F492889

General Info

Members Datasets Scaffolds Average Seq Length
1312 269 1312 380

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0230569|Ga0395905_0230569_322_1704
Length 444
Sequence MLDLGTFRSRVRFAAALSIVVLRSMVAVLLIVFPEEGLSQEIVAGLRRLNLNWRLASRLASHREMSSSSVTTRPVETKKDKKAFVDFAWEVYKDDPHWVPPLKDEVHGLITPGKNPWFEHARAQLWLAERGGKVVGRISAQVDDLVQEHMGKGIGNWGMFEALDEEAAQTLIATAEDWLRVQGMTQALGPISLSIWDEPGLEIEGFDEDPTAMMGHHRPEYRAWIEAAGYGKAKDLLTYEVDIAHWDDPKINRLIAMGEKNPHIRIRQVDKSKFNEEARIILNILNDAWSSNWGYVPLTEAEIAYAGKKLKPIIYNELVRVAEIDGEPVAFMLTIPDINELTKDLNGELFPFNFIKLLWRLRKPKVNRSRVPLMGVAKKLQQTRMASMLAFMMIEYTRRDCVGKFGINTGEFGWILEDNKGMLSIAELPGARVNHRYRIYEKDL

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 3.43
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004399 3300000549 Bacteria 1837
2 JGI24736J21556_1001550 3300001904 Bacteria 4180
3 JGI24741J21665_1002364 3300001915 Bacteria 4934
4 JGI24752J21851_1003581 3300001976 Bacteria 2044
5 JGI24740J21852_10000544 3300001979 Bacteria 16129
6 JGI24740J21852_10002386 3300001979 Bacteria 8547
7 JGI24740J21852_10010552 3300001979 Bacteria 3550
8 JGI24740J21852_10014802 3300001979 Bacteria 2866
9 JGI24740J21852_10015688 3300001979 Bacteria 2757
10 JGI24740J21852_10017625 3300001979 Bacteria 2548
11 JGI24740J21852_10023136 3300001979 Bacteria 2127
12 JGI24739J22299_10000015 3300001989 Bacteria 51265
13 JGI24739J22299_10000304 3300001989 Bacteria 16718
14 JGI24739J22299_10047543 3300001989 Bacteria 1399
15 JGI24737J22298_10000005 3300001990 Bacteria 65241
16 JGI24737J22298_10000678 3300001990 Bacteria 12025
17 JGI24737J22298_10002218 3300001990 Bacteria 6926
18 JGI24737J22298_10004157 3300001990 Bacteria 5059
19 JGI24735J21928_10030068 3300002067 Bacteria 1614
20 JGI24735J21928_10030826 3300002067 Bacteria 1592
21 JGI24738J21930_10000548 3300002075 Bacteria 10747
22 JGI24738J21930_10006684 3300002075 Bacteria 2683
23 JGI24749J21850_1002600 3300002076 Bacteria 2532
24 JGI24033J26618_1004759 3300002155 Bacteria 1474
25 JGI24034J26672_10002523 3300002239 Bacteria 2514
26 JGI24034J26672_10003677 3300002239 Bacteria 2143
27 Ga0065712_10073399 3300005290 Bacteria 4405
28 Ga0065712_10085383 3300005290 Bacteria 2700
29 Ga0065712_10116999 3300005290 Bacteria 1727
30 Ga0065715_10000482 3300005293 Bacteria 24935
31 Ga0065715_10108579 3300005293 Bacteria 2711
32 Ga0065715_10141879 3300005293 Bacteria 1841
33 Ga0065715_10172311 3300005293 Bacteria 1537
34 Ga0070658_10000117 3300005327 Bacteria 71263
35 Ga0070658_10001147 3300005327 Bacteria 22607
36 Ga0070658_10003844 3300005327 Bacteria 12308
37 Ga0070658_10009142 3300005327 Bacteria 7966
38 Ga0070658_10011098 3300005327 Bacteria 7223
39 Ga0070658_10018330 3300005327 Bacteria 5604
40 Ga0070658_10034357 3300005327 Bacteria 4080
41 Ga0070658_10042405 3300005327 Bacteria 3675
42 Ga0070658_10056372 3300005327 Bacteria 3193
43 Ga0070658_10135957 3300005327 Bacteria 2051
44 Ga0070658_10260171 3300005327 Bacteria 1474
45 Ga0070658_10326675 3300005327 Bacteria 1310
46 Ga0070676_10002210 3300005328 Bacteria 9926
47 Ga0070676_10016878 3300005328 Bacteria 4036
48 Ga0070676_10084577 3300005328 Bacteria 1931
49 Ga0070676_10084822 3300005328 Bacteria 1929
50 Ga0070676_10115745 3300005328 Bacteria 1676
51 Ga0070683_100013167 3300005329 Bacteria 7203
52 Ga0070683_100031513 3300005329 Bacteria 4822
53 Ga0070683_100054468 3300005329 Bacteria 3709
54 Ga0070683_100123412 3300005329 Bacteria 2447
55 Ga0070683_100160679 3300005329 Bacteria 2132
56 Ga0070690_100028176 3300005330 Bacteria 3478
57 Ga0070690_100045138 3300005330 Bacteria 2798
58 Ga0070670_100003790 3300005331 Bacteria 12588
59 Ga0070670_100004497 3300005331 Bacteria 11686
60 Ga0070670_100006350 3300005331 Bacteria 10005
61 Ga0070670_100007051 3300005331 Bacteria 9528
62 Ga0070670_100010222 3300005331 Bacteria 8009
63 Ga0070670_100011118 3300005331 Bacteria 7690
64 Ga0070670_100011137 3300005331 Bacteria 7685
65 Ga0070670_100038081 3300005331 Bacteria 4135
66 Ga0070670_100054479 3300005331 Bacteria 3434
67 Ga0070670_100078090 3300005331 Bacteria 2844
68 Ga0070670_100147005 3300005331 Bacteria 2039
69 Ga0070670_100254087 3300005331 Bacteria 1531
70 Ga0070677_10023811 3300005333 Bacteria 2270
71 Ga0070677_10034059 3300005333 Bacteria 1965
72 Ga0068869_100000003 3300005334 Bacteria 136262
73 Ga0068869_100019239 3300005334 Bacteria 4661
74 Ga0068869_100122633 3300005334 Bacteria 1989
75 Ga0068869_100154922 3300005334 Bacteria 1780
76 Ga0070666_10000384 3300005335 Bacteria 27792
77 Ga0070666_10000534 3300005335 Bacteria 22975
78 Ga0070666_10001262 3300005335 Bacteria 15296
79 Ga0070666_10002698 3300005335 Bacteria 10709
80 Ga0070680_100001953 3300005336 Bacteria 15165
81 Ga0070680_100006964 3300005336 Bacteria 8618
82 Ga0070680_100028608 3300005336 Bacteria 4471
83 Ga0070680_100037727 3300005336 Bacteria 3905
84 Ga0070680_100117617 3300005336 Bacteria 2216
85 Ga0070680_100143229 3300005336 Bacteria 2004
86 Ga0070682_100009329 3300005337 Bacteria 5554
87 Ga0068868_100000536 3300005338 Bacteria 25436
88 Ga0068868_100000887 3300005338 Bacteria 20308
89 Ga0068868_100137831 3300005338 Bacteria 2001
90 Ga0068868_100169526 3300005338 Bacteria 1807
91 Ga0070660_100000094 3300005339 Bacteria 53860
92 Ga0070660_100000142 3300005339 Bacteria 46063
93 Ga0070660_100002289 3300005339 Bacteria 13150
94 Ga0070660_100002417 3300005339 Bacteria 12831
95 Ga0070660_100004449 3300005339 Bacteria 9685
96 Ga0070660_100009508 3300005339 Bacteria 6840
97 Ga0070660_100009551 3300005339 Bacteria 6829
98 Ga0070660_100029490 3300005339 Bacteria 4112
99 Ga0070660_100029922 3300005339 Bacteria 4083
100 Ga0070660_100041128 3300005339 Bacteria 3522
101 Ga0070660_100079144 3300005339 Bacteria 2578
102 Ga0070660_100237225 3300005339 Bacteria 1485
103 Ga0070689_100041480 3300005340 Bacteria 3533
104 Ga0070691_10029546 3300005341 Bacteria 2565
105 Ga0070691_10058943 3300005341 Bacteria 1844
106 Ga0070687_100071150 3300005343 Bacteria 1868
107 Ga0070661_100000001 3300005344 Bacteria 424830
108 Ga0070661_100000079 3300005344 Bacteria 77180
109 Ga0070661_100002613 3300005344 Bacteria 12353
110 Ga0070661_100003445 3300005344 Bacteria 10928
111 Ga0070661_100010117 3300005344 Bacteria 6550
112 Ga0070661_100037144 3300005344 Bacteria 3543
113 Ga0070661_100045184 3300005344 Bacteria 3219
114 Ga0070661_100046790 3300005344 Bacteria 3165
115 Ga0070661_100059469 3300005344 Bacteria 2802
116 Ga0070661_100064020 3300005344 Bacteria 2702
117 Ga0070661_100071962 3300005344 Bacteria 2544
118 Ga0070692_10002599 3300005345 Bacteria 7043
119 Ga0070692_10010528 3300005345 Bacteria 4214
120 Ga0070692_10018215 3300005345 Bacteria 3372
121 Ga0070668_100000002 3300005347 Bacteria 216333
122 Ga0070668_100004815 3300005347 Bacteria 10008
123 Ga0070668_100015320 3300005347 Bacteria 5729
124 Ga0070668_100046536 3300005347 Bacteria 3332
125 Ga0070668_100057058 3300005347 Bacteria 3017
126 Ga0070668_100083895 3300005347 Bacteria 2502
127 Ga0070668_100113616 3300005347 Bacteria 2157
128 Ga0070668_100114096 3300005347 Bacteria 2153
129 Ga0070668_100281310 3300005347 Bacteria 1389
130 Ga0070669_100000128 3300005353 Bacteria 69625
131 Ga0070669_100002594 3300005353 Bacteria 13060
132 Ga0070669_100005288 3300005353 Bacteria 9320
133 Ga0070669_100057122 3300005353 Bacteria 2863
134 Ga0070669_100062547 3300005353 Bacteria 2737
135 Ga0070669_100070060 3300005353 Bacteria 2591
136 Ga0070669_100128471 3300005353 Bacteria 1941
137 Ga0070675_100001093 3300005354 Bacteria 19531
138 Ga0070675_100005462 3300005354 Bacteria 9724
139 Ga0070675_100006027 3300005354 Bacteria 9288
140 Ga0070675_100039561 3300005354 Bacteria 3849
141 Ga0070671_100001206 3300005355 Bacteria 19346
142 Ga0070671_100001969 3300005355 Bacteria 15751
143 Ga0070671_100002164 3300005355 Bacteria 15156
144 Ga0070671_100004366 3300005355 Bacteria 11182
145 Ga0070671_100009312 3300005355 Bacteria 7886
146 Ga0070671_100010462 3300005355 Bacteria 7442
147 Ga0070671_100013412 3300005355 Bacteria 6607
148 Ga0070671_100014419 3300005355 Bacteria 6386
149 Ga0070671_100021042 3300005355 Bacteria 5324
150 Ga0070671_100036126 3300005355 Bacteria 4096
151 Ga0070671_100049219 3300005355 Bacteria 3507
152 Ga0070671_100116759 3300005355 Bacteria 2244
153 Ga0070671_100129901 3300005355 Bacteria 2122
154 Ga0070671_100165248 3300005355 Bacteria 1871
155 Ga0070674_100015119 3300005356 Bacteria 4811
156 Ga0070674_100086664 3300005356 Bacteria 2250
157 Ga0070674_100098226 3300005356 Bacteria 2128
158 Ga0070674_100155338 3300005356 Bacteria 1731
159 Ga0070674_100248298 3300005356 Bacteria 1396
160 Ga0070673_100000246 3300005364 Bacteria 27366
161 Ga0070673_100009962 3300005364 Bacteria 6406
162 Ga0070673_100017516 3300005364 Bacteria 5098
163 Ga0070673_100062444 3300005364 Bacteria 2959
164 Ga0070673_100074286 3300005364 Bacteria 2739
165 Ga0070673_100089451 3300005364 Bacteria 2513
166 Ga0070673_100107337 3300005364 Bacteria 2309
167 Ga0070659_100000125 3300005366 Bacteria 57976
168 Ga0070659_100000220 3300005366 Bacteria 44199
169 Ga0070659_100001510 3300005366 Bacteria 16772
170 Ga0070659_100007001 3300005366 Bacteria 8165
171 Ga0070659_100015581 3300005366 Bacteria 5694
172 Ga0070659_100016450 3300005366 Bacteria 5554
173 Ga0070659_100019702 3300005366 Bacteria 5118
174 Ga0070659_100029131 3300005366 Bacteria 4266
175 Ga0070659_100030156 3300005366 Bacteria 4196
176 Ga0070659_100035396 3300005366 Bacteria 3888
177 Ga0070659_100054684 3300005366 Bacteria 3145
178 Ga0070659_100086298 3300005366 Bacteria 2511
179 Ga0070659_100151867 3300005366 Bacteria 1890
180 Ga0070659_100244921 3300005366 Bacteria 1484
181 Ga0070667_100001773 3300005367 Bacteria 19224
182 Ga0070667_100004802 3300005367 Bacteria 11322
183 Ga0070667_100005335 3300005367 Bacteria 10737
184 Ga0070667_100013375 3300005367 Bacteria 6784
185 Ga0070667_100014642 3300005367 Bacteria 6481
186 Ga0070667_100015564 3300005367 Bacteria 6288
187 Ga0070667_100017315 3300005367 Bacteria 5972
188 Ga0070667_100041439 3300005367 Bacteria 3863
189 Ga0070667_100042727 3300005367 Bacteria 3803
190 Ga0070667_100049589 3300005367 Bacteria 3536
191 Ga0070667_100067003 3300005367 Bacteria 3051
192 Ga0070667_100068863 3300005367 Bacteria 3012
193 Ga0070667_100101671 3300005367 Bacteria 2483
194 Ga0070667_100104293 3300005367 Bacteria 2452
195 Ga0070714_100013989 3300005435 Bacteria 6439
196 Ga0070714_100093687 3300005435 Bacteria 2635
197 Ga0070714_100214675 3300005435 Bacteria 1765
198 Ga0070714_100356038 3300005435 Bacteria 1375
199 Ga0070713_100036714 3300005436 Bacteria 3956
200 Ga0070713_100080914 3300005436 Bacteria 2771
201 Ga0070694_100007086 3300005444 Bacteria 6824
202 Ga0070708_100018564 3300005445 Bacteria 5822
203 Ga0070663_100002981 3300005455 Bacteria 9651
204 Ga0070663_100005169 3300005455 Bacteria 7728
205 Ga0070663_100014918 3300005455 Bacteria 4998
206 Ga0070663_100087254 3300005455 Bacteria 2306
207 Ga0070663_100123715 3300005455 Bacteria 1957
208 Ga0070663_100139246 3300005455 Bacteria 1851
209 Ga0070678_100006388 3300005456 Bacteria 6916
210 Ga0070678_100052352 3300005456 Bacteria 2964
211 Ga0070662_100000066 3300005457 Bacteria 57014
212 Ga0070662_100000253 3300005457 Bacteria 31619
213 Ga0070662_100001002 3300005457 Bacteria 17247
214 Ga0070662_100004007 3300005457 Bacteria 9233
215 Ga0070662_100010506 3300005457 Bacteria 6079
216 Ga0070662_100013967 3300005457 Bacteria 5351
217 Ga0070662_100014154 3300005457 Bacteria 5322
218 Ga0070662_100058177 3300005457 Bacteria 2812
219 Ga0070662_100069370 3300005457 Bacteria 2594
220 Ga0070662_100182984 3300005457 Bacteria 1653
221 Ga0070662_100201764 3300005457 Bacteria 1579
222 Ga0070681_10016910 3300005458 Bacteria 7287
223 Ga0070681_10031083 3300005458 Bacteria 5358
224 Ga0070681_10038443 3300005458 Bacteria 4798
225 Ga0070681_10139787 3300005458 Bacteria 2352
226 Ga0068867_100006521 3300005459 Bacteria 8245
227 Ga0068867_100008647 3300005459 Bacteria 7190
228 Ga0068867_100019804 3300005459 Bacteria 4795
229 Ga0068867_100074481 3300005459 Bacteria 2545
230 Ga0068867_100093177 3300005459 Bacteria 2289
231 Ga0070685_10000804 3300005466 Bacteria 17048
232 Ga0070685_10003808 3300005466 Bacteria 7630
233 Ga0070679_100014521 3300005530 Bacteria 7565
234 Ga0070679_100053073 3300005530 Bacteria 4035
235 Ga0070679_100069981 3300005530 Bacteria 3500
236 Ga0070679_100154643 3300005530 Bacteria 2269
237 Ga0070679_100169725 3300005530 Bacteria 2155
238 Ga0070679_100249680 3300005530 Bacteria 1731
239 Ga0070684_100014014 3300005535 Bacteria 6482
240 Ga0070684_100066269 3300005535 Bacteria 3170
241 Ga0068853_100000182 3300005539 Bacteria 44164
242 Ga0068853_100000445 3300005539 Bacteria 28074
243 Ga0068853_100004218 3300005539 Bacteria 11095
244 Ga0068853_100006561 3300005539 Bacteria 9268
245 Ga0068853_100012286 3300005539 Bacteria 6964
246 Ga0068853_100167431 3300005539 Bacteria 1987
247 Ga0068853_100176248 3300005539 Bacteria 1937
248 Ga0070672_100000678 3300005543 Bacteria 20007
249 Ga0070672_100001945 3300005543 Bacteria 12948
250 Ga0070672_100002918 3300005543 Bacteria 10997
251 Ga0070672_100004316 3300005543 Bacteria 9300
252 Ga0070672_100021719 3300005543 Bacteria 4700
253 Ga0070672_100119167 3300005543 Bacteria 2159
254 Ga0070672_100140378 3300005543 Bacteria 1992
255 Ga0070686_100000118 3300005544 Bacteria 55751
256 Ga0070696_100148278 3300005546 Bacteria 1720
257 Ga0070696_100258052 3300005546 Unclassified 1320
258 Ga0070665_100000670 3300005548 Bacteria 45961
259 Ga0070665_100000773 3300005548 Bacteria 42151
260 Ga0070665_100002165 3300005548 Bacteria 21915
261 Ga0070665_100005819 3300005548 Bacteria 12646
262 Ga0070665_100010208 3300005548 Bacteria 9499
263 Ga0070665_100015879 3300005548 Bacteria 7558
264 Ga0070665_100024260 3300005548 Bacteria 6106
265 Ga0070665_100032113 3300005548 Bacteria 5284
266 Ga0070665_100078718 3300005548 Bacteria 3303
267 Ga0070704_100013791 3300005549 Bacteria 5029
268 Ga0070704_100052433 3300005549 Unclassified 2878
269 Ga0068855_100000433 3300005563 Bacteria 51890
270 Ga0068855_100000886 3300005563 Bacteria 37122
271 Ga0068855_100005671 3300005563 Bacteria 15247
272 Ga0068855_100024023 3300005563 Bacteria 7298
273 Ga0068855_100031762 3300005563 Bacteria 6303
274 Ga0068855_100255014 3300005563 Bacteria 1956
275 Ga0068855_100323702 3300005563 Bacteria 1703
276 Ga0070664_100001385 3300005564 Bacteria 19330
277 Ga0070664_100002224 3300005564 Bacteria 15604
278 Ga0070664_100005437 3300005564 Bacteria 10225
279 Ga0070664_100027097 3300005564 Bacteria 4761
280 Ga0070664_100031287 3300005564 Bacteria 4445
281 Ga0070664_100045995 3300005564 Bacteria 3686
282 Ga0070664_100052721 3300005564 Bacteria 3446
283 Ga0070664_100076997 3300005564 Bacteria 2867
284 Ga0070664_100083545 3300005564 Bacteria 2755
285 Ga0070664_100163388 3300005564 Bacteria 1971
286 Ga0070664_100283811 3300005564 Bacteria 1493
287 Ga0068857_100000026 3300005577 Bacteria 83525
288 Ga0068857_100001402 3300005577 Bacteria 19032
289 Ga0068857_100041158 3300005577 Bacteria 4097
290 Ga0068857_100063641 3300005577 Bacteria 3279
291 Ga0068857_100085134 3300005577 Bacteria 2825
292 Ga0068857_100259020 3300005577 Bacteria 1596
293 Ga0068857_100299830 3300005577 Bacteria 1481
294 Ga0068854_100000204 3300005578 Bacteria 40135
295 Ga0068854_100006310 3300005578 Bacteria 7542
296 Ga0068854_100032336 3300005578 Bacteria 3640
297 Ga0068854_100046960 3300005578 Bacteria 3076
298 Ga0068854_100053379 3300005578 Bacteria 2903
299 Ga0068854_100068762 3300005578 Bacteria 2583
300 Ga0068854_100094057 3300005578 Bacteria 2235
301 Ga0068854_100135078 3300005578 Bacteria 1888
302 Ga0068854_100144123 3300005578 Bacteria 1831
303 Ga0068854_100173009 3300005578 Bacteria 1681
304 Ga0068856_100000235 3300005614 Bacteria 60202
305 Ga0068856_100365504 3300005614 Bacteria 1461
306 Ga0068852_100000152 3300005616 Bacteria 46381
307 Ga0068852_100011189 3300005616 Bacteria 6741
308 Ga0068852_100011974 3300005616 Bacteria 6560
309 Ga0068852_100019730 3300005616 Bacteria 5344
310 Ga0068852_100031029 3300005616 Bacteria 4405
311 Ga0068852_100096386 3300005616 Bacteria 2659
312 Ga0068852_100165895 3300005616 Bacteria 2066
313 Ga0068852_100408222 3300005616 Bacteria 1337
314 Ga0068859_100000088 3300005617 Bacteria 84390
315 Ga0068859_100009301 3300005617 Bacteria 9922
316 Ga0068859_100012058 3300005617 Bacteria 8684
317 Ga0068859_100013717 3300005617 Bacteria 8125
318 Ga0068859_100018023 3300005617 Bacteria 7096
319 Ga0068859_100021544 3300005617 Bacteria 6470
320 Ga0068859_100062288 3300005617 Bacteria 3760
321 Ga0068859_100124232 3300005617 Bacteria 2649
322 Ga0068864_100000047 3300005618 Bacteria 150798
323 Ga0068864_100000136 3300005618 Bacteria 70797
324 Ga0068864_100002623 3300005618 Bacteria 14848
325 Ga0068864_100006765 3300005618 Bacteria 9387
326 Ga0068864_100007255 3300005618 Bacteria 9113
327 Ga0068864_100147199 3300005618 Bacteria 2130
328 Ga0068866_10031414 3300005718 Bacteria 2558
329 Ga0068861_100014143 3300005719 Bacteria 5597
330 Ga0068861_100018618 3300005719 Bacteria 4948
331 Ga0068851_10015789 3300005834 Bacteria 3604
332 Ga0068851_10044826 3300005834 Bacteria 2234
333 Ga0068870_10023635 3300005840 Bacteria 3033
334 Ga0068863_100000008 3300005841 Bacteria 251996
335 Ga0068863_100000289 3300005841 Bacteria 52032
336 Ga0068863_100000384 3300005841 Bacteria 44825
337 Ga0068863_100006559 3300005841 Bacteria 11425
338 Ga0068863_100053279 3300005841 Bacteria 3834
339 Ga0068863_100073985 3300005841 Bacteria 3223
340 Ga0068863_100457101 3300005841 Bacteria 1253
341 Ga0068858_100000063 3300005842 Bacteria 111811
342 Ga0068858_100000425 3300005842 Bacteria 43961
343 Ga0068858_100012549 3300005842 Bacteria 7990
344 Ga0068858_100031041 3300005842 Bacteria 4962
345 Ga0068858_100060551 3300005842 Bacteria 3499
346 Ga0068858_100092723 3300005842 Bacteria 2811
347 Ga0068858_100099964 3300005842 Bacteria 2705
348 Ga0068858_100167019 3300005842 Bacteria 2074
349 Ga0068858_100215088 3300005842 Bacteria 1819
350 Ga0068860_100000607 3300005843 Bacteria 42670
351 Ga0068860_100024802 3300005843 Bacteria 5792
352 Ga0068860_100109311 3300005843 Bacteria 2642
353 Ga0068860_100221071 3300005843 Bacteria 1839
354 Ga0068860_100308100 3300005843 Bacteria 1552
355 Ga0068860_100370120 3300005843 Bacteria 1413
