:mga0qj67_1084712_c1 | |||
| 2558 | nmdc:mga0qj67_1446744_c1 | |||
| 2559 | nmdc:mga0qj67_190095_c1 | |||
| 2560 | nmdc:mga0qj67_215457_c1 | |||
| 2561 | nmdc:mga0qj67_315227_c1 | |||
| 2562 | nmdc:mga0qj67_357506_c1 | |||
| 2563 | nmdc:mga0qj67_48093_c1 | |||
| 2564 | nmdc:mga0qj67_900372_c1 | |||
| 2565 | nmdc:mga06r32_1793642_c1 | |||
| 2566 | nmdc:mga06r32_27650_c1 | |||
| 2567 | nmdc:mga06r32_337834_c1 | |||
| 2568 | nmdc:mga06r32_527204_c1 | |||
| 2569 | nmdc:mga06r32_56393_c1 | |||
| 2570 | nmdc:mga06r32_658143_c1 | |||
| 2571 | nmdc:mga06r32_930487_c1 | |||
| 2572 | nmdc:mga08y16_1113610_c1 | |||
| 2573 | nmdc:mga08y16_1404907_c1 | |||
| 2574 | nmdc:mga08y16_1445402_c1 | |||
| 2575 | nmdc:mga08y16_1486473_c1 | |||
| 2576 | nmdc:mga08y16_1502181_c1 | |||
| 2577 | nmdc:mga08y16_1504756_c1 | |||
| 2578 | nmdc:mga08y16_1556581_c1 | |||
| 2579 | nmdc:mga08y16_1891581_c1 | |||
| 2580 | nmdc:mga08y16_2171636_c1 | |||
| 2581 | nmdc:mga08y16_228365_c1 | |||
| 2582 | nmdc:mga08y16_248578_c1 | |||
| 2583 | nmdc:mga08y16_299298_c1 | |||
| 2584 | nmdc:mga08y16_30358_c2 | |||
| 2585 | nmdc:mga08y16_321786_c1 | |||
| 2586 | nmdc:mga08y16_624192_c1 | |||
| 2587 | nmdc:mga08y16_782842_c1 | |||
| 2588 | nmdc:mga08y16_938886_c1 | |||
| 2589 | nmdc:mga0n895_2216051_c1 | |||
| 2590 | nmdc:mga0n895_72932_c1 | |||
| 2591 | nmdc:mga0rr50_1166875_c1 | |||
| 2592 | nmdc:mga0rr50_1327563_c1 | |||
| 2593 | nmdc:mga0rr50_1804684_c1 | |||
| 2594 | nmdc:mga0a205_1060203_c1 | |||
| 2595 | nmdc:mga0a205_398163_c1 | |||
| 2596 | nmdc:mga0a205_697796_c1 | |||
| 2597 | nmdc:mga0a205_791316_c1 | |||
| 2598 | nmdc:mga0a205_994862_c1 | |||
| 2599 | nmdc:mga0sz30_44171_c1 | |||
| 2600 | Ga0495601_0052039 | |||
| 2601 | Ga0495601_0870213 | |||
| 2602 | Ga0495601_0966206 | |||
| 2603 | Ga0495601_1030595 | |||
| 2604 | Ga0495612_0144616 | |||
| 2605 | Ga0495612_0536400 | |||
| 2606 | Ga0495655_0000006 | |||
| 2607 | Ga0495655_0019506 | |||
| 2608 | Ga0495655_0199145 | |||
| 2609 | Ga0495655_0217168 | |||
| 2610 | Ga0495655_0227285 | |||
| 2611 | Ga0495595_0068620 | |||
| 2612 | Ga0495595_0520933 | |||
| 2613 | Ga0495595_0718709 | |||
| 2614 | Ga0495619_0000037 | |||
| 2615 | Ga0495619_0016599 | |||
| 2616 | Ga0495619_0016985 | |||
| 2617 | Ga0495619_0392621 | |||
| 2618 | Ga0495619_0690138 | |||
| 2619 | Ga0495619_0699157 | |||
| 2620 | Ga0495619_1064166 | |||
| 2621 | Ga0500628_000052 | |||
| 2622 | Ga0501084_0009083 | |||
| 2623 | Ga0501084_0012528 | |||
| 2624 | Ga0501084_0027122 | |||
| 2625 | Ga0501084_0041016 | |||
| 2626 | Ga0501084_0089774 | |||
| 2627 | Ga0501084_0290254 | |||
| 2628 | Ga0501084_0828035 | |||
| 2629 | Ga0501084_0865173 | |||
| 2630 | Ga0501084_0946118 | |||
| 2631 | Ga0501082_0000605 | |||
| 2632 | Ga0501082_0002483 | |||
| 2633 | Ga0501082_0144272 | |||
| 2634 | Ga0501082_0149257 | |||
| 2635 | Ga0501082_0258957 | |||
| 2636 | Ga0501082_0368909 | |||
| 2637 | Ga0501082_0532336 | |||
| 2638 | Ga0501082_1998489 | |||
| 2639 | Ga0530510_0003067 | |||
| 2640 | Ga0530510_0003278 | |||
| 2641 | Ga0530510_0006984 | |||
| 2642 | Ga0530510_0051193 | |||
| 2643 | Ga0530510_0111850 | |||
| 2644 | Ga0530510_0559862 | |||
| 2645 | Ga0530510_0796517 | |||
| 2646 | Ga0530510_1528356 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy