F492804

General Info

Members Datasets Scaffolds Average Seq Length
1305 541 1203 189

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10065248|Ga0070717_100652483
Length 219
Sequence VDASDVGADLKDVLIPEERLRARVTELAAQIDADYAGRELLLVGVLKGAVMVMADLARAMHMPVQMDWMAVSSYGSGTRSSGVVRILKDLDTDITGKDVLVIEDIVDSGLTLSWLVGNLRSRGPASVQVCVMLRKPAAIRMDVDVAYTGFDIENEFVVGYGLDYAEKYRNLPFIGTLAPHVYKGEESAETDAEPRTEESAEAPPGRQADPGNRISDEER

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
8 2643221613 Oerskovia sp. Root22 Isolate Unclassified
9 2643221670 Streptomyces sp. Root431 Isolate Unclassified
10 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
11 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
12 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
13 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
14 2643221714 Streptomyces sp. Root264 Isolate Unclassified
15 2643221721 Oerskovia sp. Root918 Isolate Unclassified
16 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
17 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
18 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
19 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
20 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
21 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
22 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
23 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
24 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
25 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
26 2808606448 Streptomyces sp. 193411 Isolate Unclassified
27 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
28 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
29 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
30 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
31 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
32 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
33 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
34 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
35 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
36 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
37 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
38 2862574272 Streptomyces sp. AcE210 Isolate Nodule
39 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
40 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
41 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
42 2867428634 Streptomyces sp. RP5T Isolate Unclassified
43 2867475112 Streptomyces sp. TM32 Isolate Unclassified
44 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
45 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
46 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
47 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
48 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
49 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
50 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
51 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
52 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
53 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
54 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
55 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
56 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
57 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
58 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
59 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
60 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
61 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
62 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
63 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
64 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
65 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
66 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
67 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
68 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
69 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
70 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
71 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
72 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
73 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
74 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
75 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
76 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
77 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
78 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
79 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
80 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
81 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
82 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
83 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
84 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
85 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
86 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
87 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
88 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
89 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
90 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
93 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
94 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
98 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
99 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
100 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
101 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
102 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
107 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
108 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
113 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
152 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
153 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
154 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
172 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
173 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
175 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
179 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
225 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
226 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
233 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
234 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
247 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
248 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
251 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
252 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
253 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
254 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
255 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
259 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
260 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
276 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
277 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
286 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
287 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
291 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
295 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
296 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
297 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
298 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
299 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
300 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
301 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
302 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
303 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
304 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
305 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
306 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
307 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
308 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
309 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
310 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
311 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
312 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
313 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
314 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
315 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
316 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
317 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
318 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
319 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
320 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
321 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
322 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
334 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
335 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
336 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
337 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
338 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
339 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
340 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
341 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
342 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
343 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
344 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
345 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
346 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
347 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
348 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