356 Ga0068862_100005415 3300005844 Bacteria 10662
357 Ga0068862_100027449 3300005844 Bacteria 4792
358 Ga0068862_100032732 3300005844 Bacteria 4392
359 Ga0068862_100041919 3300005844 Bacteria 3896
360 Ga0068862_100067539 3300005844 Bacteria 3082
361 Ga0068862_100091981 3300005844 Bacteria 2643
362 Ga0068862_100104218 3300005844 Bacteria 2484
363 Ga0070717_10015803 3300006028 Bacteria 5834
364 Ga0070715_10077527 3300006163 Bacteria 1500
365 Ga0075366_10070439 3300006195 Bacteria 2082
366 Ga0097621_100015473 3300006237 Bacteria 5740
367 Ga0097621_100029459 3300006237 Bacteria 4336
368 Ga0097621_100047361 3300006237 Bacteria 3484
369 Ga0097621_100053897 3300006237 Bacteria 3278
370 Ga0097621_100085939 3300006237 Bacteria 2624
371 Ga0097621_100228427 3300006237 Bacteria 1624
372 Ga0068871_100024884 3300006358 Bacteria 4649
373 Ga0068871_100043099 3300006358 Bacteria 3625
374 Ga0068871_100076875 3300006358 Bacteria 2758
375 Ga0075428_100000093 3300006844 Bacteria 73908
376 Ga0075428_100037880 3300006844 Bacteria 5307
377 Ga0075428_100136127 3300006844 Bacteria 2671
378 Ga0075431_100000342 3300006847 Bacteria 36687
379 Ga0075431_100011561 3300006847 Bacteria 8904
380 Ga0075433_10035781 3300006852 Unclassified 4274
381 Ga0075433_10164625 3300006852 Bacteria 1974
382 Ga0075429_100000002 3300006880 Bacteria 131527
383 Ga0068865_100003059 3300006881 Bacteria 10004
384 Ga0068865_100012784 3300006881 Bacteria 5291
385 Ga0068865_100031129 3300006881 Bacteria 3556
386 Ga0068865_100258682 3300006881 Bacteria 1377
387 Ga0097620_100000088 3300006931 Bacteria 84390
388 Ga0097620_100009301 3300006931 Bacteria 9922
389 Ga0097620_100012058 3300006931 Bacteria 8684
390 Ga0097620_100013717 3300006931 Bacteria 8125
391 Ga0097620_100018024 3300006931 Bacteria 7096
392 Ga0097620_100021544 3300006931 Bacteria 6470
393 Ga0097620_100062286 3300006931 Bacteria 3760
394 Ga0097620_100124224 3300006931 Bacteria 2649
395 Ga0075435_100009121 3300007076 Bacteria 7161
396 Ga0075435_100072199 3300007076 Unclassified 2819
397 Ga0105250_10022385 3300009092 Bacteria 2549
398 Ga0105240_10002881 3300009093 Bacteria 27174
399 Ga0105240_10049925 3300009093 Bacteria 5277
400 Ga0105240_10141090 3300009093 Bacteria 2881
401 Ga0111539_10019062 3300009094 Bacteria 8478
402 Ga0111539_10083653 3300009094 Bacteria 3752
403 Ga0111539_10308214 3300009094 Bacteria 1842
404 Ga0105245_10000062 3300009098 Bacteria 115179
405 Ga0105245_10058056 3300009098 Bacteria 3482
406 Ga0114129_10002547 3300009147 Bacteria 25313
407 Ga0114129_10036377 3300009147 Bacteria 6953
408 Ga0114129_10061563 3300009147 Bacteria 5245
409 Ga0105243_10010853 3300009148 Bacteria 6893
410 Ga0105243_10039322 3300009148 Bacteria 3686
411 Ga0105241_10075157 3300009174 Bacteria 2632
412 Ga0105241_10083255 3300009174 Bacteria 2510
413 Ga0105242_10123248 3300009176 Bacteria 2228
414 Ga0105248_10000117 3300009177 Bacteria 90169
415 Ga0105248_10000169 3300009177 Bacteria 75948
416 Ga0105248_10001782 3300009177 Bacteria 23920
417 Ga0105248_10002506 3300009177 Bacteria 20435
418 Ga0105248_10051429 3300009177 Bacteria 4623
419 Ga0105248_10051972 3300009177 Bacteria 4599
420 Ga0105248_10081523 3300009177 Bacteria 3637
421 Ga0105248_10126247 3300009177 Bacteria 2886
422 Ga0105248_10139911 3300009177 Bacteria 2730
423 Ga0105248_10312036 3300009177 Bacteria 1771
424 Ga0105237_10013286 3300009545 Bacteria 8638
425 Ga0105237_10025683 3300009545 Bacteria 6022
426 Ga0105238_10002193 3300009551 Bacteria 19721
427 Ga0105238_10006598 3300009551 Bacteria 11565
428 Ga0105238_10009023 3300009551 Bacteria 9977
429 Ga0105238_10015871 3300009551 Bacteria 7621
430 Ga0105238_10064121 3300009551 Bacteria 3674
431 Ga0105238_10092765 3300009551 Bacteria 3008
432 Ga0105238_10198112 3300009551 Bacteria 1984
433 Ga0105249_10002294 3300009553 Bacteria 16615
434 Ga0105249_10006127 3300009553 Bacteria 10433
435 Ga0105249_10009139 3300009553 Bacteria 8667
436 Ga0105249_10015607 3300009553 Bacteria 6723
437 Ga0105249_10033583 3300009553 Bacteria 4646
438 Ga0105249_10048313 3300009553 Bacteria 3880
439 Ga0105249_10083915 3300009553 Bacteria 2966
440 Ga0105239_10020230 3300010375 Bacteria 7343
441 Ga0105239_10056401 3300010375 Bacteria 4309
442 Ga0105239_10190764 3300010375 Bacteria 2294
443 Ga0105246_10037424 3300011119 Bacteria 3257
444 Ga0105246_10075472 3300011119 Bacteria 2386
445 Ga0105246_10117595 3300011119 Bacteria 1964
446 Ga0157373_10002525 3300013100 Bacteria 13931
447 Ga0157373_10005644 3300013100 Bacteria 9376
448 Ga0157373_10010638 3300013100 Bacteria 6771
449 Ga0157373_10038248 3300013100 Bacteria 3440
450 Ga0157373_10068678 3300013100 Bacteria 2505
451 Ga0157373_10106386 3300013100 Bacteria 1973
452 Ga0157373_10128131 3300013100 Bacteria 1785
453 Ga0157373_10128507 3300013100 Bacteria 1782
454 Ga0157373_10136904 3300013100 Bacteria 1722
455 Ga0157371_10000144 3300013102 Bacteria 103512
456 Ga0157371_10002441 3300013102 Bacteria 17716
457 Ga0157371_10008375 3300013102 Bacteria 8245
458 Ga0157371_10010308 3300013102 Bacteria 7293
459 Ga0157371_10010504 3300013102 Bacteria 7200
460 Ga0157371_10015808 3300013102 Bacteria 5645
461 Ga0157371_10016679 3300013102 Bacteria 5474
462 Ga0157371_10027033 3300013102 Bacteria 4165
463 Ga0157371_10058571 3300013102 Bacteria 2732
464 Ga0157371_10112580 3300013102 Bacteria 1932
465 Ga0157371_10153188 3300013102 Bacteria 1644
466 Ga0157370_10004946 3300013104 Bacteria 15086
467 Ga0157370_10014333 3300013104 Bacteria 8111
468 Ga0157370_10016222 3300013104 Bacteria 7550
469 Ga0157370_10022797 3300013104 Bacteria 6227
470 Ga0157370_10053949 3300013104 Bacteria 3832
471 Ga0157370_10148605 3300013104 Bacteria 2181
472 Ga0157369_10001177 3300013105 Bacteria 32602
473 Ga0157369_10012187 3300013105 Bacteria 9760
474 Ga0157369_10012443 3300013105 Bacteria 9659
475 Ga0157369_10017428 3300013105 Bacteria 8070
476 Ga0157369_10028828 3300013105 Bacteria 6140
477 Ga0157369_10044642 3300013105 Bacteria 4822
478 Ga0157369_10045153 3300013105 Bacteria 4794
479 Ga0157374_10085227 3300013296 Bacteria 3004
480 Ga0157374_10101905 3300013296 Bacteria 2753
481 Ga0157374_10105121 3300013296 Bacteria 2711
482 Ga0157378_10006458 3300013297 Bacteria 10256
483 Ga0157378_10034648 3300013297 Bacteria 4464
484 Ga0157378_10285312 3300013297 Bacteria 1593
485 Ga0157378_10301857 3300013297 Bacteria 1550
486 Ga0163162_10002163 3300013306 Bacteria 18441
487 Ga0163162_10003404 3300013306 Bacteria 15182
488 Ga0163162_10081738 3300013306 Bacteria 3302
489 Ga0163162_10142356 3300013306 Bacteria 2512
490 Ga0163162_10142509 3300013306 Bacteria 2511
491 Ga0163162_10148361 3300013306 Bacteria 2462
492 Ga0163162_10275442 3300013306 Bacteria 1815
493 Ga0157372_10001708 3300013307 Bacteria 23818
494 Ga0157372_10030209 3300013307 Bacteria 5926
495 Ga0157372_10160369 3300013307 Bacteria 2599
496 Ga0157372_10191170 3300013307 Bacteria 2371
497 Ga0157372_10243341 3300013307 Bacteria 2087
498 Ga0157372_10510083 3300013307 Bacteria 1402
499 Ga0157375_10004450 3300013308 Bacteria 12166
500 Ga0157375_10008495 3300013308 Bacteria 8993
501 Ga0157375_10008940 3300013308 Bacteria 8765
502 Ga0157375_10022465 3300013308 Bacteria 5805
503 Ga0157375_10095784 3300013308 Bacteria 3040
504 Ga0163163_10000170 3300014325 Bacteria 68377
505 Ga0163163_10000357 3300014325 Bacteria 43921
506 Ga0163163_10065312 3300014325 Bacteria 3612
507 Ga0163163_10072781 3300014325 Bacteria 3426
508 Ga0163163_10139701 3300014325 Bacteria 2464
509 Ga0163163_10209056 3300014325 Bacteria 2000
510 Ga0163163_10251391 3300014325 Bacteria 1818
511 Ga0157380_10010013 3300014326 Bacteria 6804
512 Ga0157380_10066079 3300014326 Bacteria 2908
513 Ga0157380_10069224 3300014326 Bacteria 2847
514 Ga0157380_10421371 3300014326 Bacteria 1273
515 Ga0157377_10051254 3300014745 Bacteria 2327
516 Ga0157379_10001773 3300014968 Bacteria 17808
517 Ga0157379_10014561 3300014968 Bacteria 6901
518 Ga0157379_10107630 3300014968 Bacteria 2503
519 Ga0157376_10038567 3300014969 Bacteria 3888
520 Ga0163161_10001956 3300017792 Bacteria 14993
521 Ga0213875_10002893 3300021388 Bacteria 10030
522 Ga0207673_1001964 3300025290 Bacteria 2300
523 Ga0207697_10000235 3300025315 Bacteria 30187
524 Ga0207697_10001414 3300025315 Bacteria 13140
525 Ga0207697_10027157 3300025315 Bacteria 2341
526 Ga0207697_10048127 3300025315 Bacteria 1758
527 Ga0207656_10057570 3300025321 Bacteria 1696
528 Ga0207696_1015759 3300025711 Bacteria 2550
529 Ga0207682_10001595 3300025893 Bacteria 10432
530 Ga0207682_10013926 3300025893 Bacteria 3133
531 Ga0207682_10015389 3300025893 Bacteria 2978
532 Ga0207682_10041807 3300025893 Bacteria 1871
533 Ga0207642_10002954 3300025899 Bacteria 5319
534 Ga0207642_10053985 3300025899 Bacteria 1831
535 Ga0207688_10000105 3300025901 Bacteria 33639
536 Ga0207688_10056236 3300025901 Bacteria 2210
537 Ga0207688_10076560 3300025901 Bacteria 1905
538 Ga0207688_10123252 3300025901 Bacteria 1514
539 Ga0207680_10000755 3300025903 Bacteria 15246
540 Ga0207680_10001346 3300025903 Bacteria 11631
541 Ga0207680_10001764 3300025903 Bacteria 10217
542 Ga0207680_10015973 3300025903 Bacteria 3931
543 Ga0207647_10000317 3300025904 Bacteria 40172
544 Ga0207647_10000484 3300025904 Bacteria 31935
545 Ga0207647_10000627 3300025904 Bacteria 27507
546 Ga0207647_10001120 3300025904 Bacteria 20616
547 Ga0207647_10004111 3300025904 Bacteria 10802
548 Ga0207647_10010025 3300025904 Bacteria 6708
549 Ga0207647_10020941 3300025904 Bacteria 4374
550 Ga0207647_10024490 3300025904 Bacteria 3979
551 Ga0207647_10088584 3300025904 Bacteria 1848
552 Ga0207645_10005370 3300025907 Bacteria 9312
553 Ga0207645_10007776 3300025907 Bacteria 7544
554 Ga0207645_10023139 3300025907 Bacteria 4039
555 Ga0207645_10059532 3300025907 Bacteria 2439
556 Ga0207645_10089728 3300025907 Bacteria 1977
557 Ga0207643_10040001 3300025908 Bacteria 2638
558 Ga0207643_10043333 3300025908 Bacteria 2539
559 Ga0207705_10000082 3300025909 Bacteria 118194
560 Ga0207705_10000101 3300025909 Bacteria 98231
561 Ga0207705_10000245 3300025909 Bacteria 53348
562 Ga0207705_10000577 3300025909 Bacteria 30703
563 Ga0207705_10002862 3300025909 Bacteria 13208
564 Ga0207705_10006718 3300025909 Bacteria 8502
565 Ga0207705_10011113 3300025909 Bacteria 6528
566 Ga0207705_10011882 3300025909 Bacteria 6291
567 Ga0207705_10012649 3300025909 Bacteria 6091
568 Ga0207705_10030399 3300025909 Bacteria 3854
569 Ga0207705_10031608 3300025909 Bacteria 3780
570 Ga0207705_10040749 3300025909 Bacteria 3332
571 Ga0207705_10044117 3300025909 Bacteria 3204
572 Ga0207705_10050104 3300025909 Bacteria 3006
573 Ga0207705_10056798 3300025909 Bacteria 2823
574 Ga0207705_10080035 3300025909 Bacteria 2380
575 Ga0207705_10095348 3300025909 Bacteria 2183
576 Ga0207705_10136470 3300025909 Bacteria 1829
577 Ga0207705_10165331 3300025909 Bacteria 1664
578 Ga0207705_10243310 3300025909 Bacteria 1371
579 Ga0207707_10045159 3300025912 Bacteria 3840
580 Ga0207707_10101349 3300025912 Bacteria 2516
581 Ga0207695_10003145 3300025913 Bacteria 23572
582 Ga0207695_10008146 3300025913 Bacteria 13177
583 Ga0207695_10232336 3300025913 Bacteria 1748
584 Ga0207693_10285379 3300025915 Bacteria 1293
585 Ga0207660_10000687 3300025917 Bacteria 22596
586 Ga0207660_10002719 3300025917 Bacteria 11592
587 Ga0207660_10052233 3300025917 Bacteria 2909
588 Ga0207660_10076390 3300025917 Bacteria 2449
589 Ga0207660_10158661 3300025917 Bacteria 1743
590 Ga0207660_10283758 3300025917 Bacteria 1315
591 Ga0207657_10000058 3300025919 Bacteria 103811
592 Ga0207657_10000088 3300025919 Bacteria 88065
593 Ga0207657_10000244 3300025919 Bacteria 57833
594 Ga0207657_10000797 3300025919 Bacteria 33369
595 Ga0207657_10001318 3300025919 Bacteria 26369
596 Ga0207657_10002075 3300025919 Bacteria 21676
597 Ga0207657_10009721 3300025919 Bacteria 9645
598 Ga0207657_10009829 3300025919 Bacteria 9583
599 Ga0207657_10010387 3300025919 Bacteria 9292
600 Ga0207657_10035659 3300025919 Bacteria 4459
601 Ga0207657_10046157 3300025919 Bacteria 3817
602 Ga0207657_10060807 3300025919 Bacteria 3241
603 Ga0207657_10063928 3300025919 Bacteria 3143
604 Ga0207657_10096581 3300025919 Bacteria 2458
605 Ga0207649_10000011 3300025920 Bacteria 266219
606 Ga0207649_10000135 3300025920 Bacteria 63197
607 Ga0207649_10006022 3300025920 Bacteria 6580
608 Ga0207649_10016775 3300025920 Bacteria 4140
609 Ga0207649_10018149 3300025920 Bacteria 3995
610 Ga0207649_10022318 3300025920 Bacteria 3655
611 Ga0207649_10027969 3300025920 Bacteria 3315
612 Ga0207649_10034522 3300025920 Bacteria 3031
613 Ga0207649_10042422 3300025920 Bacteria 2775
614 Ga0207649_10067481 3300025920 Bacteria 2271
615 Ga0207649_10104812 3300025920 Bacteria 1878
616 Ga0207652_10010947 3300025921 Bacteria 7313
617 Ga0207652_10068726 3300025921 Bacteria 3074
618 Ga0207652_10099089 3300025921 Bacteria 2571
619 Ga0207652_10124193 3300025921 Bacteria 2298
620 Ga0207652_10127545 3300025921 Bacteria 2267
621 Ga0207652_10220000 3300025921 Bacteria 1711
622 Ga0207652_10280708 3300025921 Bacteria 1502
623 Ga0207681_10000464 3300025923 Bacteria 28460
624 Ga0207681_10000964 3300025923 Bacteria 18767
625 Ga0207681_10006621 3300025923 Bacteria 7114
626 Ga0207681_10047610 3300025923 Bacteria 2890
627 Ga0207681_10061681 3300025923 Bacteria 2579
628 Ga0207694_10000071 3300025924 Bacteria 120633
629 Ga0207694_10000809 3300025924 Bacteria 27948
630 Ga0207694_10041865 3300025924 Bacteria 3531
631 Ga0207694_10044481 3300025924 Bacteria 3428
632 Ga0207650_10002172 3300025925 Bacteria 13705
633 Ga0207650_10004731 3300025925 Bacteria 9300
634 Ga0207650_10009574 3300025925 Bacteria 6626
635 Ga0207650_10009790 3300025925 Bacteria 6552
636 Ga0207650_10012851 3300025925 Bacteria 5785
637 Ga0207650_10023235 3300025925 Bacteria 4395
638 Ga0207650_10031580 3300025925 Bacteria 3826
639 Ga0207650_10050310 3300025925 Bacteria 3081
640 Ga0207650_10060544 3300025925 Bacteria 2825
641 Ga0207650_10085855 3300025925 Bacteria 2395
642 Ga0207650_10230980 3300025925 Bacteria 1492
643 Ga0207659_10004011 3300025926 Bacteria 8882
644 Ga0207659_10004265 3300025926 Bacteria 8642
645 Ga0207659_10016122 3300025926 Bacteria 4858
646 Ga0207659_10016660 3300025926 Bacteria 4788
647 Ga0207659_10119317 3300025926 Bacteria 2019
648 Ga0207687_10013995 3300025927 Bacteria 5244
649 Ga0207687_10038677 3300025927 Bacteria 3262
650 Ga0207687_10135832 3300025927 Bacteria 1860
651 Ga0207700_10183531 3300025928 Bacteria 1753
652 Ga0207664_10026328 3300025929 Bacteria 4395
653 Ga0207664_10031164 3300025929 Bacteria 4077
654 Ga0207664_10073514 3300025929 Bacteria 2759
655 Ga0207644_10000016 3300025931 Bacteria 179046
656 Ga0207644_10001421 3300025931 Bacteria 15415
657 Ga0207644_10001750 3300025931 Bacteria 14053
658 Ga0207644_10001909 3300025931 Bacteria 13514
659 Ga0207644_10010326 3300025931 Bacteria 6154
660 Ga0207644_10016315 3300025931 Bacteria 4996
661 Ga0207644_10024454 3300025931 Bacteria 4147
662 Ga0207644_10045464 3300025931 Bacteria 3123
663 Ga0207644_10072982 3300025931 Bacteria 2515
664 Ga0207644_10143091 3300025931 Bacteria 1843
665 Ga0207644_10185101 3300025931 Bacteria 1635
666 Ga0207690_10000240 3300025932 Bacteria 39829
667 Ga0207690_10004811 3300025932 Bacteria 7967
668 Ga0207690_10006400 3300025932 Bacteria 6980
669 Ga0207690_10030195 3300025932 Bacteria 3455
670 Ga0207690_10058366 3300025932 Bacteria 2610
671 Ga0207690_10113205 3300025932 Bacteria 1958
672 Ga0207690_10122271 3300025932 Bacteria 1893
673 Ga0207690_10132970 3300025932 Bacteria 1823
674 Ga0207690_10288995 3300025932 Bacteria 1279
675 Ga0207706_10000020 3300025933 Bacteria 162063
676 Ga0207706_10000335 3300025933 Bacteria 51098
677 Ga0207706_10001038 3300025933 Bacteria 28181
678 Ga0207706_10008622 3300025933 Bacteria 9396
679 Ga0207706_10008835 3300025933 Bacteria 9272
680 Ga0207706_10017377 3300025933 Bacteria 6480
681 Ga0207706_10022867 3300025933 Bacteria 5610
682 Ga0207706_10023100 3300025933 Bacteria 5585
683 Ga0207706_10026245 3300025933 Bacteria 5214
684 Ga0207706_10040082 3300025933 Bacteria 4151
685 Ga0207706_10072944 3300025933 Bacteria 3018
686 Ga0207706_10074170 3300025933 Bacteria 2992
687 Ga0207706_10095487 3300025933 Bacteria 2615
688 Ga0207706_10096365 3300025933 Bacteria 2602
689 Ga0207706_10097825 3300025933 Bacteria 2581
690 Ga0207706_10098050 3300025933 Bacteria 2578
691 Ga0207706_10193075 3300025933 Bacteria 1787
692 Ga0207706_10193897 3300025933 Bacteria 1782
693 Ga0207709_10039849 3300025935 Bacteria 2809
694 Ga0207709_10041647 3300025935 Bacteria 2757
695 Ga0207670_10003211 3300025936 Bacteria 8656
696 Ga0207669_10017866 3300025937 Bacteria 3650
697 Ga0207669_10091883 3300025937 Bacteria 1978
698 Ga0207704_10007757 3300025938 Bacteria 5092
699 Ga0207704_10013461 3300025938 Bacteria 4093
700 Ga0207704_10022970 3300025938 Bacteria 3353
701 Ga0207704_10049617 3300025938 Bacteria 2527
702 Ga0207691_10002336 3300025940 Bacteria 18572
703 Ga0207691_10006076 3300025940 Bacteria 11667
704 Ga0207691_10006983 3300025940 Bacteria 10893
705 Ga0207691_10009516 3300025940 Bacteria 9331
706 Ga0207691_10036488 3300025940 Bacteria 4555
707 Ga0207691_10040293 3300025940 Bacteria 4317
708 Ga0207691_10067970 3300025940 Bacteria 3220
709 Ga0207691_10226874 3300025940 Bacteria 1618
710 Ga0207711_10000039 3300025941 Bacteria 162974
711 Ga0207711_10000122 3300025941 Bacteria 81465
712 Ga0207711_10000245 3300025941 Bacteria 58210
713 Ga0207711_10001557 3300025941 Bacteria 21221
714 Ga0207711_10001599 3300025941 Bacteria 20944
715 Ga0207711_10009269 3300025941 Bacteria 8217
716 Ga0207711_10013283 3300025941 Bacteria 6842
717 Ga0207711_10025755 3300025941 Bacteria 4932
718 Ga0207711_10038124 3300025941 Bacteria 4086
719 Ga0207711_10067127 3300025941 Bacteria 3104
720 Ga0207711_10133878 3300025941 Bacteria 2224
721 Ga0207711_10171863 3300025941 Bacteria 1967
722 Ga0207711_10302419 3300025941 Bacteria 1476
723 Ga0207689_10000002 3300025942 Bacteria 198437
724 Ga0207689_10004849 3300025942 Bacteria 12121
725 Ga0207689_10030381 3300025942 Bacteria 4503
726 Ga0207689_10068299 3300025942 Bacteria 2921
727 Ga0207689_10146544 3300025942 Bacteria 1945
728 Ga0207689_10276762 3300025942 Bacteria 1390
729 Ga0207661_10008019 3300025944 Bacteria 7528
730 Ga0207661_10008375 3300025944 Bacteria 7386
731 Ga0207661_10043736 3300025944 Bacteria 3536
732 Ga0207661_10044572 3300025944 Bacteria 3506
