F492999

General Info

Members Datasets Scaffolds Average Seq Length
1323 425 2646 42

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100227102|Ga0070705_1002271023
Length 43
Sequence MVATRRRFNPNLQKVRIQEEGGGTRRVYVCARCLKSNKVTKAA

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
232 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
241 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
242 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
246 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
252 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
253 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
285 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
330 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
331 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
332 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
358 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
359 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
360 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
378 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
379 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
388 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
389 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
390 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
391 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
392 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
393 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
394 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
397 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
398 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
399 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
419 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
420 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
421 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
422 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
423 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
424 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
425 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 7.71
Rhizosphere 87.91
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100227102 3300005440 Bacteria 1296
2 LJQas_1017724 3300000549 Bacteria 829
3 JGI25407J50210_10000647 3300003373 Bacteria 7153
4 JGI25407J50210_10005201 3300003373 Bacteria 3191
5 JGI25407J50210_10022663 3300003373 Bacteria 1632
6 JGI25407J50210_10068884 3300003373 Bacteria 884
7 JGI25407J50210_10107413 3300003373 Bacteria 689
8 JGI25404J52841_10057976 3300003659 Bacteria 812
9 Ga0070658_10007864 3300005327 Bacteria 8588
10 Ga0070658_10124271 3300005327 Bacteria 2147
11 Ga0070683_100001059 3300005329 Bacteria 20635
12 Ga0070683_100057240 3300005329 Bacteria 3621
13 Ga0070683_100063493 3300005329 Bacteria 3435
14 Ga0070683_100100993 3300005329 Bacteria 2716
15 Ga0070683_100299884 3300005329 Bacteria 1529
16 Ga0070683_101848547 3300005329 Bacteria 580
17 Ga0068869_101965336 3300005334 Bacteria 525
18 Ga0070680_100833674 3300005336 Unclassified 795
19 Ga0070682_100714598 3300005337 Bacteria 805
20 Ga0070682_100944089 3300005337 Unclassified 712
21 Ga0068868_100063354 3300005338 Bacteria 2933
22 Ga0068868_100155040 3300005338 Bacteria 1888
23 Ga0068868_101132531 3300005338 Bacteria 721
24 Ga0068868_101209270 3300005338 Unclassified 699
25 Ga0070660_100010723 3300005339 Bacteria 6485
26 Ga0070660_100015124 3300005339 Bacteria 5568
27 Ga0070660_100142980 3300005339 Bacteria 1920
28 Ga0070660_100319916 3300005339 Bacteria 1274
29 Ga0070660_100615165 3300005339 Bacteria 909
30 Ga0070660_100949883 3300005339 Unclassified 726
31 Ga0070660_101339250 3300005339 Bacteria 608
32 Ga0070689_100736887 3300005340 Bacteria 863
33 Ga0070691_10024769 3300005341 Bacteria 2791
34 Ga0070687_100792589 3300005343 Bacteria 671
35 Ga0070661_100680876 3300005344 Bacteria 837
36 Ga0070668_100478566 3300005347 Bacteria 1075
37 Ga0070675_100241136 3300005354 Bacteria 1580
38 Ga0070674_100952254 3300005356 Bacteria 751
39 Ga0070674_101213647 3300005356 Bacteria 670
40 Ga0070673_100954556 3300005364 Unclassified 797
41 Ga0070667_101413814 3300005367 Bacteria 653
42 Ga0070667_102059687 3300005367 Bacteria 538
43 Ga0070703_10032059 3300005406 Bacteria 1594
44 Ga0070709_10415941 3300005434 Bacteria 1006
45 Ga0070709_10537350 3300005434 Bacteria 893
46 Ga0070714_100001136 3300005435 Bacteria 19099
47 Ga0070714_100065991 3300005435 Bacteria 3118
48 Ga0070714_100078366 3300005435 Bacteria 2872
49 Ga0070714_100120288 3300005435 Bacteria 2335
50 Ga0070713_100104043 3300005436 Bacteria 2464
51 Ga0070713_101608955 3300005436 Bacteria 630
52 Ga0070701_10026041 3300005438 Bacteria 2847
53 Ga0070701_10985559 3300005438 Bacteria 587
54 Ga0070700_100328299 3300005441 Bacteria 1126
55 Ga0070700_101745335 3300005441 Bacteria 535
56 Ga0070694_100043377 3300005444 Bacteria 3007
57 Ga0070694_100169544 3300005444 Bacteria 1607
58 Ga0070694_100377477 3300005444 Bacteria 1105
59 Ga0070678_100800268 3300005456 Bacteria 856
60 Ga0070662_101328203 3300005457 Bacteria 619
61 Ga0070681_10013572 3300005458 Bacteria 8104
62 Ga0070681_10039257 3300005458 Bacteria 4746
63 Ga0070681_10176122 3300005458 Bacteria 2061
64 Ga0070681_10461811 3300005458 Bacteria 1182
65 Ga0068867_101001567 3300005459 Bacteria 758
66 Ga0070706_100402194 3300005467 Bacteria 1275
67 Ga0070679_100040168 3300005530 Bacteria 4654
68 Ga0070679_100064556 3300005530 Bacteria 3649
69 Ga0070679_100150535 3300005530 Bacteria 2304
70 Ga0070679_100242417 3300005530 Bacteria 1760
71 Ga0070684_100011356 3300005535 Bacteria 7093
72 Ga0070684_100025743 3300005535 Bacteria 4947
73 Ga0070684_100041508 3300005535 Bacteria 3967
74 Ga0070684_100156327 3300005535 Bacteria 2068
75 Ga0070684_100285121 3300005535 Bacteria 1514
76 Ga0070684_100309997 3300005535 Bacteria 1449
77 Ga0070684_100466353 3300005535 Bacteria 1168
78 Ga0070684_100578048 3300005535 Bacteria 1044
79 Ga0070684_102104819 3300005535 Unclassified 532
80 Ga0070672_100485316 3300005543 Bacteria 1067
81 Ga0070686_100467639 3300005544 Bacteria 972
82 Ga0070686_101591475 3300005544 Bacteria 553
83 Ga0070695_100392892 3300005545 Bacteria 1049
84 Ga0070695_101208308 3300005545 Bacteria 622
85 Ga0070696_100101771 3300005546 Bacteria 2060
86 Ga0070693_100323787 3300005547 Bacteria 1046
87 Ga0070704_100447342 3300005549 Bacteria 1112
88 Ga0070704_100575373 3300005549 Bacteria 987
89 Ga0070704_101522138 3300005549 Unclassified 616
90 Ga0068855_100102069 3300005563 Bacteria 3301
91 Ga0068855_100171627 3300005563 Bacteria 2456
92 Ga0070664_100223218 3300005564 Bacteria 1686
93 Ga0070664_100345353 3300005564 Bacteria 1353
94 Ga0068857_100003516 3300005577 Bacteria 13090
95 Ga0068857_100757056 3300005577 Bacteria 925
96 Ga0068854_100071784 3300005578 Bacteria 2533
97 Ga0068854_102081360 3300005578 Bacteria 524
98 Ga0068856_100725950 3300005614 Bacteria 1014
99 Ga0070702_100579372 3300005615 Bacteria 838
100 Ga0068852_100113091 3300005616 Bacteria 2472
101 Ga0068852_102279397 3300005616 Unclassified 563
102 Ga0068864_100026766 3300005618 Bacteria 4864
103 Ga0068866_10096800 3300005718 Bacteria 1619
104 Ga0068861_100052837 3300005719 Bacteria 3089
105 Ga0068861_100590363 3300005719 Bacteria 1018
106 Ga0068870_10045088 3300005840 Bacteria 2306
107 Ga0068863_100024380 3300005841 Bacteria 5769
108 Ga0068863_102459852 3300005841 Bacteria 530
109 Ga0068858_101965791 3300005842 Unclassified 578
110 Ga0068860_101534317 3300005843 Bacteria 688
111 Ga0068862_100047767 3300005844 Bacteria 3654
112 Ga0068862_100932786 3300005844 Bacteria 855
113 Ga0081455_10014766 3300005937 Bacteria 7621
114 Ga0081455_10016928 3300005937 Bacteria 7008
115 Ga0081455_10026800 3300005937 Bacteria 5293
116 Ga0081455_10040246 3300005937 Bacteria 4124
117 Ga0081455_10052293 3300005937 Bacteria 3498
118 Ga0081455_10081825 3300005937 Bacteria 2643
119 Ga0081455_10207081 3300005937 Bacteria 1464
120 Ga0081455_10242934 3300005937 Bacteria 1322
121 Ga0081455_10764175 3300005937 Bacteria 610
122 Ga0081538_10000686 3300005981 Bacteria 37157
123 Ga0081538_10001097 3300005981 Bacteria 28701
124 Ga0081538_10001861 3300005981 Bacteria 21273
125 Ga0081538_10002388 3300005981 Bacteria 18442
126 Ga0081538_10002813 3300005981 Bacteria 16663
127 Ga0081538_10003603 3300005981 Bacteria 14547
128 Ga0081538_10017552 3300005981 Bacteria 5425
129 Ga0081538_10017844 3300005981 Bacteria 5362
130 Ga0081538_10021571 3300005981 Bacteria 4691
131 Ga0081538_10062508 3300005981 Bacteria 2123
132 Ga0081538_10110686 3300005981 Bacteria 1349
133 Ga0081538_10226752 3300005981 Bacteria 734
134 Ga0081538_10230790 3300005981 Bacteria 723
135 Ga0081540_1002544 3300005983 Bacteria 14794
136 Ga0081539_10001667 3300005985 Bacteria 35954
137 Ga0070717_10289536 3300006028 Unclassified 1454
138 Ga0070717_11161192 3300006028 Bacteria 703
139 Ga0075365_10462217 3300006038 Bacteria 896
140 Ga0075365_10687895 3300006038 Bacteria 723
141 Ga0075363_100017261 3300006048 Bacteria 3576
142 Ga0075363_100287975 3300006048 Bacteria 951
143 Ga0075364_10097521 3300006051 Bacteria 1955
144 Ga0075364_10863816 3300006051 Bacteria 616
145 Ga0075432_10006106 3300006058 Bacteria 4097
146 Ga0070716_100712877 3300006173 Bacteria 768
147 Ga0075367_10033149 3300006178 Bacteria 2975
148 Ga0075367_10795167 3300006178 Bacteria 602
149 Ga0075369_10071411 3300006186 Bacteria 1528
150 Ga0097621_100136434 3300006237 Bacteria 2093
151 Ga0097621_100213429 3300006237 Bacteria 1679
152 Ga0097621_102279418 3300006237 Bacteria 518
153 Ga0068871_100110576 3300006358 Bacteria 2311
154 Ga0068871_100307878 3300006358 Bacteria 1392
155 Ga0068871_101458547 3300006358 Bacteria 646
156 Ga0075428_100046907 3300006844 Bacteria 4745
157 Ga0075430_100147442 3300006846 Bacteria 1960
158 Ga0075430_100491366 3300006846 Bacteria 1013
159 Ga0075430_100690129 3300006846 Bacteria 842
160 Ga0075430_101382667 3300006846 Unclassified 579
161 Ga0075431_100695154 3300006847 Bacteria 995
162 Ga0075431_100809498 3300006847 Bacteria 910
163 Ga0075431_100820400 3300006847 Bacteria 903
164 Ga0075431_101721097 3300006847 Bacteria 584
165 Ga0075433_10009068 3300006852 Bacteria 7947
166 Ga0075434_100119151 3300006871 Bacteria 2653
167 Ga0075434_100123574 3300006871 Bacteria 2604
168 Ga0075434_100281669 3300006871 Bacteria 1682
169 Ga0075429_100739732 3300006880 Bacteria 861
170 Ga0075429_100785762 3300006880 Bacteria 834
171 Ga0075429_101859883 3300006880 Bacteria 522
172 Ga0068865_100687067 3300006881 Bacteria 873
173 Ga0068865_101845625 3300006881 Bacteria 547
174 Ga0068865_101986013 3300006881 Bacteria 528
175 Ga0075436_101264060 3300006914 Bacteria 558
176 Ga0075436_101400980 3300006914 Bacteria 530
177 Ga0075435_100574943 3300007076 Bacteria 977
178 Ga0105251_10226261 3300009011 Bacteria 842
179 Ga0105251_10466809 3300009011 Bacteria 587
180 Ga0105240_10476961 3300009093 Bacteria 1391
181 Ga0105240_12156159 3300009093 Bacteria 578
182 Ga0111539_10030741 3300009094 Bacteria 6528
183 Ga0111539_10085561 3300009094 Bacteria 3705
184 Ga0111539_10187206 3300009094 Bacteria 2417
185 Ga0111539_10414517 3300009094 Bacteria 1569
186 Ga0111539_10703255 3300009094 Bacteria 1176
187 Ga0111539_11075406 3300009094 Bacteria 935
188 Ga0111539_11362970 3300009094 Bacteria 823
189 Ga0111539_11441653 3300009094 Bacteria 799
190 Ga0111539_12336295 3300009094 Bacteria 620
191 Ga0111539_12506520 3300009094 Bacteria 598
192 Ga0111539_12682195 3300009094 Bacteria 578
193 Ga0111539_12793492 3300009094 Bacteria 566
194 Ga0105245_10013217 3300009098 Bacteria 7192
195 Ga0105245_10026250 3300009098 Bacteria 5126
196 Ga0105245_10136477 3300009098 Bacteria 2306
197 Ga0105245_10600306 3300009098 Bacteria 1127
198 Ga0105245_12753727 3300009098 Bacteria 545
199 Ga0105247_10001002 3300009101 Bacteria 21329
200 Ga0105247_10205303 3300009101 Bacteria 1326
201 Ga0105247_10578277 3300009101 Bacteria 830
202 Ga0105247_10973622 3300009101 Unclassified 660
203 Ga0114129_10118948 3300009147 Bacteria 3639
204 Ga0114129_10291857 3300009147 Bacteria 2176
205 Ga0114129_10673536 3300009147 Bacteria 1333
206 Ga0114129_11252753 3300009147 Bacteria 921
207 Ga0114129_11449562 3300009147 Bacteria 845