349 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
350 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
351 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
352 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
353 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
354 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
355 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
356 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
357 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
358 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
363 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
366 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
369 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
370 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
371 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
375 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
381 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
382 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
383 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
387 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
390 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
391 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
392 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
393 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
394 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
395 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
396 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
397 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
398 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
405 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
406 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
407 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
408 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
409 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
410 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
411 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
412 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
413 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
414 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
415 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
416 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
417 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
418 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
419 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
420 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
421 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
422 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
423 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
424 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
425 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
428 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
433 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
434 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
443 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
466 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
467 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
468 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
469 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
470 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
471 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
472 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
473 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
476 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
477 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
480 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
481 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
482 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
483 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
484 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
485 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
486 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
487 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
488 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
489 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
490 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
491 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
492 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
493 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
494 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
495 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
496 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
497 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
498 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
499 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
500 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
501 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
502 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
503 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
504 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
505 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
506 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
507 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
508 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
509 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
510 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
511 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
512 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
513 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
514 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
515 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
516 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
517 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
518 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
519 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
520 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
521 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
522 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
523 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
524 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
525 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
526 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
527 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
528 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
529 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
530 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
531 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
532 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
533 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
534 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
535 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
536 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
537 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
538 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
539 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
540 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
541 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.96
Metatranscriptomes 1.23
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 0.23
Rhizoplane 3.45
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010829 3300001989 Bacteria 3377
2 JGI24739J22299_10054830 3300001989 Bacteria 1276
3 JGI24735J21928_10082150 3300002067 Bacteria 923
4 JGI24735J21928_10108197 3300002067 Bacteria 799
5 JGI25153J46596_10033766 3300003215 Bacteria 1683
6 rootL2_10055055 3300003322 Bacteria 1462
7 JGI25160J50197_1018765 3300003354 Bacteria 2143
8 Ga0070658_10095112 3300005327 Bacteria 2459
9 Ga0070683_100135277 3300005329 Bacteria 2333
10 Ga0070683_100448463 3300005329 Bacteria 1231
11 Ga0070680_100237792 3300005336 Bacteria 1539
12 Ga0070691_10026742 3300005341 Bacteria 2690
13 Ga0070671_100378328 3300005355 Bacteria 1210
14 Ga0070667_100122393 3300005367 Bacteria 2264
15 Ga0070709_10000303 3300005434 Bacteria 31301
16 Ga0070709_10000658 3300005434 Bacteria 19667
17 Ga0070709_10063183 3300005434 Bacteria 2364
18 Ga0070714_100001285 3300005435 Bacteria 18158
19 Ga0070714_100007011 3300005435 Bacteria 8736
20 Ga0070714_100017017 3300005435 Bacteria 5883
21 Ga0070714_100042447 3300005435 Bacteria 3843
22 Ga0070714_100082975 3300005435 Bacteria 2793
23 Ga0070714_100084104 3300005435 Bacteria 2776
24 Ga0070714_100126586 3300005435 Bacteria 2278
25 Ga0070714_100254436 3300005435 Bacteria 1625
26 Ga0070714_100710830 3300005435 Bacteria 970
27 Ga0070713_100000735 3300005436 Bacteria 20988
28 Ga0070713_100083338 3300005436 Bacteria 2733
29 Ga0070713_100084766 3300005436 Bacteria 2712
30 Ga0070713_100096675 3300005436 Bacteria 2550
31 Ga0070713_100107677 3300005436 Bacteria 2425
32 Ga0070713_101711383 3300005436 Bacteria 610
33 Ga0070710_10002868 3300005437 Bacteria 8210
34 Ga0070711_100001622 3300005439 Bacteria 12424
35 Ga0070711_100002814 3300005439 Bacteria 9988
36 Ga0070711_100042489 3300005439 Bacteria 3073
37 Ga0070711_100104285 3300005439 Bacteria 2068
38 Ga0070711_100270564 3300005439 Bacteria 1340
39 Ga0070711_100493291 3300005439 Bacteria 1009
40 Ga0070708_100254009 3300005445 Bacteria 1652
41 Ga0070663_100207088 3300005455 Bacteria 1534
42 Ga0070663_100474322 3300005455 Bacteria 1035
43 Ga0070678_100236706 3300005456 Bacteria 1525
44 Ga0070681_10115673 3300005458 Bacteria 2620
45 Ga0070681_10182789 3300005458 Bacteria 2018
46 Ga0070706_100001435 3300005467 Bacteria 25160
47 Ga0070706_100005954 3300005467 Bacteria 11534
48 Ga0070706_100038357 3300005467 Bacteria 4421