733 Ga0207661_10079535 3300025944 Bacteria 2702
734 Ga0207661_10149278 3300025944 Bacteria 2019
735 Ga0207679_10001210 3300025945 Bacteria 16407
736 Ga0207679_10007811 3300025945 Bacteria 6798
737 Ga0207679_10012657 3300025945 Bacteria 5506
738 Ga0207679_10015274 3300025945 Bacteria 5068
739 Ga0207679_10018263 3300025945 Bacteria 4696
740 Ga0207679_10033807 3300025945 Bacteria 3601
741 Ga0207679_10073123 3300025945 Bacteria 2592
742 Ga0207679_10101335 3300025945 Bacteria 2252
743 Ga0207679_10263046 3300025945 Bacteria 1472
744 Ga0207679_10270864 3300025945 Bacteria 1452
745 Ga0207667_10000114 3300025949 Bacteria 128923
746 Ga0207667_10010471 3300025949 Bacteria 10838
747 Ga0207667_10015911 3300025949 Bacteria 8518
748 Ga0207667_10016070 3300025949 Bacteria 8473
749 Ga0207667_10016689 3300025949 Bacteria 8286
750 Ga0207667_10022311 3300025949 Bacteria 6996
751 Ga0207667_10051175 3300025949 Bacteria 4356
752 Ga0207667_10057774 3300025949 Bacteria 4071
753 Ga0207667_10110875 3300025949 Bacteria 2830
754 Ga0207667_10114889 3300025949 Bacteria 2774
755 Ga0207667_10136743 3300025949 Bacteria 2523
756 Ga0207667_10167174 3300025949 Bacteria 2261
757 Ga0207651_10015123 3300025960 Bacteria 4475
758 Ga0207651_10017515 3300025960 Bacteria 4235
759 Ga0207651_10042348 3300025960 Bacteria 3030
760 Ga0207651_10081191 3300025960 Bacteria 2336
761 Ga0207651_10343029 3300025960 Bacteria 1255
762 Ga0207712_10000195 3300025961 Bacteria 62560
763 Ga0207712_10010677 3300025961 Bacteria 5831
764 Ga0207668_10000105 3300025972 Bacteria 59485
765 Ga0207668_10000252 3300025972 Bacteria 35699
766 Ga0207668_10002195 3300025972 Bacteria 11387
767 Ga0207668_10008198 3300025972 Bacteria 6222
768 Ga0207668_10016075 3300025972 Bacteria 4663
769 Ga0207668_10023530 3300025972 Bacteria 3962
770 Ga0207668_10079407 3300025972 Bacteria 2373
771 Ga0207668_10088940 3300025972 Bacteria 2263
772 Ga0207668_10133301 3300025972 Bacteria 1900
773 Ga0207640_10001696 3300025981 Bacteria 11807
774 Ga0207640_10002809 3300025981 Bacteria 9335
775 Ga0207640_10004258 3300025981 Bacteria 7742
776 Ga0207640_10024265 3300025981 Bacteria 3657
777 Ga0207640_10034881 3300025981 Bacteria 3144
778 Ga0207640_10038994 3300025981 Bacteria 3003
779 Ga0207640_10048016 3300025981 Bacteria 2757
780 Ga0207640_10089502 3300025981 Bacteria 2128
781 Ga0207640_10095607 3300025981 Bacteria 2069
782 Ga0207640_10165145 3300025981 Bacteria 1643
783 Ga0207658_10002756 3300025986 Bacteria 12666
784 Ga0207658_10002796 3300025986 Bacteria 12557
785 Ga0207658_10003257 3300025986 Bacteria 11545
786 Ga0207658_10003522 3300025986 Bacteria 11046
787 Ga0207658_10008098 3300025986 Bacteria 7159
788 Ga0207658_10010494 3300025986 Bacteria 6291
789 Ga0207658_10029743 3300025986 Bacteria 3861
790 Ga0207658_10039329 3300025986 Bacteria 3412
791 Ga0207658_10042950 3300025986 Bacteria 3283
792 Ga0207658_10121963 3300025986 Bacteria 2080
793 Ga0207658_10127006 3300025986 Bacteria 2043
794 Ga0207677_10000730 3300026023 Bacteria 19217
795 Ga0207677_10036452 3300026023 Bacteria 3206
796 Ga0207677_10037224 3300026023 Bacteria 3178
797 Ga0207677_10166880 3300026023 Bacteria 1717
798 Ga0207703_10000327 3300026035 Bacteria 51797
799 Ga0207703_10000608 3300026035 Bacteria 36334
800 Ga0207703_10002423 3300026035 Bacteria 16178
801 Ga0207703_10021750 3300026035 Bacteria 5022
802 Ga0207703_10083265 3300026035 Bacteria 2672
803 Ga0207703_10106196 3300026035 Bacteria 2388
804 Ga0207703_10137258 3300026035 Bacteria 2118
805 Ga0207703_10168816 3300026035 Bacteria 1923
806 Ga0207639_10000135 3300026041 Bacteria 54465
807 Ga0207639_10000484 3300026041 Bacteria 27473
808 Ga0207639_10002509 3300026041 Bacteria 12311
809 Ga0207639_10013262 3300026041 Bacteria 5762
810 Ga0207639_10045683 3300026041 Bacteria 3301
811 Ga0207639_10110254 3300026041 Bacteria 2241
812 Ga0207639_10143493 3300026041 Bacteria 1992
813 Ga0207678_10001706 3300026067 Bacteria 20130
814 Ga0207678_10004771 3300026067 Bacteria 12166
815 Ga0207678_10006716 3300026067 Bacteria 10204
816 Ga0207678_10007691 3300026067 Bacteria 9519
817 Ga0207678_10015709 3300026067 Bacteria 6653
818 Ga0207678_10016722 3300026067 Bacteria 6442
819 Ga0207678_10017611 3300026067 Bacteria 6271
820 Ga0207678_10022730 3300026067 Bacteria 5492
821 Ga0207678_10027918 3300026067 Bacteria 4928
822 Ga0207678_10059080 3300026067 Bacteria 3299
823 Ga0207678_10104466 3300026067 Bacteria 2417
824 Ga0207678_10225238 3300026067 Bacteria 1605
825 Ga0207702_10005954 3300026078 Bacteria 10591
826 Ga0207702_10008260 3300026078 Bacteria 8798
827 Ga0207702_10023117 3300026078 Bacteria 5155
828 Ga0207702_10042628 3300026078 Bacteria 3807
829 Ga0207702_10074532 3300026078 Bacteria 2929
830 Ga0207702_10096154 3300026078 Bacteria 2604
831 Ga0207641_10000004 3300026088 Bacteria 481088
832 Ga0207641_10000138 3300026088 Bacteria 106531
833 Ga0207641_10006220 3300026088 Bacteria 10098
834 Ga0207641_10024928 3300026088 Bacteria 4931
835 Ga0207641_10033749 3300026088 Bacteria 4252
836 Ga0207641_10075026 3300026088 Bacteria 2919
837 Ga0207641_10075470 3300026088 Bacteria 2911
838 Ga0207641_10102638 3300026088 Bacteria 2522
839 Ga0207641_10129066 3300026088 Bacteria 2267
840 Ga0207641_10145652 3300026088 Bacteria 2141
841 Ga0207641_10293577 3300026088 Bacteria 1533
842 Ga0207641_10307845 3300026088 Bacteria 1498
843 Ga0207648_10000088 3300026089 Bacteria 86596
844 Ga0207648_10002959 3300026089 Bacteria 17953
845 Ga0207648_10010998 3300026089 Bacteria 8546
846 Ga0207648_10013695 3300026089 Bacteria 7530
847 Ga0207648_10045661 3300026089 Bacteria 3842
848 Ga0207648_10117411 3300026089 Bacteria 2338
849 Ga0207676_10000515 3300026095 Bacteria 32509
850 Ga0207676_10000983 3300026095 Bacteria 21929
851 Ga0207676_10006146 3300026095 Bacteria 8477
852 Ga0207676_10015649 3300026095 Bacteria 5479
853 Ga0207676_10016506 3300026095 Bacteria 5346
854 Ga0207676_10018196 3300026095 Bacteria 5103
855 Ga0207676_10071680 3300026095 Bacteria 2782
856 Ga0207676_10200818 3300026095 Bacteria 1761
857 Ga0207676_10235302 3300026095 Bacteria 1640
858 Ga0207674_10000082 3300026116 Bacteria 101650
859 Ga0207674_10000185 3300026116 Bacteria 76519
860 Ga0207674_10000280 3300026116 Bacteria 64258
861 Ga0207674_10001024 3300026116 Bacteria 36495
862 Ga0207674_10004532 3300026116 Bacteria 16683
863 Ga0207674_10004597 3300026116 Bacteria 16574
864 Ga0207674_10009369 3300026116 Bacteria 11199
865 Ga0207674_10010050 3300026116 Bacteria 10766
866 Ga0207674_10021918 3300026116 Bacteria 6872
867 Ga0207674_10069912 3300026116 Bacteria 3530
868 Ga0207674_10102889 3300026116 Bacteria 2836
869 Ga0207674_10158066 3300026116 Bacteria 2221
870 Ga0207674_10179571 3300026116 Bacteria 2068
871 Ga0207675_100030383 3300026118 Bacteria 5032
872 Ga0207675_100049258 3300026118 Bacteria 3932
873 Ga0207683_10002335 3300026121 Bacteria 16634
874 Ga0207683_10009616 3300026121 Bacteria 8239
875 Ga0207683_10018737 3300026121 Bacteria 5904
876 Ga0207683_10032308 3300026121 Bacteria 4547
877 Ga0207683_10033565 3300026121 Bacteria 4458
878 Ga0207698_10000412 3300026142 Bacteria 24694
879 Ga0207698_10000968 3300026142 Bacteria 16705
880 Ga0207698_10001003 3300026142 Bacteria 16409
881 Ga0207698_10001063 3300026142 Bacteria 15973
882 Ga0207698_10003864 3300026142 Bacteria 9067
883 Ga0207698_10005551 3300026142 Bacteria 7800
884 Ga0207698_10033574 3300026142 Bacteria 3730
885 Ga0207698_10078561 3300026142 Bacteria 2650
886 Ga0207698_10159232 3300026142 Bacteria 1972
887 Ga0209974_10001458 3300027876 Bacteria 8578
888 Ga0268266_10000332 3300028379 Bacteria 74181
889 Ga0268266_10005406 3300028379 Bacteria 11920
890 Ga0268266_10006203 3300028379 Bacteria 10976
891 Ga0268266_10024539 3300028379 Bacteria 5128
892 Ga0268266_10024983 3300028379 Bacteria 5085
893 Ga0268266_10066110 3300028379 Bacteria 3126
894 Ga0268266_10067721 3300028379 Bacteria 3090
895 Ga0268266_10148854 3300028379 Bacteria 2108
896 Ga0268265_10004502 3300028380 Bacteria 9647
897 Ga0268265_10010043 3300028380 Bacteria 6391
898 Ga0268265_10017970 3300028380 Bacteria 4893
899 Ga0268265_10024842 3300028380 Bacteria 4245
900 Ga0268265_10035676 3300028380 Bacteria 3636
901 Ga0268265_10038663 3300028380 Bacteria 3511
902 Ga0268265_10040683 3300028380 Bacteria 3434
903 Ga0268265_10054650 3300028380 Bacteria 3031
904 Ga0268265_10100950 3300028380 Bacteria 2330
905 Ga0268265_10148712 3300028380 Bacteria 1972
906 Ga0268265_10235086 3300028380 Bacteria 1613
907 Ga0268264_10002587 3300028381 Bacteria 15829
908 Ga0268264_10010301 3300028381 Bacteria 7736
909 Ga0268264_10010459 3300028381 Bacteria 7673
910 Ga0268264_10047786 3300028381 Bacteria 3558
911 Ga0268264_10049839 3300028381 Bacteria 3485
912 Ga0268264_10049895 3300028381 Bacteria 3483
913 Ga0316182_1288507 3300030745 Bacteria 2479
914 Ga0307408_100033624 3300031548 Bacteria 3584
915 Ga0307408_100058912 3300031548 Bacteria 2794
916 Ga0307408_100071706 3300031548 Bacteria 2562
917 Ga0307408_100171110 3300031548 Bacteria 1734
918 Ga0307408_100194697 3300031548 Bacteria 1636
919 Ga0307408_100213146 3300031548 Bacteria 1571
920 Ga0307408_100235439 3300031548 Bacteria 1502
921 Ga0316578_10077999 3300031728 Bacteria 1968
922 Ga0307405_10007044 3300031731 Bacteria 5589
923 Ga0307405_10007623 3300031731 Bacteria 5430
924 Ga0307405_10077155 3300031731 Bacteria 2164
925 Ga0307405_10130538 3300031731 Bacteria 1735
926 Ga0307405_10173283 3300031731 Bacteria 1541
927 Ga0307413_10000677 3300031824 Bacteria 11596
928 Ga0307413_10006677 3300031824 Bacteria 5293
929 Ga0307413_10018312 3300031824 Bacteria 3671
930 Ga0307413_10034475 3300031824 Bacteria 2894
931 Ga0307413_10068465 3300031824 Bacteria 2223
932 Ga0307413_10202555 3300031824 Bacteria 1434
933 Ga0307410_10000960 3300031852 Bacteria 12376
934 Ga0307410_10001834 3300031852 Bacteria 9885
935 Ga0307410_10004499 3300031852 Bacteria 7218
936 Ga0307410_10018275 3300031852 Bacteria 4233
937 Ga0307410_10023007 3300031852 Bacteria 3864
938 Ga0307410_10067074 3300031852 Bacteria 2474
939 Ga0307410_10194824 3300031852 Bacteria 1543
940 Ga0307406_10019053 3300031901 Bacteria 4023
941 Ga0307406_10032522 3300031901 Bacteria 3185
942 Ga0307406_10143534 3300031901 Bacteria 1693
943 Ga0307406_10178525 3300031901 Bacteria 1543
944 Ga0307406_10212092 3300031901 Bacteria 1433
945 Ga0307406_10219129 3300031901 Bacteria 1413
946 Ga0307407_10015433 3300031903 Bacteria 3776
947 Ga0307407_10017055 3300031903 Bacteria 3633
948 Ga0307407_10018801 3300031903 Bacteria 3504
949 Ga0307407_10025790 3300031903 Bacteria 3103
950 Ga0307407_10036280 3300031903 Bacteria 2716
951 Ga0307407_10038088 3300031903 Bacteria 2662
952 Ga0307407_10056249 3300031903 Bacteria 2276
953 Ga0307407_10057638 3300031903 Bacteria 2254
954 Ga0307412_10022237 3300031911 Bacteria 3885
955 Ga0307412_10026255 3300031911 Bacteria 3618
956 Ga0307412_10049550 3300031911 Bacteria 2768
957 Ga0307412_10059076 3300031911 Bacteria 2568
958 Ga0307412_10088619 3300031911 Bacteria 2159
959 Ga0307409_100001336 3300031995 Bacteria 11970
960 Ga0307409_100023526 3300031995 Bacteria 4272
961 Ga0307409_100023624 3300031995 Bacteria 4266
962 Ga0307409_100025359 3300031995 Bacteria 4157
963 Ga0307409_100026743 3300031995 Bacteria 4075
964 Ga0307409_100036964 3300031995 Bacteria 3595
965 Ga0307409_100039626 3300031995 Bacteria 3498
966 Ga0307409_100073972 3300031995 Bacteria 2720
967 Ga0307409_100085034 3300031995 Bacteria 2570
968 Ga0307409_100173670 3300031995 Bacteria 1899
969 Ga0307409_100311415 3300031995 Bacteria 1469
970 Ga0307409_100355183 3300031995 Bacteria 1384
971 Ga0307416_100000612 3300032002 Bacteria 18344
972 Ga0307416_100003352 3300032002 Bacteria 9379
973 Ga0307416_100025126 3300032002 Bacteria 4362
974 Ga0307416_100048041 3300032002 Bacteria 3383
975 Ga0307416_100048927 3300032002 Bacteria 3358
976 Ga0307416_100057618 3300032002 Bacteria 3144
977 Ga0307416_100063022 3300032002 Bacteria 3034
978 Ga0307416_100072671 3300032002 Bacteria 2864
979 Ga0307416_100095602 3300032002 Bacteria 2566
980 Ga0307416_100228480 3300032002 Bacteria 1792
981 Ga0307416_100231519 3300032002 Bacteria 1782
982 Ga0307416_100244895 3300032002 Bacteria 1740
983 Ga0307416_100303862 3300032002 Bacteria 1587
984 Ga0307414_10002552 3300032004 Bacteria 9573
985 Ga0307414_10003157 3300032004 Bacteria 8757
986 Ga0307414_10006073 3300032004 Bacteria 6699
987 Ga0307414_10018977 3300032004 Bacteria 4250
988 Ga0307414_10026022 3300032004 Bacteria 3759
989 Ga0307414_10029637 3300032004 Bacteria 3564
990 Ga0307414_10100238 3300032004 Bacteria 2178
991 Ga0307414_10116935 3300032004 Bacteria 2042
992 Ga0307414_10145111 3300032004 Bacteria 1864
993 Ga0307411_10000629 3300032005 Bacteria 12767
994 Ga0307411_10007168 3300032005 Bacteria 5649
995 Ga0307411_10016563 3300032005 Bacteria 4174
996 Ga0307411_10023581 3300032005 Bacteria 3648
997 Ga0307411_10028990 3300032005 Bacteria 3374
998 Ga0307411_10036941 3300032005 Bacteria 3066
999 Ga0307411_10054669 3300032005 Bacteria 2622
1000 Ga0307411_10098402 3300032005 Bacteria 2061
1001 Ga0307411_10129675 3300032005 Bacteria 1841
1002 Ga0307411_10183216 3300032005 Bacteria 1591
1003 Ga0307415_100002531 3300032126 Bacteria 9139
1004 Ga0307415_100007265 3300032126 Bacteria 6049
1005 Ga0307415_100033753 3300032126 Bacteria 3323
1006 Ga0307415_100044990 3300032126 Bacteria 2956
1007 Ga0307415_100055498 3300032126 Bacteria 2711
1008 Ga0307415_100062041 3300032126 Bacteria 2590
1009 Ga0307415_100095202 3300032126 Bacteria 2167
1010 Ga0307415_100114385 3300032126 Bacteria 2009
1011 Ga0307415_100164738 3300032126 Bacteria 1722
1012 Ga0307415_100314736 3300032126 Bacteria 1302
1013 Ga0373959_0000231 3300034820 Bacteria 12137
1014 Ga0373949_0020244 3300035090 Bacteria 1521
1015 Ga0373943_0036135 3300035170 Bacteria 2365
1016 Ga0373955_0060186 3300035172 Bacteria 2094
1017 Ga0373935_0009372 3300035692 Bacteria 5858
1018 Ga0373927_0026569 3300035695 Bacteria 3784
1019 Ga0373937_0015197 3300036401 Bacteria 6803
1020 Ga0395899_0000140 3300037312 Bacteria 109989
1021 Ga0395899_0000230 3300037312 Bacteria 76090
1022 Ga0395899_0004866 3300037312 Bacteria 10463
1023 Ga0395899_0009341 3300037312 Bacteria 7532
1024 Ga0395899_0013979 3300037312 Bacteria 6129
1025 Ga0395899_0014261 3300037312 Bacteria 6068
1026 Ga0395899_0018797 3300037312 Bacteria 5251
1027 Ga0395899_0026925 3300037312 Bacteria 4336
1028 Ga0395899_0028083 3300037312 Bacteria 4238
1029 Ga0395899_0029168 3300037312 Bacteria 4150
1030 Ga0395899_0030756 3300037312 Bacteria 4036
1031 Ga0395899_0064617 3300037312 Bacteria 2690
1032 Ga0395899_0066459 3300037312 Bacteria 2648
1033 Ga0395899_0107059 3300037312 Bacteria 2013
1034 Ga0395899_0131245 3300037312 Bacteria 1788
1035 Ga0395899_0141607 3300037312 Bacteria 1710
1036 Ga0395899_0167603 3300037312 Bacteria 1548
1037 Ga0395899_0224277 3300037312 Bacteria 1300
1038 Ga0395899_0283775 3300037312 Bacteria 1126
1039 Ga0395900_0000075 3300037418 Bacteria 183525
1040 Ga0395900_0000124 3300037418 Bacteria 133210
1041 Ga0395900_0001090 3300037418 Bacteria 34516
1042 Ga0395900_0001228 3300037418 Bacteria 31487
1043 Ga0395900_0002843 3300037418 Bacteria 18895
1044 Ga0395900_0003546 3300037418 Bacteria 16790
1045 Ga0395900_0008295 3300037418 Bacteria 10690
1046 Ga0395900_0009190 3300037418 Bacteria 10131
1047 Ga0395900_0019686 3300037418 Bacteria 6880
1048 Ga0395900_0020463 3300037418 Bacteria 6754
1049 Ga0395900_0022489 3300037418 Bacteria 6448
1050 Ga0395900_0028631 3300037418 Bacteria 5710
1051 Ga0395900_0030025 3300037418 Bacteria 5579
1052 Ga0395900_0030811 3300037418 Bacteria 5508
1053 Ga0395900_0038070 3300037418 Bacteria 4958
1054 Ga0395900_0045973 3300037418 Bacteria 4496
1055 Ga0395900_0050215 3300037418 Bacteria 4297
1056 Ga0395900_0060166 3300037418 Bacteria 3910
1057 Ga0395900_0065302 3300037418 Bacteria 3738
1058 Ga0395900_0079387 3300037418 Bacteria 3372
1059 Ga0395900_0121005 3300037418 Bacteria 2685
1060 Ga0395900_0122133 3300037418 Bacteria 2672
1061 Ga0395900_0180080 3300037418 Bacteria 2148
1062 Ga0395900_0185046 3300037418 Bacteria 2114
1063 Ga0395900_0316379 3300037418 Bacteria 1542
1064 Ga0395900_0322991 3300037418 Bacteria 1523
1065 Ga0395900_0382021 3300037418 Bacteria 1376
1066 Ga0395900_0427410 3300037418 Bacteria 1284
1067 Ga0395898_0000055 3300037466 Bacteria 278557
1068 Ga0395898_0004254 3300037466 Bacteria 15703
1069 Ga0395898_0006649 3300037466 Bacteria 12329
1070 Ga0395898_0009623 3300037466 Bacteria 10147
1071 Ga0395898_0011718 3300037466 Bacteria 9090
1072 Ga0395898_0014031 3300037466 Bacteria 8234
1073 Ga0395898_0018922 3300037466 Bacteria 7016
1074 Ga0395898_0024996 3300037466 Bacteria 6021
1075 Ga0395898_0025360 3300037466 Bacteria 5975
1076 Ga0395898_0036686 3300037466 Bacteria 4867
1077 Ga0395898_0042501 3300037466 Bacteria 4483
1078 Ga0395898_0060107 3300037466 Bacteria 3694
1079 Ga0395898_0065587 3300037466 Bacteria 3520
1080 Ga0395898_0093085 3300037466 Bacteria 2897
1081 Ga0395898_0109893 3300037466 Bacteria 2643
1082 Ga0395898_0139986 3300037466 Bacteria 2316
1083 Ga0395898_0177391 3300037466 Bacteria 2036
1084 Ga0395898_0184104 3300037466 Bacteria 1996
1085 Ga0395898_0426809 3300037466 Bacteria 1263
1086 Ga0395905_0000089 3300037471 Bacteria 152196
1087 Ga0395905_0001242 3300037471 Bacteria 31620
1088 Ga0395905_0001330 3300037471 Bacteria 30159
1089 Ga0395905_0002470 3300037471 Bacteria 20479
1090 Ga0395905_0003328 3300037471 Bacteria 17250
1091 Ga0395905_0004038 3300037471 Bacteria 15406
1092 Ga0395905_0005088 3300037471 Bacteria 13528
1093 Ga0395905_0005936 3300037471 Bacteria 12373
1094 Ga0395905_0006867 3300037471 Bacteria 11382
1095 Ga0395905_0011029 3300037471 Bacteria 8744
1096 Ga0395905_0012034 3300037471 Bacteria 8341
1097 Ga0395905_0012308 3300037471 Bacteria 8236
1098 Ga0395905_0019750 3300037471 Bacteria 6387
1099 Ga0395905_0019792 3300037471 Bacteria 6380
1100 Ga0395905_0026018 3300037471 Bacteria 5518
1101 Ga0395905_0026311 3300037471 Bacteria 5486
1102 Ga0395905_0027488 3300037471 Bacteria 5365
1103 Ga0395905_0031947 3300037471 Bacteria 4953
1104 Ga0395905_0035545 3300037471 Bacteria 4678
1105 Ga0395905_0036302 3300037471 Bacteria 4628
1106 Ga0395905_0039358 3300037471 Bacteria 4435
1107 Ga0395905_0049967 3300037471 Bacteria 3919
1108 Ga0395905_0054465 3300037471 Bacteria 3743