208 Ga0114129_11574899 3300009147 Bacteria 805
209 Ga0114129_12332380 3300009147 Bacteria 642
210 Ga0114129_12660131 3300009147 Bacteria 596
211 Ga0105243_10243238 3300009148 Bacteria 1602
212 Ga0105243_10564805 3300009148 Bacteria 1089
213 Ga0105243_10674720 3300009148 Unclassified 1004
214 Ga0105243_11481960 3300009148 Bacteria 702
215 Ga0105243_11504835 3300009148 Bacteria 697
216 Ga0105243_12002252 3300009148 Bacteria 613
217 Ga0105241_10737140 3300009174 Bacteria 902
218 Ga0105241_10847260 3300009174 Bacteria 845
219 Ga0105242_10127861 3300009176 Bacteria 2189
220 Ga0105242_12047019 3300009176 Bacteria 616
221 Ga0105242_12634063 3300009176 Bacteria 552
222 Ga0105248_10000008 3300009177 Bacteria 403910
223 Ga0105248_10845470 3300009177 Bacteria 1033
224 Ga0105237_10094470 3300009545 Bacteria 2979
225 Ga0105237_11896741 3300009545 Bacteria 604
226 Ga0105238_10061239 3300009551 Bacteria 3767
227 Ga0105238_10990471 3300009551 Bacteria 861
228 Ga0105238_11426058 3300009551 Bacteria 720
229 Ga0105238_12051082 3300009551 Unclassified 606
230 Ga0105249_10006751 3300009553 Bacteria 10000
231 Ga0105249_10730959 3300009553 Bacteria 1051
232 Ga0105249_10759692 3300009553 Bacteria 1032
233 Ga0105147_119712 3300009982 Bacteria 573
234 Ga0099796_10269204 3300010159 Bacteria 713
235 Ga0105239_10132622 3300010375 Bacteria 2772
236 Ga0105239_10274969 3300010375 Bacteria 1895
237 Ga0105239_10623107 3300010375 Bacteria 1231
238 Ga0105239_11043992 3300010375 Bacteria 940
239 Ga0105239_11486293 3300010375 Bacteria 783
240 Ga0105239_13540173 3300010375 Bacteria 507
241 Ga0105246_10114544 3300011119 Bacteria 1987
242 Ga0105246_10484722 3300011119 Bacteria 1047
243 Ga0105246_10630386 3300011119 Bacteria 930
244 Ga0105246_10678990 3300011119 Bacteria 900
245 Ga0105246_10829267 3300011119 Bacteria 823
246 Ga0105246_12055161 3300011119 Bacteria 552
247 Ga0157371_10715045 3300013102 Unclassified 750
248 Ga0157371_10927737 3300013102 Bacteria 661
249 Ga0157371_11084341 3300013102 Bacteria 614
250 Ga0157370_10016292 3300013104 Bacteria 7532
251 Ga0157370_11704252 3300013104 Bacteria 566
252 Ga0157369_10001576 3300013105 Bacteria 27893
253 Ga0157369_10005857 3300013105 Bacteria 14280
254 Ga0157369_10006509 3300013105 Bacteria 13536
255 Ga0157369_11221485 3300013105 Bacteria 767
256 Ga0157369_11498467 3300013105 Bacteria 686
257 Ga0157374_10375831 3300013296 Bacteria 1415
258 Ga0157374_11499049 3300013296 Bacteria 698
259 Ga0157378_10387378 3300013297 Bacteria 1374
260 Ga0157378_11459801 3300013297 Bacteria 728
261 Ga0163162_10059179 3300013306 Bacteria 3862
262 Ga0163162_11346875 3300013306 Unclassified 812
263 Ga0163162_11391671 3300013306 Bacteria 798
264 Ga0157372_10000882 3300013307 Bacteria 32603
265 Ga0157372_10022389 3300013307 Bacteria 6837
266 Ga0157372_11209569 3300013307 Bacteria 873
267 Ga0157372_11955931 3300013307 Bacteria 674
268 Ga0157372_12393500 3300013307 Bacteria 606
269 Ga0157372_12495650 3300013307 Bacteria 593
270 Ga0157372_12650347 3300013307 Bacteria 575
271 Ga0157372_13091274 3300013307 Bacteria 531
272 Ga0157375_10378466 3300013308 Bacteria 1582
273 Ga0157375_10538502 3300013308 Bacteria 1330
274 Ga0157375_12790418 3300013308 Bacteria 584
275 Ga0163163_10242032 3300014325 Bacteria 1854
276 Ga0163163_10521135 3300014325 Bacteria 1251
277 Ga0163163_10703539 3300014325 Bacteria 1074
278 Ga0157380_10029480 3300014326 Bacteria 4194
279 Ga0157380_11015357 3300014326 Bacteria 864
280 Ga0157380_11111899 3300014326 Bacteria 830
281 Ga0157377_10060623 3300014745 Bacteria 2160
282 Ga0157377_10371183 3300014745 Bacteria 966
283 Ga0157377_10890703 3300014745 Bacteria 664
284 Ga0157377_10983709 3300014745 Bacteria 637
285 Ga0157377_11271770 3300014745 Bacteria 573
286 Ga0157379_11408140 3300014968 Bacteria 676
287 Ga0163161_10161241 3300017792 Bacteria 1710
288 Ga0163161_11049658 3300017792 Bacteria 698
289 Ga0197907_11454115 3300020069 Bacteria 659
290 Ga0197907_11495825 3300020069 Unclassified 937
291 Ga0206356_10808650 3300020070 Bacteria 1800
292 Ga0206356_11791021 3300020070 Bacteria 583
293 Ga0206354_11697381 3300020081 Bacteria 3467
294 Ga0206353_10309370 3300020082 Bacteria 5643
295 Ga0206353_11333443 3300020082 Bacteria 1396
296 Ga0206353_11506452 3300020082 Bacteria 1101
297 Ga0224712_10049116 3300022467 Bacteria 1632
298 Ga0207692_10022697 3300025898 Bacteria 2892
299 Ga0207642_10247832 3300025899 Bacteria 1009
300 Ga0207642_10816309 3300025899 Bacteria 594
301 Ga0207710_10000461 3300025900 Bacteria 26087
302 Ga0207710_10700234 3300025900 Unclassified 531
303 Ga0207688_10411166 3300025901 Bacteria 840
304 Ga0207688_10711744 3300025901 Bacteria 635
305 Ga0207680_10361862 3300025903 Bacteria 1020
306 Ga0207647_10489024 3300025904 Bacteria 687
307 Ga0207699_10149174 3300025906 Bacteria 1545
308 Ga0207699_10156499 3300025906 Bacteria 1513
309 Ga0207699_10160575 3300025906 Bacteria 1496
310 Ga0207645_10287724 3300025907 Bacteria 1092
311 Ga0207643_10258308 3300025908 Bacteria 1075
312 Ga0207705_10062767 3300025909 Bacteria 2684
313 Ga0207707_10012642 3300025912 Bacteria 7337
314 Ga0207707_10188457 3300025912 Bacteria 1800
315 Ga0207707_10207457 3300025912 Bacteria 1707
316 Ga0207707_10419967 3300025912 Bacteria 1147
317 Ga0207707_10586733 3300025912 Unclassified 944
318 Ga0207707_11076919 3300025912 Bacteria 656
319 Ga0207695_10058413 3300025913 Bacteria 4004
320 Ga0207695_10234398 3300025913 Bacteria 1738
321 Ga0207693_10000327 3300025915 Bacteria 43947
322 Ga0207693_10528564 3300025915 Bacteria 920
323 Ga0207693_10698775 3300025915 Bacteria 786
324 Ga0207663_10011766 3300025916 Bacteria 4710
325 Ga0207660_10023880 3300025917 Bacteria 4134
326 Ga0207660_10283858 3300025917 Bacteria 1315
327 Ga0207660_10291474 3300025917 Bacteria 1298
328 Ga0207660_10362927 3300025917 Bacteria 1162
329 Ga0207660_11148785 3300025917 Unclassified 632
330 Ga0207657_10006978 3300025919 Bacteria 11630
331 Ga0207657_10016594 3300025919 Bacteria 7095
332 Ga0207657_10036776 3300025919 Bacteria 4380
333 Ga0207657_10243831 3300025919 Bacteria 1434
334 Ga0207657_10271938 3300025919 Bacteria 1347
335 Ga0207657_11140495 3300025919 Bacteria 595
336 Ga0207649_10005811 3300025920 Bacteria 6680
337 Ga0207649_10034830 3300025920 Bacteria 3020
338 Ga0207649_10778872 3300025920 Bacteria 746
339 Ga0207652_10016236 3300025921 Bacteria 6074
340 Ga0207652_10040530 3300025921 Bacteria 3955
341 Ga0207652_10064889 3300025921 Bacteria 3160
342 Ga0207694_11415451 3300025924 Bacteria 587
343 Ga0207650_10490343 3300025925 Bacteria 1026
344 Ga0207659_11864470 3300025926 Unclassified 510
345 Ga0207687_10022371 3300025927 Bacteria 4206
346 Ga0207687_10104131 3300025927 Bacteria 2094
347 Ga0207687_10131564 3300025927 Bacteria 1887
348 Ga0207687_10134242 3300025927 Bacteria 1870
349 Ga0207687_10590791 3300025927 Bacteria 935
350 Ga0207700_10079181 3300025928 Bacteria 2558
351 Ga0207700_10556377 3300025928 Bacteria 1018
352 Ga0207664_10021420 3300025929 Bacteria 4806
353 Ga0207664_10056373 3300025929 Bacteria 3121
354 Ga0207664_10312822 3300025929 Bacteria 1384
355 Ga0207664_10528668 3300025929 Bacteria 1057
356 Ga0207664_10669628 3300025929 Bacteria 933
357 Ga0207664_10706874 3300025929 Bacteria 906
358 Ga0207644_10425946 3300025931 Bacteria 1088
359 Ga0207644_10815173 3300025931 Bacteria 781
360 Ga0207690_10026917 3300025932 Bacteria 3628
361 Ga0207690_10204475 3300025932 Bacteria 1502
362 Ga0207690_10934577 3300025932 Bacteria 720
363 Ga0207706_10007358 3300025933 Bacteria 10175
364 Ga0207706_10045036 3300025933 Bacteria 3909
365 Ga0207706_10045535 3300025933 Bacteria 3886
366 Ga0207706_10200085 3300025933 Bacteria 1752
367 Ga0207706_10376262 3300025933 Bacteria 1233
368 Ga0207706_10490248 3300025933 Unclassified 1061
369 Ga0207706_10656742 3300025933 Bacteria 898
370 Ga0207706_10771162 3300025933 Bacteria 818
371 Ga0207706_10798478 3300025933 Bacteria 802
372 Ga0207706_11276858 3300025933 Bacteria 607
373 Ga0207686_10004066 3300025934 Bacteria 7851
374 Ga0207686_10081272 3300025934 Bacteria 2115
375 Ga0207709_10183000 3300025935 Bacteria 1481
376 Ga0207709_10195193 3300025935 Bacteria 1441
377 Ga0207709_10520681 3300025935 Bacteria 931
378 Ga0207709_10587820 3300025935 Bacteria 880
379 Ga0207709_11127531 3300025935 Bacteria 645
380 Ga0207709_11495567 3300025935 Bacteria 560
381 Ga0207669_10145008 3300025937 Bacteria 1654
382 Ga0207669_10375170 3300025937 Bacteria 1107
383 Ga0207669_10528826 3300025937 Bacteria 948
384 Ga0207669_10548544 3300025937 Bacteria 932
385 Ga0207669_11340780 3300025937 Bacteria 608
386 Ga0207704_10024207 3300025938 Bacteria 3288
387 Ga0207704_10217462 3300025938 Bacteria 1411
388 Ga0207704_10480177 3300025938 Bacteria 998
389 Ga0207665_10099669 3300025939 Bacteria 2026
390 Ga0207665_10932301 3300025939 Bacteria 689
391 Ga0207691_10352783 3300025940 Bacteria 1258
392 Ga0207711_10292428 3300025941 Bacteria 1502
393 Ga0207711_10568233 3300025941 Bacteria 1058
394 Ga0207661_10005475 3300025944 Bacteria 8954
395 Ga0207661_10005597 3300025944 Bacteria 8857
396 Ga0207661_10018843 3300025944 Bacteria 5135
397 Ga0207661_10054277 3300025944 Bacteria 3210
398 Ga0207661_11473860 3300025944 Bacteria 624
399 Ga0207679_10033625 3300025945 Bacteria 3610
400 Ga0207667_10270932 3300025949 Bacteria 1736
401 Ga0207651_10790556 3300025960 Bacteria 841
402 Ga0207651_10792629 3300025960 Bacteria 840
403 Ga0207712_10041224 3300025961 Bacteria 3172
404 Ga0207712_10085578 3300025961 Bacteria 2308
405 Ga0207668_10072808 3300025972 Bacteria 2460
406 Ga0207668_10100011 3300025972 Bacteria 2152
407 Ga0207668_11360424 3300025972 Bacteria 640
408 Ga0207640_10459058 3300025981 Bacteria 1052
409 Ga0207640_10566288 3300025981 Bacteria 957
410 Ga0207640_11086238 3300025981 Bacteria 707
411 Ga0207640_11122257 3300025981 Bacteria 696
412 Ga0207658_11229279 3300025986 Bacteria 685
413 Ga0207677_10209390 3300026023 Bacteria 1556
414 Ga0207677_10821133 3300026023 Bacteria 833
415 Ga0207677_11231224 3300026023 Bacteria 686
416 Ga0207639_10089943 3300026041 Bacteria 2454
417 Ga0207678_10288265 3300026067 Bacteria 1410
418 Ga0207678_10366332 3300026067 Bacteria 1244
419 Ga0207678_11565124 3300026067 Bacteria 581
420 Ga0207708_10030902 3300026075 Bacteria 4063
421 Ga0207708_10101302 3300026075 Bacteria 2229
422 Ga0207708_10146374 3300026075 Bacteria 1857
423 Ga0207708_10192233 3300026075 Bacteria 1625
424 Ga0207708_10315026 3300026075 Bacteria 1275
425 Ga0207702_10004996 3300026078 Bacteria 11654
426 Ga0207702_10023609 3300026078 Bacteria 5102
427 Ga0207702_11410215 3300026078 Bacteria 690
428 Ga0207641_10005668 3300026088 Bacteria 10630
429 Ga0207641_10268674 3300026088 Bacteria 1600
430 Ga0207648_11512641 3300026089 Bacteria 631
431 Ga0207676_10069746 3300026095 Bacteria 2816
432 Ga0207676_10388630 3300026095 Bacteria 1301
433 Ga0207674_10126629 3300026116 Bacteria 2520
434 Ga0207674_10504852 3300026116 Bacteria 1168
435 Ga0207675_100001319 3300026118 Bacteria 24876
436 Ga0207675_100130900 3300026118 Bacteria 2379
437 Ga0207675_100911123 3300026118 Bacteria 896
438 Ga0207675_100914427 3300026118 Bacteria 894
439 Ga0207675_102348718 3300026118 Bacteria 546
440 Ga0207675_102601973 3300026118 Unclassified 516
441 Ga0207683_10274418 3300026121 Bacteria 1540
442 Ga0207683_10564806 3300026121 Bacteria 1052
443 Ga0207698_10090228 3300026142 Bacteria 2506
444 Ga0207698_10143689 3300026142 Bacteria 2060
445 Ga0209969_1069687 3300027360 Unclassified 559
446 Ga0209970_1026438 3300027614 Bacteria 996
447 Ga0209974_10151813 3300027876 Bacteria 836
448 Ga0209974_10400279 3300027876 Bacteria 539
449 Ga0207428_10038116 3300027907 Bacteria 3909
450 Ga0207428_10244434 3300027907 Bacteria 1340
451 Ga0207428_10323513 3300027907 Bacteria 1139
452 Ga0207428_10510511 3300027907 Unclassified 872
453 Ga0207428_10603190 3300027907 Bacteria 791
454 Ga0207428_10798641 3300027907 Bacteria 670
455 Ga0268265_10166359 3300028380 Bacteria 1880
456 Ga0268265_10349955 3300028380 Bacteria 1349
457 Ga0268265_12037923 3300028380 Unclassified 581
458 Ga0268265_12583810 3300028380 Bacteria 514
459 Ga0268264_11168013 3300028381 Bacteria 779
460 Ga0268264_11352230 3300028381 Bacteria 723