49 Ga0070706_100291256 3300005467 Bacteria 1523
50 Ga0070706_100409956 3300005467 Bacteria 1262
51 Ga0070707_100000833 3300005468 Bacteria 30514
52 Ga0070707_100019207 3300005468 Bacteria 6439
53 Ga0070707_100023123 3300005468 Bacteria 5880
54 Ga0070707_100398034 3300005468 Bacteria 1337
55 Ga0070698_100000680 3300005471 Bacteria 36332
56 Ga0070698_100001044 3300005471 Bacteria 30485
57 Ga0070698_100041951 3300005471 Bacteria 4695
58 Ga0070698_100051264 3300005471 Bacteria 4204
59 Ga0070699_100044519 3300005518 Bacteria 3842
60 Ga0070699_100359689 3300005518 Bacteria 1312
61 Ga0070699_100667491 3300005518 Bacteria 949
62 Ga0070697_100073899 3300005536 Bacteria 2800
63 Ga0070697_100168505 3300005536 Bacteria 1853
64 Ga0068853_100042399 3300005539 Bacteria 3891
65 Ga0068853_100168810 3300005539 Bacteria 1978
66 Ga0070695_100668750 3300005545 Bacteria 821
67 Ga0070696_100511849 3300005546 Bacteria 956
68 Ga0070665_100073321 3300005548 Bacteria 3430
69 Ga0070665_100093875 3300005548 Bacteria 3005
70 Ga0070665_100172659 3300005548 Bacteria 2163
71 Ga0068855_100110791 3300005563 Bacteria 3151
72 Ga0068855_100207190 3300005563 Bacteria 2205
73 Ga0070664_100358433 3300005564 Bacteria 1328
74 Ga0070664_100893661 3300005564 Bacteria 833
75 Ga0068854_100788008 3300005578 Bacteria 827
76 Ga0068852_100007469 3300005616 Bacteria 7976
77 Ga0068859_100737826 3300005617 Bacteria 1074
78 Ga0068863_100121156 3300005841 Bacteria 2494
79 Ga0068860_100126846 3300005843 Bacteria 2446
80 Ga0081455_10309069 3300005937 Bacteria 1131
81 Ga0081540_1003225 3300005983 Bacteria 12999
82 Ga0081540_1155036 3300005983 Bacteria 897
83 Ga0081539_10066960 3300005985 Bacteria 1944
84 Ga0070717_10004476 3300006028 Bacteria 10099
85 Ga0070717_10065248 3300006028 Bacteria 3026
86 Ga0070717_10114967 3300006028 Bacteria 2299
87 Ga0070717_10123979 3300006028 Bacteria 2216
88 Ga0075365_10230197 3300006038 Bacteria 1301
89 Ga0075363_100066381 3300006048 Bacteria 1953
90 Ga0070715_10038014 3300006163 Bacteria 1996
91 Ga0070715_10071889 3300006163 Bacteria 1547
92 Ga0070716_100000094 3300006173 Bacteria 34515
93 Ga0070716_100004007 3300006173 Bacteria 6992
94 Ga0070716_100222343 3300006173 Bacteria 1269
95 Ga0070712_100224202 3300006175 Bacteria 1489
96 Ga0070712_100235700 3300006175 Bacteria 1455
97 Ga0070712_100562509 3300006175 Bacteria 962
98 Ga0075367_10120663 3300006178 Bacteria 1615
99 Ga0097621_100031362 3300006237 Bacteria 4217
100 Ga0097621_100105362 3300006237 Bacteria 2377
101 Ga0075370_10271902 3300006353 Bacteria 1006
102 Ga0075428_100013717 3300006844 Bacteria 9023
103 Ga0075428_100223572 3300006844 Bacteria 2033
104 Ga0075433_10011945 3300006852 Bacteria 7000
105 Ga0075433_10027801 3300006852 Bacteria 4802
106 Ga0075433_11107116 3300006852 Bacteria 689
107 Ga0075434_100017170 3300006871 Bacteria 6967
108 Ga0075434_100141004 3300006871 Bacteria 2430
109 Ga0075434_100848954 3300006871 Bacteria 929
110 Ga0075429_100184222 3300006880 Bacteria 1830
111 Ga0068865_100312719 3300006881 Bacteria 1261
112 Ga0075436_100002907 3300006914 Bacteria 11750
113 Ga0075436_100026649 3300006914 Bacteria 3980
114 Ga0097620_100737656 3300006931 Bacteria 1074
115 Ga0075435_100038265 3300007076 Bacteria 3824
116 Ga0075435_100128010 3300007076 Bacteria 2123
117 Ga0105251_10042952 3300009011 Bacteria 2191
118 Ga0105244_10138189 3300009036 Bacteria 1173
119 Ga0105240_10002593 3300009093 Bacteria 28927
120 Ga0111539_10217332 3300009094 Bacteria 2226
121 Ga0105245_10022695 3300009098 Bacteria 5508
122 Ga0105247_10097872 3300009101 Bacteria 1872
123 Ga0105247_10140142 3300009101 Bacteria 1584
124 Ga0114129_10008421 3300009147 Bacteria 14692
125 Ga0114129_10068964 3300009147 Bacteria 4929
126 Ga0105243_10364898 3300009148 Bacteria 1330
127 Ga0105243_10501073 3300009148 Bacteria 1151
128 Ga0105243_10534848 3300009148 Bacteria 1117
129 Ga0105241_10001133 3300009174 Bacteria 20315
130 Ga0105241_10054363 3300009174 Bacteria 3065
131 Ga0105241_10197349 3300009174 Bacteria 1679
132 Ga0105248_10112199 3300009177 Bacteria 3075
133 Ga0105248_10301486 3300009177 Bacteria 1804
134 Ga0105237_10033948 3300009545 Bacteria 5168
135 Ga0105237_10525944 3300009545 Bacteria 1189
136 Ga0105237_10587634 3300009545 Bacteria 1120
137 Ga0105238_10019076 3300009551 Bacteria 6987
138 Ga0105249_10574137 3300009553 Bacteria 1180
139 Ga0105239_10080227 3300010375 Bacteria 3590
140 Ga0105246_10012385 3300011119 Bacteria 5320
141 Ga0105246_10157689 3300011119 Bacteria 1726
142 Ga0105246_10173966 3300011119 Bacteria 1651
143 Ga0105246_10655340 3300011119 Bacteria 914
144 Ga0157370_10024372 3300013104 Bacteria 5992
145 Ga0157369_10231037 3300013105 Bacteria 1934
146 Ga0157374_10009898 3300013296 Bacteria 8182
147 Ga0157374_10028904 3300013296 Bacteria 5012
148 Ga0157378_10174862 3300013297 Bacteria 2016
149 Ga0163162_10391453 3300013306 Bacteria 1522
150 Ga0163162_10490143 3300013306 Bacteria 1360
151 Ga0157372_10062057 3300013307 Bacteria 4186
152 Ga0157372_10188025 3300013307 Bacteria 2391
153 Ga0157372_10281353 3300013307 Bacteria 1934
154 Ga0157372_10457540 3300013307 Bacteria 1487
155 Ga0157375_10277578 3300013308 Bacteria 1838
156 Ga0163163_10003442 3300014325 Bacteria 13446
157 Ga0157380_10255069 3300014326 Bacteria 1590
158 Ga0157377_10155670 3300014745 Bacteria 1417
159 Ga0157377_10852080 3300014745 Bacteria 677
160 Ga0157379_10002390 3300014968 Bacteria 15680
161 Ga0157376_10007343 3300014969 Bacteria 7856
162 Ga0157376_10102298 3300014969 Bacteria 2506
163 Ga0157376_10520189 3300014969 Bacteria 1173
164 Ga0182006_1047820 3300015261 Bacteria 1656
165 Ga0182007_10000948 3300015262 Bacteria 15950
166 Ga0182005_1024865 3300015265 Bacteria 1635
167 Ga0183367_1015 3300015688 Bacteria 298435
168 Ga0206356_10039005 3300020070 Bacteria 735
169 Ga0206355_1518046 3300020076 Bacteria 1732
170 Ga0206350_10371078 3300020080 Bacteria 1192
171 Ga0206353_10318742 3300020082 Bacteria 4638
172 Ga0213875_10016990 3300021388 Bacteria 3523
173 Ga0213875_10042697 3300021388 Bacteria 2130
174 Ga0224572_1002611 3300024225 Bacteria 2944
175 Ga0228598_1030632 3300024227 Bacteria 1059
176 Ga0209758_1020439 3300025297 Bacteria 3132
177 Ga0207426_1003984 3300025302 Bacteria 7520
178 Ga0207426_1072135 3300025302 Bacteria 959
179 Ga0209051_1112049 3300025303 Bacteria 709
180 Ga0207696_1038217 3300025711 Bacteria 1418
181 Ga0207692_10000198 3300025898 Bacteria 20008
182 Ga0207692_10005056 3300025898 Bacteria 5254
183 Ga0207692_10007347 3300025898 Bacteria 4515
184 Ga0207692_10026163 3300025898 Bacteria 2735
185 Ga0207692_10039943 3300025898 Bacteria 2312
186 Ga0207710_10263081 3300025900 Bacteria 865
187 Ga0207647_10007289 3300025904 Bacteria 8006
188 Ga0207647_10044080 3300025904 Bacteria 2788
189 Ga0207685_10007645 3300025905 Bacteria 3026
190 Ga0207685_10028498 3300025905 Bacteria 1967
191 Ga0207685_10048016 3300025905 Bacteria 1633
192 Ga0207699_10000355 3300025906 Bacteria 24243
193 Ga0207699_10008211 3300025906 Bacteria 5140
194 Ga0207699_10013730 3300025906 Bacteria 4154
195 Ga0207699_10014905 3300025906 Bacteria 4024
196 Ga0207699_10069936 3300025906 Bacteria 2142
197 Ga0207684_10000549 3300025910 Bacteria 46187
198 Ga0207684_10001867 3300025910 Bacteria 21943
199 Ga0207684_10023269 3300025910 Bacteria 5290
200 Ga0207684_10304429 3300025910 Bacteria 1374
201 Ga0207654_10002025 3300025911 Bacteria 10420
202 Ga0207707_10214262 3300025912 Bacteria 1677
203 Ga0207695_10001075 3300025913 Bacteria 47773
204 Ga0207671_10000122 3300025914 Bacteria 119512
205 Ga0207671_10858263 3300025914 Bacteria 719
206 Ga0207693_10012402 3300025915 Bacteria 6885
207 Ga0207693_10018785 3300025915 Bacteria 5501
208 Ga0207693_10056204 3300025915 Bacteria 3086
209 Ga0207693_10088416 3300025915 Bacteria 2428
210 Ga0207693_10166610 3300025915 Bacteria 1734
211 Ga0207663_10057034 3300025916 Bacteria 2459
212 Ga0207663_10647442 3300025916 Bacteria 834
213 Ga0207663_10990230 3300025916 Bacteria 674
214 Ga0207660_10372919 3300025917 Bacteria 1146
215 Ga0207646_10000577 3300025922 Bacteria 48073
216 Ga0207646_10017839 3300025922 Bacteria 6629
217 Ga0207646_10077134 3300025922 Bacteria 2978
218 Ga0207646_10104929 3300025922 Bacteria 2534
219 Ga0207646_10314217 3300025922 Bacteria 1416
220 Ga0207694_10000829 3300025924 Bacteria 27496
221 Ga0207700_10000427 3300025928 Bacteria 24804
222 Ga0207700_10008608 3300025928 Bacteria 6333
223 Ga0207700_10008868 3300025928 Bacteria 6254
224 Ga0207700_10037684 3300025928 Bacteria 3504
225 Ga0207700_10081039 3300025928 Bacteria 2533
226 Ga0207700_10111952 3300025928 Bacteria 2198
227 Ga0207700_10111987 3300025928 Bacteria 2198
228 Ga0207700_10293449 3300025928 Bacteria 1402
229 Ga0207664_10006111 3300025929 Bacteria 8246
230 Ga0207664_10010058 3300025929 Bacteria 6666
231 Ga0207664_10029954 3300025929 Bacteria 4152
232 Ga0207664_10039826 3300025929 Bacteria 3649
233 Ga0207664_10056279 3300025929 Bacteria 3123
234 Ga0207664_10075145 3300025929 Bacteria 2731
235 Ga0207664_10172013 3300025929 Bacteria 1854
236 Ga0207664_10409254 3300025929 Bacteria 1207
237 Ga0207664_10768876 3300025929 Bacteria 866
238 Ga0207686_10347464 3300025934 Bacteria 1116
239 Ga0207709_10238836 3300025935 Bacteria 1321
240 Ga0207665_10001080 3300025939 Bacteria 18366
241 Ga0207665_10003971 3300025939 Bacteria 9884
242 Ga0207665_10007451 3300025939 Bacteria 7235
243 Ga0207691_10137592 3300025940 Bacteria 2154
244 Ga0207691_10930167 3300025940 Bacteria 727
245 Ga0207691_11020483 3300025940 Bacteria 690
246 Ga0207711_10115701 3300025941 Bacteria 2390
247 Ga0207661_10138298 3300025944 Bacteria 2094
248 Ga0207667_10006929 3300025949 Bacteria 13696
249 Ga0207667_10094891 3300025949 Bacteria 3080
250 Ga0207667_10287468 3300025949 Bacteria 1680
251 Ga0207640_10006140 3300025981 Bacteria 6574