1109 Ga0395905_0068973 3300037471 Bacteria 3311
1110 Ga0395905_0070946 3300037471 Bacteria 3265
1111 Ga0395905_0071065 3300037471 Bacteria 3263
1112 Ga0395905_0076221 3300037471 Bacteria 3143
1113 Ga0395905_0099848 3300037471 Bacteria 2725
1114 Ga0395905_0106223 3300037471 Bacteria 2636
1115 Ga0395905_0117783 3300037471 Bacteria 2496
1116 Ga0395905_0118860 3300037471 Bacteria 2484
1117 Ga0395905_0139444 3300037471 Bacteria 2281
1118 Ga0395905_0142676 3300037471 Bacteria 2253
1119 Ga0395905_0156960 3300037471 Bacteria 2140
1120 Ga0395905_0180058 3300037471 Bacteria 1984
1121 Ga0395905_0198064 3300037471 Bacteria 1883
1122 Ga0395905_0230569 3300037471 Bacteria 1731
1123 Ga0395905_0417846 3300037471 Bacteria 1237
1124 Ga0436364_0792321 3300037853 Bacteria 31271
1125 Ga0395901_0000031 3300038443 Bacteria 241733
1126 Ga0395901_0000168 3300038443 Bacteria 85645
1127 Ga0395901_0000418 3300038443 Bacteria 50129
1128 Ga0395901_0000486 3300038443 Bacteria 46185
1129 Ga0395901_0003667 3300038443 Bacteria 15485
1130 Ga0395901_0008549 3300038443 Bacteria 10345
1131 Ga0395901_0008855 3300038443 Bacteria 10189
1132 Ga0395901_0012419 3300038443 Bacteria 8641
1133 Ga0395901_0024056 3300038443 Bacteria 6248
1134 Ga0395901_0026629 3300038443 Bacteria 5937
1135 Ga0395901_0029600 3300038443 Bacteria 5639
1136 Ga0395901_0031267 3300038443 Bacteria 5488
1137 Ga0395901_0031428 3300038443 Bacteria 5475
1138 Ga0395901_0032503 3300038443 Bacteria 5383
1139 Ga0395901_0057063 3300038443 Bacteria 4061
1140 Ga0395901_0057753 3300038443 Bacteria 4036
1141 Ga0395901_0073217 3300038443 Bacteria 3572
1142 Ga0395901_0074760 3300038443 Bacteria 3534
1143 Ga0395901_0079639 3300038443 Bacteria 3421
1144 Ga0395901_0118371 3300038443 Bacteria 2783
1145 Ga0395901_0138035 3300038443 Bacteria 2563
1146 Ga0395901_0193475 3300038443 Bacteria 2133
1147 Ga0395901_0251460 3300038443 Bacteria 1841
1148 Ga0436365_0174109 3300039437 Bacteria 2637
1149 Ga0436365_0851848 3300039437 Bacteria 6168
1150 Ga0439445_0006468 3300042004 Bacteria 2695
1151 Ga0439449_0008264 3300042007 Bacteria 3959
1152 Ga0439458_0000131 3300042157 Bacteria 15768
1153 Ga0439458_0000282 3300042157 Bacteria 12606
1154 Ga0439464_0019765 3300042439 Bacteria 1840
1155 Ga0466969_0042498 3300044656 Bacteria 2269
1156 Ga0466969_0065749 3300044656 Bacteria 1752
1157 Ga0466965_0045634 3300044683 Bacteria 2168
1158 Ga0466966_0000010 3300044684 Bacteria 150868
1159 Ga0466966_0012751 3300044684 Bacteria 5571
1160 Ga0466966_0039131 3300044684 Bacteria 3054
1161 Ga0466966_0057130 3300044684 Bacteria 2467
1162 Ga0466961_0005066 3300044693 Bacteria 8289
1163 Ga0466961_0007933 3300044693 Bacteria 6765
1164 Ga0466961_0023112 3300044693 Bacteria 3997
1165 Ga0466961_0061500 3300044693 Bacteria 2387
1166 Ga0466961_0090981 3300044693 Bacteria 1927
1167 Ga0466961_0147244 3300044693 Bacteria 1472
1168 Ga0466963_0001153 3300044694 Bacteria 13848
1169 Ga0466963_0039144 3300044694 Bacteria 3104
1170 Ga0466963_0039838 3300044694 Bacteria 3078
1171 Ga0466963_0042208 3300044694 Bacteria 2994
1172 Ga0466963_0158797 3300044694 Bacteria 1573
1173 Ga0466964_0014455 3300044706 Bacteria 3003
1174 Ga0466964_0021601 3300044706 Bacteria 2491
1175 Ga0466971_0064479 3300044719 Bacteria 1658
1176 Ga0466968_0044301 3300044735 Bacteria 1885
1177 Ga0466970_0007454 3300044765 Bacteria 5485
1178 Ga0466970_0086195 3300044765 Bacteria 1702
1179 Ga0466957_0000272 3300044842 Bacteria 25068
1180 Ga0466957_0001181 3300044842 Bacteria 13572
1181 Ga0466957_0001402 3300044842 Bacteria 12559
1182 Ga0466957_0006843 3300044842 Bacteria 6444
1183 Ga0466957_0013804 3300044842 Bacteria 4694
1184 Ga0466957_0039266 3300044842 Bacteria 2856
1185 Ga0466957_0078256 3300044842 Bacteria 2056
1186 Ga0466959_0020223 3300045049 Bacteria 4901
1187 Ga0466959_0024057 3300045049 Bacteria 4510
1188 Ga0466959_0037374 3300045049 Bacteria 3587
1189 Ga0466959_0055344 3300045049 Bacteria 2896
1190 Ga0466959_0060488 3300045049 Bacteria 2756
1191 Ga0466959_0103704 3300045049 Bacteria 2034
1192 Ga0466959_0173253 3300045049 Bacteria 1513
1193 Ga0451576_0285292 3300045051 Bacteria 1726
1194 Ga0466958_0000445 3300045836 Bacteria 17129
1195 Ga0466958_0006112 3300045836 Bacteria 6527
1196 Ga0466958_0007204 3300045836 Bacteria 6097
1197 Ga0466958_0022956 3300045836 Bacteria 3658
1198 Ga0466958_0064798 3300045836 Bacteria 2229
1199 Ga0466958_0224869 3300045836 Bacteria 1198
1200 Ga0466967_0000202 3300045976 Bacteria 24957
1201 Ga0466967_0001052 3300045976 Bacteria 15188
1202 Ga0466967_0015418 3300045976 Bacteria 5989
1203 Ga0466967_0025573 3300045976 Bacteria 4871
1204 Ga0466967_0031441 3300045976 Bacteria 4468
1205 Ga0466967_0071439 3300045976 Bacteria 3108
1206 Ga0466967_0118187 3300045976 Bacteria 2445
1207 Ga0466967_0125800 3300045976 Bacteria 2374
1208 Ga0466967_0226623 3300045976 Bacteria 1778
1209 Ga0466967_0240980 3300045976 Bacteria 1725
1210 Ga0495580_0000857 3300046472 Bacteria 26267
1211 Ga0495585_0006106 3300046492 Bacteria 7526
1212 Ga0495643_0000133 3300046522 Bacteria 119563
1213 Ga0495643_0072948 3300046522 Bacteria 1799
1214 Ga0495663_0000481 3300046525 Bacteria 14537
1215 Ga0495663_0013674 3300046525 Bacteria 2270
1216 Ga0495663_0032449 3300046525 Unclassified 1555
1217 Ga0495663_0035733 3300046525 Bacteria 1493
1218 Ga0495598_0002925 3300046537 Bacteria 3580
1219 Ga0495598_0047822 3300046537 Bacteria 1277
1220 Ga0495609_0079154 3300046538 Bacteria 1438
1221 Ga0495621_0000040 3300046539 Bacteria 25175
1222 Ga0495621_0000424 3300046539 Bacteria 10418
1223 Ga0495621_0014669 3300046539 Bacteria 2484
1224 Ga0495633_0001575 3300046558 Bacteria 17461
1225 Ga0495633_0060485 3300046558 Bacteria 1775
1226 Ga0495668_0005119 3300046616 Bacteria 9016
1227 Ga0495668_0027708 3300046616 Bacteria 3210
1228 Ga0495625_0089561 3300046660 Bacteria 2130
1229 Ga0495659_0071917 3300046664 Unclassified 1297
1230 Ga0495669_0000549 3300046684 Bacteria 16751
1231 Ga0495669_0005924 3300046684 Bacteria 5095
1232 Ga0495669_0011641 3300046684 Bacteria 3739
1233 Ga0495669_0035411 3300046684 Bacteria 2204
1234 Ga0495669_0039667 3300046684 Bacteria 2085
1235 Ga0495670_0000340 3300046691 Bacteria 22311
1236 Ga0495670_0007830 3300046691 Bacteria 5255
1237 Ga0495670_0018921 3300046691 Bacteria 3394
1238 Ga0495670_0055595 3300046691 Bacteria 1985
1239 Ga0495677_0005467 3300047445 Bacteria 4820
1240 Ga0495677_0008434 3300047445 Bacteria 3826
1241 Ga0495677_0065371 3300047445 Bacteria 1352
1242 Ga0495602_0088594 3300048088 Bacteria 2576
1243 Ga0496100_0010919 3300048903 Bacteria 5156
1244 Ga0496100_0022684 3300048903 Bacteria 3801
1245 Ga0496101_0008529 3300048904 Bacteria 6699
1246 Ga0496101_0017366 3300048904 Bacteria 4883
1247 Ga0496102_0216934 3300048905 Bacteria 1803
1248 Ga0496102_0294355 3300048905 Bacteria 1530
1249 Ga0496104_0022365 3300048907 Bacteria 5807
1250 Ga0496104_0312703 3300048907 Bacteria 1484
1251 Ga0496106_0080241 3300048909 Bacteria 2506
1252 Ga0496107_0015378 3300048910 Bacteria 5362
1253 Ga0496107_0020757 3300048910 Bacteria 4642
1254 Ga0496107_0071818 3300048910 Bacteria 2516
1255 Ga0496107_0292943 3300048910 Bacteria 1211
1256 Ga0496108_0000229 3300048911 Bacteria 50203
1257 Ga0496108_0001509 3300048911 Bacteria 18424
1258 Ga0496108_0013201 3300048911 Bacteria 6733
1259 Ga0496108_0016679 3300048911 Bacteria 6000
1260 Ga0496108_0028976 3300048911 Bacteria 4580
1261 Ga0496108_0060418 3300048911 Bacteria 3189
1262 Ga0496108_0114379 3300048911 Bacteria 2310
1263 Ga0496109_0019016 3300048912 Bacteria 6051
1264 Ga0496109_0027038 3300048912 Bacteria 5119
1265 Ga0496109_0184808 3300048912 Bacteria 1958
1266 Ga0496109_0291516 3300048912 Bacteria 1538
1267 Ga0496110_0000654 3300048913 Bacteria 23654
1268 Ga0496110_0011850 3300048913 Bacteria 7159
1269 Ga0496110_0021024 3300048913 Bacteria 5516
1270 Ga0496110_0034940 3300048913 Bacteria 4357
1271 Ga0496110_0083164 3300048913 Bacteria 2856
1272 Ga0496110_0090675 3300048913 Bacteria 2733
1273 Ga0496110_0100993 3300048913 Bacteria 2586
1274 Ga0496111_0006186 3300048914 Bacteria 7751
1275 Ga0496111_0041828 3300048914 Bacteria 3289
1276 Ga0496111_0121938 3300048914 Bacteria 1925
1277 Ga0496112_0001660 3300048915 Bacteria 17301
1278 Ga0496112_0037775 3300048915 Bacteria 4714
1279 Ga0496112_0121487 3300048915 Bacteria 2582
1280 Ga0496113_0010535 3300048916 Bacteria 6115
1281 Ga0496113_0025054 3300048916 Bacteria 4248
1282 Ga0496113_0137697 3300048916 Bacteria 1919
1283 Ga0496114_0000033 3300048917 Bacteria 166897
1284 Ga0496114_0012532 3300048917 Bacteria 6790
1285 Ga0496114_0056654 3300048917 Bacteria 3271
1286 Ga0496115_0005203 3300048918 Bacteria 9461
1287 Ga0496115_0016999 3300048918 Bacteria 5549
1288 Ga0501067_0019215 3300049583 Bacteria 3782
1289 Ga0501070_0211229 3300049586 Bacteria 1593
1290 Ga0501234_001597 3300049707 Bacteria 3544
1291 Ga0501079_0212293 3300049741 Bacteria 1512
1292 Ga0501080_0088539 3300049742 Bacteria 2876
1293 nmdc:mga03683_51158_c1 3300050489 Bacteria 1723
1294 nmdc:mga05p37_105616_c1 3300050507 Unclassified 3464
1295 nmdc:mga05p37_28874_c1 3300050507 Unclassified 2830
1296 nmdc:mga05p37_592_c1 3300050507 Bacteria 39914
1297 nmdc:mga09592_1831_c1 3300050508 Bacteria 17093
1298 nmdc:mga06r32_58_c1 3300050510 Bacteria 70343
1299 nmdc:mga08y16_166870_c1 3300050511 Bacteria 2287
1300 nmdc:mga08y16_25716_c1 3300050511 Bacteria 6210
1301 nmdc:mga0n895_16807_c1 3300050512 Bacteria 6724
1302 nmdc:mga08x19_149795_c1 3300050514 Bacteria 1579
1303 nmdc:mga0a205_167164_c1 3300050515 Bacteria 2095
1304 nmdc:mga0a205_27099_c1 3300050515 Bacteria 5471
1305 nmdc:mga0a205_355698_c1 3300050515 Bacteria 1331
1306 nmdc:mga0a205_61098_c1 3300050515 Bacteria 3639
1307 Ga0500618_007336 3300053125 Bacteria 3154
1308 Ga0500658_0000022 3300053134 Bacteria 129341
1309 Ga0500568_0000413 3300053139 Bacteria 32699
1310 Ga0500604_0000038 3300053151 Bacteria 50694
1311 Ga0500616_0000711 3300053153 Bacteria 38558
1312 Ga0466962_0002892 3300061719 Bacteria 8187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100064020 Ga0070661_1000640203 345
2 3300005564 Ga0070664_100052721 Ga0070664_1000527214 345
3 3300025920 Ga0207649_10067481 Ga0207649_100674812 345
4 3300025945 Ga0207679_10073123 Ga0207679_100731232 345
5 3300037312 Ga0395899_0283775 Ga0395899_0283775_33_1115 347
6 3300046522 Ga0495643_0000133 Ga0495643_0000133_64867_66033 348
7 3300034820 Ga0373959_0000231 Ga0373959_0000231_23_1246 349
8 3300037471 Ga0395905_0027488 Ga0395905_0027488_2799_3923 352
9 3300046525 Ga0495663_0032449 Ga0495663_0032449_288_1415 352
10 3300046538 Ga0495609_0079154 Ga0495609_0079154_114_1241 352
11 3300046664 Ga0495659_0071917 Ga0495659_0071917_143_1270 352
12 3300049741 Ga0501079_0212293 Ga0501079_0212293_100_1209 352
13 3300005445 Ga0070708_100018564 Ga0070708_1000185645 353
14 3300005457 Ga0070662_100069370 Ga0070662_1000693702 353
15 3300005546 Ga0070696_100258052 Ga0070696_1002580521 353
16 3300005549 Ga0070704_100052433 Ga0070704_1000524333 353
17 3300006163 Ga0070715_10077527 Ga0070715_100775272 353
18 3300006852 Ga0075433_10164625 Ga0075433_101646252 353
19 3300007076 Ga0075435_100009121 Ga0075435_1000091216 353
20 3300007076 Ga0075435_100072199 Ga0075435_1000721992 353
21 3300009147 Ga0114129_10036377 Ga0114129_100363776 353
22 3300025933 Ga0207706_10008835 Ga0207706_100088357 353
23 3300031548 Ga0307408_100213146 Ga0307408_1002131462 353
24 3300046472 Ga0495580_0000857 Ga0495580_0000857_220_1347 353
25 3300050507 nmdc:mga05p37_105616_c1 nmdc:mga05p37_105616_c1_1560_2687 353
26 3300050512 nmdc:mga0n895_16807_c1 nmdc:mga0n895_16807_c1_972_2099 353
27 3300050514 nmdc:mga08x19_149795_c1 nmdc:mga08x19_149795_c1_260_1387 353
28 3300050515 nmdc:mga0a205_27099_c1 nmdc:mga0a205_27099_c1_2981_4108 353
29 3300050515 nmdc:mga0a205_355698_c1 nmdc:mga0a205_355698_c1_106_1233 353
30 3300005353 Ga0070669_100062547 Ga0070669_1000625472 354
31 3300005549 Ga0070704_100013791 Ga0070704_1000137914 354
32 3300005719 Ga0068861_100014143 Ga0068861_1000141433 354
33 3300006844 Ga0075428_100000093 Ga0075428_10000009322 354
34 3300006847 Ga0075431_100000342 Ga0075431_10000034221 354
35 3300006852 Ga0075433_10035781 Ga0075433_100357812 354
36 3300006880 Ga0075429_100000002 Ga0075429_10000000296 354
37 3300009147 Ga0114129_10002547 Ga0114129_100025479 354
38 3300009147 Ga0114129_10061563 Ga0114129_100615635 354
39 3300009551 Ga0105238_10002193 Ga0105238_100021936 354
40 3300025923 Ga0207681_10061681 Ga0207681_100616812 354
41 3300025924 Ga0207694_10000071 Ga0207694_1000007171 354
42 3300046691 Ga0495670_0055595 Ga0495670_0055595_696_1799 354
43 3300050507 nmdc:mga05p37_28874_c1 nmdc:mga05p37_28874_c1_1217_2344 354
44 3300050507 nmdc:mga05p37_592_c1 nmdc:mga05p37_592_c1_30856_31983 354
45 3300050508 nmdc:mga09592_1831_c1 nmdc:mga09592_1831_c1_8160_9287 354
46 3300050510 nmdc:mga06r32_58_c1 nmdc:mga06r32_58_c1_17915_19042 354
47 3300050515 nmdc:mga0a205_167164_c1 nmdc:mga0a205_167164_c1_316_1443 354
48 3300005466 Ga0070685_10000804 Ga0070685_100008047 356
49 3300005466 Ga0070685_10003808 Ga0070685_100038082 356
50 3300005544 Ga0070686_100000118 Ga0070686_10000011850 356
51 3300044683 Ga0466965_0045634 Ga0466965_0045634_774_1952 356
52 3300044693 Ga0466961_0007933 Ga0466961_0007933_2578_3756 356
53 3300044693 Ga0466961_0147244 Ga0466961_0147244_11_1120 356
54 3300042007 Ga0439449_0008264 Ga0439449_0008264_694_1806 357
55 3300044842 Ga0466957_0078256 Ga0466957_0078256_29_1141 357
56 3300049707 Ga0501234_001597 Ga0501234_001597_1227_2339 357
57 3300031728 Ga0316578_10077999 Ga0316578_100779992 360
58 3300046522 Ga0495643_0072948 Ga0495643_0072948_247_1395 360
59 3300053125 Ga0500618_007336 Ga0500618_007336_121_1269 360
60 3300032002 Ga0307416_100231519 Ga0307416_1002315192 361
61 3300045051 Ga0451576_0285292 Ga0451576_0285292_72_1205 361
62 3300028380 Ga0268265_10038663 Ga0268265_100386633 362
63 3300005331 Ga0070670_100011137 Ga0070670_1000111377 363
64 3300005347 Ga0070668_100046536 Ga0070668_1000465362 363
65 3300005539 Ga0068853_100167431 Ga0068853_1001674312 363
66 3300005843 Ga0068860_100370120 Ga0068860_1003701202 363
67 3300006844 Ga0075428_100136127 Ga0075428_1001361273 363
68 3300009177 Ga0105248_10312036 Ga0105248_103120362 363
69 3300009553 Ga0105249_10033583 Ga0105249_100335836 363
70 3300009553 Ga0105249_10083915 Ga0105249_100839151 363
71 3300014326 Ga0157380_10066079 Ga0157380_100660793 363
72 3300014326 Ga0157380_10421371 Ga0157380_104213711 363
73 3300025893 Ga0207682_10013926 Ga0207682_100139265 363
74 3300025925 Ga0207650_10004731 Ga0207650_100047311 363
75 3300026041 Ga0207639_10045683 Ga0207639_100456832 363
76 3300031824 Ga0307413_10000677 Ga0307413_100006774 363
77 3300031852 Ga0307410_10004499 Ga0307410_100044996 363
78 3300031995 Ga0307409_100023624 Ga0307409_1000236243 363
79 3300032004 Ga0307414_10026022 Ga0307414_100260223 363
80 3300032005 Ga0307411_10000629 Ga0307411_100006292 363
81 3300046539 Ga0495621_0014669 Ga0495621_0014669_198_1340 363
82 3300046558 Ga0495633_0060485 Ga0495633_0060485_256_1398 363
83 3300002076 JGI24749J21850_1002600 JGI24749J21850_10026003 364
84 3300002155 JGI24033J26618_1004759 JGI24033J26618_10047592 364
85 3300002239 JGI24034J26672_10002523 JGI24034J26672_100025232 364
86 3300005290 Ga0065712_10085383 Ga0065712_100853831 364
87 3300005293 Ga0065715_10000482 Ga0065715_1000048210 364
88 3300005328 Ga0070676_10002210 Ga0070676_100022107 364
89 3300005331 Ga0070670_100003790 Ga0070670_1000037909 364
90 3300005343 Ga0070687_100071150 Ga0070687_1000711501 364
91 3300005347 Ga0070668_100004815 Ga0070668_1000048152 364
92 3300005353 Ga0070669_100002594 Ga0070669_1000025949 364
93 3300005354 Ga0070675_100001093 Ga0070675_10000109315 364
94 3300005355 Ga0070671_100021042 Ga0070671_1000210423 364
95 3300005356 Ga0070674_100015119 Ga0070674_1000151196 364
96 3300005367 Ga0070667_100015564 Ga0070667_1000155643 364
97 3300005457 Ga0070662_100000253 Ga0070662_10000025329 364
98 3300005459 Ga0068867_100008647 Ga0068867_1000086475 364
99 3300005543 Ga0070672_100001945 Ga0070672_1000019456 364
100 3300005564 Ga0070664_100031287 Ga0070664_1000312875 364
101 3300005617 Ga0068859_100009301 Ga0068859_1000093012 364
102 3300005719 Ga0068861_100018618 Ga0068861_1000186182 364
103 3300005840 Ga0068870_10023635 Ga0068870_100236353 364
104 3300005844 Ga0068862_100005415 Ga0068862_1000054157 364
105 3300006847 Ga0075431_100011561 Ga0075431_1000115615 364
106 3300006881 Ga0068865_100258682 Ga0068865_1002586822 364
107 3300006931 Ga0097620_100009301 Ga0097620_1000093012 364
108 3300009094 Ga0111539_10019062 Ga0111539_100190623 364
109 3300009553 Ga0105249_10002294 Ga0105249_1000229410 364
110 3300013308 Ga0157375_10095784 Ga0157375_100957843 364
111 3300014326 Ga0157380_10010013 Ga0157380_100100136 364
112 3300017792 Ga0163161_10001956 Ga0163161_100019562 364
113 3300025315 Ga0207697_10001414 Ga0207697_100014149 364
114 3300025893 Ga0207682_10001595 Ga0207682_100015958 364
115 3300025901 Ga0207688_10076560 Ga0207688_100765602 364
116 3300025907 Ga0207645_10007776 Ga0207645_100077763 364
117 3300025908 Ga0207643_10040001 Ga0207643_100400012 364
118 3300025923 Ga0207681_10000964 Ga0207681_100009643 364
119 3300025925 Ga0207650_10002172 Ga0207650_100021726 364
120 3300025926 Ga0207659_10004011 Ga0207659_100040115 364
121 3300025931 Ga0207644_10010326 Ga0207644_100103266 364
122 3300025933 Ga0207706_10001038 Ga0207706_1000103827 364
123 3300025937 Ga0207669_10017866 Ga0207669_100178664 364
124 3300025940 Ga0207691_10002336 Ga0207691_1000233613 364
125 3300025945 Ga0207679_10012657 Ga0207679_100126573 364
126 3300025960 Ga0207651_10343029 Ga0207651_103430291 364
127 3300025972 Ga0207668_10002195 Ga0207668_100021953 364
128 3300025981 Ga0207640_10024265 Ga0207640_100242653 364
129 3300025986 Ga0207658_10029743 Ga0207658_100297433 364
130 3300026089 Ga0207648_10013695 Ga0207648_100136956 364
131 3300026118 Ga0207675_100030383 Ga0207675_1000303835 364
132 3300026121 Ga0207683_10033565 Ga0207683_100335651 364
133 3300028380 Ga0268265_10004502 Ga0268265_100045029 364
134 3300030745 Ga0316182_1288507 Ga0316182_12885073 364
135 3300031731 Ga0307405_10007623 Ga0307405_100076235 364
136 3300031852 Ga0307410_10001834 Ga0307410_100018343 364
137 3300031903 Ga0307407_10017055 Ga0307407_100170552 364