461 Ga0265326_10245737 3300028558 Bacteria 517
462 Ga0265322_10235668 3300028654 Unclassified 525
463 Ga0265338_10067558 3300028800 Bacteria 3086
464 Ga0265338_10562644 3300028800 Bacteria 797
465 Ga0265324_10035867 3300029957 Bacteria 1725
466 Ga0265329_10058500 3300031242 Bacteria 1220
467 Ga0265339_10124483 3300031249 Bacteria 1322
468 Ga0307408_100112212 3300031548 Bacteria 2096
469 Ga0307408_100181803 3300031548 Bacteria 1687
470 Ga0307405_10084095 3300031731 Bacteria 2088
471 Ga0307405_10331758 3300031731 Bacteria 1166
472 Ga0307410_10005242 3300031852 Bacteria 6833
473 Ga0307410_10049037 3300031852 Bacteria 2833
474 Ga0307410_10123974 3300031852 Bacteria 1888
475 Ga0307410_10157305 3300031852 Bacteria 1699
476 Ga0307410_11997874 3300031852 Bacteria 517
477 Ga0307406_10203429 3300031901 Bacteria 1459
478 Ga0307406_10256133 3300031901 Bacteria 1321
479 Ga0307406_11410232 3300031901 Bacteria 611
480 Ga0307406_11529735 3300031901 Bacteria 588
481 Ga0307407_10868259 3300031903 Bacteria 690
482 Ga0307407_10935757 3300031903 Bacteria 667
483 Ga0307407_11264173 3300031903 Bacteria 578
484 Ga0307412_10101667 3300031911 Bacteria 2034
485 Ga0307412_10381700 3300031911 Bacteria 1141
486 Ga0307412_10741449 3300031911 Bacteria 847
487 Ga0307409_100008843 3300031995 Bacteria 6144
488 Ga0307409_100025648 3300031995 Bacteria 4139
489 Ga0307409_100175393 3300031995 Bacteria 1891
490 Ga0307409_100187052 3300031995 Bacteria 1839
491 Ga0307409_100197889 3300031995 Bacteria 1795
492 Ga0307409_100290421 3300031995 Bacteria 1516
493 Ga0307409_102004315 3300031995 Bacteria 608
494 Ga0307409_102166798 3300031995 Bacteria 585
495 Ga0307409_102538507 3300031995 Bacteria 541
496 Ga0307409_102605410 3300031995 Bacteria 534
497 Ga0307416_100026631 3300032002 Bacteria 4264
498 Ga0307416_100094130 3300032002 Bacteria 2582
499 Ga0307416_100160319 3300032002 Bacteria 2078
500 Ga0307416_100683036 3300032002 Bacteria 1114
501 Ga0307414_10064344 3300032004 Bacteria 2611
502 Ga0307414_10298735 3300032004 Bacteria 1361
503 Ga0307414_10930984 3300032004 Bacteria 798
504 Ga0307411_10072439 3300032005 Bacteria 2340
505 Ga0307411_10466700 3300032005 Bacteria 1060
506 Ga0307411_10629553 3300032005 Bacteria 926
507 Ga0307411_10706979 3300032005 Bacteria 878
508 Ga0307415_100009432 3300032126 Bacteria 5470
509 Ga0307415_100030417 3300032126 Bacteria 3466
510 Ga0307415_100066821 3300032126 Bacteria 2511
511 Ga0307415_100099339 3300032126 Bacteria 2130
512 Ga0373959_0130916 3300034820 Bacteria 621
513 Ga0373938_0244320 3300034957 Bacteria 511
514 Ga0373944_0354845 3300035089 Bacteria 559
515 Ga0373952_0191105 3300035092 Bacteria 595
516 Ga0373923_0055064 3300035111 Bacteria 1676
517 Ga0373923_0640915 3300035111 Bacteria 525
518 Ga0373932_0213879 3300035112 Bacteria 690
519 Ga0373936_0253075 3300035113 Bacteria 787
520 Ga0373939_0053380 3300035114 Bacteria 1262
521 Ga0373945_0410023 3300035116 Bacteria 595
522 Ga0373953_0122897 3300035117 Bacteria 1103
523 Ga0373954_0176765 3300035118 Bacteria 1046
524 Ga0373956_0174209 3300035119 Bacteria 1016
525 Ga0373957_0180599 3300035120 Bacteria 874
526 Ga0373943_0521532 3300035170 Bacteria 696
527 Ga0373946_0105714 3300035171 Bacteria 1268
528 Ga0373946_0115090 3300035171 Bacteria 1222
529 Ga0373955_0056768 3300035172 Bacteria 2149
530 Ga0373961_0013500 3300035241 Bacteria 2061
531 Ga0373961_0321445 3300035241 Bacteria 577
532 Ga0373961_0335003 3300035241 Bacteria 567
533 Ga0373962_0273281 3300035242 Bacteria 593
534 Ga0316574_0339953 3300035398 Bacteria 951
535 Ga0316574_0342247 3300035398 Bacteria 947
536 Ga0373924_0104076 3300035410 Bacteria 1223
537 Ga0373931_0085014 3300035691 Bacteria 1753
538 Ga0373931_0864617 3300035691 Bacteria 606
539 Ga0373935_0236129 3300035692 Bacteria 1275
540 Ga0373935_0309056 3300035692 Bacteria 1119
541 Ga0373927_0145994 3300035695 Bacteria 1549
542 Ga0373933_0088640 3300035724 Bacteria 1906
543 Ga0373933_0253597 3300035724 Bacteria 1133
544 Ga0373947_0129699 3300035725 Bacteria 1608
545 Ga0373937_0029481 3300036401 Bacteria 4969
546 Ga0373925_1131286 3300037068 Bacteria 644
547 Ga0395899_0003553 3300037312 Bacteria 12345
548 Ga0395899_0004500 3300037312 Bacteria 10867
549 Ga0395899_0015196 3300037312 Bacteria 5870
550 Ga0395899_0117298 3300037312 Bacteria 1909
551 Ga0395899_0193560 3300037312 Unclassified 1422
552 Ga0395899_0299048 3300037312 Bacteria 1089
553 Ga0395899_0431824 3300037312 Bacteria 866
554 Ga0395899_0888390 3300037312 Bacteria 544
555 Ga0395900_0001151 3300037418 Bacteria 33219
556 Ga0395900_0003158 3300037418 Bacteria 17863
557 Ga0395900_0029208 3300037418 Bacteria 5655
558 Ga0395900_0032554 3300037418 Bacteria 5361
559 Ga0395900_0049434 3300037418 Bacteria 4333
560 Ga0395900_0099875 3300037418 Bacteria 2981
561 Ga0395900_0248961 3300037418 Unclassified 1779
562 Ga0395900_0653381 3300037418 Bacteria 988
563 Ga0395900_0703105 3300037418 Bacteria 944
564 Ga0395900_0777970 3300037418 Bacteria 886
565 Ga0395900_1010740 3300037418 Unclassified 751
566 Ga0395900_1314846 3300037418 Bacteria 637
567 Ga0395900_1411199 3300037418 Bacteria 609
568 Ga0395900_1778536 3300037418 Bacteria 527
569 Ga0395898_0003255 3300037466 Bacteria 18259
570 Ga0395898_0007563 3300037466 Bacteria 11531
571 Ga0395898_0017807 3300037466 Bacteria 7249
572 Ga0395898_0110067 3300037466 Bacteria 2641
573 Ga0395898_0130997 3300037466 Bacteria 2402
574 Ga0395898_0223727 3300037466 Bacteria 1795
575 Ga0395898_0661781 3300037466 Bacteria 987
576 Ga0395898_1053338 3300037466 Bacteria 748
577 Ga0395898_1127117 3300037466 Bacteria 717
578 Ga0395898_1236179 3300037466 Bacteria 677
579 Ga0395905_0005310 3300037471 Bacteria 13169
580 Ga0395905_0018615 3300037471 Bacteria 6587
581 Ga0395905_0038953 3300037471 Bacteria 4459
582 Ga0395905_0186955 3300037471 Bacteria 1944
583 Ga0395905_1724555 3300037471 Bacteria 532
584 Ga0436364_0058676 3300037853 Bacteria 861
585 Ga0436364_0335112 3300037853 Bacteria 6470
586 Ga0436364_0857259 3300037853 Bacteria 787
587 Ga0436364_0968519 3300037853 Bacteria 1421
588 Ga0395901_0009117 3300038443 Bacteria 10048
589 Ga0395901_0009324 3300038443 Bacteria 9949
590 Ga0395901_0011708 3300038443 Bacteria 8890
591 Ga0395901_0013838 3300038443 Bacteria 8207
592 Ga0395901_0017307 3300038443 Bacteria 7357
593 Ga0395901_0022647 3300038443 Bacteria 6440
594 Ga0395901_0108496 3300038443 Bacteria 2914
595 Ga0395901_0470338 3300038443 Bacteria 1283
596 Ga0395901_0791741 3300038443 Bacteria 938
597 Ga0395901_0816093 3300038443 Bacteria 921
598 Ga0395901_0847389 3300038443 Bacteria 900
599 Ga0395901_0924487 3300038443 Bacteria 853
600 Ga0395901_1242215 3300038443 Bacteria 709
601 Ga0395901_1247541 3300038443 Bacteria 707
602 Ga0436360_0309792 3300039438 Bacteria 9010
603 Ga0436363_1685287 3300039450 Bacteria 1378
604 Ga0436362_0196630 3300039453 Bacteria 579
605 Ga0439453_0152042 3300041408 Bacteria 550
606 Ga0451802_2110464 3300041460 Unclassified 690
607 Ga0451807_1033732 3300041486 Bacteria 1799
608 Ga0451807_1785489 3300041486 Bacteria 711
609 Ga0451833_0562689 3300041491 Bacteria 2511
610 Ga0451839_0129166 3300041496 Bacteria 515
611 Ga0451845_0181262 3300041501 Unclassified 594
612 Ga0451845_0319367 3300041501 Unclassified 541
613 Ga0451843_1498561 3300041509 Bacteria 518
614 Ga0451853_0358062 3300041512 Bacteria 503
615 Ga0451853_3422080 3300041512 Unclassified 819
616 Ga0451853_3517233 3300041512 Bacteria 1422
617 Ga0451853_3685609 3300041512 Bacteria 673
618 Ga0439448_0387220 3300042005 Bacteria 500
619 Ga0439450_044045 3300042008 Bacteria 1044
620 Ga0439450_157144 3300042008 Bacteria 598
621 Ga0439454_020462 3300042011 Bacteria 971
622 Ga0439455_0083711 3300042012 Bacteria 869
623 Ga0439455_0113218 3300042012 Bacteria 756
624 Ga0439463_137876 3300042016 Bacteria 632
625 Ga0439463_154771 3300042016 Bacteria 594
626 Ga0450905_021975 3300042142 Bacteria 946
627 Ga0450910_105201 3300042147 Bacteria 509
628 Ga0439459_0019449 3300042438 Bacteria 1287
629 Ga0439464_0093853 3300042439 Bacteria 906
630 Ga0439464_0208225 3300042439 Bacteria 625
631 Ga0439460_0016281 3300042461 Bacteria 1979
632 Ga0439460_0154203 3300042461 Bacteria 767
633 Ga0439460_0372778 3300042461 Bacteria 505
634 Ga0450901_018784 3300042533 Bacteria 735
635 Ga0439440_0073182 3300042993 Bacteria 895
636 Ga0439440_0098656 3300042993 Bacteria 792
637 Ga0466969_0019734 3300044656 Bacteria 3499
638 Ga0466969_0259660 3300044656 Unclassified 787
639 Ga0466969_0284223 3300044656 Bacteria 749
640 Ga0466969_0548685 3300044656 Bacteria 529
641 Ga0466966_0581062 3300044684 Bacteria 674
642 Ga0466961_0181657 3300044693 Bacteria 1306
643 Ga0466961_0599149 3300044693 Bacteria 663
644 Ga0466961_0705592 3300044693 Bacteria 604
645 Ga0466963_0008740 3300044694 Bacteria 6081
646 Ga0466963_0071439 3300044694 Bacteria 2336
647 Ga0466963_0073797 3300044694 Bacteria 2300
648 Ga0466963_0701092 3300044694 Bacteria 714
649 Ga0466963_0704970 3300044694 Bacteria 712
650 Ga0466963_1187582 3300044694 Bacteria 536
651 Ga0466964_0251713 3300044706 Bacteria 871
652 Ga0466964_0431635 3300044706 Bacteria 695
653 Ga0466964_0506611 3300044706 Bacteria 649
654 Ga0466964_0613582 3300044706 Bacteria 598
655 Ga0466964_0865599 3300044706 Bacteria 515
656 Ga0466971_0365992 3300044719 Bacteria 699
657 Ga0466968_0190868 3300044735 Bacteria 956
658 Ga0466957_0078451 3300044842 Bacteria 2053
659 Ga0466957_0502174 3300044842 Bacteria 841
660 Ga0466957_0563316 3300044842 Bacteria 795
661 Ga0466960_0955541 3300044901 Bacteria 525
662 Ga0466959_0206183 3300045049 Bacteria 1367
663 Ga0466959_0221023 3300045049 Bacteria 1314
664 Ga0466959_0225580 3300045049 Bacteria 1298
665 Ga0466959_0326687 3300045049 Unclassified 1048
666 Ga0466959_0468170 3300045049 Bacteria 853
667 Ga0466959_0608425 3300045049 Bacteria 735
668 Ga0466958_0051092 3300045836 Bacteria 2502
669 Ga0466958_0056145 3300045836 Bacteria 2391
670 Ga0466958_0089729 3300045836 Bacteria 1901
671 Ga0466958_0107968 3300045836 Bacteria 1736
672 Ga0466958_0356153 3300045836 Bacteria 942
673 Ga0466958_0439066 3300045836 Bacteria 845
674 Ga0466967_0084813 3300045976 Bacteria 2867
675 Ga0466967_0122463 3300045976 Bacteria 2405
676 Ga0466967_0213024 3300045976 Bacteria 1833
677 Ga0466967_0323636 3300045976 Bacteria 1487
678 Ga0466967_0334946 3300045976 Bacteria 1462
679 Ga0466967_0514059 3300045976 Bacteria 1176
680 Ga0466967_0829283 3300045976 Bacteria 919
681 Ga0466967_1089567 3300045976 Bacteria 796
682 Ga0466967_1205240 3300045976 Bacteria 754
683 Ga0466967_1310825 3300045976 Bacteria 721
684 Ga0466967_1340099 3300045976 Bacteria 713
685 Ga0466967_1520605 3300045976 Bacteria 667
686 Ga0466967_1554229 3300045976 Bacteria 659
687 Ga0466967_2302087 3300045976 Bacteria 534
688 Ga0495627_131768 3300046453 Bacteria 703
689 Ga0495592_0009914 3300046454 Bacteria 7172
690 Ga0495592_0172570 3300046454 Bacteria 1479
691 Ga0495592_0954479 3300046454 Unclassified 501
692 Ga0495603_0206203 3300046455 Bacteria 1136
693 Ga0495603_0271293 3300046455 Bacteria 976
694 Ga0495603_0478875 3300046455 Bacteria 713
695 Ga0495590_0352160 3300046457 Bacteria 560
696 Ga0495629_0001331 3300046459 Bacteria 19420
697 Ga0495629_0009051 3300046459 Bacteria 7299
698 Ga0495629_0038892 3300046459 Bacteria 3349
699 Ga0495629_0042675 3300046459 Bacteria 3186
700 Ga0495629_0097082 3300046459 Bacteria 2056
701 Ga0495629_0270503 3300046459 Bacteria 1167
702 Ga0495638_0352076 3300046460 Bacteria 777
703 Ga0495641_0071444 3300046461 Bacteria 1558
704 Ga0495641_0394246 3300046461 Bacteria 628
705 Ga0495641_0538051 3300046461 Bacteria 533
706 Ga0495651_0006259 3300046462 Bacteria 9102
707 Ga0495651_0135474 3300046462 Bacteria 1792
708 Ga0495651_0173225 3300046462 Bacteria 1535
709 Ga0495651_0738850 3300046462 Bacteria 611
710 Ga0495653_0032490 3300046463 Bacteria 4142
711 Ga0495653_0154953 3300046463 Bacteria 1597
712 Ga0495653_0458079 3300046463 Bacteria 801
713 Ga0495653_0857280 3300046463 Bacteria 543
714 Ga0495653_0965063 3300046463 Bacteria 505
715 Ga0495580_0203714 3300046472 Bacteria 1363
716 Ga0495580_0610517 3300046472 Bacteria 720
717 Ga0495582_0148178 3300046473 Bacteria 1332
718 Ga0495582_0503360 3300046473 Bacteria 700
719 Ga0495605_0192695 3300046474 Bacteria 891