252 Ga0207658_10386164 3300025986 Bacteria 1227
253 Ga0207703_10146273 3300026035 Bacteria 2056
254 Ga0207639_10023348 3300026041 Bacteria 4466
255 Ga0207639_10048788 3300026041 Bacteria 3206
256 Ga0207678_10084430 3300026067 Bacteria 2716
257 Ga0207678_10486158 3300026067 Bacteria 1075
258 Ga0207702_10019973 3300026078 Bacteria 5550
259 Ga0207641_10059677 3300026088 Bacteria 3249
260 Ga0207674_10214750 3300026116 Bacteria 1872
261 Ga0207683_10188808 3300026121 Bacteria 1870
262 Ga0207698_10035262 3300026142 Bacteria 3658
263 Ga0209371_1008032 3300027312 Bacteria 3569
264 Ga0209371_1018659 3300027312 Bacteria 1754
265 Ga0207428_10053288 3300027907 Bacteria 3226
266 Ga0268266_10042600 3300028379 Bacteria 3878
267 Ga0307517_10008770 3300028786 Bacteria 14457
268 Ga0307517_10012587 3300028786 Bacteria 11590
269 Ga0307515_10001114 3300028794 Bacteria 61489
270 Ga0307515_10101266 3300028794 Bacteria 3479
271 Ga0265338_10000718 3300028800 Bacteria 56666
272 Ga0268256_1005719 3300030500 Bacteria 4800
273 Ga0268256_1015837 3300030500 Bacteria 2184
274 Ga0307511_10003592 3300030521 Bacteria 15888
275 Ga0307511_10089148 3300030521 Bacteria 2104
276 Ga0307511_10145549 3300030521 Bacteria 1378
277 Ga0307512_10006056 3300030522 Bacteria 12386
278 Ga0307513_10015029 3300031456 Bacteria 9397
279 Ga0307513_10036984 3300031456 Bacteria 5437
280 Ga0307509_10030305 3300031507 Bacteria 5987
281 Ga0307509_10166488 3300031507 Bacteria 2091
282 Ga0307509_10174524 3300031507 Bacteria 2023
283 Ga0265313_10125733 3300031595 Bacteria 1115
284 Ga0307508_10019325 3300031616 Bacteria 6193
285 Ga0307508_10105662 3300031616 Bacteria 2413
286 Ga0307508_10191297 3300031616 Bacteria 1647
287 Ga0307514_10001631 3300031649 Bacteria 26246
288 Ga0307514_10022169 3300031649 Bacteria 5166
289 Ga0307514_10303992 3300031649 Bacteria 891
290 Ga0316575_10000002 3300031665 Bacteria 148142
291 Ga0316575_10000356 3300031665 Bacteria 12976
292 Ga0316579_10011102 3300031691 Bacteria 3822
293 Ga0316576_10000206 3300031727 Bacteria 24729
294 Ga0316576_10001306 3300031727 Bacteria 13232
295 Ga0316576_10257292 3300031727 Bacteria 1310
296 Ga0316576_10353518 3300031727 Bacteria 1093
297 Ga0307516_10010607 3300031730 Bacteria 10108
298 Ga0307516_10051538 3300031730 Bacteria 4033
299 Ga0307516_10503110 3300031730 Bacteria 866
300 Ga0316577_10020948 3300031733 Bacteria 3623
301 Ga0307518_10039052 3300031838 Bacteria 3451
302 Ga0307518_10169360 3300031838 Bacteria 1490
303 Ga0307410_10078913 3300031852 Bacteria 2305
304 Ga0307406_10521558 3300031901 Bacteria 967
305 Ga0307412_10168871 3300031911 Bacteria 1634
306 Ga0307409_100100195 3300031995 Bacteria 2401
307 Ga0307409_100192306 3300031995 Bacteria 1817
308 Ga0307416_100148139 3300032002 Bacteria 2147
309 Ga0307416_100759353 3300032002 Bacteria 1063
310 Ga0307416_100990072 3300032002 Bacteria 943
311 Ga0307414_10112584 3300032004 Bacteria 2075
312 Ga0307414_10405169 3300032004 Bacteria 1186
313 Ga0307414_10867056 3300032004 Bacteria 826
314 Ga0307411_10117908 3300032005 Bacteria 1914
315 Ga0307411_10592719 3300032005 Bacteria 952
316 Ga0307415_100561399 3300032126 Bacteria 1009
317 Ga0307415_100829103 3300032126 Bacteria 847
318 Ga0316583_10037055 3300032133 Bacteria 1728
319 Ga0316580_10013909 3300032139 Bacteria 2453
320 Ga0307507_10000013 3300033179 Bacteria 242708
321 Ga0307507_10057967 3300033179 Bacteria 3641
322 Ga0307507_10097415 3300033179 Bacteria 2481
323 Ga0307507_10136125 3300033179 Bacteria 1902
324 Ga0307507_10140857 3300033179 Bacteria 1850
325 Ga0307510_10045037 3300033180 Bacteria 4770
326 Ga0307510_10152409 3300033180 Bacteria 1927
327 Ga0307510_10245106 3300033180 Bacteria 1283
328 Ga0307510_10287941 3300033180 Bacteria 1110
329 Ga0373930_0019205 3300034816 Bacteria 1321
330 Ga0373948_0006582 3300034817 Bacteria 1927
331 Ga0373958_0106638 3300034819 Bacteria 663
332 Ga0373938_0006469 3300034957 Bacteria 2025
333 Ga0373926_0040258 3300035083 Bacteria 1667
334 Ga0373926_0139670 3300035083 Bacteria 920
335 Ga0373929_0037106 3300035085 Bacteria 1067
336 Ga0373934_0000184 3300035086 Bacteria 22845
337 Ga0373934_0002392 3300035086 Bacteria 6905
338 Ga0373934_0018608 3300035086 Bacteria 2659
339 Ga0373934_0019406 3300035086 Bacteria 2609
340 Ga0373940_0048960 3300035088 Bacteria 1182
341 Ga0373949_0038148 3300035090 Bacteria 1171
342 Ga0373951_0030281 3300035091 Bacteria 1273
343 Ga0373952_0048375 3300035092 Bacteria 1006
344 Ga0373923_0006465 3300035111 Bacteria 4055
345 Ga0373923_0030219 3300035111 Bacteria 2177
346 Ga0373923_0048861 3300035111 Bacteria 1767
347 Ga0373923_0084512 3300035111 Bacteria 1381
348 Ga0373923_0109734 3300035111 Bacteria 1224
349 Ga0373932_0003623 3300035112 Bacteria 3694
350 Ga0373936_0032597 3300035113 Bacteria 2061
351 Ga0373936_0046718 3300035113 Bacteria 1746
352 Ga0373936_0100073 3300035113 Bacteria 1222
353 Ga0373936_0170120 3300035113 Bacteria 952
354 Ga0373939_0057298 3300035114 Bacteria 1229
355 Ga0373941_0078018 3300035115 Bacteria 1113
356 Ga0373945_0009754 3300035116 Bacteria 3150
357 Ga0373945_0049152 3300035116 Bacteria 1547
358 Ga0373945_0082988 3300035116 Bacteria 1230
359 Ga0373945_0131611 3300035116 Bacteria 1002
360 Ga0373953_0000116 3300035117 Bacteria 19418
361 Ga0373953_0005235 3300035117 Bacteria 4194
362 Ga0373953_0012677 3300035117 Bacteria 2992
363 Ga0373953_0026389 3300035117 Bacteria 2225
364 Ga0373954_0001000 3300035118 Bacteria 11155
365 Ga0373954_0024414 3300035118 Bacteria 2756
366 Ga0373954_0106711 3300035118 Bacteria 1353
367 Ga0373956_0000136 3300035119 Bacteria 26262
368 Ga0373956_0011462 3300035119 Bacteria 3655
369 Ga0373956_0103573 3300035119 Bacteria 1322
370 Ga0373956_0109470 3300035119 Bacteria 1285
371 Ga0373957_0000035 3300035120 Bacteria 34674
372 Ga0373957_0002953 3300035120 Bacteria 4931
373 Ga0373957_0003000 3300035120 Bacteria 4901
374 Ga0373957_0018235 3300035120 Bacteria 2455
375 Ga0373957_0061778 3300035120 Bacteria 1453
376 Ga0373960_0011091 3300035121 Bacteria 2213
377 Ga0373943_0494058 3300035170 Bacteria 714
378 Ga0373946_0132812 3300035171 Bacteria 1147
379 Ga0373946_0299054 3300035171 Bacteria 795
380 Ga0373955_0000072 3300035172 Bacteria 40814
381 Ga0373955_0010552 3300035172 Bacteria 4367
382 Ga0373955_0042016 3300035172 Bacteria 2453
383 Ga0373955_0048357 3300035172 Bacteria 2306
384 Ga0373955_0091799 3300035172 Bacteria 1731
385 Ga0373955_0264755 3300035172 Bacteria 1032
386 Ga0373942_0035611 3300035207 Bacteria 1336
387 Ga0373962_0009821 3300035242 Bacteria 2377
388 Ga0316574_0021271 3300035398 Bacteria 3851
389 Ga0316574_0209927 3300035398 Bacteria 1249
390 Ga0373924_0001000 3300035410 Bacteria 8959
391 Ga0373924_0002302 3300035410 Bacteria 6408
392 Ga0373924_0012374 3300035410 Bacteria 3186
393 Ga0373924_0026843 3300035410 Bacteria 2286
394 Ga0373931_0143278 3300035691 Bacteria 1386
395 Ga0373931_0291280 3300035691 Bacteria 1005
396 Ga0373931_0550532 3300035691 Bacteria 749
397 Ga0373935_0045702 3300035692 Bacteria 2763
398 Ga0373935_0120221 3300035692 Bacteria 1754
399 Ga0373935_0151149 3300035692 Bacteria 1576
400 Ga0373935_0170699 3300035692 Bacteria 1488
401 Ga0373935_0396466 3300035692 Bacteria 990
402 Ga0373927_0080460 3300035695 Bacteria 2111
403 Ga0373933_0000327 3300035724 Bacteria 30644
404 Ga0373933_0006553 3300035724 Bacteria 6344
405 Ga0373933_0018940 3300035724 Bacteria 3878
406 Ga0373933_0036349 3300035724 Bacteria 2882
407 Ga0373933_0160018 3300035724 Bacteria 1429
408 Ga0373933_0200604 3300035724 Bacteria 1276
409 Ga0373947_0075049 3300035725 Bacteria 2081
410 Ga0373947_0100587 3300035725 Bacteria 1817
411 Ga0373947_0129409 3300035725 Bacteria 1610
412 Ga0373947_0161540 3300035725 Bacteria 1449
413 Ga0373937_0000010 3300036401 Bacteria 163001
414 Ga0373937_0001685 3300036401 Bacteria 18583
415 Ga0373937_0009917 3300036401 Bacteria 8305
416 Ga0373937_0017506 3300036401 Bacteria 6386
417 Ga0373937_0803493 3300036401 Bacteria 888
418 Ga0316582_0025759 3300036647 Bacteria 3534
419 Ga0316584_0000468 3300036712 Bacteria 21119
420 Ga0316584_0367146 3300036712 Bacteria 1031
421 Ga0316584_0733065 3300036712 Bacteria 675
422 Ga0373925_0103218 3300037068 Bacteria 2194
423 Ga0373925_0134396 3300037068 Bacteria 1931
424 Ga0373925_0300626 3300037068 Bacteria 1296
425 Ga0373925_0377747 3300037068 Bacteria 1153
426 Ga0395899_0002623 3300037312 Bacteria 14501
427 Ga0395899_0203269 3300037312 Bacteria 1380
428 Ga0395898_0031982 3300037466 Bacteria 5252
429 Ga0395898_0058062 3300037466 Bacteria 3768
430 Ga0316581_0002277 3300037588 Bacteria 4549
431 Ga0436364_0849349 3300037853 Bacteria 1284
432 Ga0436364_0894524 3300037853 Bacteria 2015
433 Ga0436364_1059010 3300037853 Bacteria 60327
434 Ga0436364_1147169 3300037853 Bacteria 29511
435 Ga0395901_1541329 3300038443 Bacteria 619
436 Ga0436363_1505785 3300039450 Bacteria 682
437 Ga0436362_0845973 3300039453 Bacteria 1143
438 Ga0439436_0003576 3300041404 Bacteria 4726
439 Ga0439436_0008118 3300041404 Bacteria 3226
440 Ga0439439_0000554 3300041406 Bacteria 6514
441 Ga0439453_0021310 3300041408 Bacteria 1168
442 Ga0451791_0512465 3300041451 Bacteria 1325
443 Ga0451795_0794252 3300041456 Bacteria 1230
444 Ga0451802_1325708 3300041460 Bacteria 1159
445 Ga0451841_0752493 3300041498 Bacteria 1355
446 Ga0451853_2214190 3300041512 Bacteria 2173
447 Ga0439433_0000267 3300041999 Bacteria 8812
448 Ga0439442_030524 3300042002 Bacteria 1125
449 Ga0439448_0009759 3300042005 Bacteria 2833
450 Ga0439448_0125248 3300042005 Bacteria 883
451 Ga0439449_0003868 3300042007 Bacteria 5804
452 Ga0439449_0006979 3300042007 Bacteria 4303
453 Ga0439455_0085584 3300042012 Bacteria 860
454 Ga0439457_000100 3300042014 Bacteria 20035
455 Ga0439457_001085 3300042014 Bacteria 8211
456 Ga0439462_0003676 3300042015 Bacteria 3699