138 3300031911 Ga0307412_10026255 Ga0307412_100262554 364
139 3300031911 Ga0307412_10049550 Ga0307412_100495502 364
140 3300031995 Ga0307409_100036964 Ga0307409_1000369642 364
141 3300031995 Ga0307409_100073972 Ga0307409_1000739722 364
142 3300032002 Ga0307416_100048041 Ga0307416_1000480413 364
143 3300032002 Ga0307416_100095602 Ga0307416_1000956022 364
144 3300032005 Ga0307411_10023581 Ga0307411_100235813 364
145 3300032005 Ga0307411_10028990 Ga0307411_100289902 364
146 3300032005 Ga0307411_10054669 Ga0307411_100546692 364
147 3300032126 Ga0307415_100095202 Ga0307415_1000952023 364
148 3300032126 Ga0307415_100164738 Ga0307415_1001647382 364
149 3300046525 Ga0495663_0013674 Ga0495663_0013674_546_1685 364
150 3300046691 Ga0495670_0018921 Ga0495670_0018921_205_1344 364
151 3300047445 Ga0495677_0008434 Ga0495677_0008434_2235_3374 364
152 3300050511 nmdc:mga08y16_25716_c1 nmdc:mga08y16_25716_c1_3558_4697 364
153 3300002067 JGI24735J21928_10030826 JGI24735J21928_100308262 365
154 3300005290 Ga0065712_10116999 Ga0065712_101169992 365
155 3300005293 Ga0065715_10108579 Ga0065715_101085793 365
156 3300005293 Ga0065715_10141879 Ga0065715_101418791 365
157 3300005327 Ga0070658_10001147 Ga0070658_1000114717 365
158 3300005327 Ga0070658_10011098 Ga0070658_100110985 365
159 3300005327 Ga0070658_10326675 Ga0070658_103266751 365
160 3300005328 Ga0070676_10084822 Ga0070676_100848223 365
161 3300005329 Ga0070683_100160679 Ga0070683_1001606792 365
162 3300005331 Ga0070670_100007051 Ga0070670_1000070513 365
163 3300005333 Ga0070677_10034059 Ga0070677_100340592 365
164 3300005336 Ga0070680_100117617 Ga0070680_1001176172 365
165 3300005339 Ga0070660_100000094 Ga0070660_10000009448 365
166 3300005339 Ga0070660_100009551 Ga0070660_1000095516 365
167 3300005339 Ga0070660_100029922 Ga0070660_1000299222 365
168 3300005339 Ga0070660_100237225 Ga0070660_1002372251 365
169 3300005345 Ga0070692_10002599 Ga0070692_100025995 365
170 3300005347 Ga0070668_100015320 Ga0070668_1000153201 365
171 3300005347 Ga0070668_100057058 Ga0070668_1000570582 365
172 3300005353 Ga0070669_100005288 Ga0070669_1000052887 365
173 3300005354 Ga0070675_100005462 Ga0070675_1000054625 365
174 3300005354 Ga0070675_100039561 Ga0070675_1000395615 365
175 3300005355 Ga0070671_100013412 Ga0070671_1000134126 365
176 3300005356 Ga0070674_100098226 Ga0070674_1000982262 365
177 3300005364 Ga0070673_100009962 Ga0070673_1000099625 365
178 3300005366 Ga0070659_100029131 Ga0070659_1000291313 365
179 3300005366 Ga0070659_100030156 Ga0070659_1000301564 365
180 3300005366 Ga0070659_100054684 Ga0070659_1000546843 365
181 3300005367 Ga0070667_100067003 Ga0070667_1000670033 365
182 3300005455 Ga0070663_100123715 Ga0070663_1001237152 365
183 3300005458 Ga0070681_10038443 Ga0070681_100384432 365
184 3300005458 Ga0070681_10139787 Ga0070681_101397872 365
185 3300005530 Ga0070679_100154643 Ga0070679_1001546433 365
186 3300005530 Ga0070679_100249680 Ga0070679_1002496802 365
187 3300005543 Ga0070672_100140378 Ga0070672_1001403782 365
188 3300005548 Ga0070665_100000773 Ga0070665_10000077311 365
189 3300005548 Ga0070665_100002165 Ga0070665_10000216510 365
190 3300005548 Ga0070665_100015879 Ga0070665_1000158792 365
191 3300005563 Ga0068855_100000433 Ga0068855_10000043355 365
192 3300005842 Ga0068858_100099964 Ga0068858_1000999642 365
193 3300005843 Ga0068860_100221071 Ga0068860_1002210712 365
194 3300006237 Ga0097621_100015473 Ga0097621_1000154732 365
195 3300006844 Ga0075428_100037880 Ga0075428_1000378807 365
196 3300009093 Ga0105240_10141090 Ga0105240_101410903 365
197 3300009094 Ga0111539_10083653 Ga0111539_100836533 365
198 3300009177 Ga0105248_10081523 Ga0105248_100815233 365
199 3300013102 Ga0157371_10008375 Ga0157371_100083756 365
200 3300013102 Ga0157371_10010504 Ga0157371_100105044 365
201 3300013102 Ga0157371_10027033 Ga0157371_100270332 365
202 3300013104 Ga0157370_10148605 Ga0157370_101486052 365
203 3300013296 Ga0157374_10105121 Ga0157374_101051212 365
204 3300013306 Ga0163162_10142509 Ga0163162_101425092 365
205 3300013306 Ga0163162_10148361 Ga0163162_101483612 365
206 3300014326 Ga0157380_10069224 Ga0157380_100692242 365
207 3300025315 Ga0207697_10027157 Ga0207697_100271572 365
208 3300025315 Ga0207697_10048127 Ga0207697_100481272 365
209 3300025893 Ga0207682_10015389 Ga0207682_100153892 365
210 3300025901 Ga0207688_10123252 Ga0207688_101232521 365
211 3300025904 Ga0207647_10010025 Ga0207647_100100252 365
212 3300025908 Ga0207643_10043333 Ga0207643_100433332 365
213 3300025909 Ga0207705_10000082 Ga0207705_1000008284 365
214 3300025909 Ga0207705_10000577 Ga0207705_1000057717 365
215 3300025909 Ga0207705_10030399 Ga0207705_100303992 365
216 3300025909 Ga0207705_10044117 Ga0207705_100441172 365
217 3300025909 Ga0207705_10136470 Ga0207705_101364703 365
218 3300025917 Ga0207660_10283758 Ga0207660_102837581 365
219 3300025919 Ga0207657_10000058 Ga0207657_1000005876 365
220 3300025919 Ga0207657_10000088 Ga0207657_1000008881 365
221 3300025919 Ga0207657_10001318 Ga0207657_1000131816 365
222 3300025919 Ga0207657_10009829 Ga0207657_100098298 365
223 3300025921 Ga0207652_10124193 Ga0207652_101241932 365
224 3300025921 Ga0207652_10220000 Ga0207652_102200001 365
225 3300025923 Ga0207681_10006621 Ga0207681_100066212 365
226 3300025925 Ga0207650_10085855 Ga0207650_100858552 365
227 3300025926 Ga0207659_10004265 Ga0207659_100042653 365
228 3300025926 Ga0207659_10016122 Ga0207659_100161225 365
229 3300025931 Ga0207644_10001421 Ga0207644_100014213 365
230 3300025931 Ga0207644_10024454 Ga0207644_100244543 365
231 3300025932 Ga0207690_10058366 Ga0207690_100583662 365
232 3300025933 Ga0207706_10040082 Ga0207706_100400821 365
233 3300025933 Ga0207706_10074170 Ga0207706_100741702 365
234 3300025933 Ga0207706_10193897 Ga0207706_101938972 365
235 3300025937 Ga0207669_10091883 Ga0207669_100918832 365
236 3300025938 Ga0207704_10049617 Ga0207704_100496172 365
237 3300025940 Ga0207691_10040293 Ga0207691_100402934 365
238 3300025941 Ga0207711_10302419 Ga0207711_103024192 365
239 3300025942 Ga0207689_10068299 Ga0207689_100682992 365
240 3300025944 Ga0207661_10043736 Ga0207661_100437364 365
241 3300025949 Ga0207667_10000114 Ga0207667_1000011472 365
242 3300025960 Ga0207651_10015123 Ga0207651_100151232 365
243 3300025960 Ga0207651_10081191 Ga0207651_100811912 365
244 3300025972 Ga0207668_10000252 Ga0207668_100002523 365
245 3300025972 Ga0207668_10023530 Ga0207668_100235303 365
246 3300025981 Ga0207640_10089502 Ga0207640_100895022 365
247 3300025986 Ga0207658_10121963 Ga0207658_101219632 365
248 3300026035 Ga0207703_10083265 Ga0207703_100832653 365
249 3300026041 Ga0207639_10110254 Ga0207639_101102542 365
250 3300026067 Ga0207678_10059080 Ga0207678_100590802 365
251 3300026088 Ga0207641_10024928 Ga0207641_100249283 365
252 3300027876 Ga0209974_10001458 Ga0209974_100014587 365
253 3300028379 Ga0268266_10006203 Ga0268266_100062034 365
254 3300028379 Ga0268266_10066110 Ga0268266_100661102 365
255 3300028379 Ga0268266_10067721 Ga0268266_100677212 365
256 3300028380 Ga0268265_10010043 Ga0268265_1001004310 365
257 3300028380 Ga0268265_10054650 Ga0268265_100546502 365
258 3300028381 Ga0268264_10049839 Ga0268264_100498392 365
259 3300031548 Ga0307408_100071706 Ga0307408_1000717062 365
260 3300031548 Ga0307408_100171110 Ga0307408_1001711102 365
261 3300031548 Ga0307408_100235439 Ga0307408_1002354392 365
262 3300031824 Ga0307413_10034475 Ga0307413_100344752 365
263 3300031903 Ga0307407_10015433 Ga0307407_100154334 365
264 3300031911 Ga0307412_10088619 Ga0307412_100886192 365
265 3300031995 Ga0307409_100039626 Ga0307409_1000396261 365
266 3300032002 Ga0307416_100025126 Ga0307416_1000251265 365
267 3300032004 Ga0307414_10003157 Ga0307414_100031578 365
268 3300032004 Ga0307414_10006073 Ga0307414_100060733 365
269 3300032005 Ga0307411_10129675 Ga0307411_101296752 365
270 3300032126 Ga0307415_100044990 Ga0307415_1000449903 365
271 3300032126 Ga0307415_100114385 Ga0307415_1001143852 365
272 3300037312 Ga0395899_0000230 Ga0395899_0000230_27009_28148 365
273 3300037312 Ga0395899_0131245 Ga0395899_0131245_400_1539 365
274 3300037418 Ga0395900_0000124 Ga0395900_0000124_78054_79193 365
275 3300037418 Ga0395900_0002843 Ga0395900_0002843_4199_5347 365
276 3300037418 Ga0395900_0322991 Ga0395900_0322991_269_1420 365
277 3300037418 Ga0395900_0427410 Ga0395900_0427410_108_1247 365
278 3300037466 Ga0395898_0109893 Ga0395898_0109893_208_1356 365
279 3300037471 Ga0395905_0001330 Ga0395905_0001330_25216_26364 365
280 3300037471 Ga0395905_0156960 Ga0395905_0156960_701_1840 365
281 3300038443 Ga0395901_0000031 Ga0395901_0000031_78497_79636 365
282 3300038443 Ga0395901_0000486 Ga0395901_0000486_22929_24077 365
283 3300042004 Ga0439445_0006468 Ga0439445_0006468_1010_2149 365
284 3300044656 Ga0466969_0042498 Ga0466969_0042498_678_1817 365
285 3300044684 Ga0466966_0039131 Ga0466966_0039131_1858_2997 365
286 3300046537 Ga0495598_0002925 Ga0495598_0002925_1498_2637 365
287 3300046537 Ga0495598_0047822 Ga0495598_0047822_30_1205 365
288 3300046539 Ga0495621_0000424 Ga0495621_0000424_5233_6372 365
289 3300046616 Ga0495668_0005119 Ga0495668_0005119_6281_7420 365
290 3300046684 Ga0495669_0000549 Ga0495669_0000549_10199_11338 365
291 3300046684 Ga0495669_0011641 Ga0495669_0011641_724_1863 365
292 3300046691 Ga0495670_0000340 Ga0495670_0000340_8374_9513 365
293 3300048910 Ga0496107_0292943 Ga0496107_0292943_54_1193 365
294 3300048911 Ga0496108_0000229 Ga0496108_0000229_37614_38753 365
295 3300048911 Ga0496108_0013201 Ga0496108_0013201_3963_5114 365
296 3300050511 nmdc:mga08y16_166870_c1 nmdc:mga08y16_166870_c1_214_1353 365
297 3300053139 Ga0500568_0000413 Ga0500568_0000413_9561_10736 365
298 3300053151 Ga0500604_0000038 Ga0500604_0000038_48384_49559 365
299 3300053153 Ga0500616_0000711 Ga0500616_0000711_7028_8203 365
300 3300000549 LJQas_1004399 LJQas_10043992 366
301 3300001904 JGI24736J21556_1001550 JGI24736J21556_10015503 366
302 3300001915 JGI24741J21665_1002364 JGI24741J21665_10023642 366
303 3300001976 JGI24752J21851_1003581 JGI24752J21851_10035812 366
304 3300001979 JGI24740J21852_10000544 JGI24740J21852_1000054418 366
305 3300001979 JGI24740J21852_10002386 JGI24740J21852_1000238610 366
306 3300001979 JGI24740J21852_10010552 JGI24740J21852_100105522 366
307 3300001979 JGI24740J21852_10014802 JGI24740J21852_100148023 366
308 3300001979 JGI24740J21852_10015688 JGI24740J21852_100156883 366
309 3300001979 JGI24740J21852_10017625 JGI24740J21852_100176252 366
310 3300001979 JGI24740J21852_10023136 JGI24740J21852_100231362 366
311 3300001989 JGI24739J22299_10000015 JGI24739J22299_1000001530 366
312 3300001989 JGI24739J22299_10000304 JGI24739J22299_100003044 366
313 3300001989 JGI24739J22299_10047543 JGI24739J22299_100475431 366
314 3300001990 JGI24737J22298_10000005 JGI24737J22298_1000000568 366
315 3300001990 JGI24737J22298_10000678 JGI24737J22298_100006783 366
316 3300001990 JGI24737J22298_10002218 JGI24737J22298_100022188 366
317 3300001990 JGI24737J22298_10004157 JGI24737J22298_100041575 366
318 3300002067 JGI24735J21928_10030068 JGI24735J21928_100300681 366
319 3300002075 JGI24738J21930_10000548 JGI24738J21930_100005486 366
320 3300002075 JGI24738J21930_10006684 JGI24738J21930_100066842 366
321 3300002239 JGI24034J26672_10003677 JGI24034J26672_100036772 366
322 3300005290 Ga0065712_10073399 Ga0065712_100733994 366
323 3300005293 Ga0065715_10172311 Ga0065715_101723111 366
324 3300005327 Ga0070658_10000117 Ga0070658_1000011742 366
325 3300005327 Ga0070658_10003844 Ga0070658_1000384412 366
326 3300005327 Ga0070658_10009142 Ga0070658_100091425 366
327 3300005327 Ga0070658_10018330 Ga0070658_100183302 366
328 3300005327 Ga0070658_10034357 Ga0070658_100343572 366
329 3300005327 Ga0070658_10042405 Ga0070658_100424054 366
330 3300005327 Ga0070658_10056372 Ga0070658_100563722 366
331 3300005327 Ga0070658_10135957 Ga0070658_101359572 366
332 3300005327 Ga0070658_10260171 Ga0070658_102601711 366
333 3300005328 Ga0070676_10016878 Ga0070676_100168782 366
334 3300005328 Ga0070676_10084577 Ga0070676_100845772 366
335 3300005328 Ga0070676_10115745 Ga0070676_101157452 366
336 3300005329 Ga0070683_100013167 Ga0070683_1000131673 366
337 3300005329 Ga0070683_100031513 Ga0070683_1000315132 366
338 3300005329 Ga0070683_100054468 Ga0070683_1000544682 366
339 3300005329 Ga0070683_100123412 Ga0070683_1001234122 366
340 3300005330 Ga0070690_100028176 Ga0070690_1000281762 366
341 3300005330 Ga0070690_100045138 Ga0070690_1000451382 366
342 3300005331 Ga0070670_100004497 Ga0070670_1000044974 366
343 3300005331 Ga0070670_100006350 Ga0070670_1000063506 366
344 3300005331 Ga0070670_100010222 Ga0070670_1000102222 366
345 3300005331 Ga0070670_100011118 Ga0070670_1000111187 366
346 3300005331 Ga0070670_100038081 Ga0070670_1000380815 366
347 3300005331 Ga0070670_100054479 Ga0070670_1000544792 366
348 3300005331 Ga0070670_100078090 Ga0070670_1000780902 366
349 3300005331 Ga0070670_100147005 Ga0070670_1001470052 366
350 3300005331 Ga0070670_100254087 Ga0070670_1002540872 366
351 3300005333 Ga0070677_10023811 Ga0070677_100238114 366
352 3300005334 Ga0068869_100000003 Ga0068869_10000000327 366
353 3300005334 Ga0068869_100019239 Ga0068869_1000192394 366
354 3300005334 Ga0068869_100122633 Ga0068869_1001226331 366
355 3300005334 Ga0068869_100154922 Ga0068869_1001549222 366
356 3300005335 Ga0070666_10000384 Ga0070666_1000038431 366
357 3300005335 Ga0070666_10000534 Ga0070666_1000053426 366
358 3300005335 Ga0070666_10001262 Ga0070666_1000126215 366
359 3300005335 Ga0070666_10002698 Ga0070666_100026981 366
360 3300005336 Ga0070680_100001953 Ga0070680_1000019536 366
361 3300005336 Ga0070680_100006964 Ga0070680_1000069647 366
362 3300005336 Ga0070680_100028608 Ga0070680_1000286086 366
363 3300005336 Ga0070680_100037727 Ga0070680_1000377272 366
364 3300005336 Ga0070680_100143229 Ga0070680_1001432292 366
365 3300005337 Ga0070682_100009329 Ga0070682_1000093292 366
366 3300005338 Ga0068868_100000536 Ga0068868_10000053628 366
367 3300005338 Ga0068868_100000887 Ga0068868_1000008874 366
368 3300005338 Ga0068868_100137831 Ga0068868_1001378312 366
369 3300005338 Ga0068868_100169526 Ga0068868_1001695262 366
370 3300005339 Ga0070660_100000142 Ga0070660_10000014242 366
371 3300005339 Ga0070660_100002289 Ga0070660_1000022897 366
372 3300005339 Ga0070660_100002417 Ga0070660_10000241712 366
373 3300005339 Ga0070660_100004449 Ga0070660_1000044495 366
374 3300005339 Ga0070660_100009508 Ga0070660_1000095081 366
375 3300005339 Ga0070660_100029490 Ga0070660_1000294904 366
376 3300005339 Ga0070660_100041128 Ga0070660_1000411282 366
377 3300005339 Ga0070660_100079144 Ga0070660_1000791442 366
378 3300005340 Ga0070689_100041480 Ga0070689_1000414803 366
379 3300005341 Ga0070691_10029546 Ga0070691_100295462 366
380 3300005341 Ga0070691_10058943 Ga0070691_100589432 366
381 3300005344 Ga0070661_100000001 Ga0070661_100000001295 366
382 3300005344 Ga0070661_100000079 Ga0070661_10000007941 366
383 3300005344 Ga0070661_100002613 Ga0070661_10000261314 366
384 3300005344 Ga0070661_100003445 Ga0070661_1000034453 366
385 3300005344 Ga0070661_100010117 Ga0070661_1000101171 366
386 3300005344 Ga0070661_100037144 Ga0070661_1000371443 366
387 3300005344 Ga0070661_100045184 Ga0070661_1000451842 366
388 3300005344 Ga0070661_100046790 Ga0070661_1000467902 366
389 3300005344 Ga0070661_100059469 Ga0070661_1000594692 366
390 3300005344 Ga0070661_100071962 Ga0070661_1000719623 366
391 3300005345 Ga0070692_10010528 Ga0070692_100105283 366
392 3300005345 Ga0070692_10018215 Ga0070692_100182153 366
393 3300005347 Ga0070668_100000002 Ga0070668_10000000289 366
394 3300005347 Ga0070668_100083895 Ga0070668_1000838952 366
395 3300005347 Ga0070668_100113616 Ga0070668_1001136162 366
396 3300005347 Ga0070668_100114096 Ga0070668_1001140962 366
397 3300005347 Ga0070668_100281310 Ga0070668_1002813101 366
398 3300005353 Ga0070669_100000128 Ga0070669_10000012849 366
399 3300005353 Ga0070669_100057122 Ga0070669_1000571223 366
400 3300005353 Ga0070669_100070060 Ga0070669_1000700602 366
401 3300005353 Ga0070669_100128471 Ga0070669_1001284712 366
402 3300005354 Ga0070675_100006027 Ga0070675_1000060277 366
403 3300005355 Ga0070671_100001206 Ga0070671_10000120610 366
404 3300005355 Ga0070671_100001969 Ga0070671_1000019695 366
405 3300005355 Ga0070671_100002164 Ga0070671_1000021649 366
406 3300005355 Ga0070671_100004366 Ga0070671_1000043667 366
407 3300005355 Ga0070671_100009312 Ga0070671_1000093125 366
408 3300005355 Ga0070671_100010462 Ga0070671_1000104624 366
409 3300005355 Ga0070671_100014419 Ga0070671_1000144199 366
410 3300005355 Ga0070671_100036126 Ga0070671_1000361264 366
411 3300005355 Ga0070671_100049219 Ga0070671_1000492194 366
412 3300005355 Ga0070671_100116759 Ga0070671_1001167592 366
413 3300005355 Ga0070671_100129901 Ga0070671_1001299012 366
414 3300005355 Ga0070671_100165248 Ga0070671_1001652482 366
415 3300005356 Ga0070674_100086664 Ga0070674_1000866641 366
416 3300005356 Ga0070674_100155338 Ga0070674_1001553381 366
417 3300005356 Ga0070674_100248298 Ga0070674_1002482981 366
418 3300005364 Ga0070673_100000246 Ga0070673_10000024616 366
419 3300005364 Ga0070673_100017516 Ga0070673_1000175162 366
420 3300005364 Ga0070673_100062444 Ga0070673_1000624442 366
421 3300005364 Ga0070673_100074286 Ga0070673_1000742861 366
422 3300005364 Ga0070673_100089451 Ga0070673_1000894512 366
423 3300005364 Ga0070673_100107337 Ga0070673_1001073372 366
424 3300005366 Ga0070659_100000125 Ga0070659_10000012553 366
425 3300005366 Ga0070659_100000220 Ga0070659_10000022048 366
426 3300005366 Ga0070659_100001510 Ga0070659_1000015102 366
427 3300005366 Ga0070659_100007001 Ga0070659_1000070012 366
428 3300005366 Ga0070659_100015581 Ga0070659_1000155814 366
429 3300005366 Ga0070659_100016450 Ga0070659_1000164504 366
430 3300005366 Ga0070659_100019702 Ga0070659_1000197025 366
431 3300005366 Ga0070659_100035396 Ga0070659_1000353962 366
432 3300005366 Ga0070659_100086298 Ga0070659_1000862982 366
433 3300005366 Ga0070659_100151867 Ga0070659_1001518672 366
434 3300005366 Ga0070659_100244921 Ga0070659_1002449211 366
435 3300005367 Ga0070667_100001773 Ga0070667_10000177311 366
436 3300005367 Ga0070667_100004802 Ga0070667_1000048025 366
437 3300005367 Ga0070667_100005335 Ga0070667_10000533511 366