720 Ga0495605_0309572 3300046474 Bacteria 667
721 Ga0495639_0229286 3300046475 Bacteria 915
722 Ga0495662_0113304 3300046476 Bacteria 1330
723 Ga0495584_0205130 3300046491 Bacteria 1002
724 Ga0495584_0235722 3300046491 Bacteria 930
725 Ga0495594_0883079 3300046499 Bacteria 503
726 Ga0495596_0048864 3300046500 Bacteria 1659
727 Ga0495596_0157157 3300046500 Bacteria 883
728 Ga0495607_0258937 3300046501 Bacteria 834
729 Ga0495607_0492413 3300046501 Bacteria 545
730 Ga0495608_0002443 3300046511 Bacteria 13351
731 Ga0495608_0018553 3300046511 Bacteria 4796
732 Ga0495608_0207189 3300046511 Bacteria 1234
733 Ga0495616_0068551 3300046513 Bacteria 1722
734 Ga0495618_0010592 3300046514 Bacteria 5579
735 Ga0495618_0489905 3300046514 Unclassified 742
736 Ga0495618_0566008 3300046514 Bacteria 679
737 Ga0495628_0028908 3300046516 Bacteria 4499
738 Ga0495628_0103164 3300046516 Bacteria 2199
739 Ga0495628_0290645 3300046516 Bacteria 1212
740 Ga0495628_0542566 3300046516 Bacteria 836
741 Ga0495628_0597128 3300046516 Bacteria 789
742 Ga0495630_0017787 3300046517 Bacteria 5212
743 Ga0495630_0077462 3300046517 Bacteria 2507
744 Ga0495630_0117572 3300046517 Bacteria 2016
745 Ga0495630_0240360 3300046517 Bacteria 1384
746 Ga0495630_0366001 3300046517 Bacteria 1104
747 Ga0495630_0872066 3300046517 Bacteria 686
748 Ga0495630_1023257 3300046517 Bacteria 627
749 Ga0495631_0242917 3300046518 Bacteria 768
750 Ga0495643_0195022 3300046522 Bacteria 976
751 Ga0495644_0205406 3300046523 Bacteria 760
752 Ga0495663_0086851 3300046525 Bacteria 1014
753 Ga0495666_0514434 3300046526 Bacteria 535
754 Ga0495642_0367815 3300046528 Bacteria 633
755 Ga0495652_0089134 3300046529 Bacteria 2526
756 Ga0495652_0110230 3300046529 Bacteria 2214
757 Ga0495652_0370401 3300046529 Bacteria 1021
758 Ga0495665_0477825 3300046531 Bacteria 629
759 Ga0495640_0014053 3300046533 Bacteria 6072
760 Ga0495640_0191253 3300046533 Bacteria 1301
761 Ga0495640_0902010 3300046533 Unclassified 524
762 Ga0495586_0006171 3300046535 Bacteria 6407
763 Ga0495586_0057979 3300046535 Bacteria 2102
764 Ga0495586_0145228 3300046535 Bacteria 1333
765 Ga0495586_0436151 3300046535 Bacteria 755
766 Ga0495587_0031382 3300046536 Bacteria 3217
767 Ga0495587_0137673 3300046536 Bacteria 1394
768 Ga0495587_0492652 3300046536 Bacteria 678
769 Ga0495609_0275415 3300046538 Bacteria 689
770 Ga0495621_0413179 3300046539 Bacteria 574
771 Ga0495621_0484841 3300046539 Bacteria 532
772 Ga0495597_0365910 3300046542 Bacteria 552
773 Ga0495645_0148375 3300046543 Bacteria 1631
774 Ga0495645_0202215 3300046543 Bacteria 1346
775 Ga0495645_0535191 3300046543 Bacteria 728
776 Ga0495622_0000618 3300046557 Bacteria 20626
777 Ga0495667_0013676 3300046559 Bacteria 5484
778 Ga0495667_0678069 3300046559 Bacteria 639
779 Ga0495667_0698128 3300046559 Unclassified 629
780 Ga0495656_0276167 3300046615 Bacteria 855
781 Ga0495656_0542211 3300046615 Bacteria 619
782 Ga0495668_0767732 3300046616 Bacteria 534
783 Ga0495634_0025585 3300046642 Bacteria 4126
784 Ga0495634_0206720 3300046642 Unclassified 1217
785 Ga0495634_0218712 3300046642 Bacteria 1177
786 Ga0495635_0052206 3300046663 Bacteria 2816
787 Ga0495635_0064066 3300046663 Bacteria 2524
788 Ga0495659_0451222 3300046664 Bacteria 560
789 Ga0495661_0574088 3300046665 Bacteria 532
790 Ga0495657_0017591 3300046675 Bacteria 5185
791 Ga0495657_0034335 3300046675 Bacteria 3523
792 Ga0495657_0173474 3300046675 Unclassified 1327
793 Ga0495599_0048531 3300046678 Bacteria 2661
794 Ga0495623_0165216 3300046679 Bacteria 1297
795 Ga0495646_0084378 3300046680 Bacteria 1844
796 Ga0495646_0202527 3300046680 Bacteria 1080
797 Ga0495647_0192574 3300046681 Bacteria 891
798 Ga0495647_0242949 3300046681 Bacteria 800
799 Ga0495647_0567081 3300046681 Unclassified 532
800 Ga0495658_0063434 3300046683 Bacteria 2126
801 Ga0495658_0106840 3300046683 Bacteria 1678
802 Ga0495613_0099039 3300046689 Bacteria 2106
803 Ga0495613_0261950 3300046689 Bacteria 1204
804 Ga0495613_0384789 3300046689 Bacteria 959
805 Ga0495613_0539701 3300046689 Bacteria 781
806 Ga0495613_0648388 3300046689 Bacteria 699
807 Ga0495624_0138274 3300046690 Bacteria 1493
808 Ga0495624_0186663 3300046690 Unclassified 1262
809 Ga0495670_0622905 3300046691 Bacteria 588
810 Ga0495671_0151509 3300046692 Bacteria 1129
811 Ga0495589_0229233 3300046794 Bacteria 871
812 Ga0495589_0458134 3300046794 Bacteria 583
813 Ga0495589_0581263 3300046794 Bacteria 510
814 Ga0495600_0019723 3300046809 Bacteria 4309
815 Ga0495600_0317205 3300046809 Bacteria 981
816 Ga0495600_0686512 3300046809 Bacteria 617
817 Ga0495660_0181988 3300046810 Unclassified 1016
818 Ga0495581_0676510 3300047315 Bacteria 596
819 Ga0495604_0007191 3300047317 Bacteria 8818
820 Ga0495674_0046218 3300047319 Bacteria 3864
821 Ga0495674_0299567 3300047319 Bacteria 1314
822 Ga0495674_0304214 3300047319 Bacteria 1302
823 Ga0495674_0307077 3300047319 Bacteria 1295
824 Ga0495674_0483629 3300047319 Bacteria 992
825 Ga0495676_0208839 3300047321 Bacteria 1352
826 Ga0495676_0347648 3300047321 Bacteria 992
827 Ga0495676_0498672 3300047321 Bacteria 799
828 Ga0495680_0040313 3300047322 Bacteria 3721
829 Ga0495680_0100314 3300047322 Bacteria 2157
830 Ga0495680_0113827 3300047322 Bacteria 2002
831 Ga0495680_0189934 3300047322 Bacteria 1478
832 Ga0495680_0604795 3300047322 Bacteria 733
833 Ga0495683_0237355 3300047323 Bacteria 806
834 Ga0495675_0092107 3300047444 Bacteria 1902
835 Ga0495675_0245406 3300047444 Bacteria 1077
836 Ga0495677_0277924 3300047445 Bacteria 657
837 Ga0495685_301535 3300047447 Bacteria 503
838 Ga0495684_0018945 3300047471 Bacteria 5299
839 Ga0495686_0154850 3300047472 Bacteria 1343
840 Ga0495686_0184938 3300047472 Bacteria 1205
841 Ga0495593_0059544 3300047673 Bacteria 2001
842 Ga0495593_0078628 3300047673 Bacteria 1708
843 Ga0495593_0397648 3300047673 Bacteria 689
844 Ga0495602_0013661 3300048088 Bacteria 8285
845 Ga0495614_0262917 3300048089 Bacteria 791
846 Ga0495615_0251658 3300048090 Bacteria 560
847 Ga0496100_0102913 3300048903 Bacteria 1971
848 Ga0496100_0484371 3300048903 Bacteria 952
849 Ga0496100_0821023 3300048903 Bacteria 729
850 Ga0496101_0007125 3300048904 Bacteria 7233
851 Ga0496101_0290688 3300048904 Bacteria 1279
852 Ga0496101_0628628 3300048904 Bacteria 849
853 Ga0496101_0631588 3300048904 Bacteria 846
854 Ga0496102_0001083 3300048905 Bacteria 25208
855 Ga0496102_0244270 3300048905 Bacteria 1693
856 Ga0496102_0305088 3300048905 Bacteria 1500
857 Ga0496102_0425033 3300048905 Bacteria 1248
858 Ga0496102_0616362 3300048905 Bacteria 1008
859 Ga0496102_1077364 3300048905 Bacteria 724
860 Ga0496102_1099577 3300048905 Bacteria 715
861 Ga0496102_1736499 3300048905 Bacteria 542
862 Ga0496103_0000031 3300048906 Bacteria 204016
863 Ga0496103_0474501 3300048906 Bacteria 801
864 Ga0496103_0905823 3300048906 Bacteria 552
865 Ga0496104_0000009 3300048907 Bacteria 488055
866 Ga0496104_0131282 3300048907 Bacteria 2406
867 Ga0496104_0172586 3300048907 Bacteria 2073
868 Ga0496104_0213847 3300048907 Bacteria 1839
869 Ga0496104_0479397 3300048907 Bacteria 1155
870 Ga0496104_0624982 3300048907 Bacteria 987
871 Ga0496104_0673842 3300048907 Bacteria 942
872 Ga0496104_1037721 3300048907 Bacteria 724
873 Ga0496105_0000007 3300048908 Bacteria 339658
874 Ga0496105_0000401 3300048908 Bacteria 28464
875 Ga0496105_0047865 3300048908 Bacteria 3528
876 Ga0496105_0057371 3300048908 Bacteria 3215
877 Ga0496105_0120866 3300048908 Bacteria 2160
878 Ga0496105_0121766 3300048908 Bacteria 2151
879 Ga0496105_0140355 3300048908 Bacteria 1989
880 Ga0496105_0752326 3300048908 Bacteria 744
881 Ga0496105_0954516 3300048908 Bacteria 644
882 Ga0496105_1267082 3300048908 Bacteria 540
883 Ga0496106_0320286 3300048909 Bacteria 1244
884 Ga0496106_0404394 3300048909 Bacteria 1097
885 Ga0496106_0838125 3300048909 Bacteria 728
886 Ga0496107_0640619 3300048910 Bacteria 784
887 Ga0496107_1187512 3300048910 Unclassified 549
888 Ga0496108_0000026 3300048911 Bacteria 172399
889 Ga0496108_0001551 3300048911 Bacteria 18179
890 Ga0496108_0008908 3300048911 Bacteria 8132
891 Ga0496108_0130646 3300048911 Bacteria 2159
892 Ga0496108_0146695 3300048911 Bacteria 2035
893 Ga0496108_0234017 3300048911 Bacteria 1598
894 Ga0496108_0254951 3300048911 Bacteria 1526
895 Ga0496108_0258925 3300048911 Bacteria 1514
896 Ga0496108_0674445 3300048911 Bacteria 897
897 Ga0496108_0696625 3300048911 Bacteria 881
898 Ga0496108_0745430 3300048911 Bacteria 847
899 Ga0496108_0790348 3300048911 Bacteria 819
900 Ga0496108_0981392 3300048911 Bacteria 722
901 Ga0496108_1154651 3300048911 Bacteria 656
902 Ga0496109_0000012 3300048912 Bacteria 229699
903 Ga0496109_0004905 3300048912 Bacteria 11170
904 Ga0496109_0078503 3300048912 Bacteria 3040
905 Ga0496109_0296733 3300048912 Bacteria 1524
906 Ga0496109_0435083 3300048912 Bacteria 1239
907 Ga0496109_0557157 3300048912 Bacteria 1081
908 Ga0496109_1034826 3300048912 Bacteria 758
909 Ga0496109_1486429 3300048912 Bacteria 612
910 Ga0496109_1611694 3300048912 Bacteria 583
911 Ga0496110_0011382 3300048913 Bacteria 7279
912 Ga0496110_0049641 3300048913 Bacteria 3682
913 Ga0496110_0058708 3300048913 Bacteria 3389
914 Ga0496110_0174428 3300048913 Bacteria 1951
915 Ga0496110_0811040 3300048913 Bacteria 840
916 Ga0496110_0869038 3300048913 Bacteria 807
917 Ga0496110_1221608 3300048913 Bacteria 661
918 Ga0496110_1225241 3300048913 Unclassified 659
919 Ga0496111_0001050 3300048914 Bacteria 15205
920 Ga0496111_0142391 3300048914 Bacteria 1777
921 Ga0496111_0170928 3300048914 Bacteria 1615
922 Ga0496111_0629296 3300048914 Bacteria 784
923 Ga0496111_0785501 3300048914 Bacteria 690
924 Ga0496112_0011438 3300048915 Bacteria 8104
925 Ga0496112_0014164 3300048915 Bacteria 7389
926 Ga0496112_0179080 3300048915 Bacteria 2084
927 Ga0496112_0366422 3300048915 Bacteria 1382
928 Ga0496112_0744460 3300048915 Bacteria 907
929 Ga0496112_1210192 3300048915 Bacteria 672
930 Ga0496112_1248410 3300048915 Bacteria 659
931 Ga0496112_1830085 3300048915 Bacteria 519
932 Ga0496113_0041886 3300048916 Bacteria 3382
933 Ga0496113_0095118 3300048916 Bacteria 2302
934 Ga0496113_0126370 3300048916 Bacteria 2003
935 Ga0496113_0168365 3300048916 Bacteria 1735
936 Ga0496113_0391588 3300048916 Bacteria 1115
937 Ga0496113_0851786 3300048916 Bacteria 722
938 Ga0496113_1394292 3300048916 Bacteria 543
939 Ga0496114_0035168 3300048917 Bacteria 4136
940 Ga0496114_0125652 3300048917 Bacteria 2211
941 Ga0496114_0283639 3300048917 Bacteria 1460
942 Ga0496114_0784809 3300048917 Bacteria 831
943 Ga0496114_1020619 3300048917 Bacteria 711
944 Ga0496115_0010148 3300048918 Bacteria 7027
945 Ga0496115_0140402 3300048918 Bacteria 1993
946 Ga0496116_0000360 3300048919 Bacteria 70849
947 Ga0496118_0184896 3300048921 Bacteria 1254
948 Ga0496118_0208221 3300048921 Bacteria 1150
949 Ga0496119_0003375 3300048922 Bacteria 16614
950 Ga0496119_0019417 3300048922 Bacteria 5007
951 Ga0496119_0110770 3300048922 Bacteria 1524
952 Ga0496120_0008036 3300048923 Bacteria 7760
953 Ga0496120_0140610 3300048923 Bacteria 1226
954 Ga0496121_0003947 3300048924 Bacteria 20501
955 Ga0496121_0036929 3300048924 Bacteria 4346
956 Ga0496121_0073431 3300048924 Bacteria 2741
957 Ga0496121_0258296 3300048924 Bacteria 1204
958 Ga0496121_0592756 3300048924 Bacteria 685
959 Ga0496124_0318342 3300048927 Bacteria 1115
960 Ga0496124_0843861 3300048927 Bacteria 562
961 Ga0496125_0140842 3300048928 Bacteria 1677
962 Ga0495678_091463 3300049459 Bacteria 1071
963 Ga0501291_079710 3300049514 Bacteria 650
964 Ga0501296_068715 3300049519 Bacteria 546
965 Ga0501299_148816 3300049522 Bacteria 589
966 Ga0501311_105996 3300049527 Bacteria 502
967 Ga0501318_055619 3300049534 Bacteria 597
968 Ga0501031_0000518 3300049568 Bacteria 22531
969 Ga0501031_0036646 3300049568 Bacteria 3199
970 Ga0501031_0168873 3300049568 Bacteria 1429
971 Ga0501031_0172799 3300049568 Bacteria 1412
972 Ga0501031_0813652 3300049568 Bacteria 599
973 Ga0501031_0991037 3300049568 Bacteria 537
974 Ga0501032_0005293 3300049569 Bacteria 9596
975 Ga0501032_0077286 3300049569 Bacteria 2216
976 Ga0501032_0840122 3300049569 Bacteria 579
977 Ga0501033_0002948 3300049570 Bacteria 14221
978 Ga0501033_0031433 3300049570 Bacteria 3989