457 Ga0450894_001105 3300042131 Bacteria 4063
458 Ga0450895_002110 3300042132 Bacteria 1451
459 Ga0450898_001128 3300042134 Bacteria 3419
460 Ga0450899_000632 3300042135 Bacteria 4017
461 Ga0450903_000500 3300042138 Bacteria 8239
462 Ga0450906_003967 3300042145 Bacteria 3131
463 Ga0439458_0007753 3300042157 Bacteria 2390
464 Ga0439458_0073582 3300042157 Bacteria 865
465 Ga0450908_009782 3300042184 Bacteria 1776
466 Ga0466969_0004692 3300044656 Bacteria 7281
467 Ga0466969_0007675 3300044656 Bacteria 5734
468 Ga0466969_0018099 3300044656 Bacteria 3675
469 Ga0466969_0018877 3300044656 Bacteria 3590
470 Ga0466969_0107910 3300044656 Bacteria 1305
471 Ga0466972_0012556 3300044658 Bacteria 4256
472 Ga0466972_0073178 3300044658 Bacteria 1633
473 Ga0466972_0131987 3300044658 Bacteria 1176
474 Ga0466972_0164257 3300044658 Bacteria 1043
475 Ga0466965_0083545 3300044683 Bacteria 1617
476 Ga0466965_0129997 3300044683 Bacteria 1305
477 Ga0466965_0194482 3300044683 Bacteria 1074
478 Ga0466966_0001731 3300044684 Bacteria 14107
479 Ga0466966_0002839 3300044684 Bacteria 11406
480 Ga0466966_0007222 3300044684 Bacteria 7363
481 Ga0466966_0015224 3300044684 Bacteria 5087
482 Ga0466966_0035646 3300044684 Bacteria 3213
483 Ga0466966_0041189 3300044684 Bacteria 2968
484 Ga0466966_0274986 3300044684 Bacteria 1013
485 Ga0466961_0006951 3300044693 Bacteria 7200
486 Ga0466961_0012581 3300044693 Bacteria 5417
487 Ga0466961_0029154 3300044693 Bacteria 3548
488 Ga0466961_0037073 3300044693 Bacteria 3129
489 Ga0466961_0056218 3300044693 Bacteria 2507
490 Ga0466961_0060219 3300044693 Bacteria 2414
491 Ga0466961_0142714 3300044693 Bacteria 1498
492 Ga0466961_0412060 3300044693 Bacteria 819
493 Ga0466963_0004122 3300044694 Bacteria 8405
494 Ga0466963_0004646 3300044694 Bacteria 8011
495 Ga0466963_0180150 3300044694 Bacteria 1475
496 Ga0466963_0283112 3300044694 Bacteria 1165
497 Ga0466963_0759646 3300044694 Bacteria 684
498 Ga0466963_0927377 3300044694 Bacteria 613
499 Ga0466964_0080868 3300044706 Bacteria 1394
500 Ga0466964_0299217 3300044706 Bacteria 810
501 Ga0466971_0004706 3300044719 Bacteria 5899
502 Ga0466971_0005777 3300044719 Bacteria 5381
503 Ga0466971_0010182 3300044719 Bacteria 4106
504 Ga0466971_0040149 3300044719 Bacteria 2102
505 Ga0466971_0048922 3300044719 Bacteria 1901
506 Ga0466971_0209622 3300044719 Bacteria 921
507 Ga0466968_0087727 3300044735 Bacteria 1374
508 Ga0466970_0000340 3300044765 Bacteria 22884
509 Ga0466970_0007649 3300044765 Bacteria 5416
510 Ga0466970_0011402 3300044765 Bacteria 4531
511 Ga0466970_0105706 3300044765 Bacteria 1535
512 Ga0466970_0264396 3300044765 Bacteria 965
513 Ga0466970_0512832 3300044765 Bacteria 691
514 Ga0466957_0000482 3300044842 Bacteria 19826
515 Ga0466957_0031489 3300044842 Bacteria 3170
516 Ga0466957_0349244 3300044842 Bacteria 1003
517 Ga0466960_0002803 3300044901 Bacteria 6600
518 Ga0466960_0125492 3300044901 Bacteria 1349
519 Ga0466960_0171059 3300044901 Bacteria 1172
520 Ga0466959_0001725 3300045049 Bacteria 13588
521 Ga0466959_0012149 3300045049 Bacteria 6214
522 Ga0466959_0015474 3300045049 Bacteria 5558
523 Ga0466959_0024315 3300045049 Bacteria 4486
524 Ga0466959_0097990 3300045049 Bacteria 2100
525 Ga0466959_0125601 3300045049 Bacteria 1821
526 Ga0466959_0218628 3300045049 Bacteria 1322
527 Ga0466959_0244598 3300045049 Bacteria 1238
528 Ga0466958_0000083 3300045836 Bacteria 28940
529 Ga0466958_0014280 3300045836 Bacteria 4535
530 Ga0466958_0070274 3300045836 Bacteria 2142
531 Ga0466958_0127815 3300045836 Bacteria 1594
532 Ga0466967_0035261 3300045976 Bacteria 4256
533 Ga0466967_0105117 3300045976 Bacteria 2586
534 Ga0466967_0201985 3300045976 Bacteria 1883
535 Ga0466967_1645105 3300045976 Bacteria 639
536 Ga0495617_003736 3300046452 Bacteria 5655
537 Ga0495592_0000136 3300046454 Bacteria 65571
538 Ga0495592_0006355 3300046454 Bacteria 8801
539 Ga0495592_0015144 3300046454 Bacteria 5858
540 Ga0495592_0075441 3300046454 Bacteria 2448
541 Ga0495592_0093513 3300046454 Bacteria 2153
542 Ga0495592_0131556 3300046454 Bacteria 1749
543 Ga0495592_0180425 3300046454 Bacteria 1438
544 Ga0495592_0372488 3300046454 Bacteria 911
545 Ga0495603_0004768 3300046455 Bacteria 8096
546 Ga0495603_0016026 3300046455 Bacteria 4531
547 Ga0495603_0023453 3300046455 Bacteria 3733
548 Ga0495603_0029409 3300046455 Bacteria 3312
549 Ga0495603_0055964 3300046455 Bacteria 2336
550 Ga0495603_0073210 3300046455 Bacteria 2013
551 Ga0495629_0004137 3300046459 Bacteria 10881
552 Ga0495629_0009288 3300046459 Bacteria 7194
553 Ga0495629_0010861 3300046459 Bacteria 6621
554 Ga0495629_0011501 3300046459 Bacteria 6429
555 Ga0495629_0059207 3300046459 Bacteria 2677
556 Ga0495629_0062453 3300046459 Bacteria 2602
557 Ga0495629_0065153 3300046459 Bacteria 2543
558 Ga0495629_0118408 3300046459 Bacteria 1845
559 Ga0495629_0242946 3300046459 Bacteria 1239
560 Ga0495629_0545579 3300046459 Bacteria 778
561 Ga0495638_0013477 3300046460 Bacteria 5565
562 Ga0495638_0027916 3300046460 Bacteria 3649
563 Ga0495638_0040475 3300046460 Bacteria 2953
564 Ga0495638_0082360 3300046460 Bacteria 1952
565 Ga0495641_0014933 3300046461 Bacteria 4180
566 Ga0495641_0041104 3300046461 Bacteria 2148
567 Ga0495641_0043399 3300046461 Bacteria 2079
568 Ga0495641_0075536 3300046461 Bacteria 1511
569 Ga0495641_0229465 3300046461 Bacteria 833
570 Ga0495651_0000047 3300046462 Bacteria 89551
571 Ga0495651_0000251 3300046462 Bacteria 41515
572 Ga0495651_0000452 3300046462 Bacteria 31571
573 Ga0495651_0006816 3300046462 Bacteria 8729
574 Ga0495651_0014042 3300046462 Bacteria 6194
575 Ga0495651_0015668 3300046462 Bacteria 5869
576 Ga0495651_0123334 3300046462 Bacteria 1900
577 Ga0495651_0148793 3300046462 Bacteria 1690
578 Ga0495653_0000753 3300046463 Bacteria 24762
579 Ga0495653_0016556 3300046463 Bacteria 6000
580 Ga0495653_0019645 3300046463 Bacteria 5479
581 Ga0495653_0039630 3300046463 Bacteria 3689
582 Ga0495653_0061156 3300046463 Bacteria 2850
583 Ga0495653_0065677 3300046463 Bacteria 2730
584 Ga0495653_0149206 3300046463 Bacteria 1635
585 Ga0495653_0195548 3300046463 Bacteria 1376
586 Ga0495580_0035896 3300046472 Bacteria 3563
587 Ga0495580_0094787 3300046472 Bacteria 2076
588 Ga0495582_0004891 3300046473 Bacteria 7508
589 Ga0495582_0041169 3300046473 Bacteria 2545
590 Ga0495582_0122487 3300046473 Bacteria 1466
591 Ga0495582_0244922 3300046473 Bacteria 1027
592 Ga0495582_0538378 3300046473 Bacteria 675
593 Ga0495639_0009946 3300046475 Bacteria 4088
594 Ga0495639_0082203 3300046475 Bacteria 1501
595 Ga0495662_0000990 3300046476 Bacteria 13904
596 Ga0495662_0013161 3300046476 Bacteria 4028
597 Ga0495662_0016011 3300046476 Bacteria 3638
598 Ga0495662_0017846 3300046476 Bacteria 3435
599 Ga0495662_0023647 3300046476 Bacteria 2967
600 Ga0495662_0069877 3300046476 Bacteria 1701
601 Ga0495662_0275317 3300046476 Bacteria 828
602 Ga0495664_0000447 3300046477 Bacteria 20283
603 Ga0495664_0006683 3300046477 Bacteria 6378
604 Ga0495664_0007598 3300046477 Bacteria 6026
605 Ga0495664_0012044 3300046477 Bacteria 4889
606 Ga0495664_0033188 3300046477 Bacteria 3033
607 Ga0495664_0084649 3300046477 Bacteria 1903
608 Ga0495585_0009338 3300046492 Bacteria 5889
609 Ga0495585_0028053 3300046492 Bacteria 3213
610 Ga0495585_0079626 3300046492 Bacteria 1777
611 Ga0495585_0080988 3300046492 Bacteria 1759
612 Ga0495594_0006912 3300046499 Bacteria 5838
613 Ga0495594_0013664 3300046499 Bacteria 4242
614 Ga0495594_0051380 3300046499 Bacteria 2268
615 Ga0495594_0090696 3300046499 Bacteria 1712
616 Ga0495594_0141163 3300046499 Bacteria 1366
617 Ga0495594_0169880 3300046499 Bacteria 1240
618 Ga0495607_0016214 3300046501 Bacteria 4811
619 Ga0495583_0015667 3300046506 Bacteria 4109
620 Ga0495606_0010908 3300046507 Bacteria 7478
621 Ga0495608_0000089 3300046511 Bacteria 65189
622 Ga0495608_0005222 3300046511 Bacteria 9278
623 Ga0495608_0010518 3300046511 Bacteria 6456
624 Ga0495608_0012351 3300046511 Bacteria 5930
625 Ga0495608_0029367 3300046511 Bacteria 3730
626 Ga0495608_0030063 3300046511 Bacteria 3680
627 Ga0495610_0028169 3300046512 Bacteria 2974
628 Ga0495616_0005383 3300046513 Bacteria 7888
629 Ga0495618_0027385 3300046514 Bacteria 3547
630 Ga0495618_0152604 3300046514 Bacteria 1475
631 Ga0495618_0306676 3300046514 Bacteria 985
632 Ga0495620_0031352 3300046515 Bacteria 2436
633 Ga0495628_0000325 3300046516 Bacteria 43145
634 Ga0495628_0003602 3300046516 Bacteria 13858
635 Ga0495628_0005690 3300046516 Bacteria 10917
636 Ga0495628_0032896 3300046516 Bacteria 4182
637 Ga0495628_0039248 3300046516 Bacteria 3787
638 Ga0495628_0043744 3300046516 Bacteria 3565
639 Ga0495628_0076458 3300046516 Bacteria 2605
640 Ga0495628_0113392 3300046516 Bacteria 2083
641 Ga0495628_0136341 3300046516 Bacteria 1876
642 Ga0495628_0144274 3300046516 Bacteria 1815
643 Ga0495628_0169940 3300046516 Bacteria 1653
644 Ga0495628_0312066 3300046516 Bacteria 1162
645 Ga0495630_0054579 3300046517 Bacteria 2993
646 Ga0495630_0076461 3300046517 Bacteria 2522
647 Ga0495630_0098499 3300046517 Bacteria 2211
648 Ga0495630_0176416 3300046517 Bacteria 1629
649 Ga0495630_0190313 3300046517 Bacteria 1565
650 Ga0495630_0199897 3300046517 Bacteria 1525
651 Ga0495631_0009662 3300046518 Bacteria 4809
652 Ga0495631_0093134 3300046518 Bacteria 1297
653 Ga0495632_0167646 3300046519 Bacteria 1010
654 Ga0495637_0024609 3300046520 Bacteria 2723
655 Ga0495643_0001898 3300046522 Bacteria 17653
656 Ga0495643_0005581 3300046522 Bacteria 8467
657 Ga0495643_0118303 3300046522 Bacteria 1341
658 Ga0495648_0208265 3300046524 Bacteria 973
659 Ga0495666_0000558 3300046526 Bacteria 16637
660 Ga0495666_0005462 3300046526 Bacteria 6402
661 Ga0495666_0011524 3300046526 Bacteria 4408
662 Ga0495666_0129906 3300046526 Bacteria 1177
663 Ga0495666_0169154 3300046526 Bacteria 1011