438 3300005367 Ga0070667_100013375 Ga0070667_1000133752 366
439 3300005367 Ga0070667_100014642 Ga0070667_1000146426 366
440 3300005367 Ga0070667_100017315 Ga0070667_1000173156 366
441 3300005367 Ga0070667_100041439 Ga0070667_1000414396 366
442 3300005367 Ga0070667_100042727 Ga0070667_1000427272 366
443 3300005367 Ga0070667_100049589 Ga0070667_1000495893 366
444 3300005367 Ga0070667_100068863 Ga0070667_1000688632 366
445 3300005367 Ga0070667_100101671 Ga0070667_1001016712 366
446 3300005367 Ga0070667_100104293 Ga0070667_1001042932 366
447 3300005435 Ga0070714_100013989 Ga0070714_1000139893 366
448 3300005435 Ga0070714_100093687 Ga0070714_1000936872 366
449 3300005435 Ga0070714_100214675 Ga0070714_1002146752 366
450 3300005435 Ga0070714_100356038 Ga0070714_1003560381 366
451 3300005436 Ga0070713_100036714 Ga0070713_1000367144 366
452 3300005436 Ga0070713_100080914 Ga0070713_1000809141 366
453 3300005444 Ga0070694_100007086 Ga0070694_1000070863 366
454 3300005455 Ga0070663_100002981 Ga0070663_1000029814 366
455 3300005455 Ga0070663_100005169 Ga0070663_1000051699 366
456 3300005455 Ga0070663_100014918 Ga0070663_1000149185 366
457 3300005455 Ga0070663_100087254 Ga0070663_1000872541 366
458 3300005455 Ga0070663_100139246 Ga0070663_1001392462 366
459 3300005456 Ga0070678_100006388 Ga0070678_1000063882 366
460 3300005456 Ga0070678_100052352 Ga0070678_1000523522 366
461 3300005457 Ga0070662_100000066 Ga0070662_10000006641 366
462 3300005457 Ga0070662_100001002 Ga0070662_1000010024 366
463 3300005457 Ga0070662_100004007 Ga0070662_10000400710 366
464 3300005457 Ga0070662_100010506 Ga0070662_1000105064 366
465 3300005457 Ga0070662_100013967 Ga0070662_1000139671 366
466 3300005457 Ga0070662_100014154 Ga0070662_1000141544 366
467 3300005457 Ga0070662_100058177 Ga0070662_1000581772 366
468 3300005457 Ga0070662_100182984 Ga0070662_1001829842 366
469 3300005457 Ga0070662_100201764 Ga0070662_1002017641 366
470 3300005458 Ga0070681_10016910 Ga0070681_100169102 366
471 3300005458 Ga0070681_10031083 Ga0070681_100310835 366
472 3300005459 Ga0068867_100006521 Ga0068867_1000065219 366
473 3300005459 Ga0068867_100019804 Ga0068867_1000198044 366
474 3300005459 Ga0068867_100074481 Ga0068867_1000744811 366
475 3300005459 Ga0068867_100093177 Ga0068867_1000931772 366
476 3300005530 Ga0070679_100014521 Ga0070679_1000145213 366
477 3300005530 Ga0070679_100053073 Ga0070679_1000530732 366
478 3300005530 Ga0070679_100069981 Ga0070679_1000699812 366
479 3300005530 Ga0070679_100169725 Ga0070679_1001697252 366
480 3300005535 Ga0070684_100014014 Ga0070684_1000140147 366
481 3300005535 Ga0070684_100066269 Ga0070684_1000662693 366
482 3300005539 Ga0068853_100000182 Ga0068853_10000018231 366
483 3300005539 Ga0068853_100000445 Ga0068853_1000004452 366
484 3300005539 Ga0068853_100004218 Ga0068853_1000042189 366
485 3300005539 Ga0068853_100006561 Ga0068853_1000065619 366
486 3300005539 Ga0068853_100012286 Ga0068853_1000122867 366
487 3300005539 Ga0068853_100176248 Ga0068853_1001762482 366
488 3300005543 Ga0070672_100000678 Ga0070672_10000067814 366
489 3300005543 Ga0070672_100002918 Ga0070672_1000029187 366
490 3300005543 Ga0070672_100004316 Ga0070672_10000431612 366
491 3300005543 Ga0070672_100021719 Ga0070672_1000217193 366
492 3300005543 Ga0070672_100119167 Ga0070672_1001191671 366
493 3300005546 Ga0070696_100148278 Ga0070696_1001482782 366
494 3300005548 Ga0070665_100000670 Ga0070665_1000006708 366
495 3300005548 Ga0070665_100005819 Ga0070665_1000058199 366
496 3300005548 Ga0070665_100010208 Ga0070665_1000102086 366
497 3300005548 Ga0070665_100024260 Ga0070665_1000242608 366
498 3300005548 Ga0070665_100032113 Ga0070665_1000321132 366
499 3300005548 Ga0070665_100078718 Ga0070665_1000787181 366
500 3300005563 Ga0068855_100000886 Ga0068855_1000008865 366
501 3300005563 Ga0068855_100005671 Ga0068855_10000567111 366
502 3300005563 Ga0068855_100024023 Ga0068855_1000240235 366
503 3300005563 Ga0068855_100031762 Ga0068855_1000317622 366
504 3300005563 Ga0068855_100255014 Ga0068855_1002550142 366
505 3300005563 Ga0068855_100323702 Ga0068855_1003237023 366
506 3300005564 Ga0070664_100001385 Ga0070664_10000138511 366
507 3300005564 Ga0070664_100002224 Ga0070664_1000022248 366
508 3300005564 Ga0070664_100005437 Ga0070664_1000054373 366
509 3300005564 Ga0070664_100027097 Ga0070664_1000270971 366
510 3300005564 Ga0070664_100045995 Ga0070664_1000459951 366
511 3300005564 Ga0070664_100076997 Ga0070664_1000769972 366
512 3300005564 Ga0070664_100083545 Ga0070664_1000835453 366
513 3300005564 Ga0070664_100163388 Ga0070664_1001633882 366
514 3300005564 Ga0070664_100283811 Ga0070664_1002838112 366
515 3300005577 Ga0068857_100000026 Ga0068857_10000002660 366
516 3300005577 Ga0068857_100001402 Ga0068857_1000014027 366
517 3300005577 Ga0068857_100041158 Ga0068857_1000411583 366
518 3300005577 Ga0068857_100063641 Ga0068857_1000636412 366
519 3300005577 Ga0068857_100085134 Ga0068857_1000851343 366
520 3300005577 Ga0068857_100259020 Ga0068857_1002590202 366
521 3300005577 Ga0068857_100299830 Ga0068857_1002998301 366
522 3300005578 Ga0068854_100000204 Ga0068854_10000020418 366
523 3300005578 Ga0068854_100006310 Ga0068854_1000063102 366
524 3300005578 Ga0068854_100032336 Ga0068854_1000323362 366
525 3300005578 Ga0068854_100046960 Ga0068854_1000469603 366
526 3300005578 Ga0068854_100053379 Ga0068854_1000533792 366
527 3300005578 Ga0068854_100068762 Ga0068854_1000687623 366
528 3300005578 Ga0068854_100094057 Ga0068854_1000940572 366
529 3300005578 Ga0068854_100135078 Ga0068854_1001350782 366
530 3300005578 Ga0068854_100144123 Ga0068854_1001441231 366
531 3300005578 Ga0068854_100173009 Ga0068854_1001730092 366
532 3300005614 Ga0068856_100000235 Ga0068856_10000023540 366
533 3300005614 Ga0068856_100365504 Ga0068856_1003655041 366
534 3300005616 Ga0068852_100000152 Ga0068852_10000015229 366
535 3300005616 Ga0068852_100011189 Ga0068852_1000111892 366
536 3300005616 Ga0068852_100011974 Ga0068852_1000119746 366
537 3300005616 Ga0068852_100019730 Ga0068852_1000197302 366
538 3300005616 Ga0068852_100031029 Ga0068852_1000310294 366
539 3300005616 Ga0068852_100096386 Ga0068852_1000963862 366
540 3300005616 Ga0068852_100165895 Ga0068852_1001658953 366
541 3300005616 Ga0068852_100408222 Ga0068852_1004082221 366
542 3300005617 Ga0068859_100000088 Ga0068859_10000008870 366
543 3300005617 Ga0068859_100012058 Ga0068859_1000120585 366
544 3300005617 Ga0068859_100013717 Ga0068859_10001371710 366
545 3300005617 Ga0068859_100018023 Ga0068859_1000180233 366
546 3300005617 Ga0068859_100021544 Ga0068859_1000215442 366
547 3300005617 Ga0068859_100062288 Ga0068859_1000622883 366
548 3300005617 Ga0068859_100124232 Ga0068859_1001242322 366
549 3300005618 Ga0068864_100000047 Ga0068864_10000004738 366
550 3300005618 Ga0068864_100000136 Ga0068864_10000013631 366
551 3300005618 Ga0068864_100002623 Ga0068864_10000262314 366
552 3300005618 Ga0068864_100006765 Ga0068864_1000067656 366
553 3300005618 Ga0068864_100007255 Ga0068864_1000072551 366
554 3300005618 Ga0068864_100147199 Ga0068864_1001471992 366
555 3300005718 Ga0068866_10031414 Ga0068866_100314143 366
556 3300005834 Ga0068851_10015789 Ga0068851_100157892 366
557 3300005834 Ga0068851_10044826 Ga0068851_100448261 366
558 3300005841 Ga0068863_100000008 Ga0068863_100000008104 366
559 3300005841 Ga0068863_100000289 Ga0068863_10000028935 366
560 3300005841 Ga0068863_100000384 Ga0068863_10000038432 366
561 3300005841 Ga0068863_100006559 Ga0068863_10000655913 366
562 3300005841 Ga0068863_100053279 Ga0068863_1000532792 366
563 3300005841 Ga0068863_100073985 Ga0068863_1000739852 366
564 3300005841 Ga0068863_100457101 Ga0068863_1004571011 366
565 3300005842 Ga0068858_100000063 Ga0068858_10000006356 366
566 3300005842 Ga0068858_100000425 Ga0068858_10000042515 366
567 3300005842 Ga0068858_100012549 Ga0068858_1000125494 366
568 3300005842 Ga0068858_100031041 Ga0068858_1000310414 366
569 3300005842 Ga0068858_100060551 Ga0068858_1000605512 366
570 3300005842 Ga0068858_100092723 Ga0068858_1000927232 366
571 3300005842 Ga0068858_100167019 Ga0068858_1001670192 366
572 3300005842 Ga0068858_100215088 Ga0068858_1002150882 366
573 3300005843 Ga0068860_100000607 Ga0068860_10000060742 366
574 3300005843 Ga0068860_100024802 Ga0068860_1000248024 366
575 3300005843 Ga0068860_100109311 Ga0068860_1001093112 366
576 3300005843 Ga0068860_100308100 Ga0068860_1003081002 366
577 3300005844 Ga0068862_100027449 Ga0068862_1000274493 366
578 3300005844 Ga0068862_100032732 Ga0068862_1000327322 366
579 3300005844 Ga0068862_100041919 Ga0068862_1000419194 366
580 3300005844 Ga0068862_100067539 Ga0068862_1000675394 366
581 3300005844 Ga0068862_100091981 Ga0068862_1000919812 366
582 3300005844 Ga0068862_100104218 Ga0068862_1001042183 366
583 3300006028 Ga0070717_10015803 Ga0070717_100158031 366
584 3300006195 Ga0075366_10070439 Ga0075366_100704392 366
585 3300006237 Ga0097621_100029459 Ga0097621_1000294595 366
586 3300006237 Ga0097621_100047361 Ga0097621_1000473611 366
587 3300006237 Ga0097621_100053897 Ga0097621_1000538973 366
588 3300006237 Ga0097621_100085939 Ga0097621_1000859392 366
589 3300006237 Ga0097621_100228427 Ga0097621_1002284272 366
590 3300006358 Ga0068871_100024884 Ga0068871_1000248842 366
591 3300006358 Ga0068871_100043099 Ga0068871_1000430993 366
592 3300006358 Ga0068871_100076875 Ga0068871_1000768753 366
593 3300006881 Ga0068865_100003059 Ga0068865_10000305911 366
594 3300006881 Ga0068865_100012784 Ga0068865_1000127842 366
595 3300006881 Ga0068865_100031129 Ga0068865_1000311293 366
596 3300006931 Ga0097620_100000088 Ga0097620_10000008870 366
597 3300006931 Ga0097620_100012058 Ga0097620_1000120585 366
598 3300006931 Ga0097620_100013717 Ga0097620_1000137174 366
599 3300006931 Ga0097620_100018024 Ga0097620_1000180246 366
600 3300006931 Ga0097620_100021544 Ga0097620_1000215442 366
601 3300006931 Ga0097620_100062286 Ga0097620_1000622863 366
602 3300006931 Ga0097620_100124224 Ga0097620_1001242242 366
603 3300009092 Ga0105250_10022385 Ga0105250_100223852 366
604 3300009093 Ga0105240_10002881 Ga0105240_1000288110 366
605 3300009093 Ga0105240_10049925 Ga0105240_100499252 366
606 3300009094 Ga0111539_10308214 Ga0111539_103082142 366
607 3300009098 Ga0105245_10000062 Ga0105245_1000006269 366
608 3300009098 Ga0105245_10058056 Ga0105245_100580562 366
609 3300009148 Ga0105243_10010853 Ga0105243_100108533 366
610 3300009148 Ga0105243_10039322 Ga0105243_100393222 366
611 3300009174 Ga0105241_10075157 Ga0105241_100751572 366
612 3300009174 Ga0105241_10083255 Ga0105241_100832552 366
613 3300009176 Ga0105242_10123248 Ga0105242_101232482 366
614 3300009177 Ga0105248_10000117 Ga0105248_1000011740 366
615 3300009177 Ga0105248_10000169 Ga0105248_1000016962 366
616 3300009177 Ga0105248_10001782 Ga0105248_1000178227 366
617 3300009177 Ga0105248_10002506 Ga0105248_100025061 366
618 3300009177 Ga0105248_10051429 Ga0105248_100514294 366
619 3300009177 Ga0105248_10051972 Ga0105248_100519723 366
620 3300009177 Ga0105248_10126247 Ga0105248_101262471 366
621 3300009177 Ga0105248_10139911 Ga0105248_101399112 366
622 3300009545 Ga0105237_10013286 Ga0105237_100132863 366
623 3300009545 Ga0105237_10025683 Ga0105237_100256832 366
624 3300009551 Ga0105238_10006598 Ga0105238_1000659811 366
625 3300009551 Ga0105238_10009023 Ga0105238_100090237 366
626 3300009551 Ga0105238_10015871 Ga0105238_100158715 366
627 3300009551 Ga0105238_10064121 Ga0105238_100641212 366
628 3300009551 Ga0105238_10092765 Ga0105238_100927652 366
629 3300009551 Ga0105238_10198112 Ga0105238_101981121 366
630 3300009553 Ga0105249_10006127 Ga0105249_100061273 366
631 3300009553 Ga0105249_10009139 Ga0105249_1000913911 366
632 3300009553 Ga0105249_10015607 Ga0105249_100156076 366
633 3300009553 Ga0105249_10048313 Ga0105249_100483132 366
634 3300010375 Ga0105239_10020230 Ga0105239_100202308 366
635 3300010375 Ga0105239_10056401 Ga0105239_100564012 366
636 3300010375 Ga0105239_10190764 Ga0105239_101907642 366
637 3300011119 Ga0105246_10037424 Ga0105246_100374242 366
638 3300011119 Ga0105246_10075472 Ga0105246_100754722 366
639 3300011119 Ga0105246_10117595 Ga0105246_101175952 366
640 3300013100 Ga0157373_10002525 Ga0157373_100025255 366
641 3300013100 Ga0157373_10005644 Ga0157373_100056444 366
642 3300013100 Ga0157373_10010638 Ga0157373_100106384 366
643 3300013100 Ga0157373_10038248 Ga0157373_100382482 366
644 3300013100 Ga0157373_10068678 Ga0157373_100686782 366
645 3300013100 Ga0157373_10106386 Ga0157373_101063862 366
646 3300013100 Ga0157373_10128131 Ga0157373_101281312 366
647 3300013100 Ga0157373_10128507 Ga0157373_101285072 366
648 3300013100 Ga0157373_10136904 Ga0157373_101369041 366
649 3300013102 Ga0157371_10000144 Ga0157371_1000014467 366
650 3300013102 Ga0157371_10002441 Ga0157371_1000244121 366
651 3300013102 Ga0157371_10010308 Ga0157371_100103087 366
652 3300013102 Ga0157371_10015808 Ga0157371_100158084 366
653 3300013102 Ga0157371_10016679 Ga0157371_100166795 366
654 3300013102 Ga0157371_10058571 Ga0157371_100585712 366
655 3300013102 Ga0157371_10112580 Ga0157371_101125802 366
656 3300013102 Ga0157371_10153188 Ga0157371_101531881 366
657 3300013104 Ga0157370_10004946 Ga0157370_1000494611 366
658 3300013104 Ga0157370_10014333 Ga0157370_100143331 366
659 3300013104 Ga0157370_10016222 Ga0157370_100162222 366
660 3300013104 Ga0157370_10022797 Ga0157370_100227976 366
661 3300013104 Ga0157370_10053949 Ga0157370_100539492 366
662 3300013105 Ga0157369_10001177 Ga0157369_1000117711 366
663 3300013105 Ga0157369_10012187 Ga0157369_100121875 366
664 3300013105 Ga0157369_10012443 Ga0157369_1001244311 366
665 3300013105 Ga0157369_10017428 Ga0157369_100174282 366
666 3300013105 Ga0157369_10028828 Ga0157369_100288286 366
667 3300013105 Ga0157369_10044642 Ga0157369_100446424 366
668 3300013105 Ga0157369_10045153 Ga0157369_100451534 366
669 3300013296 Ga0157374_10085227 Ga0157374_100852272 366
670 3300013296 Ga0157374_10101905 Ga0157374_101019052 366
671 3300013297 Ga0157378_10006458 Ga0157378_100064585 366
672 3300013297 Ga0157378_10034648 Ga0157378_100346481 366
673 3300013297 Ga0157378_10285312 Ga0157378_102853121 366
674 3300013297 Ga0157378_10301857 Ga0157378_103018572 366
675 3300013306 Ga0163162_10002163 Ga0163162_1000216312 366
676 3300013306 Ga0163162_10003404 Ga0163162_1000340414 366
677 3300013306 Ga0163162_10081738 Ga0163162_100817383 366
678 3300013306 Ga0163162_10142356 Ga0163162_101423563 366
679 3300013306 Ga0163162_10275442 Ga0163162_102754421 366
680 3300013307 Ga0157372_10001708 Ga0157372_1000170817 366
681 3300013307 Ga0157372_10030209 Ga0157372_100302092 366
682 3300013307 Ga0157372_10160369 Ga0157372_101603694 366
683 3300013307 Ga0157372_10191170 Ga0157372_101911702 366
684 3300013307 Ga0157372_10243341 Ga0157372_102433412 366
685 3300013307 Ga0157372_10510083 Ga0157372_105100832 366
686 3300013308 Ga0157375_10004450 Ga0157375_100044506 366
687 3300013308 Ga0157375_10008495 Ga0157375_100084959 366
688 3300013308 Ga0157375_10008940 Ga0157375_100089409 366
689 3300013308 Ga0157375_10022465 Ga0157375_100224652 366
690 3300014325 Ga0163163_10000170 Ga0163163_1000017054 366
691 3300014325 Ga0163163_10000357 Ga0163163_100003575 366
692 3300014325 Ga0163163_10065312 Ga0163163_100653122 366
693 3300014325 Ga0163163_10072781 Ga0163163_100727813 366
694 3300014325 Ga0163163_10139701 Ga0163163_101397012 366
695 3300014325 Ga0163163_10209056 Ga0163163_102090562 366
696 3300014325 Ga0163163_10251391 Ga0163163_102513912 366
697 3300014745 Ga0157377_10051254 Ga0157377_100512542 366
698 3300014968 Ga0157379_10001773 Ga0157379_100017735 366
699 3300014968 Ga0157379_10014561 Ga0157379_100145614 366
700 3300014968 Ga0157379_10107630 Ga0157379_101076302 366
701 3300014969 Ga0157376_10038567 Ga0157376_100385673 366
702 3300021388 Ga0213875_10002893 Ga0213875_100028938 366
703 3300025290 Ga0207673_1001964 Ga0207673_10019642 366
704 3300025315 Ga0207697_10000235 Ga0207697_1000023529 366
705 3300025321 Ga0207656_10057570 Ga0207656_100575701 366
706 3300025711 Ga0207696_1015759 Ga0207696_10157593 366
707 3300025893 Ga0207682_10041807 Ga0207682_100418072 366
708 3300025899 Ga0207642_10002954 Ga0207642_100029545 366
709 3300025899 Ga0207642_10053985 Ga0207642_100539852 366
710 3300025901 Ga0207688_10000105 Ga0207688_1000010531 366
711 3300025901 Ga0207688_10056236 Ga0207688_100562362 366
712 3300025903 Ga0207680_10000755 Ga0207680_1000075510 366
713 3300025903 Ga0207680_10001346 Ga0207680_100013464 366
714 3300025903 Ga0207680_10001764 Ga0207680_100017645 366
715 3300025903 Ga0207680_10015973 Ga0207680_100159734 366
716 3300025904 Ga0207647_10000317 Ga0207647_100003178 366
717 3300025904 Ga0207647_10000484 Ga0207647_1000048435 366
718 3300025904 Ga0207647_10000627 Ga0207647_1000062715 366
719 3300025904 Ga0207647_10001120 Ga0207647_1000112016 366
720 3300025904 Ga0207647_10004111 Ga0207647_100041114 366
721 3300025904 Ga0207647_10020941 Ga0207647_100209412 366
722 3300025904 Ga0207647_10024490 Ga0207647_100244905 366
723 3300025904 Ga0207647_10088584 Ga0207647_100885842 366
724 3300025907 Ga0207645_10005370 Ga0207645_100053708 366
725 3300025907 Ga0207645_10023139 Ga0207645_100231394 366
726 3300025907 Ga0207645_10059532 Ga0207645_100595322 366
727 3300025907 Ga0207645_10089728 Ga0207645_100897282 366
728 3300025909 Ga0207705_10000101 Ga0207705_100001017 366
729 3300025909 Ga0207705_10000245 Ga0207705_100002452 366
730 3300025909 Ga0207705_10002862 Ga0207705_100028628 366
731 3300025909 Ga0207705_10006718 Ga0207705_100067186 366
732 3300025909 Ga0207705_10011113 Ga0207705_100111138 366
733 3300025909 Ga0207705_10011882 Ga0207705_100118822 366
734 3300025909 Ga0207705_10012649 Ga0207705_100126492 366
735 3300025909 Ga0207705_10031608 Ga0207705_100316083 366
736 3300025909 Ga0207705_10040749 Ga0207705_100407494 366
737 3300025909 Ga0207705_10050104 Ga0207705_100501043 366
738 3300025909 Ga0207705_10056798 Ga0207705_100567982 366
739 3300025909 Ga0207705_10080035 Ga0207705_100800352 366
740 3300025909 Ga0207705_10095348 Ga0207705_100953481 366
741 3300025909 Ga0207705_10165331 Ga0207705_101653311 366
742 3300025909 Ga0207705_10243310 Ga0207705_102433101 366
743 3300025912 Ga0207707_10045159 Ga0207707_100451592 366
744 3300025912 Ga0207707_10101349 Ga0207707_101013492 366
745 3300025913 Ga0207695_10003145 Ga0207695_1000314521 366