979 Ga0501033_0272238 3300049570 Bacteria 1197
980 Ga0501033_0277794 3300049570 Bacteria 1183
981 Ga0501033_0699581 3300049570 Bacteria 690
982 Ga0501033_1039326 3300049570 Bacteria 546
983 Ga0501034_0033847 3300049571 Bacteria 5180
984 Ga0501034_0358911 3300049571 Bacteria 1385
985 Ga0501036_0000227 3300049572 Bacteria 37896
986 Ga0501036_0003861 3300049572 Bacteria 12026
987 Ga0501036_0037260 3300049572 Bacteria 4114
988 Ga0501036_0155948 3300049572 Bacteria 1926
989 Ga0501036_0239472 3300049572 Bacteria 1522
990 Ga0501036_0812535 3300049572 Bacteria 770
991 Ga0501036_1067536 3300049572 Bacteria 660
992 Ga0501036_1263097 3300049572 Bacteria 601
993 Ga0501036_1689421 3300049572 Bacteria 510
994 Ga0501037_0031355 3300049573 Bacteria 3924
995 Ga0501037_0244342 3300049573 Bacteria 1257
996 Ga0501037_0402665 3300049573 Bacteria 938
997 Ga0501037_0862856 3300049573 Bacteria 595
998 Ga0501038_0002331 3300049574 Bacteria 17683
999 Ga0501038_0023699 3300049574 Bacteria 5485
1000 Ga0501038_0054198 3300049574 Bacteria 3449
1001 Ga0501038_0464016 3300049574 Bacteria 972
1002 Ga0501038_0740346 3300049574 Bacteria 734
1003 Ga0501038_1056520 3300049574 Unclassified 594
1004 Ga0501038_1159161 3300049574 Bacteria 562
1005 Ga0501038_1187185 3300049574 Bacteria 554
1006 Ga0501039_0000817 3300049575 Bacteria 22459
1007 Ga0501039_0024988 3300049575 Bacteria 4588
1008 Ga0501039_0039399 3300049575 Bacteria 3649
1009 Ga0501039_0080713 3300049575 Bacteria 2531
1010 Ga0501039_0125165 3300049575 Bacteria 2016
1011 Ga0501039_0150816 3300049575 Bacteria 1826
1012 Ga0501039_0432122 3300049575 Bacteria 1034
1013 Ga0501039_0995014 3300049575 Bacteria 652
1014 Ga0501039_1319638 3300049575 Bacteria 556
1015 Ga0501040_0026259 3300049576 Bacteria 3916
1016 Ga0501040_0051067 3300049576 Bacteria 2829
1017 Ga0501040_0129819 3300049576 Bacteria 1771
1018 Ga0501040_0243793 3300049576 Bacteria 1281
1019 Ga0501040_0245241 3300049576 Bacteria 1277
1020 Ga0501040_0363283 3300049576 Bacteria 1038
1021 Ga0501040_0407802 3300049576 Bacteria 976
1022 Ga0501040_0491104 3300049576 Bacteria 885
1023 Ga0501040_0568775 3300049576 Bacteria 818
1024 Ga0501041_0000836 3300049577 Bacteria 16532
1025 Ga0501041_0018099 3300049577 Bacteria 4196
1026 Ga0501041_0023356 3300049577 Bacteria 3708
1027 Ga0501041_0024566 3300049577 Bacteria 3618
1028 Ga0501041_0080386 3300049577 Bacteria 2007
1029 Ga0501041_0148607 3300049577 Bacteria 1462
1030 Ga0501041_0358718 3300049577 Bacteria 922
1031 Ga0501041_0360609 3300049577 Bacteria 919
1032 Ga0501042_0000314 3300049578 Bacteria 24226
1033 Ga0501042_0022170 3300049578 Bacteria 4435
1034 Ga0501042_0085843 3300049578 Bacteria 2257
1035 Ga0501042_0153946 3300049578 Bacteria 1658
1036 Ga0501042_0214517 3300049578 Bacteria 1388
1037 Ga0501042_0276895 3300049578 Bacteria 1211
1038 Ga0501042_0411699 3300049578 Bacteria 980
1039 Ga0501042_0532834 3300049578 Bacteria 853
1040 Ga0501042_0657545 3300049578 Bacteria 762
1041 Ga0501042_0899245 3300049578 Bacteria 645
1042 Ga0501042_1267122 3300049578 Bacteria 538
1043 Ga0501043_0001251 3300049579 Bacteria 22398
1044 Ga0501043_0619961 3300049579 Bacteria 797
1045 Ga0501043_0683112 3300049579 Bacteria 751
1046 Ga0501043_0820577 3300049579 Bacteria 671
1047 Ga0501043_1038934 3300049579 Bacteria 581
1048 Ga0501043_1091158 3300049579 Bacteria 564
1049 Ga0501046_0000158 3300049580 Bacteria 70218
1050 Ga0501046_0047802 3300049580 Bacteria 3391
1051 Ga0501046_0196490 3300049580 Bacteria 1502
1052 Ga0501046_0208714 3300049580 Bacteria 1451
1053 Ga0501046_0250560 3300049580 Bacteria 1303
1054 Ga0501046_0352181 3300049580 Bacteria 1069
1055 Ga0501046_0527553 3300049580 Bacteria 843
1056 Ga0501046_0958905 3300049580 Bacteria 595
1057 Ga0501047_0004798 3300049581 Bacteria 12724
1058 Ga0501047_0013835 3300049581 Bacteria 7660
1059 Ga0501047_0045884 3300049581 Bacteria 4224
1060 Ga0501047_0266058 3300049581 Bacteria 1561
1061 Ga0501047_0491553 3300049581 Bacteria 1054
1062 Ga0501048_0002270 3300049582 Bacteria 14668
1063 Ga0501048_0016574 3300049582 Bacteria 5433
1064 Ga0501048_0026492 3300049582 Bacteria 4221
1065 Ga0501048_0060046 3300049582 Bacteria 2694
1066 Ga0501048_0061923 3300049582 Bacteria 2649
1067 Ga0501048_0078909 3300049582 Bacteria 2323
1068 Ga0501048_0196142 3300049582 Bacteria 1431
1069 Ga0501048_0225396 3300049582 Bacteria 1330
1070 Ga0501048_0685944 3300049582 Archaea 735
1071 Ga0501067_0037989 3300049583 Bacteria 2674
1072 Ga0501067_0225543 3300049583 Bacteria 1043
1073 Ga0501067_0570789 3300049583 Bacteria 634
1074 Ga0501068_0000071 3300049584 Bacteria 40485
1075 Ga0501068_0024532 3300049584 Bacteria 3542
1076 Ga0501068_0149301 3300049584 Bacteria 1468
1077 Ga0501068_0320791 3300049584 Bacteria 993
1078 Ga0501068_0355666 3300049584 Bacteria 942
1079 Ga0501068_0408591 3300049584 Bacteria 876
1080 Ga0501068_0697808 3300049584 Bacteria 664
1081 Ga0501068_0921233 3300049584 Bacteria 575
1082 Ga0501068_1050190 3300049584 Bacteria 538
1083 Ga0501069_0041260 3300049585 Bacteria 2550
1084 Ga0501069_0090250 3300049585 Bacteria 1732
1085 Ga0501069_0557678 3300049585 Bacteria 686
1086 Ga0501070_0003160 3300049586 Bacteria 14326
1087 Ga0501070_0028261 3300049586 Bacteria 4702
1088 Ga0501070_0042224 3300049586 Bacteria 3798
1089 Ga0501070_0095031 3300049586 Bacteria 2466
1090 Ga0501070_0168238 3300049586 Bacteria 1806
1091 Ga0501070_0212313 3300049586 Bacteria 1588
1092 Ga0501070_0561717 3300049586 Bacteria 913
1093 Ga0501071_0000705 3300049587 Bacteria 17524
1094 Ga0501071_0051603 3300049587 Bacteria 2964
1095 Ga0501071_0180626 3300049587 Bacteria 1581
1096 Ga0501071_0291320 3300049587 Bacteria 1236
1097 Ga0501071_0421814 3300049587 Bacteria 1020
1098 Ga0501071_0698152 3300049587 Bacteria 781
1099 Ga0501071_0976560 3300049587 Bacteria 654
1100 Ga0501071_0985252 3300049587 Bacteria 651
1101 Ga0501071_1031514 3300049587 Bacteria 635
1102 Ga0501071_1053749 3300049587 Bacteria 628
1103 Ga0501071_1132190 3300049587 Bacteria 605
1104 Ga0501072_0034360 3300049588 Bacteria 3973
1105 Ga0501072_0041682 3300049588 Bacteria 3607
1106 Ga0501072_0047943 3300049588 Bacteria 3364
1107 Ga0501072_0083174 3300049588 Bacteria 2537
1108 Ga0501072_0100613 3300049588 Bacteria 2298
1109 Ga0501072_0222262 3300049588 Bacteria 1505
1110 Ga0501072_0256918 3300049588 Bacteria 1391
1111 Ga0501072_0500303 3300049588 Bacteria 961
1112 Ga0501072_0844853 3300049588 Bacteria 716
1113 Ga0501072_1106661 3300049588 Bacteria 616
1114 Ga0501072_1317677 3300049588 Bacteria 559
1115 Ga0501073_0021965 3300049589 Bacteria 4597
1116 Ga0501073_0287458 3300049589 Bacteria 1134
1117 Ga0501074_0000343 3300049590 Bacteria 27140
1118 Ga0501074_0080020 3300049590 Bacteria 2345
1119 Ga0501074_0101814 3300049590 Bacteria 2056
1120 Ga0501074_0164810 3300049590 Bacteria 1582
1121 Ga0501074_0235296 3300049590 Bacteria 1303
1122 Ga0501074_0959757 3300049590 Bacteria 601
1123 Ga0501074_1057272 3300049590 Bacteria 570
1124 Ga0501075_0023003 3300049591 Bacteria 4558
1125 Ga0501075_0143366 3300049591 Bacteria 1821
1126 Ga0501075_0242049 3300049591 Bacteria 1375
1127 Ga0501075_0242112 3300049591 Bacteria 1375
1128 Ga0501075_0304916 3300049591 Bacteria 1213
1129 Ga0501075_0424638 3300049591 Bacteria 1013
1130 Ga0501075_0873288 3300049591 Bacteria 684
1131 Ga0501075_1521141 3300049591 Bacteria 506
1132 Ga0501076_0023264 3300049592 Bacteria 4774
1133 Ga0501076_0025133 3300049592 Bacteria 4607
1134 Ga0501076_0263560 3300049592 Bacteria 1411
1135 Ga0501076_0285723 3300049592 Bacteria 1351
1136 Ga0501076_0305889 3300049592 Bacteria 1303
1137 Ga0501076_0620478 3300049592 Bacteria 892
1138 Ga0501076_0794592 3300049592 Bacteria 781
1139 Ga0501076_0868656 3300049592 Bacteria 744
1140 Ga0501076_1252170 3300049592 Unclassified 610
1141 Ga0501077_0003562 3300049593 Bacteria 9358
1142 Ga0501077_0009374 3300049593 Bacteria 6081
1143 Ga0501077_0021261 3300049593 Bacteria 4106
1144 Ga0501077_0154197 3300049593 Bacteria 1458
1145 Ga0501077_0388296 3300049593 Bacteria 892
1146 Ga0501077_0741995 3300049593 Bacteria 631
1147 Ga0501077_1139119 3300049593 Bacteria 502
1148 Ga0501208_100171 3300049655 Bacteria 620
1149 Ga0501214_028591 3300049659 Bacteria 753
1150 Ga0501227_136317 3300049665 Bacteria 671
1151 Ga0501233_278268 3300049668 Bacteria 511
1152 Ga0501243_140184 3300049675 Unclassified 510
1153 Ga0501261_128874 3300049690 Bacteria 508
1154 Ga0501079_0006091 3300049741 Bacteria 9040
1155 Ga0501079_0033127 3300049741 Bacteria 3973
1156 Ga0501079_0057049 3300049741 Bacteria 3013
1157 Ga0501079_0057535 3300049741 Bacteria 3000
1158 Ga0501079_0074477 3300049741 Bacteria 2624
1159 Ga0501079_0102218 3300049741 Bacteria 2223
1160 Ga0501079_0123145 3300049741 Bacteria 2017
1161 Ga0501079_0213081 3300049741 Bacteria 1509
1162 Ga0501079_0311365 3300049741 Bacteria 1232
1163 Ga0501079_0921663 3300049741 Bacteria 688
1164 Ga0501080_0007150 3300049742 Bacteria 10074
1165 Ga0501080_0387969 3300049742 Bacteria 1257
1166 Ga0501080_0435817 3300049742 Bacteria 1176
1167 Ga0501080_0686385 3300049742 Bacteria 904
1168 Ga0501080_1152724 3300049742 Bacteria 668
1169 Ga0501080_1529446 3300049742 Bacteria 566
1170 Ga0501081_0001597 3300049743 Bacteria 13984
1171 Ga0501081_0018220 3300049743 Bacteria 4661
1172 Ga0501081_0235445 3300049743 Bacteria 1334
1173 Ga0501081_0372786 3300049743 Bacteria 1054
1174 Ga0501081_0482849 3300049743 Bacteria 922
1175 Ga0501081_0688173 3300049743 Bacteria 767
1176 Ga0501081_0712738 3300049743 Bacteria 753
1177 Ga0501081_0981403 3300049743 Bacteria 638
1178 Ga0501083_0000141 3300049744 Bacteria 49193
1179 Ga0501083_0472707 3300049744 Bacteria 816
1180 Ga0501083_0785264 3300049744 Bacteria 620
1181 Ga0501266_034847 3300049763 Bacteria 730
1182 Ga0501268_173605 3300049765 Bacteria 510
1183 Ga0501035_0000856 3300049822 Bacteria 32437
1184 Ga0501035_0070715 3300049822 Bacteria 3090
1185 Ga0501035_1284377 3300049822 Bacteria 565
1186 Ga0501044_0005849 3300049823 Bacteria 13622
1187 Ga0501044_0286045 3300049823 Bacteria 1581
1188 Ga0501044_0614279 3300049823 Bacteria 979
1189 Ga0501044_0705799 3300049823 Bacteria 894
1190 Ga0501044_1082381 3300049823 Bacteria 671
1191 Ga0501044_1647580 3300049823 Bacteria 506
1192 Ga0501044_1659627 3300049823 Bacteria 504
1193 Ga0501045_0002026 3300049824 Bacteria 13700
1194 Ga0501045_0025350 3300049824 Bacteria 4262
1195 Ga0501045_0043941 3300049824 Bacteria 3254
1196 Ga0501045_0059132 3300049824 Bacteria 2807
1197 Ga0501045_0345611 3300049824 Bacteria 1107
1198 Ga0501045_0571790 3300049824 Bacteria 838
1199 Ga0501045_0756404 3300049824 Bacteria 716
1200 Ga0501045_0882159 3300049824 Bacteria 657
1201 Ga0501212_046437 3300049851 Bacteria 728
1202 nmdc:mga03n38_449329_c1 3300050490 Bacteria 717
1203 nmdc:mga03n38_793286_c1 3300050490 Bacteria 551
1204 nmdc:mga03n38_86593_c1 3300050490 Bacteria 1483
1205 nmdc:mga00v17_155506_c1 3300050491 Bacteria 1470
1206 nmdc:mga00v17_309015_c1 3300050491 Bacteria 1027
1207 nmdc:mga00v17_661337_c1 3300050491 Bacteria 671
1208 nmdc:mga0yw44_1002328_c1 3300050492 Bacteria 565
1209 nmdc:mga0yw44_1199744_c1 3300050492 Bacteria 512
1210 nmdc:mga0yw44_251594_c1 3300050492 Bacteria 1176
1211 nmdc:mga0yw44_259902_c1 3300050492 Bacteria 1157
1212 nmdc:mga0yw44_266377_c1 3300050492 Bacteria 1143
1213 nmdc:mga0yw44_396704_c1 3300050492 Bacteria 932
1214 nmdc:mga0yw44_580315_c1 3300050492 Bacteria 761
1215 nmdc:mga06z11_177386_c1 3300050494 Bacteria 1227
1216 nmdc:mga06z11_448720_c1 3300050494 Bacteria 779
1217 nmdc:mga06z11_776114_c1 3300050494 Bacteria 584
1218 nmdc:mga06z11_930471_c1 3300050494 Bacteria 530
1219 nmdc:mga05p37_1169559_c1 3300050507 Bacteria 798
1220 nmdc:mga05p37_151862_c1 3300050507 Bacteria 2832
1221 nmdc:mga05p37_19978_c1 3300050507 Bacteria 8105
1222 nmdc:mga05p37_379328_c1 3300050507 Bacteria 1657
1223 nmdc:mga05p37_387230_c1 3300050507 Bacteria 1636
1224 nmdc:mga05p37_782329_c1 3300050507 Bacteria 1047
1225 nmdc:mga05p37_903395_c1 3300050507 Bacteria 952
1226 nmdc:mga09592_1531842_c1 3300050508 Bacteria 542
1227 nmdc:mga09592_545257_c1 3300050508 Bacteria 996
1228 nmdc:mga09592_602038_c1 3300050508 Bacteria 941
1229 nmdc:mga09592_717760_c1 3300050508 Bacteria 850