664 Ga0495652_0000199 3300046529 Bacteria 69104
665 Ga0495652_0000982 3300046529 Bacteria 32624
666 Ga0495652_0006292 3300046529 Bacteria 11060
667 Ga0495652_0017286 3300046529 Bacteria 6437
668 Ga0495652_0023352 3300046529 Bacteria 5481
669 Ga0495652_0031986 3300046529 Bacteria 4603
670 Ga0495652_0038570 3300046529 Bacteria 4138
671 Ga0495652_0047643 3300046529 Bacteria 3675
672 Ga0495652_0062877 3300046529 Bacteria 3127
673 Ga0495652_0084586 3300046529 Bacteria 2608
674 Ga0495652_0140223 3300046529 Bacteria 1902
675 Ga0495652_0324755 3300046529 Bacteria 1110
676 Ga0495654_0003823 3300046530 Bacteria 9103
677 Ga0495665_0003003 3300046531 Bacteria 9115
678 Ga0495665_0014672 3300046531 Bacteria 4223
679 Ga0495665_0017945 3300046531 Bacteria 3803
680 Ga0495665_0209156 3300046531 Bacteria 1010
681 Ga0495665_0284761 3300046531 Bacteria 847
682 Ga0495640_0007528 3300046533 Bacteria 8556
683 Ga0495640_0012287 3300046533 Bacteria 6549
684 Ga0495640_0013458 3300046533 Bacteria 6215
685 Ga0495640_0047394 3300046533 Bacteria 2974
686 Ga0495640_0107147 3300046533 Bacteria 1829
687 Ga0495640_0116559 3300046533 Bacteria 1739
688 Ga0495640_0160390 3300046533 Bacteria 1441
689 Ga0495586_0001586 3300046535 Bacteria 12508
690 Ga0495586_0001723 3300046535 Bacteria 11943
691 Ga0495586_0008008 3300046535 Bacteria 5637
692 Ga0495586_0038041 3300046535 Bacteria 2583
693 Ga0495586_0082919 3300046535 Bacteria 1763
694 Ga0495586_0087249 3300046535 Bacteria 1720
695 Ga0495586_0127408 3300046535 Bacteria 1424
696 Ga0495587_0000074 3300046536 Bacteria 78796
697 Ga0495587_0000644 3300046536 Bacteria 23420
698 Ga0495587_0012793 3300046536 Bacteria 5278
699 Ga0495587_0024905 3300046536 Bacteria 3662
700 Ga0495587_0025699 3300046536 Bacteria 3597
701 Ga0495587_0072375 3300046536 Bacteria 2004
702 Ga0495587_0111917 3300046536 Bacteria 1567
703 Ga0495587_0240668 3300046536 Bacteria 1018
704 Ga0495609_0009209 3300046538 Bacteria 4784
705 Ga0495597_0036879 3300046542 Bacteria 2198
706 Ga0495597_0221597 3300046542 Bacteria 751
707 Ga0495597_0332363 3300046542 Bacteria 585
708 Ga0495645_0003455 3300046543 Bacteria 10718
709 Ga0495645_0007656 3300046543 Bacteria 7515
710 Ga0495645_0014924 3300046543 Bacteria 5520
711 Ga0495645_0017450 3300046543 Bacteria 5141
712 Ga0495645_0035334 3300046543 Bacteria 3643
713 Ga0495645_0063472 3300046543 Bacteria 2674
714 Ga0495645_0076533 3300046543 Bacteria 2407
715 Ga0495645_0223340 3300046543 Bacteria 1266
716 Ga0495645_0281841 3300046543 Bacteria 1092
717 Ga0495645_0744917 3300046543 Bacteria 592
718 Ga0495622_0002086 3300046557 Bacteria 9771
719 Ga0495622_0004999 3300046557 Bacteria 6146
720 Ga0495622_0045660 3300046557 Bacteria 2035
721 Ga0495622_0063860 3300046557 Bacteria 1703
722 Ga0495622_0066602 3300046557 Bacteria 1665
723 Ga0495633_0004699 3300046558 Bacteria 8583
724 Ga0495633_0052786 3300046558 Bacteria 1914
725 Ga0495667_0000064 3300046559 Bacteria 89628
726 Ga0495667_0000347 3300046559 Bacteria 29301
727 Ga0495667_0002034 3300046559 Bacteria 13407
728 Ga0495667_0008486 3300046559 Bacteria 6974
729 Ga0495667_0022169 3300046559 Bacteria 4279
730 Ga0495667_0038878 3300046559 Bacteria 3167
731 Ga0495667_0088717 3300046559 Bacteria 2004
732 Ga0495634_0000804 3300046642 Bacteria 30477
733 Ga0495634_0006199 3300046642 Bacteria 9113
734 Ga0495634_0032561 3300046642 Bacteria 3585
735 Ga0495634_0036650 3300046642 Bacteria 3353
736 Ga0495634_0101575 3300046642 Bacteria 1857
737 Ga0495634_0667932 3300046642 Bacteria 599
738 Ga0495611_0013516 3300046648 Bacteria 3477
739 Ga0495611_0222453 3300046648 Bacteria 878
740 Ga0495625_0104124 3300046660 Bacteria 1946
741 Ga0495625_0150270 3300046660 Bacteria 1566
742 Ga0495625_0279644 3300046660 Bacteria 1074
743 Ga0495635_0001573 3300046663 Bacteria 15328
744 Ga0495635_0020778 3300046663 Bacteria 4573
745 Ga0495635_0023230 3300046663 Bacteria 4321
746 Ga0495635_0045888 3300046663 Bacteria 3014
747 Ga0495635_0051031 3300046663 Bacteria 2851
748 Ga0495635_0089295 3300046663 Bacteria 2108
749 Ga0495635_0103554 3300046663 Bacteria 1945
750 Ga0495635_0375411 3300046663 Bacteria 946
751 Ga0495635_0624193 3300046663 Bacteria 702
752 Ga0495661_0014414 3300046665 Bacteria 5296
753 Ga0495661_0160081 3300046665 Bacteria 1209
754 Ga0495588_0009014 3300046674 Bacteria 4596
755 Ga0495588_0033389 3300046674 Bacteria 2598
756 Ga0495588_0079314 3300046674 Bacteria 1713
757 Ga0495588_0153539 3300046674 Bacteria 1217
758 Ga0495588_0243192 3300046674 Bacteria 949
759 Ga0495657_0000009 3300046675 Bacteria 217555
760 Ga0495657_0015381 3300046675 Bacteria 5601
761 Ga0495657_0022658 3300046675 Bacteria 4495
762 Ga0495657_0023773 3300046675 Bacteria 4375
763 Ga0495657_0025398 3300046675 Bacteria 4207
764 Ga0495657_0030262 3300046675 Bacteria 3793
765 Ga0495657_0041850 3300046675 Bacteria 3132
766 Ga0495657_0057845 3300046675 Bacteria 2576
767 Ga0495657_0069033 3300046675 Bacteria 2313
768 Ga0495657_0204768 3300046675 Bacteria 1201
769 Ga0495599_0000084 3300046678 Bacteria 65440
770 Ga0495599_0024103 3300046678 Bacteria 3805
771 Ga0495599_0133992 3300046678 Bacteria 1538
772 Ga0495599_0257210 3300046678 Bacteria 1061
773 Ga0495599_0271365 3300046678 Bacteria 1029
774 Ga0495623_0000168 3300046679 Bacteria 40826
775 Ga0495623_0016760 3300046679 Bacteria 4734
776 Ga0495623_0019236 3300046679 Bacteria 4415
777 Ga0495623_0024851 3300046679 Bacteria 3858
778 Ga0495623_0135912 3300046679 Bacteria 1467
779 Ga0495623_0137406 3300046679 Bacteria 1457
780 Ga0495623_0156499 3300046679 Bacteria 1343
781 Ga0495623_0210545 3300046679 Bacteria 1113
782 Ga0495623_0321023 3300046679 Bacteria 850
783 Ga0495646_0000131 3300046680 Bacteria 37843
784 Ga0495646_0006779 3300046680 Bacteria 7267
785 Ga0495646_0010288 3300046680 Bacteria 5949
786 Ga0495646_0030816 3300046680 Bacteria 3346
787 Ga0495646_0084121 3300046680 Bacteria 1848
788 Ga0495646_0264135 3300046680 Bacteria 919
789 Ga0495647_0024412 3300046681 Bacteria 2201
790 Ga0495658_0014985 3300046683 Bacteria 3972
791 Ga0495658_0153570 3300046683 Bacteria 1415
792 Ga0495613_0000387 3300046689 Bacteria 38006
793 Ga0495613_0002214 3300046689 Bacteria 14721
794 Ga0495613_0004116 3300046689 Bacteria 10877
795 Ga0495613_0082328 3300046689 Bacteria 2337
796 Ga0495613_0229356 3300046689 Bacteria 1301
797 Ga0495613_0238367 3300046689 Bacteria 1272
798 Ga0495624_0009562 3300046690 Bacteria 6710
799 Ga0495624_0024942 3300046690 Bacteria 3933
800 Ga0495624_0082931 3300046690 Bacteria 1983
801 Ga0495624_0113025 3300046690 Bacteria 1669
802 Ga0495670_0004170 3300046691 Bacteria 7082
803 Ga0495670_0222664 3300046691 Bacteria 1002
804 Ga0495671_0013623 3300046692 Bacteria 4396
805 Ga0495649_0120395 3300046694 Bacteria 1388
806 Ga0495649_0302760 3300046694 Bacteria 813
807 Ga0495589_0013467 3300046794 Bacteria 4218
808 Ga0495589_0141399 3300046794 Bacteria 1152
809 Ga0495600_0009602 3300046809 Bacteria 5981
810 Ga0495600_0009890 3300046809 Bacteria 5905
811 Ga0495600_0011653 3300046809 Bacteria 5484
812 Ga0495600_0012067 3300046809 Bacteria 5396
813 Ga0495600_0015357 3300046809 Bacteria 4841
814 Ga0495600_0020564 3300046809 Bacteria 4220
815 Ga0495600_0086335 3300046809 Bacteria 2047
816 Ga0495600_0122217 3300046809 Bacteria 1693
817 Ga0495600_0178561 3300046809 Bacteria 1368
818 Ga0495600_0223964 3300046809 Bacteria 1202
819 Ga0495600_0336237 3300046809 Bacteria 947
820 Ga0495660_0006126 3300046810 Bacteria 7140
821 Ga0495660_0012927 3300046810 Bacteria 4839
822 Ga0495581_0003195 3300047315 Bacteria 9376
823 Ga0495581_0015726 3300047315 Bacteria 4393
824 Ga0495581_0032518 3300047315 Bacteria 3020
825 Ga0495581_0061905 3300047315 Bacteria 2162
826 Ga0495581_0099920 3300047315 Bacteria 1685
827 Ga0495581_0156169 3300047315 Bacteria 1333
828 Ga0495581_0173333 3300047315 Bacteria 1262
829 Ga0495581_0247640 3300047315 Bacteria 1042
830 Ga0495581_0262280 3300047315 Bacteria 1010
831 Ga0495604_0000070 3300047317 Bacteria 89500
832 Ga0495604_0000385 3300047317 Bacteria 39910
833 Ga0495604_0001476 3300047317 Bacteria 19368
834 Ga0495604_0002049 3300047317 Bacteria 16276
835 Ga0495604_0018002 3300047317 Bacteria 5654
836 Ga0495604_0066109 3300047317 Bacteria 2751
837 Ga0495604_0073929 3300047317 Bacteria 2570
838 Ga0495604_0081059 3300047317 Bacteria 2430
839 Ga0495604_0141052 3300047317 Bacteria 1721
840 Ga0495604_0233206 3300047317 Bacteria 1261
841 Ga0495604_0404711 3300047317 Bacteria 898
842 Ga0495636_0004226 3300047318 Bacteria 5635
843 Ga0495636_0036138 3300047318 Bacteria 2036
844 Ga0495636_0088713 3300047318 Bacteria 1340
845 Ga0495636_0343015 3300047318 Bacteria 704
846 Ga0495674_0018316 3300047319 Bacteria 6519
847 Ga0495674_0051585 3300047319 Bacteria 3625
848 Ga0495674_0053562 3300047319 Bacteria 3546
849 Ga0495674_0109000 3300047319 Bacteria 2349
850 Ga0495674_0162255 3300047319 Bacteria 1869
851 Ga0495674_0204688 3300047319 Bacteria 1636
852 Ga0495674_0241459 3300047319 Bacteria 1488
853 Ga0495674_0282899 3300047319 Bacteria 1358
854 Ga0495672_0425365 3300047320 Bacteria 603
855 Ga0495676_0004682 3300047321 Bacteria 12526
856 Ga0495676_0027215 3300047321 Bacteria 4907
857 Ga0495676_0062084 3300047321 Bacteria 2919
858 Ga0495676_0076992 3300047321 Bacteria 2544
859 Ga0495676_0203918 3300047321 Bacteria 1372
860 Ga0495676_0257478 3300047321 Bacteria 1188
861 Ga0495676_0481799 3300047321 Bacteria 816
862 Ga0495680_0000195 3300047322 Bacteria 65440
863 Ga0495680_0004196 3300047322 Bacteria 13841
864 Ga0495680_0007153 3300047322 Bacteria 10280
865 Ga0495680_0017098 3300047322 Bacteria 6205
866 Ga0495680_0020452 3300047322 Bacteria 5569
867 Ga0495680_0021436 3300047322 Bacteria 5409
868 Ga0495680_0027349 3300047322 Bacteria 4688
869 Ga0495683_0086524 3300047323 Bacteria 1523
870 Ga0495683_0171299 3300047323 Bacteria 997