746 3300025913 Ga0207695_10008146 Ga0207695_100081462 366
747 3300025913 Ga0207695_10232336 Ga0207695_102323362 366
748 3300025915 Ga0207693_10285379 Ga0207693_102853791 366
749 3300025917 Ga0207660_10000687 Ga0207660_1000068712 366
750 3300025917 Ga0207660_10002719 Ga0207660_100027192 366
751 3300025917 Ga0207660_10052233 Ga0207660_100522332 366
752 3300025917 Ga0207660_10076390 Ga0207660_100763902 366
753 3300025917 Ga0207660_10158661 Ga0207660_101586612 366
754 3300025919 Ga0207657_10000244 Ga0207657_1000024452 366
755 3300025919 Ga0207657_10000797 Ga0207657_1000079735 366
756 3300025919 Ga0207657_10002075 Ga0207657_100020754 366
757 3300025919 Ga0207657_10009721 Ga0207657_100097216 366
758 3300025919 Ga0207657_10010387 Ga0207657_100103872 366
759 3300025919 Ga0207657_10035659 Ga0207657_100356595 366
760 3300025919 Ga0207657_10046157 Ga0207657_100461572 366
761 3300025919 Ga0207657_10060807 Ga0207657_100608074 366
762 3300025919 Ga0207657_10063928 Ga0207657_100639282 366
763 3300025919 Ga0207657_10096581 Ga0207657_100965811 366
764 3300025920 Ga0207649_10000011 Ga0207649_10000011201 366
765 3300025920 Ga0207649_10000135 Ga0207649_1000013544 366
766 3300025920 Ga0207649_10006022 Ga0207649_100060221 366
767 3300025920 Ga0207649_10016775 Ga0207649_100167753 366
768 3300025920 Ga0207649_10018149 Ga0207649_100181492 366
769 3300025920 Ga0207649_10022318 Ga0207649_100223182 366
770 3300025920 Ga0207649_10027969 Ga0207649_100279691 366
771 3300025920 Ga0207649_10034522 Ga0207649_100345223 366
772 3300025920 Ga0207649_10042422 Ga0207649_100424222 366
773 3300025920 Ga0207649_10104812 Ga0207649_101048122 366
774 3300025921 Ga0207652_10010947 Ga0207652_100109473 366
775 3300025921 Ga0207652_10068726 Ga0207652_100687262 366
776 3300025921 Ga0207652_10099089 Ga0207652_100990892 366
777 3300025921 Ga0207652_10127545 Ga0207652_101275451 366
778 3300025921 Ga0207652_10280708 Ga0207652_102807082 366
779 3300025923 Ga0207681_10000464 Ga0207681_100004645 366
780 3300025923 Ga0207681_10047610 Ga0207681_100476102 366
781 3300025924 Ga0207694_10000809 Ga0207694_1000080924 366
782 3300025924 Ga0207694_10041865 Ga0207694_100418653 366
783 3300025924 Ga0207694_10044481 Ga0207694_100444812 366
784 3300025925 Ga0207650_10009574 Ga0207650_100095745 366
785 3300025925 Ga0207650_10009790 Ga0207650_100097903 366
786 3300025925 Ga0207650_10012851 Ga0207650_100128512 366
787 3300025925 Ga0207650_10023235 Ga0207650_100232354 366
788 3300025925 Ga0207650_10031580 Ga0207650_100315803 366
789 3300025925 Ga0207650_10050310 Ga0207650_100503102 366
790 3300025925 Ga0207650_10060544 Ga0207650_100605443 366
791 3300025925 Ga0207650_10230980 Ga0207650_102309802 366
792 3300025926 Ga0207659_10016660 Ga0207659_100166604 366
793 3300025926 Ga0207659_10119317 Ga0207659_101193172 366
794 3300025927 Ga0207687_10013995 Ga0207687_100139955 366
795 3300025927 Ga0207687_10038677 Ga0207687_100386772 366
796 3300025927 Ga0207687_10135832 Ga0207687_101358321 366
797 3300025928 Ga0207700_10183531 Ga0207700_101835312 366
798 3300025929 Ga0207664_10026328 Ga0207664_100263282 366
799 3300025929 Ga0207664_10031164 Ga0207664_100311643 366
800 3300025929 Ga0207664_10073514 Ga0207664_100735143 366
801 3300025931 Ga0207644_10000016 Ga0207644_10000016106 366
802 3300025931 Ga0207644_10001750 Ga0207644_1000175013 366
803 3300025931 Ga0207644_10001909 Ga0207644_100019091 366
804 3300025931 Ga0207644_10016315 Ga0207644_100163155 366
805 3300025931 Ga0207644_10045464 Ga0207644_100454644 366
806 3300025931 Ga0207644_10072982 Ga0207644_100729822 366
807 3300025931 Ga0207644_10143091 Ga0207644_101430912 366
808 3300025931 Ga0207644_10185101 Ga0207644_101851012 366
809 3300025932 Ga0207690_10000240 Ga0207690_1000024033 366
810 3300025932 Ga0207690_10004811 Ga0207690_100048112 366
811 3300025932 Ga0207690_10006400 Ga0207690_100064002 366
812 3300025932 Ga0207690_10030195 Ga0207690_100301954 366
813 3300025932 Ga0207690_10113205 Ga0207690_101132052 366
814 3300025932 Ga0207690_10122271 Ga0207690_101222712 366
815 3300025932 Ga0207690_10132970 Ga0207690_101329702 366
816 3300025932 Ga0207690_10288995 Ga0207690_102889951 366
817 3300025933 Ga0207706_10000020 Ga0207706_10000020131 366
818 3300025933 Ga0207706_10000335 Ga0207706_1000033512 366
819 3300025933 Ga0207706_10008622 Ga0207706_100086224 366
820 3300025933 Ga0207706_10017377 Ga0207706_100173779 366
821 3300025933 Ga0207706_10022867 Ga0207706_100228672 366
822 3300025933 Ga0207706_10023100 Ga0207706_100231001 366
823 3300025933 Ga0207706_10026245 Ga0207706_100262453 366
824 3300025933 Ga0207706_10072944 Ga0207706_100729442 366
825 3300025933 Ga0207706_10095487 Ga0207706_100954873 366
826 3300025933 Ga0207706_10096365 Ga0207706_100963652 366
827 3300025933 Ga0207706_10097825 Ga0207706_100978253 366
828 3300025933 Ga0207706_10098050 Ga0207706_100980502 366
829 3300025933 Ga0207706_10193075 Ga0207706_101930752 366
830 3300025935 Ga0207709_10039849 Ga0207709_100398494 366
831 3300025935 Ga0207709_10041647 Ga0207709_100416472 366
832 3300025936 Ga0207670_10003211 Ga0207670_1000321111 366
833 3300025938 Ga0207704_10007757 Ga0207704_100077575 366
834 3300025938 Ga0207704_10013461 Ga0207704_100134612 366
835 3300025938 Ga0207704_10022970 Ga0207704_100229702 366
836 3300025940 Ga0207691_10006076 Ga0207691_100060767 366
837 3300025940 Ga0207691_10006983 Ga0207691_1000698311 366
838 3300025940 Ga0207691_10009516 Ga0207691_100095165 366
839 3300025940 Ga0207691_10036488 Ga0207691_100364885 366
840 3300025940 Ga0207691_10067970 Ga0207691_100679702 366
841 3300025940 Ga0207691_10226874 Ga0207691_102268742 366
842 3300025941 Ga0207711_10000039 Ga0207711_10000039139 366
843 3300025941 Ga0207711_10000122 Ga0207711_1000012264 366
844 3300025941 Ga0207711_10000245 Ga0207711_1000024541 366
845 3300025941 Ga0207711_10001557 Ga0207711_1000155715 366
846 3300025941 Ga0207711_10001599 Ga0207711_100015993 366
847 3300025941 Ga0207711_10009269 Ga0207711_100092692 366
848 3300025941 Ga0207711_10013283 Ga0207711_100132835 366
849 3300025941 Ga0207711_10025755 Ga0207711_100257554 366
850 3300025941 Ga0207711_10038124 Ga0207711_100381244 366
851 3300025941 Ga0207711_10067127 Ga0207711_100671272 366
852 3300025941 Ga0207711_10133878 Ga0207711_101338782 366
853 3300025941 Ga0207711_10171863 Ga0207711_101718632 366
854 3300025942 Ga0207689_10000002 Ga0207689_10000002144 366
855 3300025942 Ga0207689_10004849 Ga0207689_1000484912 366
856 3300025942 Ga0207689_10030381 Ga0207689_100303813 366
857 3300025942 Ga0207689_10146544 Ga0207689_101465442 366
858 3300025942 Ga0207689_10276762 Ga0207689_102767622 366
859 3300025944 Ga0207661_10008019 Ga0207661_100080192 366
860 3300025944 Ga0207661_10008375 Ga0207661_100083756 366
861 3300025944 Ga0207661_10044572 Ga0207661_100445721 366
862 3300025944 Ga0207661_10079535 Ga0207661_100795352 366
863 3300025944 Ga0207661_10149278 Ga0207661_101492782 366
864 3300025945 Ga0207679_10001210 Ga0207679_100012108 366
865 3300025945 Ga0207679_10007811 Ga0207679_100078114 366
866 3300025945 Ga0207679_10015274 Ga0207679_100152741 366
867 3300025945 Ga0207679_10018263 Ga0207679_100182635 366
868 3300025945 Ga0207679_10033807 Ga0207679_100338072 366
869 3300025945 Ga0207679_10101335 Ga0207679_101013352 366
870 3300025945 Ga0207679_10263046 Ga0207679_102630462 366
871 3300025945 Ga0207679_10270864 Ga0207679_102708641 366
872 3300025949 Ga0207667_10010471 Ga0207667_100104717 366
873 3300025949 Ga0207667_10015911 Ga0207667_100159113 366
874 3300025949 Ga0207667_10016070 Ga0207667_100160705 366
875 3300025949 Ga0207667_10016689 Ga0207667_100166892 366
876 3300025949 Ga0207667_10022311 Ga0207667_100223115 366
877 3300025949 Ga0207667_10051175 Ga0207667_100511755 366
878 3300025949 Ga0207667_10057774 Ga0207667_100577742 366
879 3300025949 Ga0207667_10110875 Ga0207667_101108752 366
880 3300025949 Ga0207667_10114889 Ga0207667_101148892 366
881 3300025949 Ga0207667_10136743 Ga0207667_101367432 366
882 3300025949 Ga0207667_10167174 Ga0207667_101671741 366
883 3300025960 Ga0207651_10017515 Ga0207651_100175152 366
884 3300025960 Ga0207651_10042348 Ga0207651_100423482 366
885 3300025961 Ga0207712_10000195 Ga0207712_1000019554 366
886 3300025961 Ga0207712_10010677 Ga0207712_100106778 366
887 3300025972 Ga0207668_10000105 Ga0207668_1000010532 366
888 3300025972 Ga0207668_10008198 Ga0207668_100081983 366
889 3300025972 Ga0207668_10016075 Ga0207668_100160755 366
890 3300025972 Ga0207668_10079407 Ga0207668_100794072 366
891 3300025972 Ga0207668_10088940 Ga0207668_100889402 366
892 3300025972 Ga0207668_10133301 Ga0207668_101333012 366
893 3300025981 Ga0207640_10001696 Ga0207640_100016968 366
894 3300025981 Ga0207640_10002809 Ga0207640_100028092 366
895 3300025981 Ga0207640_10004258 Ga0207640_1000425810 366
896 3300025981 Ga0207640_10034881 Ga0207640_100348812 366
897 3300025981 Ga0207640_10038994 Ga0207640_100389943 366
898 3300025981 Ga0207640_10048016 Ga0207640_100480163 366
899 3300025981 Ga0207640_10095607 Ga0207640_100956072 366
900 3300025981 Ga0207640_10165145 Ga0207640_101651452 366
901 3300025986 Ga0207658_10002756 Ga0207658_100027566 366
902 3300025986 Ga0207658_10002796 Ga0207658_100027961 366
903 3300025986 Ga0207658_10003257 Ga0207658_1000325712 366
904 3300025986 Ga0207658_10003522 Ga0207658_1000352210 366
905 3300025986 Ga0207658_10008098 Ga0207658_100080987 366
906 3300025986 Ga0207658_10010494 Ga0207658_100104943 366
907 3300025986 Ga0207658_10039329 Ga0207658_100393292 366
908 3300025986 Ga0207658_10042950 Ga0207658_100429502 366
909 3300025986 Ga0207658_10127006 Ga0207658_101270061 366
910 3300026023 Ga0207677_10000730 Ga0207677_1000073010 366
911 3300026023 Ga0207677_10036452 Ga0207677_100364522 366
912 3300026023 Ga0207677_10037224 Ga0207677_100372242 366
913 3300026023 Ga0207677_10166880 Ga0207677_101668801 366
914 3300026035 Ga0207703_10000327 Ga0207703_1000032717 366
915 3300026035 Ga0207703_10000608 Ga0207703_100006087 366
916 3300026035 Ga0207703_10002423 Ga0207703_100024232 366
917 3300026035 Ga0207703_10021750 Ga0207703_100217503 366
918 3300026035 Ga0207703_10106196 Ga0207703_101061962 366
919 3300026035 Ga0207703_10137258 Ga0207703_101372582 366
920 3300026035 Ga0207703_10168816 Ga0207703_101688162 366
921 3300026041 Ga0207639_10000135 Ga0207639_100001353 366
922 3300026041 Ga0207639_10000484 Ga0207639_100004842 366
923 3300026041 Ga0207639_10002509 Ga0207639_100025092 366
924 3300026041 Ga0207639_10013262 Ga0207639_100132622 366
925 3300026041 Ga0207639_10143493 Ga0207639_101434932 366
926 3300026067 Ga0207678_10001706 Ga0207678_1000170611 366
927 3300026067 Ga0207678_10004771 Ga0207678_1000477115 366
928 3300026067 Ga0207678_10006716 Ga0207678_100067166 366
929 3300026067 Ga0207678_10007691 Ga0207678_100076915 366
930 3300026067 Ga0207678_10015709 Ga0207678_100157093 366
931 3300026067 Ga0207678_10016722 Ga0207678_100167222 366
932 3300026067 Ga0207678_10017611 Ga0207678_100176115 366
933 3300026067 Ga0207678_10022730 Ga0207678_100227306 366
934 3300026067 Ga0207678_10027918 Ga0207678_100279184 366
935 3300026067 Ga0207678_10104466 Ga0207678_101044662 366
936 3300026067 Ga0207678_10225238 Ga0207678_102252381 366
937 3300026078 Ga0207702_10005954 Ga0207702_100059544 366
938 3300026078 Ga0207702_10008260 Ga0207702_100082606 366
939 3300026078 Ga0207702_10023117 Ga0207702_100231172 366
940 3300026078 Ga0207702_10042628 Ga0207702_100426284 366
941 3300026078 Ga0207702_10074532 Ga0207702_100745322 366
942 3300026078 Ga0207702_10096154 Ga0207702_100961542 366
943 3300026088 Ga0207641_10000004 Ga0207641_10000004145 366
944 3300026088 Ga0207641_10000138 Ga0207641_1000013850 366
945 3300026088 Ga0207641_10006220 Ga0207641_1000622014 366
946 3300026088 Ga0207641_10033749 Ga0207641_100337496 366
947 3300026088 Ga0207641_10075026 Ga0207641_100750264 366
948 3300026088 Ga0207641_10075470 Ga0207641_100754702 366
949 3300026088 Ga0207641_10102638 Ga0207641_101026382 366
950 3300026088 Ga0207641_10129066 Ga0207641_101290663 366
951 3300026088 Ga0207641_10145652 Ga0207641_101456522 366
952 3300026088 Ga0207641_10293577 Ga0207641_102935772 366
953 3300026088 Ga0207641_10307845 Ga0207641_103078452 366
954 3300026089 Ga0207648_10000088 Ga0207648_1000008883 366
955 3300026089 Ga0207648_10002959 Ga0207648_1000295920 366
956 3300026089 Ga0207648_10010998 Ga0207648_100109984 366
957 3300026089 Ga0207648_10045661 Ga0207648_100456612 366
958 3300026089 Ga0207648_10117411 Ga0207648_101174112 366
959 3300026095 Ga0207676_10000515 Ga0207676_1000051529 366
960 3300026095 Ga0207676_10000983 Ga0207676_1000098317 366
961 3300026095 Ga0207676_10006146 Ga0207676_100061465 366
962 3300026095 Ga0207676_10015649 Ga0207676_100156495 366
963 3300026095 Ga0207676_10016506 Ga0207676_100165062 366
964 3300026095 Ga0207676_10018196 Ga0207676_100181962 366
965 3300026095 Ga0207676_10071680 Ga0207676_100716801 366
966 3300026095 Ga0207676_10200818 Ga0207676_102008182 366
967 3300026095 Ga0207676_10235302 Ga0207676_102353022 366
968 3300026116 Ga0207674_10000082 Ga0207674_1000008264 366
969 3300026116 Ga0207674_10000185 Ga0207674_1000018557 366
970 3300026116 Ga0207674_10000280 Ga0207674_1000028034 366
971 3300026116 Ga0207674_10001024 Ga0207674_100010244 366
972 3300026116 Ga0207674_10004532 Ga0207674_100045326 366
973 3300026116 Ga0207674_10004597 Ga0207674_100045975 366
974 3300026116 Ga0207674_10009369 Ga0207674_1000936910 366
975 3300026116 Ga0207674_10010050 Ga0207674_1001005011 366
976 3300026116 Ga0207674_10021918 Ga0207674_100219189 366
977 3300026116 Ga0207674_10069912 Ga0207674_100699122 366
978 3300026116 Ga0207674_10102889 Ga0207674_101028892 366
979 3300026116 Ga0207674_10158066 Ga0207674_101580662 366
980 3300026116 Ga0207674_10179571 Ga0207674_101795712 366
981 3300026118 Ga0207675_100049258 Ga0207675_1000492584 366
982 3300026121 Ga0207683_10002335 Ga0207683_100023357 366
983 3300026121 Ga0207683_10009616 Ga0207683_100096162 366
984 3300026121 Ga0207683_10018737 Ga0207683_100187373 366
985 3300026121 Ga0207683_10032308 Ga0207683_100323085 366
986 3300026142 Ga0207698_10000412 Ga0207698_1000041210 366
987 3300026142 Ga0207698_10000968 Ga0207698_100009686 366
988 3300026142 Ga0207698_10001003 Ga0207698_1000100311 366
989 3300026142 Ga0207698_10001063 Ga0207698_1000106311 366
990 3300026142 Ga0207698_10003864 Ga0207698_100038644 366
991 3300026142 Ga0207698_10005551 Ga0207698_100055515 366
992 3300026142 Ga0207698_10033574 Ga0207698_100335742 366
993 3300026142 Ga0207698_10078561 Ga0207698_100785613 366
994 3300026142 Ga0207698_10159232 Ga0207698_101592322 366
995 3300028379 Ga0268266_10000332 Ga0268266_1000033237 366
996 3300028379 Ga0268266_10005406 Ga0268266_100054064 366
997 3300028379 Ga0268266_10024539 Ga0268266_100245396 366
998 3300028379 Ga0268266_10024983 Ga0268266_100249831 366
999 3300028379 Ga0268266_10148854 Ga0268266_101488542 366
1000 3300028380 Ga0268265_10017970 Ga0268265_100179705 366
1001 3300028380 Ga0268265_10024842 Ga0268265_100248425 366
1002 3300028380 Ga0268265_10035676 Ga0268265_100356764 366
1003 3300028380 Ga0268265_10040683 Ga0268265_100406832 366
1004 3300028380 Ga0268265_10100950 Ga0268265_101009502 366
1005 3300028380 Ga0268265_10148712 Ga0268265_101487122 366
1006 3300028380 Ga0268265_10235086 Ga0268265_102350862 366
1007 3300028381 Ga0268264_10002587 Ga0268264_1000258715 366
1008 3300028381 Ga0268264_10010301 Ga0268264_100103015 366
1009 3300028381 Ga0268264_10010459 Ga0268264_1001045910 366
1010 3300028381 Ga0268264_10047786 Ga0268264_100477862 366
1011 3300028381 Ga0268264_10049895 Ga0268264_100498951 366
1012 3300031548 Ga0307408_100033624 Ga0307408_1000336243 366
1013 3300031548 Ga0307408_100058912 Ga0307408_1000589123 366
1014 3300031548 Ga0307408_100194697 Ga0307408_1001946971 366
1015 3300031731 Ga0307405_10007044 Ga0307405_100070445 366
1016 3300031731 Ga0307405_10077155 Ga0307405_100771552 366
1017 3300031731 Ga0307405_10130538 Ga0307405_101305383 366
1018 3300031731 Ga0307405_10173283 Ga0307405_101732832 366
1019 3300031824 Ga0307413_10006677 Ga0307413_100066775 366
1020 3300031824 Ga0307413_10018312 Ga0307413_100183124 366
1021 3300031824 Ga0307413_10068465 Ga0307413_100684652 366
1022 3300031824 Ga0307413_10202555 Ga0307413_102025551 366
1023 3300031852 Ga0307410_10000960 Ga0307410_1000096014 366
1024 3300031852 Ga0307410_10018275 Ga0307410_100182752 366
1025 3300031852 Ga0307410_10023007 Ga0307410_100230072 366
1026 3300031852 Ga0307410_10067074 Ga0307410_100670742 366
1027 3300031852 Ga0307410_10194824 Ga0307410_101948242 366
1028 3300031901 Ga0307406_10019053 Ga0307406_100190534 366
1029 3300031901 Ga0307406_10032522 Ga0307406_100325222 366
1030 3300031901 Ga0307406_10143534 Ga0307406_101435341 366
1031 3300031901 Ga0307406_10178525 Ga0307406_101785252 366
1032 3300031901 Ga0307406_10212092 Ga0307406_102120921 366
1033 3300031901 Ga0307406_10219129 Ga0307406_102191291 366
1034 3300031903 Ga0307407_10018801 Ga0307407_100188012 366
1035 3300031903 Ga0307407_10025790 Ga0307407_100257903 366
1036 3300031903 Ga0307407_10036280 Ga0307407_100362803 366
1037 3300031903 Ga0307407_10038088 Ga0307407_100380881 366
1038 3300031903 Ga0307407_10056249 Ga0307407_100562492 366
1039 3300031903 Ga0307407_10057638 Ga0307407_100576382 366
1040 3300031911 Ga0307412_10022237 Ga0307412_100222373 366
1041 3300031911 Ga0307412_10059076 Ga0307412_100590763 366
1042 3300031995 Ga0307409_100001336 Ga0307409_10000133614 366
1043 3300031995 Ga0307409_100023526 Ga0307409_1000235264 366
1044 3300031995 Ga0307409_100025359 Ga0307409_1000253592 366
1045 3300031995 Ga0307409_100026743 Ga0307409_1000267433 366
1046 3300031995 Ga0307409_100085034 Ga0307409_1000850343 366
1047 3300031995 Ga0307409_100173670 Ga0307409_1001736702 366
1048 3300031995 Ga0307409_100311415 Ga0307409_1003114152 366
1049 3300031995 Ga0307409_100355183 Ga0307409_1003551831 366
1050 3300032002 Ga0307416_100000612 Ga0307416_10000061212 366
1051 3300032002 Ga0307416_100003352 Ga0307416_1000033523 366
1052 3300032002 Ga0307416_100048927 Ga0307416_1000489272 366
1053 3300032002 Ga0307416_100057618 Ga0307416_1000576182 366
1054 3300032002 Ga0307416_100063022 Ga0307416_1000630222 366
1055 3300032002 Ga0307416_100072671 Ga0307416_1000726712 366
1056 3300032002 Ga0307416_100228480 Ga0307416_1002284802 366