1230 nmdc:mga09592_793983_c1 3300050508 Bacteria 801
1231 nmdc:mga09592_795797_c1 3300050508 Bacteria 800
1232 nmdc:mga09592_8067_c1 3300050508 Bacteria 8566
1233 nmdc:mga0qj67_1032502_c1 3300050509 Unclassified 644
1234 nmdc:mga0qj67_1084712_c1 3300050509 Bacteria 626
1235 nmdc:mga0qj67_1446744_c1 3300050509 Bacteria 529
1236 nmdc:mga0qj67_190095_c1 3300050509 Bacteria 1669
1237 nmdc:mga0qj67_215457_c1 3300050509 Bacteria 1559
1238 nmdc:mga0qj67_315227_c1 3300050509 Bacteria 1266
1239 nmdc:mga0qj67_357506_c1 3300050509 Bacteria 1180
1240 nmdc:mga0qj67_48093_c1 3300050509 Bacteria 3369
1241 nmdc:mga0qj67_900372_c1 3300050509 Bacteria 697
1242 nmdc:mga06r32_1793642_c1 3300050510 Bacteria 549
1243 nmdc:mga06r32_27650_c1 3300050510 Bacteria 5302
1244 nmdc:mga06r32_337834_c1 3300050510 Bacteria 1491
1245 nmdc:mga06r32_527204_c1 3300050510 Bacteria 1156
1246 nmdc:mga06r32_56393_c1 3300050510 Bacteria 3772
1247 nmdc:mga06r32_658143_c1 3300050510 Bacteria 1015
1248 nmdc:mga06r32_930487_c1 3300050510 Bacteria 824
1249 nmdc:mga08y16_1113610_c1 3300050511 Bacteria 764
1250 nmdc:mga08y16_1404907_c1 3300050511 Bacteria 661
1251 nmdc:mga08y16_1445402_c1 3300050511 Bacteria 649
1252 nmdc:mga08y16_1486473_c1 3300050511 Bacteria 638
1253 nmdc:mga08y16_1502181_c1 3300050511 Bacteria 634
1254 nmdc:mga08y16_1504756_c1 3300050511 Bacteria 633
1255 nmdc:mga08y16_1556581_c1 3300050511 Bacteria 620
1256 nmdc:mga08y16_1891581_c1 3300050511 Bacteria 548
1257 nmdc:mga08y16_2171636_c1 3300050511 Bacteria 502
1258 nmdc:mga08y16_228365_c1 3300050511 Bacteria 1925
1259 nmdc:mga08y16_248578_c1 3300050511 Bacteria 1838
1260 nmdc:mga08y16_299298_c1 3300050511 Bacteria 1658
1261 nmdc:mga08y16_30358_c2 3300050511 Bacteria 4521
1262 nmdc:mga08y16_321786_c1 3300050511 Bacteria 1592
1263 nmdc:mga08y16_624192_c1 3300050511 Bacteria 1084
1264 nmdc:mga08y16_782842_c1 3300050511 Bacteria 948
1265 nmdc:mga08y16_938886_c1 3300050511 Bacteria 849
1266 nmdc:mga0n895_2216051_c1 3300050512 Bacteria 505
1267 nmdc:mga0n895_72932_c1 3300050512 Bacteria 3407
1268 nmdc:mga0rr50_1166875_c1 3300050513 Bacteria 655
1269 nmdc:mga0rr50_1327563_c1 3300050513 Bacteria 610
1270 nmdc:mga0rr50_1804684_c1 3300050513 Bacteria 515
1271 nmdc:mga0a205_1060203_c1 3300050515 Bacteria 658
1272 nmdc:mga0a205_398163_c1 3300050515 Bacteria 1241
1273 nmdc:mga0a205_697796_c1 3300050515 Bacteria 865
1274 nmdc:mga0a205_791316_c1 3300050515 Bacteria 796
1275 nmdc:mga0a205_994862_c1 3300050515 Bacteria 685
1276 nmdc:mga0sz30_44171_c1 3300050516 Bacteria 1876
1277 Ga0495601_0052039 3300053077 Bacteria 2585
1278 Ga0495601_0870213 3300053077 Bacteria 570
1279 Ga0495601_0966206 3300053077 Bacteria 536
1280 Ga0495601_1030595 3300053077 Unclassified 517
1281 Ga0495612_0144616 3300053078 Bacteria 1033
1282 Ga0495612_0536400 3300053078 Unclassified 538
1283 Ga0495655_0000006 3300053083 Bacteria 201200
1284 Ga0495655_0019506 3300053083 Bacteria 1506
1285 Ga0495655_0199145 3300053083 Bacteria 654
1286 Ga0495655_0217168 3300053083 Bacteria 631
1287 Ga0495655_0227285 3300053083 Bacteria 620
1288 Ga0495595_0068620 3300053084 Bacteria 1672
1289 Ga0495595_0520933 3300053084 Bacteria 606
1290 Ga0495595_0718709 3300053084 Bacteria 512
1291 Ga0495619_0000037 3300053085 Bacteria 124007
1292 Ga0495619_0016599 3300053085 Bacteria 4661
1293 Ga0495619_0016985 3300053085 Bacteria 4611
1294 Ga0495619_0392621 3300053085 Bacteria 958
1295 Ga0495619_0690138 3300053085 Bacteria 695
1296 Ga0495619_0699157 3300053085 Bacteria 689
1297 Ga0495619_1064166 3300053085 Bacteria 539
1298 Ga0500628_000052 3300053129 Bacteria 38627
1299 Ga0501084_0009083 3300054114 Bacteria 8224
1300 Ga0501084_0012528 3300054114 Bacteria 7023
1301 Ga0501084_0027122 3300054114 Bacteria 4786
1302 Ga0501084_0041016 3300054114 Bacteria 3872
1303 Ga0501084_0089774 3300054114 Bacteria 2579
1304 Ga0501084_0290254 3300054114 Bacteria 1381
1305 Ga0501084_0828035 3300054114 Bacteria 779
1306 Ga0501084_0865173 3300054114 Bacteria 760
1307 Ga0501084_0946118 3300054114 Bacteria 724
1308 Ga0501082_0000605 3300060353 Bacteria 31641
1309 Ga0501082_0002483 3300060353 Bacteria 16162
1310 Ga0501082_0144272 3300060353 Bacteria 2066
1311 Ga0501082_0149257 3300060353 Bacteria 2030
1312 Ga0501082_0258957 3300060353 Bacteria 1513
1313 Ga0501082_0368909 3300060353 Bacteria 1252
1314 Ga0501082_0532336 3300060353 Bacteria 1027
1315 Ga0501082_1998489 3300060353 Bacteria 505
1316 Ga0530510_0003067 3300061734 Bacteria 11472
1317 Ga0530510_0003278 3300061734 Bacteria 11137
1318 Ga0530510_0006984 3300061734 Bacteria 7866
1319 Ga0530510_0051193 3300061734 Bacteria 2983
1320 Ga0530510_0111850 3300061734 Bacteria 2001
1321 Ga0530510_0559862 3300061734 Bacteria 868
1322 Ga0530510_0796517 3300061734 Bacteria 721
1323 Ga0530510_1528356 3300061734 Bacteria 513
1324 Ga0070705_100227102
1325 LJQas_1017724
1326 JGI25407J50210_10000647
1327 JGI25407J50210_10005201
1328 JGI25407J50210_10022663
1329 JGI25407J50210_10068884
1330 JGI25407J50210_10107413
1331 JGI25404J52841_10057976
1332 Ga0070658_10007864
1333 Ga0070658_10124271
1334 Ga0070683_100001059
1335 Ga0070683_100057240
1336 Ga0070683_100063493
1337 Ga0070683_100100993
1338 Ga0070683_100299884
1339 Ga0070683_101848547
1340 Ga0068869_101965336
1341 Ga0070680_100833674
1342 Ga0070682_100714598
1343 Ga0070682_100944089
1344 Ga0068868_100063354
1345 Ga0068868_100155040
1346 Ga0068868_101132531
1347 Ga0068868_101209270
1348 Ga0070660_100010723
1349 Ga0070660_100015124
1350 Ga0070660_100142980
1351 Ga0070660_100319916
1352 Ga0070660_100615165
1353 Ga0070660_100949883
1354 Ga0070660_101339250
1355 Ga0070689_100736887
1356 Ga0070691_10024769
1357 Ga0070687_100792589
1358 Ga0070661_100680876
1359 Ga0070668_100478566
1360 Ga0070675_100241136
1361 Ga0070674_100952254
1362 Ga0070674_101213647
1363 Ga0070673_100954556
1364 Ga0070667_101413814
1365 Ga0070667_102059687
1366 Ga0070703_10032059
1367 Ga0070709_10415941
1368 Ga0070709_10537350
1369 Ga0070714_100001136
1370 Ga0070714_100065991
1371 Ga0070714_100078366
1372 Ga0070714_100120288
1373 Ga0070713_100104043
1374 Ga0070713_101608955
1375 Ga0070701_10026041
1376 Ga0070701_10985559
1377 Ga0070700_100328299
1378 Ga0070700_101745335
1379 Ga0070694_100043377
1380 Ga0070694_100169544
1381 Ga0070694_100377477
1382 Ga0070678_100800268
1383 Ga0070662_101328203
1384 Ga0070681_10013572
1385 Ga0070681_10039257
1386 Ga0070681_10176122
1387 Ga0070681_10461811
1388 Ga0068867_101001567
1389 Ga0070706_100402194
1390 Ga0070679_100040168
1391 Ga0070679_100064556
1392 Ga0070679_100150535
1393 Ga0070679_100242417
1394 Ga0070684_100011356
1395 Ga0070684_100025743
1396 Ga0070684_100041508
1397 Ga0070684_100156327
1398 Ga0070684_100285121
1399 Ga0070684_100309997
1400 Ga0070684_100466353
1401 Ga0070684_100578048
1402 Ga0070684_102104819
1403 Ga0070672_100485316
1404 Ga0070686_100467639
1405 Ga0070686_101591475
1406 Ga0070695_100392892
1407 Ga0070695_101208308
1408 Ga0070696_100101771
1409 Ga0070693_100323787
1410 Ga0070704_100447342
1411 Ga0070704_100575373
1412 Ga0070704_101522138
1413 Ga0068855_100102069
1414 Ga0068855_100171627
1415 Ga0070664_100223218
1416 Ga0070664_100345353
1417 Ga0068857_100003516
1418 Ga0068857_100757056
1419 Ga0068854_100071784
1420 Ga0068854_102081360
1421 Ga0068856_100725950
1422 Ga0070702_100579372
1423 Ga0068852_100113091
1424 Ga0068852_102279397
1425 Ga0068864_100026766
1426 Ga0068866_10096800
1427 Ga0068861_100052837
1428 Ga0068861_100590363
1429 Ga0068870_10045088
1430 Ga0068863_100024380
1431 Ga0068863_102459852
1432 Ga0068858_101965791
1433 Ga0068860_101534317
1434 Ga0068862_100047767
1435 Ga0068862_100932786
1436 Ga0081455_10014766
1437 Ga0081455_10016928
1438 Ga0081455_10026800
1439 Ga0081455_10040246
1440 Ga0081455_10052293
1441 Ga0081455_10081825
1442 Ga0081455_10207081
1443 Ga0081455_10242934
1444 Ga0081455_10764175
1445 Ga0081538_10000686
1446 Ga0081538_10001097
1447 Ga0081538_10001861
1448 Ga0081538_10002388
1449 Ga0081538_10002813
1450 Ga0081538_10003603
1451 Ga0081538_10017552
1452 Ga0081538_10017844
1453 Ga0081538_10021571
1454 Ga0081538_10062508
1455 Ga0081538_10110686
1456 Ga0081538_10226752
1457 Ga0081538_10230790
1458 Ga0081540_1002544
1459 Ga0081539_10001667
1460 Ga0070717_10289536
1461 Ga0070717_11161192
1462 Ga0075365_10462217
1463 Ga0075365_10687895
1464 Ga0075363_100017261
1465 Ga0075363_100287975
1466 Ga0075364_10097521
1467 Ga0075364_10863816
1468 Ga0075432_10006106
1469 Ga0070716_100712877
1470 Ga0075367_10033149
1471 Ga0075367_10795167
1472 Ga0075369_10071411
1473 Ga0097621_100136434
1474 Ga0097621_100213429
1475 Ga0097621_102279418
1476 Ga0068871_100110576
1477 Ga0068871_100307878
1478 Ga0068871_101458547
1479 Ga0075428_100046907
1480 Ga0075430_100147442
1481 Ga0075430_100491366
1482 Ga0075430_100690129
1483 Ga0075430_101382667
1484 Ga0075431_100695154
1485 Ga0075431_100809498
1486 Ga0075431_100820400
1487 Ga0075431_101721097
1488 Ga0075433_10009068
1489 Ga0075434_100119151
1490 Ga0075434_100123574
1491 Ga0075434_100281669
1492 Ga0075429_100739732
1493 Ga0075429_100785762
1494 Ga0075429_101859883
1495 Ga0068865_100687067
1496 Ga0068865_101845625
1497 Ga0068865_101986013
1498 Ga0075436_101264060
1499 Ga0075436_101400980
1500 Ga0075435_100574943
1501 Ga0105251_10226261
1502 Ga0105251_10466809
1503 Ga0105240_10476961
1504 Ga0105240_12156159
1505 Ga0111539_10030741
1506 Ga0111539_10085561
1507 Ga0111539_10187206
1508 Ga0111539_10414517
1509 Ga0111539_10703255
1510 Ga0111539_11075406
1511 Ga0111539_11362970
1512 Ga0111539_11441653
1513 Ga0111539_12336295
1514 Ga0111539_12506520
1515 Ga0111539_12682195
1516 Ga0111539_12793492
1517 Ga0105245_10013217
1518 Ga0105245_10026250
1519 Ga0105245_10136477
1520 Ga0105245_10600306
1521 Ga0105245_12753727
1522 Ga0105247_10001002
1523 Ga0105247_10205303
1524 Ga0105247_10578277
1525 Ga0105247_10973622
1526 Ga0114129_10118948
1527 Ga0114129_10291857
1528 Ga0114129_10673536
1529 Ga0114129_11252753
1530 Ga0114129_11449562
1531 Ga0114129_11574899
1532 Ga0114129_12332380
1533 Ga0114129_12660131
1534 Ga0105243_10243238
1535 Ga0105243_10564805
1536 Ga0105243_10674720
1537 Ga0105243_11481960
1538 Ga0105243_11504835
1539 Ga0105243_12002252
1540 Ga0105241_10737140
1541 Ga0105241_10847260
1542 Ga0105242_10127861
1543 Ga0105242_12047019
1544 Ga0105242_12634063
1545 Ga0105248_10000008
1546 Ga0105248_10845470
1547 Ga0105237_10094470
1548 Ga0105237_11896741
1549 Ga0105238_10061239
1550 Ga0105238_10990471
1551 Ga0105238_11426058
1552 Ga0105238_12051082
1553 Ga0105249_10006751
1554 Ga0105249_10730959
1555 Ga0105249_10759692
1556 Ga0105147_119712
1557 Ga0099796_10269204
1558 Ga0105239_10132622
1559 Ga0105239_10274969
1560 Ga0105239_10623107
1561 Ga0105239_11043992
1562 Ga0105239_11486293
1563 Ga0105239_13540173
1564 Ga0105246_10114544
1565 Ga0105246_10484722
1566 Ga0105246_10630386
1567 Ga0105246_10678990
1568 Ga0105246_10829267
1569 Ga0105246_12055161
1570 Ga0157371_10715045
1571 Ga0157371_10927737
1572 Ga0157371_11084341
1573 Ga0157370_10016292
1574 Ga0157370_11704252
1575 Ga0157369_10001576
1576 Ga0157369_10005857
1577 Ga0157369_10006509
1578 Ga0157369_11221485
1579 Ga0157369_11498467
1580 Ga0157374_10375831
1581 Ga0157374_11499049
1582 Ga0157378_10387378
1583 Ga0157378_11459801
1584 Ga0163162_10059179
1585 Ga0163162_11346875
1586 Ga0163162_11391671
1587 Ga0157372_10000882
1588 Ga0157372_10022389
1589 Ga0157372_11209569
1590 Ga0157372_11955931
1591 Ga0157372_12393500
1592 Ga0157372_12495650
1593 Ga0157372_12650347
1594 Ga0157372_13091274
1595 Ga0157375_10378466
1596 Ga0157375_10538502
1597 Ga0157375_12790418
1598 Ga0163163_10242032
1599 Ga0163163_10521135
1600 Ga0163163_10703539
1601 Ga0157380_10029480
1602 Ga0157380_11015357
1603 Ga0157380_11111899
1604 Ga0157377_10060623
1605 Ga0157377_10371183
1606 Ga0157377_10890703
1607 Ga0157377_10983709
1608 Ga0157377_11271770
1609 Ga0157379_11408140
1610 Ga0163161_10161241
1611 Ga0163161_11049658
1612 Ga0197907_11454115
1613 Ga0197907_11495825
1614 Ga0206356_10808650
1615 Ga0206356_11791021
1616 Ga0206354_11697381
1617 Ga0206353_10309370
1618 Ga0206353_11333443
1619 Ga0206353_11506452
1620 Ga0224712_10049116
1621 Ga0207692_10022697
1622 Ga0207642_10247832
1623 Ga0207642_10816309
1624 Ga0207710_10000461
1625 Ga0207710_10700234