871 Ga0495687_009716 3300047443 Bacteria 5348
872 Ga0495687_067544 3300047443 Bacteria 1446
873 Ga0495687_077248 3300047443 Bacteria 1315
874 Ga0495675_0002990 3300047444 Bacteria 10145
875 Ga0495675_0003023 3300047444 Bacteria 10102
876 Ga0495675_0011010 3300047444 Bacteria 5669
877 Ga0495675_0017663 3300047444 Bacteria 4523
878 Ga0495675_0021862 3300047444 Bacteria 4075
879 Ga0495675_0027933 3300047444 Bacteria 3596
880 Ga0495675_0054932 3300047444 Bacteria 2526
881 Ga0495675_0139644 3300047444 Bacteria 1502
882 Ga0495679_024981 3300047446 Bacteria 2004
883 Ga0495679_044078 3300047446 Bacteria 1368
884 Ga0495685_001876 3300047447 Bacteria 6493
885 Ga0495685_009339 3300047447 Bacteria 3274
886 Ga0495685_011010 3300047447 Bacteria 3042
887 Ga0495681_0003180 3300047470 Bacteria 11474
888 Ga0495681_0017515 3300047470 Bacteria 3974
889 Ga0495681_0157153 3300047470 Bacteria 949
890 Ga0495684_0017677 3300047471 Bacteria 5491
891 Ga0495684_0097621 3300047471 Bacteria 2222
892 Ga0495684_0123162 3300047471 Bacteria 1951
893 Ga0495684_0157045 3300047471 Bacteria 1698
894 Ga0495686_0029178 3300047472 Bacteria 3590
895 Ga0495686_0071898 3300047472 Bacteria 2128
896 Ga0495686_0238381 3300047472 Bacteria 1027
897 Ga0495686_0243020 3300047472 Bacteria 1014
898 Ga0495593_0001454 3300047673 Bacteria 13885
899 Ga0495593_0006130 3300047673 Bacteria 7072
900 Ga0495593_0021962 3300047673 Bacteria 3560
901 Ga0495593_0035826 3300047673 Bacteria 2692
902 Ga0495593_0037710 3300047673 Bacteria 2612
903 Ga0495593_0050511 3300047673 Bacteria 2203
904 Ga0495593_0065512 3300047673 Bacteria 1895
905 Ga0495593_0083795 3300047673 Bacteria 1646
906 Ga0495602_0000122 3300048088 Bacteria 73031
907 Ga0495602_0017568 3300048088 Bacteria 7166
908 Ga0495602_0030008 3300048088 Bacteria 5166
909 Ga0495602_0033322 3300048088 Bacteria 4834
910 Ga0495602_0053483 3300048088 Bacteria 3576
911 Ga0495602_0061115 3300048088 Bacteria 3278
912 Ga0495602_0068896 3300048088 Bacteria 3036
913 Ga0495602_0070400 3300048088 Bacteria 2993
914 Ga0495602_0211322 3300048088 Bacteria 1472
915 Ga0495602_0291745 3300048088 Bacteria 1197
916 Ga0495602_0733293 3300048088 Bacteria 668
917 Ga0495614_0000388 3300048089 Bacteria 17839
918 Ga0495614_0016264 3300048089 Bacteria 3239
919 Ga0495614_0042976 3300048089 Bacteria 1937
920 Ga0495614_0127501 3300048089 Bacteria 1124
921 Ga0495614_0202979 3300048089 Bacteria 897
922 Ga0495626_0006119 3300048091 Bacteria 6905
923 Ga0496100_0054621 3300048903 Bacteria 2606
924 Ga0496100_0297860 3300048903 Bacteria 1206
925 Ga0496101_0059634 3300048904 Bacteria 2766
926 Ga0496101_0078212 3300048904 Bacteria 2439
927 Ga0496101_0364105 3300048904 Bacteria 1137
928 Ga0496102_0064355 3300048905 Bacteria 3359
929 Ga0496104_0000909 3300048907 Bacteria 25355
930 Ga0496104_0055242 3300048907 Bacteria 3754
931 Ga0496104_0074102 3300048907 Bacteria 3240
932 Ga0496104_0518311 3300048907 Bacteria 1103
933 Ga0496104_1182853 3300048907 Bacteria 668
934 Ga0496105_0009583 3300048908 Bacteria 7578
935 Ga0496105_0056371 3300048908 Bacteria 3243
936 Ga0496105_0197646 3300048908 Bacteria 1642
937 Ga0496105_0779095 3300048908 Bacteria 729
938 Ga0496106_0014561 3300048909 Bacteria 5812
939 Ga0496106_0028480 3300048909 Bacteria 4161
940 Ga0496106_0106933 3300048909 Bacteria 2175
941 Ga0496106_0414000 3300048909 Bacteria 1083
942 Ga0496107_0113543 3300048910 Bacteria 1993
943 Ga0496107_0215977 3300048910 Bacteria 1426
944 Ga0496108_0001829 3300048911 Bacteria 16995
945 Ga0496108_0019071 3300048911 Bacteria 5628
946 Ga0496108_0065031 3300048911 Bacteria 3073
947 Ga0496109_0286016 3300048912 Bacteria 1554
948 Ga0496109_0537695 3300048912 Bacteria 1102
949 Ga0496110_0039855 3300048913 Bacteria 4092
950 Ga0496110_1015379 3300048913 Bacteria 737
951 Ga0496111_0176849 3300048914 Bacteria 1586
952 Ga0496111_0348790 3300048914 Bacteria 1096
953 Ga0496112_0000817 3300048915 Bacteria 22051
954 Ga0496112_0098289 3300048915 Bacteria 2897
955 Ga0496112_0213307 3300048915 Bacteria 1887
956 Ga0496113_0020163 3300048916 Bacteria 4681
957 Ga0496113_0134982 3300048916 Bacteria 1938
958 Ga0496113_0570344 3300048916 Bacteria 907
959 Ga0496114_0012843 3300048917 Bacteria 6707
960 Ga0496114_0063734 3300048917 Bacteria 3086
961 Ga0496114_0155272 3300048917 Bacteria 1987
962 Ga0496114_0354594 3300048917 Bacteria 1298
963 Ga0496114_0373705 3300048917 Bacteria 1262
964 Ga0496115_0016929 3300048918 Bacteria 5561
965 Ga0496117_0053353 3300048920 Bacteria 2841
966 Ga0496118_0031289 3300048921 Bacteria 4414
967 Ga0496118_0034550 3300048921 Bacteria 4122
968 Ga0496118_0053609 3300048921 Bacteria 3063
969 Ga0496119_0070378 3300048922 Bacteria 2052
970 Ga0496121_0254923 3300048924 Bacteria 1215
971 Ga0496122_0000206 3300048925 Bacteria 131731
972 Ga0496122_0000583 3300048925 Bacteria 74712
973 Ga0496122_0130527 3300048925 Bacteria 1598
974 Ga0496123_0000112 3300048926 Bacteria 163990
975 Ga0496124_0000290 3300048927 Bacteria 94803
976 Ga0496124_0113231 3300048927 Bacteria 2180
977 Ga0496125_0000069 3300048928 Bacteria 246981
978 Ga0496125_0011923 3300048928 Bacteria 8660
979 Ga0496126_0088751 3300048929 Bacteria 2723
980 Ga0496126_0125238 3300048929 Bacteria 2225
981 Ga0501308_040256 3300049128 Bacteria 656
982 Ga0501310_020266 3300049130 Bacteria 824
983 Ga0501307_030584 3300049162 Bacteria 745
984 Ga0495682_0022616 3300049460 Bacteria 2351
985 Ga0501311_000618 3300049527 Bacteria 2617
986 Ga0501313_040960 3300049529 Bacteria 622
987 Ga0501315_000989 3300049531 Bacteria 2250
988 Ga0501316_011534 3300049532 Bacteria 1021
989 Ga0501317_001679 3300049533 Bacteria 1960
990 Ga0501323_001534 3300049539 Bacteria 2077
991 Ga0501323_001795 3300049539 Bacteria 1978
992 Ga0501324_003212 3300049540 Bacteria 1241
993 Ga0501324_006757 3300049540 Bacteria 974
994 Ga0501031_0057014 3300049568 Bacteria 2545
995 Ga0501031_0118152 3300049568 Bacteria 1732
996 Ga0501032_0013368 3300049569 Bacteria 5842
997 Ga0501032_0023444 3300049569 Bacteria 4263
998 Ga0501032_0045515 3300049569 Bacteria 2967
999 Ga0501032_0449553 3300049569 Bacteria 825
1000 Ga0501032_0528863 3300049569 Bacteria 752
1001 Ga0501033_0020260 3300049570 Bacteria 5025
1002 Ga0501033_0037370 3300049570 Bacteria 3635
1003 Ga0501033_0057008 3300049570 Bacteria 2887
1004 Ga0501033_0066039 3300049570 Bacteria 2660
1005 Ga0501033_0090480 3300049570 Bacteria 2239
1006 Ga0501033_0110208 3300049570 Bacteria 2004
1007 Ga0501033_0179412 3300049570 Bacteria 1518
1008 Ga0501033_0322770 3300049570 Bacteria 1084
1009 Ga0501033_0656214 3300049570 Bacteria 716
1010 Ga0501034_0012571 3300049571 Bacteria 8738
1011 Ga0501034_0054193 3300049571 Bacteria 4037
1012 Ga0501034_0064608 3300049571 Bacteria 3673
1013 Ga0501034_0067569 3300049571 Bacteria 3586
1014 Ga0501034_0122802 3300049571 Bacteria 2583
1015 Ga0501034_0144207 3300049571 Bacteria 2359
1016 Ga0501034_0173514 3300049571 Bacteria 2122
1017 Ga0501034_0184832 3300049571 Bacteria 2048
1018 Ga0501034_0196901 3300049571 Bacteria 1974
1019 Ga0501036_0001212 3300049572 Bacteria 19704
1020 Ga0501036_0010825 3300049572 Bacteria 7536
1021 Ga0501036_0019020 3300049572 Bacteria 5762
1022 Ga0501036_0103822 3300049572 Bacteria 2403
1023 Ga0501036_0116899 3300049572 Bacteria 2252
1024 Ga0501036_0121639 3300049572 Bacteria 2204
1025 Ga0501037_0003070 3300049573 Bacteria 12096
1026 Ga0501037_0029527 3300049573 Bacteria 4051
1027 Ga0501037_0034235 3300049573 Bacteria 3748
1028 Ga0501038_0002444 3300049574 Bacteria 17293
1029 Ga0501038_0032589 3300049574 Bacteria 4596
1030 Ga0501038_0033075 3300049574 Bacteria 4556
1031 Ga0501038_0048790 3300049574 Bacteria 3662
1032 Ga0501038_0056405 3300049574 Bacteria 3373
1033 Ga0501038_0159952 3300049574 Bacteria 1831
1034 Ga0501039_0101931 3300049575 Bacteria 2240
1035 Ga0501039_0179252 3300049575 Bacteria 1666
1036 Ga0501039_0394748 3300049575 Bacteria 1086
1037 Ga0501039_0495527 3300049575 Bacteria 959
1038 Ga0501040_0015630 3300049576 Bacteria 5017
1039 Ga0501041_0055004 3300049577 Bacteria 2429
1040 Ga0501041_0099014 3300049577 Bacteria 1803
1041 Ga0501042_0009583 3300049578 Bacteria 6461
1042 Ga0501042_0130741 3300049578 Bacteria 1809
1043 Ga0501042_0145961 3300049578 Bacteria 1706
1044 Ga0501042_0200902 3300049578 Bacteria 1437
1045 Ga0501042_0234895 3300049578 Bacteria 1323
1046 Ga0501042_0426463 3300049578 Bacteria 961
1047 Ga0501043_0002529 3300049579 Bacteria 15462
1048 Ga0501043_0050030 3300049579 Bacteria 3285
1049 Ga0501043_0050056 3300049579 Bacteria 3284
1050 Ga0501043_0078531 3300049579 Bacteria 2593
1051 Ga0501043_0087964 3300049579 Bacteria 2441
1052 Ga0501043_0091296 3300049579 Bacteria 2394
1053 Ga0501043_0375761 3300049579 Bacteria 1076
1054 Ga0501046_0010869 3300049580 Bacteria 7801
1055 Ga0501046_0197949 3300049580 Bacteria 1496
1056 Ga0501046_0258282 3300049580 Bacteria 1280
1057 Ga0501047_0000072 3300049581 Bacteria 126542
1058 Ga0501047_0002236 3300049581 Bacteria 18522
1059 Ga0501047_0023511 3300049581 Bacteria 5914
1060 Ga0501047_0032695 3300049581 Bacteria 5023
1061 Ga0501047_0052175 3300049581 Bacteria 3952
1062 Ga0501047_0095566 3300049581 Bacteria 2850
1063 Ga0501047_0131287 3300049581 Bacteria 2385
1064 Ga0501047_0162290 3300049581 Bacteria 2106
1065 Ga0501047_0249736 3300049581 Bacteria 1622
1066 Ga0501047_0402959 3300049581 Bacteria 1201
1067 Ga0501048_0023021 3300049582 Bacteria 4554
1068 Ga0501048_0024072 3300049582 Bacteria 4446
1069 Ga0501048_0096263 3300049582 Bacteria 2088
1070 Ga0501048_0099477 3300049582 Bacteria 2052
1071 Ga0501068_0119074 3300049584 Bacteria 1645
1072 Ga0501068_0509124 3300049584 Bacteria 781
1073 Ga0501068_0852955 3300049584 Bacteria 598
1074 Ga0501070_0012353 3300049586 Bacteria 7205
1075 Ga0501070_0042504 3300049586 Bacteria 3786
1076 Ga0501070_0121758 3300049586 Bacteria 2156