1057 3300032002 Ga0307416_100244895 Ga0307416_1002448952 366
1058 3300032002 Ga0307416_100303862 Ga0307416_1003038621 366
1059 3300032004 Ga0307414_10002552 Ga0307414_100025526 366
1060 3300032004 Ga0307414_10018977 Ga0307414_100189775 366
1061 3300032004 Ga0307414_10029637 Ga0307414_100296372 366
1062 3300032004 Ga0307414_10100238 Ga0307414_101002382 366
1063 3300032004 Ga0307414_10116935 Ga0307414_101169351 366
1064 3300032004 Ga0307414_10145111 Ga0307414_101451111 366
1065 3300032005 Ga0307411_10007168 Ga0307411_100071683 366
1066 3300032005 Ga0307411_10016563 Ga0307411_100165634 366
1067 3300032005 Ga0307411_10036941 Ga0307411_100369411 366
1068 3300032005 Ga0307411_10098402 Ga0307411_100984022 366
1069 3300032005 Ga0307411_10183216 Ga0307411_101832162 366
1070 3300032126 Ga0307415_100002531 Ga0307415_1000025318 366
1071 3300032126 Ga0307415_100007265 Ga0307415_1000072655 366
1072 3300032126 Ga0307415_100033753 Ga0307415_1000337532 366
1073 3300032126 Ga0307415_100055498 Ga0307415_1000554982 366
1074 3300032126 Ga0307415_100062041 Ga0307415_1000620412 366
1075 3300032126 Ga0307415_100314736 Ga0307415_1003147361 366
1076 3300035090 Ga0373949_0020244 Ga0373949_0020244_279_1421 366
1077 3300035170 Ga0373943_0036135 Ga0373943_0036135_355_1497 366
1078 3300035172 Ga0373955_0060186 Ga0373955_0060186_767_1909 366
1079 3300035692 Ga0373935_0009372 Ga0373935_0009372_2085_3227 366
1080 3300035695 Ga0373927_0026569 Ga0373927_0026569_1748_2890 366
1081 3300036401 Ga0373937_0015197 Ga0373937_0015197_3908_5050 366
1082 3300037312 Ga0395899_0000140 Ga0395899_0000140_44812_45954 366
1083 3300037312 Ga0395899_0004866 Ga0395899_0004866_5770_6912 366
1084 3300037312 Ga0395899_0009341 Ga0395899_0009341_3341_4483 366
1085 3300037312 Ga0395899_0013979 Ga0395899_0013979_657_1799 366
1086 3300037312 Ga0395899_0014261 Ga0395899_0014261_852_1994 366
1087 3300037312 Ga0395899_0018797 Ga0395899_0018797_3364_4506 366
1088 3300037312 Ga0395899_0026925 Ga0395899_0026925_1730_2872 366
1089 3300037312 Ga0395899_0028083 Ga0395899_0028083_354_1505 366
1090 3300037312 Ga0395899_0029168 Ga0395899_0029168_1640_2782 366
1091 3300037312 Ga0395899_0030756 Ga0395899_0030756_1480_2622 366
1092 3300037312 Ga0395899_0064617 Ga0395899_0064617_625_1767 366
1093 3300037312 Ga0395899_0066459 Ga0395899_0066459_1037_2179 366
1094 3300037312 Ga0395899_0107059 Ga0395899_0107059_16_1158 366
1095 3300037312 Ga0395899_0141607 Ga0395899_0141607_464_1606 366
1096 3300037312 Ga0395899_0167603 Ga0395899_0167603_80_1222 366
1097 3300037312 Ga0395899_0224277 Ga0395899_0224277_22_1164 366
1098 3300037418 Ga0395900_0000075 Ga0395900_0000075_121670_122812 366
1099 3300037418 Ga0395900_0001090 Ga0395900_0001090_7144_8307 366
1100 3300037418 Ga0395900_0001228 Ga0395900_0001228_6267_7409 366
1101 3300037418 Ga0395900_0003546 Ga0395900_0003546_1367_2509 366
1102 3300037418 Ga0395900_0008295 Ga0395900_0008295_4065_5207 366
1103 3300037418 Ga0395900_0009190 Ga0395900_0009190_67_1209 366
1104 3300037418 Ga0395900_0019686 Ga0395900_0019686_1364_2506 366
1105 3300037418 Ga0395900_0020463 Ga0395900_0020463_1202_2344 366
1106 3300037418 Ga0395900_0022489 Ga0395900_0022489_4886_6028 366
1107 3300037418 Ga0395900_0028631 Ga0395900_0028631_4032_5183 366
1108 3300037418 Ga0395900_0030025 Ga0395900_0030025_1240_2382 366
1109 3300037418 Ga0395900_0030811 Ga0395900_0030811_614_1756 366
1110 3300037418 Ga0395900_0038070 Ga0395900_0038070_1523_2665 366
1111 3300037418 Ga0395900_0045973 Ga0395900_0045973_2449_3591 366
1112 3300037418 Ga0395900_0050215 Ga0395900_0050215_2574_3716 366
1113 3300037418 Ga0395900_0060166 Ga0395900_0060166_1415_2557 366
1114 3300037418 Ga0395900_0065302 Ga0395900_0065302_2525_3667 366
1115 3300037418 Ga0395900_0079387 Ga0395900_0079387_2183_3325 366
1116 3300037418 Ga0395900_0121005 Ga0395900_0121005_365_1507 366
1117 3300037418 Ga0395900_0122133 Ga0395900_0122133_314_1459 366
1118 3300037418 Ga0395900_0180080 Ga0395900_0180080_117_1259 366
1119 3300037418 Ga0395900_0185046 Ga0395900_0185046_761_1903 366
1120 3300037418 Ga0395900_0316379 Ga0395900_0316379_217_1359 366
1121 3300037418 Ga0395900_0382021 Ga0395900_0382021_175_1317 366
1122 3300037466 Ga0395898_0000055 Ga0395898_0000055_64026_65168 366
1123 3300037466 Ga0395898_0004254 Ga0395898_0004254_11520_12662 366
1124 3300037466 Ga0395898_0006649 Ga0395898_0006649_9073_10215 366
1125 3300037466 Ga0395898_0009623 Ga0395898_0009623_7876_9018 366
1126 3300037466 Ga0395898_0011718 Ga0395898_0011718_1681_2823 366
1127 3300037466 Ga0395898_0014031 Ga0395898_0014031_2915_4057 366
1128 3300037466 Ga0395898_0018922 Ga0395898_0018922_4449_5591 366
1129 3300037466 Ga0395898_0024996 Ga0395898_0024996_463_1605 366
1130 3300037466 Ga0395898_0025360 Ga0395898_0025360_391_1542 366
1131 3300037466 Ga0395898_0036686 Ga0395898_0036686_3228_4370 366
1132 3300037466 Ga0395898_0042501 Ga0395898_0042501_1186_2328 366
1133 3300037466 Ga0395898_0060107 Ga0395898_0060107_217_1359 366
1134 3300037466 Ga0395898_0065587 Ga0395898_0065587_1959_3101 366
1135 3300037466 Ga0395898_0093085 Ga0395898_0093085_224_1366 366
1136 3300037466 Ga0395898_0139986 Ga0395898_0139986_1111_2253 366
1137 3300037466 Ga0395898_0177391 Ga0395898_0177391_300_1442 366
1138 3300037466 Ga0395898_0184104 Ga0395898_0184104_495_1637 366
1139 3300037466 Ga0395898_0426809 Ga0395898_0426809_41_1183 366
1140 3300037471 Ga0395905_0000089 Ga0395905_0000089_119425_120567 366
1141 3300037471 Ga0395905_0001242 Ga0395905_0001242_1168_2310 366
1142 3300037471 Ga0395905_0002470 Ga0395905_0002470_5552_6697 366
1143 3300037471 Ga0395905_0003328 Ga0395905_0003328_15801_16943 366
1144 3300037471 Ga0395905_0004038 Ga0395905_0004038_10949_12091 366
1145 3300037471 Ga0395905_0005088 Ga0395905_0005088_4317_5480 366
1146 3300037471 Ga0395905_0005936 Ga0395905_0005936_10020_11162 366
1147 3300037471 Ga0395905_0006867 Ga0395905_0006867_8148_9290 366
1148 3300037471 Ga0395905_0011029 Ga0395905_0011029_2740_3882 366
1149 3300037471 Ga0395905_0012034 Ga0395905_0012034_2972_4114 366
1150 3300037471 Ga0395905_0012308 Ga0395905_0012308_3597_4739 366
1151 3300037471 Ga0395905_0019750 Ga0395905_0019750_307_1449 366
1152 3300037471 Ga0395905_0019792 Ga0395905_0019792_4694_5836 366
1153 3300037471 Ga0395905_0026018 Ga0395905_0026018_1075_2217 366
1154 3300037471 Ga0395905_0026311 Ga0395905_0026311_3688_4830 366
1155 3300037471 Ga0395905_0031947 Ga0395905_0031947_1831_2973 366
1156 3300037471 Ga0395905_0035545 Ga0395905_0035545_2275_3417 366
1157 3300037471 Ga0395905_0036302 Ga0395905_0036302_1754_2896 366
1158 3300037471 Ga0395905_0039358 Ga0395905_0039358_1868_3019 366
1159 3300037471 Ga0395905_0049967 Ga0395905_0049967_2506_3648 366
1160 3300037471 Ga0395905_0054465 Ga0395905_0054465_2375_3517 366
1161 3300037471 Ga0395905_0068973 Ga0395905_0068973_1689_2831 366
1162 3300037471 Ga0395905_0070946 Ga0395905_0070946_924_2066 366
1163 3300037471 Ga0395905_0071065 Ga0395905_0071065_1637_2779 366
1164 3300037471 Ga0395905_0076221 Ga0395905_0076221_1280_2422 366
1165 3300037471 Ga0395905_0099848 Ga0395905_0099848_639_1781 366
1166 3300037471 Ga0395905_0106223 Ga0395905_0106223_135_1277 366
1167 3300037471 Ga0395905_0117783 Ga0395905_0117783_679_1833 366
1168 3300037471 Ga0395905_0118860 Ga0395905_0118860_548_1690 366
1169 3300037471 Ga0395905_0139444 Ga0395905_0139444_573_1715 366
1170 3300037471 Ga0395905_0142676 Ga0395905_0142676_964_2106 366
1171 3300037471 Ga0395905_0180058 Ga0395905_0180058_39_1181 366
1172 3300037471 Ga0395905_0198064 Ga0395905_0198064_610_1752 366
1173 3300037471 Ga0395905_0230569 Ga0395905_0230569_322_1704 366
1174 3300037471 Ga0395905_0417846 Ga0395905_0417846_80_1225 366
1175 3300037853 Ga0436364_0792321 Ga0436364_0792321_27364_28512 366
1176 3300038443 Ga0395901_0000168 Ga0395901_0000168_33800_34942 366
1177 3300038443 Ga0395901_0000418 Ga0395901_0000418_47071_48213 366
1178 3300038443 Ga0395901_0003667 Ga0395901_0003667_2965_4107 366
1179 3300038443 Ga0395901_0008549 Ga0395901_0008549_2145_3308 366
1180 3300038443 Ga0395901_0008855 Ga0395901_0008855_74_1216 366
1181 3300038443 Ga0395901_0012419 Ga0395901_0012419_5196_6338 366
1182 3300038443 Ga0395901_0024056 Ga0395901_0024056_187_1332 366
1183 3300038443 Ga0395901_0026629 Ga0395901_0026629_3885_5027 366
1184 3300038443 Ga0395901_0029600 Ga0395901_0029600_648_1790 366
1185 3300038443 Ga0395901_0031267 Ga0395901_0031267_614_1756 366
1186 3300038443 Ga0395901_0031428 Ga0395901_0031428_1284_2426 366
1187 3300038443 Ga0395901_0032503 Ga0395901_0032503_3319_4461 366
1188 3300038443 Ga0395901_0057063 Ga0395901_0057063_242_1384 366
1189 3300038443 Ga0395901_0057753 Ga0395901_0057753_1339_2481 366
1190 3300038443 Ga0395901_0073217 Ga0395901_0073217_2359_3501 366
1191 3300038443 Ga0395901_0074760 Ga0395901_0074760_1237_2379 366
1192 3300038443 Ga0395901_0079639 Ga0395901_0079639_1007_2149 366
1193 3300038443 Ga0395901_0118371 Ga0395901_0118371_939_2081 366
1194 3300038443 Ga0395901_0138035 Ga0395901_0138035_786_1928 366
1195 3300038443 Ga0395901_0193475 Ga0395901_0193475_243_1385 366
1196 3300038443 Ga0395901_0251460 Ga0395901_0251460_196_1344 366
1197 3300039437 Ga0436365_0174109 Ga0436365_0174109_225_1367 366
1198 3300039437 Ga0436365_0851848 Ga0436365_0851848_4704_5846 366
1199 3300042157 Ga0439458_0000131 Ga0439458_0000131_10694_11842 366
1200 3300042157 Ga0439458_0000282 Ga0439458_0000282_5741_6883 366
1201 3300042439 Ga0439464_0019765 Ga0439464_0019765_432_1574 366
1202 3300044656 Ga0466969_0065749 Ga0466969_0065749_264_1406 366
1203 3300044684 Ga0466966_0000010 Ga0466966_0000010_9562_10704 366
1204 3300044684 Ga0466966_0012751 Ga0466966_0012751_2022_3164 366
1205 3300044684 Ga0466966_0057130 Ga0466966_0057130_358_1500 366
1206 3300044693 Ga0466961_0005066 Ga0466961_0005066_1331_2473 366
1207 3300044693 Ga0466961_0023112 Ga0466961_0023112_954_2096 366
1208 3300044693 Ga0466961_0061500 Ga0466961_0061500_150_1292 366
1209 3300044693 Ga0466961_0090981 Ga0466961_0090981_98_1240 366
1210 3300044694 Ga0466963_0001153 Ga0466963_0001153_11871_13016 366
1211 3300044694 Ga0466963_0039144 Ga0466963_0039144_160_1302 366
1212 3300044694 Ga0466963_0039838 Ga0466963_0039838_959_2101 366
1213 3300044694 Ga0466963_0042208 Ga0466963_0042208_1385_2527 366
1214 3300044694 Ga0466963_0158797 Ga0466963_0158797_351_1493 366
1215 3300044706 Ga0466964_0014455 Ga0466964_0014455_1449_2591 366
1216 3300044706 Ga0466964_0021601 Ga0466964_0021601_636_1778 366
1217 3300044719 Ga0466971_0064479 Ga0466971_0064479_301_1443 366
1218 3300044735 Ga0466968_0044301 Ga0466968_0044301_203_1345 366
1219 3300044765 Ga0466970_0007454 Ga0466970_0007454_976_2118 366
1220 3300044765 Ga0466970_0086195 Ga0466970_0086195_433_1575 366
1221 3300044842 Ga0466957_0000272 Ga0466957_0000272_22230_23372 366
1222 3300044842 Ga0466957_0001181 Ga0466957_0001181_1782_2927 366
1223 3300044842 Ga0466957_0001402 Ga0466957_0001402_9935_11077 366
1224 3300044842 Ga0466957_0006843 Ga0466957_0006843_4204_5346 366
1225 3300044842 Ga0466957_0013804 Ga0466957_0013804_2636_3910 366
1226 3300044842 Ga0466957_0039266 Ga0466957_0039266_925_2067 366
1227 3300045049 Ga0466959_0020223 Ga0466959_0020223_902_2044 366
1228 3300045049 Ga0466959_0024057 Ga0466959_0024057_620_1765 366
1229 3300045049 Ga0466959_0037374 Ga0466959_0037374_1204_2346 366
1230 3300045049 Ga0466959_0055344 Ga0466959_0055344_1277_2458 366
1231 3300045049 Ga0466959_0060488 Ga0466959_0060488_692_1834 366
1232 3300045049 Ga0466959_0103704 Ga0466959_0103704_427_1569 366
1233 3300045049 Ga0466959_0173253 Ga0466959_0173253_76_1224 366
1234 3300045836 Ga0466958_0000445 Ga0466958_0000445_15024_16166 366
1235 3300045836 Ga0466958_0006112 Ga0466958_0006112_2831_3973 366
1236 3300045836 Ga0466958_0007204 Ga0466958_0007204_3714_4856 366
1237 3300045836 Ga0466958_0022956 Ga0466958_0022956_1673_2815 366
1238 3300045836 Ga0466958_0064798 Ga0466958_0064798_950_2092 366
1239 3300045836 Ga0466958_0224869 Ga0466958_0224869_22_1164 366
1240 3300045976 Ga0466967_0000202 Ga0466967_0000202_23072_24217 366
1241 3300045976 Ga0466967_0001052 Ga0466967_0001052_7451_8593 366
1242 3300045976 Ga0466967_0015418 Ga0466967_0015418_3336_4478 366
1243 3300045976 Ga0466967_0025573 Ga0466967_0025573_1578_2720 366
1244 3300045976 Ga0466967_0031441 Ga0466967_0031441_1577_2719 366
1245 3300045976 Ga0466967_0071439 Ga0466967_0071439_1586_2728 366
1246 3300045976 Ga0466967_0118187 Ga0466967_0118187_1223_2365 366
1247 3300045976 Ga0466967_0125800 Ga0466967_0125800_468_1610 366
1248 3300045976 Ga0466967_0226623 Ga0466967_0226623_532_1674 366
1249 3300045976 Ga0466967_0240980 Ga0466967_0240980_468_1610 366
1250 3300046492 Ga0495585_0006106 Ga0495585_0006106_3711_4862 366
1251 3300046525 Ga0495663_0000481 Ga0495663_0000481_5170_6321 366
1252 3300046525 Ga0495663_0035733 Ga0495663_0035733_130_1275 366
1253 3300046539 Ga0495621_0000040 Ga0495621_0000040_4679_5830 366
1254 3300046558 Ga0495633_0001575 Ga0495633_0001575_15243_16394 366
1255 3300046616 Ga0495668_0027708 Ga0495668_0027708_1930_3072 366
1256 3300046660 Ga0495625_0089561 Ga0495625_0089561_69_1211 366
1257 3300046684 Ga0495669_0005924 Ga0495669_0005924_1904_3049 366
1258 3300046684 Ga0495669_0035411 Ga0495669_0035411_953_2095 366
1259 3300046684 Ga0495669_0039667 Ga0495669_0039667_497_1642 366
1260 3300046691 Ga0495670_0007830 Ga0495670_0007830_1356_2507 366
1261 3300047445 Ga0495677_0005467 Ga0495677_0005467_70_1221 366
1262 3300047445 Ga0495677_0065371 Ga0495677_0065371_65_1210 366
1263 3300048088 Ga0495602_0088594 Ga0495602_0088594_866_2008 366
1264 3300048903 Ga0496100_0010919 Ga0496100_0010919_935_2077 366
1265 3300048903 Ga0496100_0022684 Ga0496100_0022684_360_1502 366
1266 3300048904 Ga0496101_0008529 Ga0496101_0008529_199_1341 366
1267 3300048904 Ga0496101_0017366 Ga0496101_0017366_3093_4442 366
1268 3300048905 Ga0496102_0216934 Ga0496102_0216934_85_1227 366
1269 3300048905 Ga0496102_0294355 Ga0496102_0294355_99_1241 366
1270 3300048907 Ga0496104_0022365 Ga0496104_0022365_446_1588 366
1271 3300048907 Ga0496104_0312703 Ga0496104_0312703_314_1456 366
1272 3300048909 Ga0496106_0080241 Ga0496106_0080241_407_1549 366
1273 3300048910 Ga0496107_0015378 Ga0496107_0015378_1088_2230 366
1274 3300048910 Ga0496107_0020757 Ga0496107_0020757_1570_2712 366
1275 3300048910 Ga0496107_0071818 Ga0496107_0071818_1053_2195 366
1276 3300048911 Ga0496108_0001509 Ga0496108_0001509_10375_11517 366
1277 3300048911 Ga0496108_0016679 Ga0496108_0016679_3379_4728 366
1278 3300048911 Ga0496108_0028976 Ga0496108_0028976_3096_4238 366
1279 3300048911 Ga0496108_0060418 Ga0496108_0060418_1632_2774 366
1280 3300048911 Ga0496108_0114379 Ga0496108_0114379_1053_2255 366
1281 3300048912 Ga0496109_0019016 Ga0496109_0019016_519_1664 366
1282 3300048912 Ga0496109_0027038 Ga0496109_0027038_372_1514 366
1283 3300048912 Ga0496109_0184808 Ga0496109_0184808_671_1813 366
1284 3300048912 Ga0496109_0291516 Ga0496109_0291516_190_1332 366
1285 3300048913 Ga0496110_0000654 Ga0496110_0000654_14816_16165 366
1286 3300048913 Ga0496110_0011850 Ga0496110_0011850_3510_4655 366
1287 3300048913 Ga0496110_0021024 Ga0496110_0021024_3973_5115 366
1288 3300048913 Ga0496110_0034940 Ga0496110_0034940_2972_4114 366
1289 3300048913 Ga0496110_0083164 Ga0496110_0083164_402_1544 366
1290 3300048913 Ga0496110_0090675 Ga0496110_0090675_1550_2692 366
1291 3300048913 Ga0496110_0100993 Ga0496110_0100993_771_1913 366
1292 3300048914 Ga0496111_0006186 Ga0496111_0006186_2166_3515 366
1293 3300048914 Ga0496111_0041828 Ga0496111_0041828_818_1960 366
1294 3300048914 Ga0496111_0121938 Ga0496111_0121938_242_1384 366
1295 3300048915 Ga0496112_0001660 Ga0496112_0001660_12494_13843 366
1296 3300048915 Ga0496112_0037775 Ga0496112_0037775_783_1925 366
1297 3300048915 Ga0496112_0121487 Ga0496112_0121487_428_1570 366
1298 3300048916 Ga0496113_0010535 Ga0496113_0010535_2588_3730 366
1299 3300048916 Ga0496113_0025054 Ga0496113_0025054_1623_2972 366
1300 3300048916 Ga0496113_0137697 Ga0496113_0137697_540_1682 366
1301 3300048917 Ga0496114_0000033 Ga0496114_0000033_115238_116389 366
1302 3300048917 Ga0496114_0012532 Ga0496114_0012532_4106_5308 366
1303 3300048917 Ga0496114_0056654 Ga0496114_0056654_1012_2154 366
1304 3300048918 Ga0496115_0005203 Ga0496115_0005203_1717_2859 366
1305 3300048918 Ga0496115_0016999 Ga0496115_0016999_3388_4530 366
1306 3300049583 Ga0501067_0019215 Ga0501067_0019215_2400_3542 366
1307 3300049586 Ga0501070_0211229 Ga0501070_0211229_233_1375 366
1308 3300049742 Ga0501080_0088539 Ga0501080_0088539_694_1836 366
1309 3300050489 nmdc:mga03683_51158_c1 nmdc:mga03683_51158_c1_69_1211 366
1310 3300050515 nmdc:mga0a205_61098_c1 nmdc:mga0a205_61098_c1_2209_3351 366
1311 3300053134 Ga0500658_0000022 Ga0500658_0000022_51604_52746 366
1312 3300061719 Ga0466962_0002892 Ga0466962_0002892_6769_7911 366

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xnh-assembly1.cif.gz_C crystal structure of yeast n-terminal acetyltransferase nate (ip6) in complex with a bisubstrate 0.7901 3 155
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.7777 58 157
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.7741 58 157
6hd7-assembly1.cif.gz_v cryo-em structure of the ribosome-nata complex 0.7702 3 155
1q2y-assembly1.cif.gz_A crystal structure of the protein yjcf from bacillus subtilis: a member of the gcn5-related n-acetyltransferase superfamily fold 0.7613 6 155
ID Description Score Start End Superfamily
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.946 8 366 3.40.630.30
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.926 8 366 3.40.630.30
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7771 58 157 3.40.630.30
1q2yA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7613 6 155 3.40.630.30
3owcB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7568 58 157 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A257ERD8-F1-model_v4 N-acetyltransferase 0.9746 1 366 GO:0016740
AF-A0A4Q2XST5-F1-model_v4 deleted 0.9738 6 366
AF-A0A7X7PJP6-F1-model_v4 N-acetyltransferase 0.972 11 119 GO:0016740
AF-A0A257ERD8-F1-model_v4 N-acetyltransferase 0.972 1 366 GO:0016740
AF-A0A5C7JKZ7-F1-model_v4 deleted 0.9717 3 365

Feature Viewer

pLDDT pTM Quality
89.14 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map