1626 Ga0207688_10411166
1627 Ga0207688_10711744
1628 Ga0207680_10361862
1629 Ga0207647_10489024
1630 Ga0207699_10149174
1631 Ga0207699_10156499
1632 Ga0207699_10160575
1633 Ga0207645_10287724
1634 Ga0207643_10258308
1635 Ga0207705_10062767
1636 Ga0207707_10012642
1637 Ga0207707_10188457
1638 Ga0207707_10207457
1639 Ga0207707_10419967
1640 Ga0207707_10586733
1641 Ga0207707_11076919
1642 Ga0207695_10058413
1643 Ga0207695_10234398
1644 Ga0207693_10000327
1645 Ga0207693_10528564
1646 Ga0207693_10698775
1647 Ga0207663_10011766
1648 Ga0207660_10023880
1649 Ga0207660_10283858
1650 Ga0207660_10291474
1651 Ga0207660_10362927
1652 Ga0207660_11148785
1653 Ga0207657_10006978
1654 Ga0207657_10016594
1655 Ga0207657_10036776
1656 Ga0207657_10243831
1657 Ga0207657_10271938
1658 Ga0207657_11140495
1659 Ga0207649_10005811
1660 Ga0207649_10034830
1661 Ga0207649_10778872
1662 Ga0207652_10016236
1663 Ga0207652_10040530
1664 Ga0207652_10064889
1665 Ga0207694_11415451
1666 Ga0207650_10490343
1667 Ga0207659_11864470
1668 Ga0207687_10022371
1669 Ga0207687_10104131
1670 Ga0207687_10131564
1671 Ga0207687_10134242
1672 Ga0207687_10590791
1673 Ga0207700_10079181
1674 Ga0207700_10556377
1675 Ga0207664_10021420
1676 Ga0207664_10056373
1677 Ga0207664_10312822
1678 Ga0207664_10528668
1679 Ga0207664_10669628
1680 Ga0207664_10706874
1681 Ga0207644_10425946
1682 Ga0207644_10815173
1683 Ga0207690_10026917
1684 Ga0207690_10204475
1685 Ga0207690_10934577
1686 Ga0207706_10007358
1687 Ga0207706_10045036
1688 Ga0207706_10045535
1689 Ga0207706_10200085
1690 Ga0207706_10376262
1691 Ga0207706_10490248
1692 Ga0207706_10656742
1693 Ga0207706_10771162
1694 Ga0207706_10798478
1695 Ga0207706_11276858
1696 Ga0207686_10004066
1697 Ga0207686_10081272
1698 Ga0207709_10183000
1699 Ga0207709_10195193
1700 Ga0207709_10520681
1701 Ga0207709_10587820
1702 Ga0207709_11127531
1703 Ga0207709_11495567
1704 Ga0207669_10145008
1705 Ga0207669_10375170
1706 Ga0207669_10528826
1707 Ga0207669_10548544
1708 Ga0207669_11340780
1709 Ga0207704_10024207
1710 Ga0207704_10217462
1711 Ga0207704_10480177
1712 Ga0207665_10099669
1713 Ga0207665_10932301
1714 Ga0207691_10352783
1715 Ga0207711_10292428
1716 Ga0207711_10568233
1717 Ga0207661_10005475
1718 Ga0207661_10005597
1719 Ga0207661_10018843
1720 Ga0207661_10054277
1721 Ga0207661_11473860
1722 Ga0207679_10033625
1723 Ga0207667_10270932
1724 Ga0207651_10790556
1725 Ga0207651_10792629
1726 Ga0207712_10041224
1727 Ga0207712_10085578
1728 Ga0207668_10072808
1729 Ga0207668_10100011
1730 Ga0207668_11360424
1731 Ga0207640_10459058
1732 Ga0207640_10566288
1733 Ga0207640_11086238
1734 Ga0207640_11122257
1735 Ga0207658_11229279
1736 Ga0207677_10209390
1737 Ga0207677_10821133
1738 Ga0207677_11231224
1739 Ga0207639_10089943
1740 Ga0207678_10288265
1741 Ga0207678_10366332
1742 Ga0207678_11565124
1743 Ga0207708_10030902
1744 Ga0207708_10101302
1745 Ga0207708_10146374
1746 Ga0207708_10192233
1747 Ga0207708_10315026
1748 Ga0207702_10004996
1749 Ga0207702_10023609
1750 Ga0207702_11410215
1751 Ga0207641_10005668
1752 Ga0207641_10268674
1753 Ga0207648_11512641
1754 Ga0207676_10069746
1755 Ga0207676_10388630
1756 Ga0207674_10126629
1757 Ga0207674_10504852
1758 Ga0207675_100001319
1759 Ga0207675_100130900
1760 Ga0207675_100911123
1761 Ga0207675_100914427
1762 Ga0207675_102348718
1763 Ga0207675_102601973
1764 Ga0207683_10274418
1765 Ga0207683_10564806
1766 Ga0207698_10090228
1767 Ga0207698_10143689
1768 Ga0209969_1069687
1769 Ga0209970_1026438
1770 Ga0209974_10151813
1771 Ga0209974_10400279
1772 Ga0207428_10038116
1773 Ga0207428_10244434
1774 Ga0207428_10323513
1775 Ga0207428_10510511
1776 Ga0207428_10603190
1777 Ga0207428_10798641
1778 Ga0268265_10166359
1779 Ga0268265_10349955
1780 Ga0268265_12037923
1781 Ga0268265_12583810
1782 Ga0268264_11168013
1783 Ga0268264_11352230
1784 Ga0265326_10245737
1785 Ga0265322_10235668
1786 Ga0265338_10067558
1787 Ga0265338_10562644
1788 Ga0265324_10035867
1789 Ga0265329_10058500
1790 Ga0265339_10124483
1791 Ga0307408_100112212
1792 Ga0307408_100181803
1793 Ga0307405_10084095
1794 Ga0307405_10331758
1795 Ga0307410_10005242
1796 Ga0307410_10049037
1797 Ga0307410_10123974
1798 Ga0307410_10157305
1799 Ga0307410_11997874
1800 Ga0307406_10203429
1801 Ga0307406_10256133
1802 Ga0307406_11410232
1803 Ga0307406_11529735
1804 Ga0307407_10868259
1805 Ga0307407_10935757
1806 Ga0307407_11264173
1807 Ga0307412_10101667
1808 Ga0307412_10381700
1809 Ga0307412_10741449
1810 Ga0307409_100008843
1811 Ga0307409_100025648
1812 Ga0307409_100175393
1813 Ga0307409_100187052
1814 Ga0307409_100197889
1815 Ga0307409_100290421
1816 Ga0307409_102004315
1817 Ga0307409_102166798
1818 Ga0307409_102538507
1819 Ga0307409_102605410
1820 Ga0307416_100026631
1821 Ga0307416_100094130
1822 Ga0307416_100160319
1823 Ga0307416_100683036
1824 Ga0307414_10064344
1825 Ga0307414_10298735
1826 Ga0307414_10930984
1827 Ga0307411_10072439
1828 Ga0307411_10466700
1829 Ga0307411_10629553
1830 Ga0307411_10706979
1831 Ga0307415_100009432
1832 Ga0307415_100030417
1833 Ga0307415_100066821
1834 Ga0307415_100099339
1835 Ga0373959_0130916
1836 Ga0373938_0244320
1837 Ga0373944_0354845
1838 Ga0373952_0191105
1839 Ga0373923_0055064
1840 Ga0373923_0640915
1841 Ga0373932_0213879
1842 Ga0373936_0253075
1843 Ga0373939_0053380
1844 Ga0373945_0410023
1845 Ga0373953_0122897
1846 Ga0373954_0176765
1847 Ga0373956_0174209
1848 Ga0373957_0180599
1849 Ga0373943_0521532
1850 Ga0373946_0105714
1851 Ga0373946_0115090
1852 Ga0373955_0056768
1853 Ga0373961_0013500
1854 Ga0373961_0321445
1855 Ga0373961_0335003
1856 Ga0373962_0273281
1857 Ga0316574_0339953
1858 Ga0316574_0342247
1859 Ga0373924_0104076
1860 Ga0373931_0085014
1861 Ga0373931_0864617
1862 Ga0373935_0236129
1863 Ga0373935_0309056
1864 Ga0373927_0145994
1865 Ga0373933_0088640
1866 Ga0373933_0253597
1867 Ga0373947_0129699
1868 Ga0373937_0029481
1869 Ga0373925_1131286
1870 Ga0395899_0003553
1871 Ga0395899_0004500
1872 Ga0395899_0015196
1873 Ga0395899_0117298
1874 Ga0395899_0193560
1875 Ga0395899_0299048
1876 Ga0395899_0431824
1877 Ga0395899_0888390
1878 Ga0395900_0001151
1879 Ga0395900_0003158
1880 Ga0395900_0029208
1881 Ga0395900_0032554
1882 Ga0395900_0049434
1883 Ga0395900_0099875
1884 Ga0395900_0248961
1885 Ga0395900_0653381
1886 Ga0395900_0703105
1887 Ga0395900_0777970
1888 Ga0395900_1010740
1889 Ga0395900_1314846
1890 Ga0395900_1411199
1891 Ga0395900_1778536
1892 Ga0395898_0003255
1893 Ga0395898_0007563
1894 Ga0395898_0017807
1895 Ga0395898_0110067
1896 Ga0395898_0130997
1897 Ga0395898_0223727
1898 Ga0395898_0661781
1899 Ga0395898_1053338
1900 Ga0395898_1127117
1901 Ga0395898_1236179
1902 Ga0395905_0005310
1903 Ga0395905_0018615
1904 Ga0395905_0038953
1905 Ga0395905_0186955
1906 Ga0395905_1724555
1907 Ga0436364_0058676
1908 Ga0436364_0335112
1909 Ga0436364_0857259
1910 Ga0436364_0968519
1911 Ga0395901_0009117
1912 Ga0395901_0009324
1913 Ga0395901_0011708
1914 Ga0395901_0013838
1915 Ga0395901_0017307
1916 Ga0395901_0022647
1917 Ga0395901_0108496
1918 Ga0395901_0470338
1919 Ga0395901_0791741
1920 Ga0395901_0816093
1921 Ga0395901_0847389
1922 Ga0395901_0924487
1923 Ga0395901_1242215
1924 Ga0395901_1247541
1925 Ga0436360_0309792
1926 Ga0436363_1685287
1927 Ga0436362_0196630
1928 Ga0439453_0152042
1929 Ga0451802_2110464
1930 Ga0451807_1033732
1931 Ga0451807_1785489
1932 Ga0451833_0562689
1933 Ga0451839_0129166
1934 Ga0451845_0181262
1935 Ga0451845_0319367
1936 Ga0451843_1498561
1937 Ga0451853_0358062
1938 Ga0451853_3422080
1939 Ga0451853_3517233
1940 Ga0451853_3685609
1941 Ga0439448_0387220
1942 Ga0439450_044045
1943 Ga0439450_157144
1944 Ga0439454_020462
1945 Ga0439455_0083711
1946 Ga0439455_0113218
1947 Ga0439463_137876
1948 Ga0439463_154771
1949 Ga0450905_021975
1950 Ga0450910_105201
1951 Ga0439459_0019449
1952 Ga0439464_0093853
1953 Ga0439464_0208225
1954 Ga0439460_0016281
1955 Ga0439460_0154203
1956 Ga0439460_0372778
1957 Ga0450901_018784
1958 Ga0439440_0073182
1959 Ga0439440_0098656
1960 Ga0466969_0019734
1961 Ga0466969_0259660
1962 Ga0466969_0284223
1963 Ga0466969_0548685
1964 Ga0466966_0581062
1965 Ga0466961_0181657
1966 Ga0466961_0599149
1967 Ga0466961_0705592
1968 Ga0466963_0008740
1969 Ga0466963_0071439
1970 Ga0466963_0073797
1971 Ga0466963_0701092
1972 Ga0466963_0704970
1973 Ga0466963_1187582
1974 Ga0466964_0251713
1975 Ga0466964_0431635
1976 Ga0466964_0506611
1977 Ga0466964_0613582
1978 Ga0466964_0865599
1979 Ga0466971_0365992
1980 Ga0466968_0190868
1981 Ga0466957_0078451
1982 Ga0466957_0502174
1983 Ga0466957_0563316
1984 Ga0466960_0955541
1985 Ga0466959_0206183
1986 Ga0466959_0221023
1987 Ga0466959_0225580
1988 Ga0466959_0326687
1989 Ga0466959_0468170
1990 Ga0466959_0608425
1991 Ga0466958_0051092
1992 Ga0466958_0056145
1993 Ga0466958_0089729
1994 Ga0466958_0107968
1995 Ga0466958_0356153
1996 Ga0466958_0439066
1997 Ga0466967_0084813
1998 Ga0466967_0122463
1999 Ga0466967_0213024
2000 Ga0466967_0323636
2001 Ga0466967_0334946
2002 Ga0466967_0514059
2003 Ga0466967_0829283
2004 Ga0466967_1089567
2005 Ga0466967_1205240
2006 Ga0466967_1310825
2007 Ga0466967_1340099
2008 Ga0466967_1520605
2009 Ga0466967_1554229
2010 Ga0466967_2302087
2011 Ga0495627_131768
2012 Ga0495592_0009914
2013 Ga0495592_0172570
2014 Ga0495592_0954479
2015 Ga0495603_0206203
2016 Ga0495603_0271293
2017 Ga0495603_0478875
2018 Ga0495590_0352160
2019 Ga0495629_0001331
2020 Ga0495629_0009051
2021 Ga0495629_0038892
2022 Ga0495629_0042675
2023 Ga0495629_0097082
2024 Ga0495629_0270503
2025 Ga0495638_0352076
2026 Ga0495641_0071444
2027 Ga0495641_0394246
2028 Ga0495641_0538051
2029 Ga0495651_0006259
2030 Ga0495651_0135474
2031 Ga0495651_0173225
2032 Ga0495651_0738850
2033 Ga0495653_0032490
2034 Ga0495653_0154953
2035 Ga0495653_0458079
2036 Ga0495653_0857280
2037 Ga0495653_0965063
2038 Ga0495580_0203714
2039 Ga0495580_0610517
2040 Ga0495582_0148178
2041 Ga0495582_0503360
2042 Ga0495605_0192695
2043 Ga0495605_0309572
2044 Ga0495639_0229286
2045 Ga0495662_0113304
2046 Ga0495584_0205130
2047 Ga0495584_0235722
2048 Ga0495594_0883079
2049 Ga0495596_0048864
2050 Ga0495596_0157157
2051 Ga0495607_0258937
2052 Ga0495607_0492413
2053 Ga0495608_0002443
2054 Ga0495608_0018553
2055 Ga0495608_0207189
2056 Ga0495616_0068551
2057 Ga0495618_0010592
2058 Ga0495618_0489905
2059 Ga0495618_0566008
2060 Ga0495628_0028908
2061 Ga0495628_0103164
2062 Ga0495628_0290645
2063 Ga0495628_0542566
2064 Ga0495628_0597128
2065 Ga0495630_0017787
2066 Ga0495630_0077462
2067 Ga0495630_0117572
2068 Ga0495630_0240360
2069 Ga0495630_0366001
2070 Ga0495630_0872066
2071 Ga0495630_1023257
2072 Ga0495631_0242917
2073 Ga0495643_0195022
2074 Ga0495644_0205406
2075 Ga0495663_0086851
2076 Ga0495666_0514434
2077 Ga0495642_0367815
2078 Ga0495652_0089134
2079 Ga0495652_0110230
2080 Ga0495652_0370401
2081 Ga0495665_0477825
2082 Ga0495640_0014053
2083 Ga0495640_0191253
2084 Ga0495640_0902010
2085 Ga0495586_0006171
2086 Ga0495586_0057979
2087 Ga0495586_0145228
2088 Ga0495586_0436151
2089 Ga0495587_0031382
2090 Ga0495587_0137673
2091 Ga0495587_0492652
2092 Ga0495609_0275415
2093 Ga0495621_0413179
2094 Ga0495621_0484841
2095 Ga0495597_0365910
2096 Ga0495645_0148375
2097 Ga0495645_0202215
2098 Ga0495645_0535191
2099 Ga0495622_0000618
2100 Ga0495667_0013676
2101 Ga0495667_0678069
2102 Ga0495667_0698128
2103 Ga0495656_0276167
2104 Ga0495656_0542211
2105 Ga0495668_0767732
2106 Ga0495634_0025585
2107 Ga0495634_0206720
2108 Ga0495634_0218712
2109 Ga0495635_0052206
2110 Ga0495635_0064066
2111 Ga0495659_0451222
2112 Ga0495661_0574088
2113 Ga0495657_0017591
2114 Ga0495657_0034335
2115 Ga0495657_0173474
2116 Ga0495599_0048531
2117 Ga0495623_0165216
2118 Ga0495646_0084378
2119 Ga0495646_0202527
2120 Ga0495647_0192574
2121 Ga0495647_0242949
2122 Ga0495647_0567081
2123 Ga0495658_0063434
2124 Ga0495658_0106840
2125 Ga0495613_0099039
2126 Ga0495613_0261950
2127 Ga0495613_0384789
2128 Ga0495613_0539701
2129 Ga0495613_0648388
2130 Ga0495624_0138274
2131 Ga0495624_0186663
2132 Ga0495670_0622905
2133 Ga0495671_0151509
2134 Ga0495589_0229233
2135 Ga0495589_0458134
2136 Ga0495589_0581263
2137 Ga0495600_0019723
2138 Ga0495600_0317205
2139 Ga0495600_0686512
2140 Ga0495660_0181988
2141 Ga0495581_0676510
2142 Ga0495604_0007191
2143 Ga0495674_0046218
2144 Ga0495674_0299567
2145 Ga0495674_0304214
2146 Ga0495674_0307077
2147 Ga0495674_0483629
2148 Ga0495676_0208839
2149 Ga0495676_0347648
2150 Ga0495676_0498672
2151 Ga0495680_0040313
2152 Ga0495680_0100314
2153 Ga0495680_0113827
2154 Ga0495680_0189934
2155 Ga0495680_0604795
2156 Ga0495683_0237355
2157 Ga0495675_0092107
2158 Ga0495675_0245406
2159 Ga0495677_0277924
2160 Ga0495685_301535
2161 Ga0495684_0018945
2162 Ga0495686_0154850
2163 Ga0495686_0184938
2164 Ga0495593_0059544
2165 Ga0495593_0078628
2166 Ga0495593_0397648
2167 Ga0495602_0013661
2168 Ga0495614_0262917
2169 Ga0495615_0251658
2170 Ga0496100_0102913
2171 Ga0496100_0484371
2172 Ga0496100_0821023
2173 Ga0496101_0007125
2174 Ga0496101_0290688
2175 Ga0496101_0628628
2176 Ga0496101_0631588
2177 Ga0496102_0001083
2178 Ga0496102_0244270
2179 Ga0496102_0305088
2180 Ga0496102_0425033
2181 Ga0496102_0616362
2182 Ga0496102_1077364
2183 Ga0496102_1099577
2184 Ga0496102_1736499
2185 Ga0496103_0000031
2186 Ga0496103_0474501
2187 Ga0496103_0905823
2188 Ga0496104_0000009
2189 Ga0496104_0131282
2190 Ga0496104_0172586
2191 Ga0496104_0213847
2192 Ga0496104_0479397
2193 Ga0496104_0624982
2194 Ga0496104_0673842
2195 Ga0496104_1037721
2196 Ga0496105_0000007
2197 Ga0496105_0000401
2198 Ga0496105_0047865
2199 Ga0496105_0057371
2200 Ga0496105_0120866
2201 Ga0496105_0121766
2202 Ga0496105_0140355
2203 Ga0496105_0752326
2204 Ga0496105_0954516
2205 Ga0496105_1267082
2206 Ga0496106_0320286
2207 Ga0496106_0404394
2208 Ga0496106_0838125
2209 Ga0496107_0640619
2210 Ga0496107_1187512
2211 Ga0496108_0000026
2212 Ga0496108_0001551
2213 Ga0496108_0008908
2214 Ga0496108_0130646
2215 Ga0496108_0146695
2216 Ga0496108_0234017
2217 Ga0496108_0254951
2218 Ga0496108_0258925
2219 Ga0496108_0674445
2220 Ga0496108_0696625
2221 Ga0496108_0745430
2222 Ga0496108_0790348
2223 Ga0496108_0981392
2224 Ga0496108_1154651
2225 Ga0496109_0000012
2226 Ga0496109_0004905
2227 Ga0496109_0078503
2228 Ga0496109_0296733
2229 Ga0496109_0435083
2230 Ga0496109_0557157
2231 Ga0496109_1034826
2232 Ga0496109_1486429
2233 Ga0496109_1611694
2234 Ga0496110_0011382
2235 Ga0496110_0049641
2236 Ga0496110_0058708
2237 Ga0496110_0174428
2238 Ga0496110_0811040
2239 Ga0496110_0869038
2240 Ga0496110_1221608
2241 Ga0496110_1225241
2242 Ga0496111_0001050
2243 Ga0496111_0142391
2244 Ga0496111_0170928
2245 Ga0496111_0629296
2246 Ga0496111_0785501
2247 Ga0496112_0011438
2248 Ga0496112_0014164
2249 Ga0496112_0179080
2250 Ga0496112_0366422
2251 Ga0496112_0744460
2252 Ga0496112_1210192
2253 Ga0496112_1248410
2254 Ga0496112_1830085
2255 Ga0496113_0041886
2256 Ga0496113_0095118
2257 Ga0496113_0126370
2258 Ga0496113_0168365
2259 Ga0496113_0391588
2260 Ga0496113_0851786
2261 Ga0496113_1394292
2262 Ga0496114_0035168
2263 Ga0496114_0125652
2264 Ga0496114_0283639
2265 Ga0496114_0784809
2266 Ga0496114_1020619
2267 Ga0496115_0010148
2268 Ga0496115_0140402
2269 Ga0496116_0000360
2270 Ga0496118_0184896
2271 Ga0496118_0208221
2272 Ga0496119_0003375
2273 Ga0496119_0019417
2274 Ga0496119_0110770
2275 Ga0496120_0008036
2276 Ga0496120_0140610
2277 Ga0496121_0003947
2278 Ga0496121_0036929
2279 Ga0496121_0073431
2280 Ga0496121_0258296
2281 Ga0496121_0592756
2282 Ga0496124_0318342
2283 Ga0496124_0843861
2284 Ga0496125_0140842
2285 Ga0495678_091463
2286 Ga0501291_079710
2287 Ga0501296_068715
2288 Ga0501299_148816
2289 Ga0501311_105996
2290 Ga0501318_055619
2291 Ga0501031_0000518
2292 Ga0501031_0036646
2293 Ga0501031_0168873
2294 Ga0501031_0172799
2295 Ga0501031_0813652
2296 Ga0501031_0991037
2297 Ga0501032_0005293
2298 Ga0501032_0077286
2299 Ga0501032_0840122
2300 Ga0501033_0002948
2301 Ga0501033_0031433
2302 Ga0501033_0272238
2303 Ga0501033_0277794
2304 Ga0501033_0699581
2305 Ga0501033_1039326
2306 Ga0501034_0033847
2307 Ga0501034_0358911
2308 Ga0501036_0000227
2309 Ga0501036_0003861
2310 Ga0501036_0037260
2311 Ga0501036_0155948
2312 Ga0501036_0239472
2313 Ga0501036_0812535
2314 Ga0501036_1067536
2315 Ga0501036_1263097
2316 Ga0501036_1689421
2317 Ga0501037_0031355
2318 Ga0501037_0244342
2319 Ga0501037_0402665
2320 Ga0501037_0862856
2321 Ga0501038_0002331
2322 Ga0501038_0023699
2323 Ga0501038_0054198
2324 Ga0501038_0464016
2325 Ga0501038_0740346
2326 Ga0501038_1056520
2327 Ga0501038_1159161
2328 Ga0501038_1187185
2329 Ga0501039_0000817
2330 Ga0501039_0024988
2331 Ga0501039_0039399
2332 Ga0501039_0080713
2333 Ga0501039_0125165
2334 Ga0501039_0150816
2335 Ga0501039_0432122
2336 Ga0501039_0995014
2337 Ga0501039_1319638
2338 Ga0501040_0026259
2339 Ga0501040_0051067
2340 Ga0501040_0129819
2341 Ga0501040_0243793
2342 Ga0501040_0245241
2343 Ga0501040_0363283
2344 Ga0501040_0407802
2345 Ga0501040_0491104
2346 Ga0501040_0568775
2347 Ga0501041_0000836
2348 Ga0501041_0018099
2349 Ga0501041_0023356
2350 Ga0501041_0024566
2351 Ga0501041_0080386
2352 Ga0501041_0148607
2353 Ga0501041_0358718
2354 Ga0501041_0360609
2355 Ga0501042_0000314
2356 Ga0501042_0022170
2357 Ga0501042_0085843
2358 Ga0501042_0153946
2359 Ga0501042_0214517
2360 Ga0501042_0276895
2361 Ga0501042_0411699
2362 Ga0501042_0532834
2363 Ga0501042_0657545
2364 Ga0501042_0899245
2365 Ga0501042_1267122
2366 Ga0501043_0001251
2367 Ga0501043_0619961
2368 Ga0501043_0683112
2369 Ga0501043_0820577
2370 Ga0501043_1038934
2371 Ga0501043_1091158
2372 Ga0501046_0000158
2373 Ga0501046_0047802
2374 Ga0501046_0196490
2375 Ga0501046_0208714
2376 Ga0501046_0250560
2377 Ga0501046_0352181
2378 Ga0501046_0527553
2379 Ga0501046_0958905
2380 Ga0501047_0004798
2381 Ga0501047_0013835
2382 Ga0501047_0045884
2383 Ga0501047_0266058
2384 Ga0501047_0491553
2385 Ga0501048_0002270
2386 Ga0501048_0016574
2387 Ga0501048_0026492
2388 Ga0501048_0060046
2389 Ga0501048_0061923
2390 Ga0501048_0078909
2391 Ga0501048_0196142
2392 Ga0501048_0225396
2393 Ga0501048_0685944
2394 Ga0501067_0037989
2395 Ga0501067_0225543
2396 Ga0501067_0570789
2397 Ga0501068_0000071
2398 Ga0501068_0024532
2399 Ga0501068_0149301
2400 Ga0501068_0320791
2401 Ga0501068_0355666
2402 Ga0501068_0408591
2403 Ga0501068_0697808
2404 Ga0501068_0921233
2405 Ga0501068_1050190
2406 Ga0501069_0041260
2407 Ga0501069_0090250
2408 Ga0501069_0557678
2409 Ga0501070_0003160
2410 Ga0501070_0028261
2411 Ga0501070_0042224
2412 Ga0501070_0095031
2413 Ga0501070_0168238
2414 Ga0501070_0212313
2415 Ga0501070_0561717
2416 Ga0501071_0000705
2417 Ga0501071_0051603
2418 Ga0501071_0180626
2419 Ga0501071_0291320
2420 Ga0501071_0421814
2421 Ga0501071_0698152
2422 Ga0501071_0976560
2423 Ga0501071_0985252
2424 Ga0501071_1031514
2425 Ga0501071_1053749
2426 Ga0501071_1132190
2427 Ga0501072_0034360
2428 Ga0501072_0041682
2429 Ga0501072_0047943
2430 Ga0501072_0083174
2431 Ga0501072_0100613
2432 Ga0501072_0222262
2433 Ga0501072_0256918
2434 Ga0501072_0500303
2435 Ga0501072_0844853
2436 Ga0501072_1106661
2437 Ga0501072_1317677
2438 Ga0501073_0021965
2439 Ga0501073_0287458
2440 Ga0501074_0000343
2441 Ga0501074_0080020
2442 Ga0501074_0101814
2443 Ga0501074_0164810
2444 Ga0501074_0235296
2445 Ga0501074_0959757
2446 Ga0501074_1057272
2447 Ga0501075_0023003
2448 Ga0501075_0143366
2449 Ga0501075_0242049
2450 Ga0501075_0242112
2451 Ga0501075_0304916
2452 Ga0501075_0424638
2453 Ga0501075_0873288
2454 Ga0501075_1521141
2455 Ga0501076_0023264
2456 Ga0501076_0025133
2457 Ga0501076_0263560
2458 Ga0501076_0285723
2459 Ga0501076_0305889
2460 Ga0501076_0620478
2461 Ga0501076_0794592
2462 Ga0501076_0868656
2463 Ga0501076_1252170
2464 Ga0501077_0003562
2465 Ga0501077_0009374
2466 Ga0501077_0021261
2467 Ga0501077_0154197
2468 Ga0501077_0388296
2469 Ga0501077_0741995
2470 Ga0501077_1139119
2471 Ga0501208_100171
2472 Ga0501214_028591
2473 Ga0501227_136317
2474 Ga0501233_278268
2475 Ga0501243_140184
2476 Ga0501261_128874
2477 Ga0501079_0006091
2478 Ga0501079_0033127
2479 Ga0501079_0057049
2480 Ga0501079_0057535
2481 Ga0501079_0074477
2482 Ga0501079_0102218
2483 Ga0501079_0123145
2484 Ga0501079_0213081
2485 Ga0501079_0311365
2486 Ga0501079_0921663
2487 Ga0501080_0007150
2488 Ga0501080_0387969
2489 Ga0501080_0435817
2490 Ga0501080_0686385
2491 Ga0501080_1152724
2492 Ga0501080_1529446
2493 Ga0501081_0001597
2494 Ga0501081_0018220
2495 Ga0501081_0235445
2496 Ga0501081_0372786
2497 Ga0501081_0482849
2498 Ga0501081_0688173
2499 Ga0501081_0712738
2500 Ga0501081_0981403
2501 Ga0501083_0000141
2502 Ga0501083_0472707
2503 Ga0501083_0785264
2504 Ga0501266_034847
2505 Ga0501268_173605
2506 Ga0501035_0000856
2507 Ga0501035_0070715
2508 Ga0501035_1284377
2509 Ga0501044_0005849
2510 Ga0501044_0286045
2511 Ga0501044_0614279
2512 Ga0501044_0705799
2513 Ga0501044_1082381
2514 Ga0501044_1647580
2515 Ga0501044_1659627
2516 Ga0501045_0002026
2517 Ga0501045_0025350
2518 Ga0501045_0043941
2519 Ga0501045_0059132
2520 Ga0501045_0345611
2521 Ga0501045_0571790
2522 Ga0501045_0756404
2523 Ga0501045_0882159
2524 Ga0501212_046437
2525 nmdc:mga03n38_449329_c1
2526 nmdc:mga03n38_793286_c1
2527 nmdc:mga03n38_86593_c1
2528 nmdc:mga00v17_155506_c1
2529 nmdc:mga00v17_309015_c1
2530 nmdc:mga00v17_661337_c1
2531 nmdc:mga0yw44_1002328_c1
2532 nmdc:mga0yw44_1199744_c1
2533 nmdc:mga0yw44_251594_c1
2534 nmdc:mga0yw44_259902_c1
2535 nmdc:mga0yw44_266377_c1
2536 nmdc:mga0yw44_396704_c1
2537 nmdc:mga0yw44_580315_c1
2538 nmdc:mga06z11_177386_c1
2539 nmdc:mga06z11_448720_c1
2540 nmdc:mga06z11_776114_c1
2541 nmdc:mga06z11_930471_c1
2542 nmdc:mga05p37_1169559_c1
2543 nmdc:mga05p37_151862_c1
2544 nmdc:mga05p37_19978_c1
2545 nmdc:mga05p37_379328_c1
2546 nmdc:mga05p37_387230_c1
2547 nmdc:mga05p37_782329_c1
2548 nmdc:mga05p37_903395_c1
2549 nmdc:mga09592_1531842_c1
2550 nmdc:mga09592_545257_c1
2551 nmdc:mga09592_602038_c1
2552 nmdc:mga09592_717760_c1
2553 nmdc:mga09592_793983_c1
2554 nmdc:mga09592_795797_c1
2555 nmdc:mga09592_8067_c1
2556 nmdc:mga0qj67_1032502_c1
2557 nmdc:mga0qj67_1084712_c1
2558 nmdc:mga0qj67_1446744_c1
2559 nmdc:mga0qj67_190095_c1
2560 nmdc:mga0qj67_215457_c1
2561 nmdc:mga0qj67_315227_c1
2562 nmdc:mga0qj67_357506_c1
2563 nmdc:mga0qj67_48093_c1
2564 nmdc:mga0qj67_900372_c1
2565 nmdc:mga06r32_1793642_c1
2566 nmdc:mga06r32_27650_c1
2567 nmdc:mga06r32_337834_c1
2568 nmdc:mga06r32_527204_c1
2569 nmdc:mga06r32_56393_c1
2570 nmdc:mga06r32_658143_c1
2571 nmdc:mga06r32_930487_c1
2572 nmdc:mga08y16_1113610_c1
2573 nmdc:mga08y16_1404907_c1
2574 nmdc:mga08y16_1445402_c1
2575 nmdc:mga08y16_1486473_c1
2576 nmdc:mga08y16_1502181_c1
2577 nmdc:mga08y16_1504756_c1
2578 nmdc:mga08y16_1556581_c1
2579 nmdc:mga08y16_1891581_c1
2580 nmdc:mga08y16_2171636_c1
2581 nmdc:mga08y16_228365_c1
2582 nmdc:mga08y16_248578_c1
2583 nmdc:mga08y16_299298_c1
2584 nmdc:mga08y16_30358_c2
2585 nmdc:mga08y16_321786_c1
2586 nmdc:mga08y16_624192_c1
2587 nmdc:mga08y16_782842_c1
2588 nmdc:mga08y16_938886_c1
2589 nmdc:mga0n895_2216051_c1
2590 nmdc:mga0n895_72932_c1
2591 nmdc:mga0rr50_1166875_c1
2592 nmdc:mga0rr50_1327563_c1
2593 nmdc:mga0rr50_1804684_c1
2594 nmdc:mga0a205_1060203_c1
2595 nmdc:mga0a205_398163_c1
2596 nmdc:mga0a205_697796_c1
2597 nmdc:mga0a205_791316_c1
2598 nmdc:mga0a205_994862_c1
2599 nmdc:mga0sz30_44171_c1
2600 Ga0495601_0052039
2601 Ga0495601_0870213
2602 Ga0495601_0966206
2603 Ga0495601_1030595
2604 Ga0495612_0144616
2605 Ga0495612_0536400
2606 Ga0495655_0000006
2607 Ga0495655_0019506
2608 Ga0495655_0199145
2609 Ga0495655_0217168
2610 Ga0495655_0227285
2611 Ga0495595_0068620
2612 Ga0495595_0520933
2613 Ga0495595_0718709
2614 Ga0495619_0000037
2615 Ga0495619_0016599
2616 Ga0495619_0016985
2617 Ga0495619_0392621
2618 Ga0495619_0690138
2619 Ga0495619_0699157
2620 Ga0495619_1064166
2621 Ga0500628_000052
2622 Ga0501084_0009083
2623 Ga0501084_0012528
2624 Ga0501084_0027122
2625 Ga0501084_0041016
2626 Ga0501084_0089774
2627 Ga0501084_0290254
2628 Ga0501084_0828035
2629 Ga0501084_0865173
2630 Ga0501084_0946118
2631 Ga0501082_0000605
2632 Ga0501082_0002483
2633 Ga0501082_0144272
2634 Ga0501082_0149257
2635 Ga0501082_0258957
2636 Ga0501082_0368909
2637 Ga0501082_0532336
2638 Ga0501082_1998489
2639 Ga0530510_0003067
2640 Ga0530510_0003278
2641 Ga0530510_0006984
2642 Ga0530510_0051193
2643 Ga0530510_0111850
2644 Ga0530510_0559862
2645 Ga0530510_0796517
2646 Ga0530510_1528356

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00830

Ribosomal_L28

Ribosomal L28 family

1

40

0.92

Map