1077 Ga0501070_0160054 3300049586 Bacteria 1856
1078 Ga0501070_0537854 3300049586 Bacteria 936
1079 Ga0501071_0045006 3300049587 Bacteria 3167
1080 Ga0501071_1189265 3300049587 Bacteria 589
1081 Ga0501072_0076238 3300049588 Bacteria 2653
1082 Ga0501072_0148963 3300049588 Bacteria 1866
1083 Ga0501073_0008499 3300049589 Bacteria 7614
1084 Ga0501073_0499502 3300049589 Bacteria 841
1085 Ga0501074_0000848 3300049590 Bacteria 19450
1086 Ga0501074_0057023 3300049590 Bacteria 2814
1087 Ga0501076_0049046 3300049592 Bacteria 3338
1088 Ga0501076_0425975 3300049592 Bacteria 1092
1089 Ga0501235_037277 3300049669 Bacteria 1106
1090 Ga0501257_019938 3300049686 Bacteria 1571
1091 Ga0501079_0170812 3300049741 Bacteria 1695
1092 Ga0501079_0562151 3300049741 Bacteria 897
1093 Ga0501081_0112361 3300049743 Bacteria 1934
1094 Ga0501083_0010851 3300049744 Bacteria 6408
1095 Ga0501035_0003491 3300049822 Bacteria 15035
1096 Ga0501035_0013355 3300049822 Bacteria 7580
1097 Ga0501035_0032338 3300049822 Bacteria 4760
1098 Ga0501035_0039755 3300049822 Bacteria 4255
1099 Ga0501035_0045118 3300049822 Bacteria 3966
1100 Ga0501035_0087511 3300049822 Bacteria 2745
1101 Ga0501035_0105874 3300049822 Bacteria 2466
1102 Ga0501035_0187169 3300049822 Bacteria 1781
1103 Ga0501035_0597542 3300049822 Bacteria 899
1104 Ga0501044_0002742 3300049823 Bacteria 20039
1105 Ga0501044_0013235 3300049823 Bacteria 8931
1106 Ga0501044_0018277 3300049823 Bacteria 7513
1107 Ga0501044_0123954 3300049823 Bacteria 2582
1108 Ga0501044_0124468 3300049823 Bacteria 2576
1109 Ga0501044_0213395 3300049823 Bacteria 1883
1110 Ga0501044_0305518 3300049823 Bacteria 1518
1111 Ga0501044_0412336 3300049823 Bacteria 1262
1112 Ga0501044_0456093 3300049823 Bacteria 1184
1113 Ga0501044_0512674 3300049823 Bacteria 1099
1114 Ga0501044_0601664 3300049823 Bacteria 992
1115 Ga0501044_0747551 3300049823 Bacteria 860
1116 Ga0501044_0818626 3300049823 Bacteria 809
1117 Ga0501045_0068330 3300049824 Bacteria 2610
1118 Ga0501045_0094604 3300049824 Bacteria 2210
1119 Ga0501045_0667884 3300049824 Bacteria 767
1120 nmdc:mga0yw44_240120_c1 3300050492 Bacteria 1204
1121 nmdc:mga06z11_7684_c1 3300050494 Bacteria 4451
1122 nmdc:mga05p37_21063_c1 3300050507 Bacteria 7892
1123 nmdc:mga05p37_59022_c1 3300050507 Bacteria 4725
1124 nmdc:mga09592_189829_c1 3300050508 Bacteria 1778
1125 nmdc:mga0qj67_187915_c1 3300050509 Bacteria 1678
1126 nmdc:mga06r32_977402_c1 3300050510 Bacteria 800
1127 nmdc:mga08y16_79556_c1 3300050511 Bacteria 3416
1128 nmdc:mga0n895_134032_c1 3300050512 Bacteria 2503
1129 nmdc:mga0n895_5271_c1 3300050512 Bacteria 10765
1130 nmdc:mga0n895_59113_c1 3300050512 Bacteria 3783
1131 nmdc:mga0rr50_121363_c1 3300050513 Bacteria 2081
1132 nmdc:mga0rr50_179158_c1 3300050513 Bacteria 1731
1133 nmdc:mga0rr50_23778_c1 3300050513 Bacteria 4234
1134 nmdc:mga08x19_13898_c1 3300050514 Bacteria 4876
1135 nmdc:mga08x19_68539_c1 3300050514 Bacteria 2309
1136 nmdc:mga0a205_41756_c1 3300050515 Bacteria 4419
1137 nmdc:mga0a205_9759_c1 3300050515 Bacteria 8794
1138 Ga0495601_0010340 3300053077 Bacteria 5551
1139 Ga0495601_0011920 3300053077 Bacteria 5211
1140 Ga0495601_0036290 3300053077 Bacteria 3077
1141 Ga0495601_0081211 3300053077 Bacteria 2080
1142 Ga0495601_0086161 3300053077 Bacteria 2018
1143 Ga0495601_0182998 3300053077 Bacteria 1370
1144 Ga0495601_0409881 3300053077 Bacteria 878
1145 Ga0495612_0009788 3300053078 Bacteria 3884
1146 Ga0495612_0015980 3300053078 Bacteria 3007
1147 Ga0495612_0073321 3300053078 Bacteria 1430
1148 Ga0495612_0075689 3300053078 Bacteria 1409
1149 Ga0495612_0076115 3300053078 Bacteria 1405
1150 Ga0495612_0101488 3300053078 Bacteria 1225
1151 Ga0495612_0189865 3300053078 Bacteria 904
1152 Ga0495595_0000288 3300053084 Bacteria 19645
1153 Ga0495595_0004237 3300053084 Bacteria 5767
1154 Ga0495595_0065626 3300053084 Bacteria 1707
1155 Ga0495619_0014125 3300053085 Bacteria 5041
1156 Ga0495619_0029190 3300053085 Bacteria 3562
1157 Ga0495619_0052770 3300053085 Bacteria 2688
1158 Ga0495619_0103750 3300053085 Bacteria 1937
1159 Ga0495619_0105858 3300053085 Bacteria 1918
1160 Ga0495619_0271904 3300053085 Bacteria 1174
1161 Ga0495619_0288624 3300053085 Bacteria 1136
1162 Ga0495619_0317201 3300053085 Bacteria 1079
1163 Ga0500578_0027273 3300053086 Bacteria 3666
1164 Ga0500644_0038061 3300053088 Bacteria 1576
1165 Ga0500651_0229966 3300053093 Bacteria 1085
1166 Ga0500640_005745 3300053095 Bacteria 4663
1167 Ga0500641_0077403 3300053096 Bacteria 1408
1168 Ga0500654_067044 3300053099 Bacteria 1782
1169 Ga0500553_037039 3300053101 Bacteria 2410
1170 Ga0500556_0026382 3300053104 Bacteria 1930
1171 Ga0500572_021039 3300053111 Bacteria 1723
1172 Ga0500614_011290 3300053123 Bacteria 1931
1173 Ga0500628_003764 3300053129 Bacteria 2503
1174 Ga0500652_009578 3300053131 Bacteria 3283
1175 Ga0500652_105384 3300053131 Bacteria 1179
1176 Ga0500658_0009142 3300053134 Bacteria 3656
1177 Ga0500561_0001882 3300053137 Bacteria 3465
1178 Ga0500573_0020678 3300053140 Bacteria 3771
1179 Ga0500573_0117994 3300053140 Bacteria 1480
1180 Ga0500577_0156008 3300053142 Bacteria 970
1181 Ga0500579_020565 3300053143 Bacteria 4281
1182 Ga0500588_0019540 3300053146 Bacteria 1803
1183 Ga0500600_0014804 3300053149 Bacteria 4740
1184 Ga0500604_0067508 3300053151 Bacteria 1135
1185 Ga0500606_088096 3300053152 Bacteria 1050
1186 Ga0500616_0003674 3300053153 Bacteria 11511
1187 Ga0500616_0011658 3300053153 Bacteria 5179
1188 Ga0500624_001358 3300053157 Bacteria 4108
1189 Ga0500633_0009991 3300053160 Bacteria 2519
1190 Ga0500634_0047199 3300053161 Bacteria 2325
1191 Ga0500656_001101 3300053732 Bacteria 2236
1192 Ga0500587_000440 3300053739 Bacteria 4891
1193 Ga0501084_0078228 3300054114 Bacteria 2772
1194 Ga0501082_0008414 3300060353 Bacteria 8902
1195 Ga0501082_0017727 3300060353 Bacteria 6132
1196 Ga0501082_0051409 3300060353 Bacteria 3552
1197 Ga0501082_1058406 3300060353 Bacteria 709
1198 Ga0466962_0000156 3300061719 Bacteria 28746
1199 Ga0466962_0008705 3300061719 Bacteria 4865
1200 Ga0466962_0048045 3300061719 Bacteria 2039
1201 Ga0466962_0053482 3300061719 Bacteria 1930
1202 Ga0466962_0374035 3300061719 Bacteria 711
1203 Ga0530510_0479338 3300061734 Bacteria 942

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10000303 Ga0070709_1000030313 165
2 3300005435 Ga0070714_100001285 Ga0070714_10000128515 165
3 3300005436 Ga0070713_100000735 Ga0070713_10000073517 165
4 3300005439 Ga0070711_100001622 Ga0070711_1000016221 165
5 3300006173 Ga0070716_100000094 Ga0070716_10000009432 165
6 3300046543 Ga0495645_0744917 Ga0495645_0744917_39_572 165
7 3300049584 Ga0501068_0852955 Ga0501068_0852955_11_544 165
8 3300046516 Ga0495628_0312066 Ga0495628_0312066_299_916 170
9 3300034816 Ga0373930_0019205 Ga0373930_0019205_383_937 172
10 3300034817 Ga0373948_0006582 Ga0373948_0006582_1052_1606 172
11 3300034957 Ga0373938_0006469 Ga0373938_0006469_518_1072 172
12 3300035088 Ga0373940_0048960 Ga0373940_0048960_571_1125 172
13 3300035112 Ga0373932_0003623 Ga0373932_0003623_2856_3410 172
14 3300035121 Ga0373960_0011091 Ga0373960_0011091_1402_1956 172
15 3300035207 Ga0373942_0035611 Ga0373942_0035611_308_862 172
16 3300035724 Ga0373933_0160018 Ga0373933_0160018_31_654 172
17 3300048088 Ga0495602_0733293 Ga0495602_0733293_29_622 172
18 3300048915 Ga0496112_0213307 Ga0496112_0213307_896_1450 172
19 3300048916 Ga0496113_0134982 Ga0496113_0134982_832_1386 172
20 3300050512 nmdc:mga0n895_134032_c1 nmdc:mga0n895_134032_c1_1626_2180 172
21 3300045976 Ga0466967_0201985 Ga0466967_0201985_189_788 175
22 3300049571 Ga0501034_0064608 Ga0501034_0064608_2210_2812 175
23 3300049572 Ga0501036_0001212 Ga0501036_0001212_4284_4886 175
24 3300049573 Ga0501037_0003070 Ga0501037_0003070_5091_5693 175
25 3300049574 Ga0501038_0032589 Ga0501038_0032589_2462_3064 175
26 3300049578 Ga0501042_0200902 Ga0501042_0200902_414_1016 175
27 3300049579 Ga0501043_0091296 Ga0501043_0091296_741_1343 175
28 3300049581 Ga0501047_0095566 Ga0501047_0095566_1414_2016 175
29 3300049582 Ga0501048_0023021 Ga0501048_0023021_259_861 175
30 3300049589 Ga0501073_0008499 Ga0501073_0008499_6683_7285 175
31 3300049590 Ga0501074_0000848 Ga0501074_0000848_7391_7993 175
32 3300049592 Ga0501076_0425975 Ga0501076_0425975_118_720 175
33 3300049823 Ga0501044_0124468 Ga0501044_0124468_275_877 175
34 3300033179 Ga0307507_10057967 Ga0307507_100579673 178
35 3300044694 Ga0466963_0927377 Ga0466963_0927377_65_601 178
36 3300044765 Ga0466970_0512832 Ga0466970_0512832_142_678 178
37 3300044901 Ga0466960_0125492 Ga0466960_0125492_754_1290 178
38 3300046461 Ga0495641_0229465 Ga0495641_0229465_179_715 178
39 3300048907 Ga0496104_0518311 Ga0496104_0518311_364_900 178
40 3300048908 Ga0496105_0197646 Ga0496105_0197646_553_1089 178
41 3300048917 Ga0496114_0063734 Ga0496114_0063734_60_596 178
42 3300002067 JGI24735J21928_10108197 JGI24735J21928_101081971 179
43 3300003354 JGI25160J50197_1018765 JGI25160J50197_10187652 179
44 3300005329 Ga0070683_100448463 Ga0070683_1004484631 179
45 3300005445 Ga0070708_100254009 Ga0070708_1002540091 179
46 3300005455 Ga0070663_100207088 Ga0070663_1002070882 179
47 3300005467 Ga0070706_100001435 Ga0070706_1000014359 179
48 3300005468 Ga0070707_100000833 Ga0070707_10000083320 179
49 3300005468 Ga0070707_100019207 Ga0070707_1000192074 179
50 3300005471 Ga0070698_100001044 Ga0070698_10000104411 179
51 3300005539 Ga0068853_100042399 Ga0068853_1000423992 179
52 3300005548 Ga0070665_100073321 Ga0070665_1000733212 179
53 3300005563 Ga0068855_100207190 Ga0068855_1002071902 179
54 3300005616 Ga0068852_100007469 Ga0068852_1000074692 179
55 3300014745 Ga0157377_10852080 Ga0157377_108520801 179
56 3300020076 Ga0206355_1518046 Ga0206355_15180462 179
57 3300025302 Ga0207426_1003984 Ga0207426_10039844 179
58 3300025904 Ga0207647_10044080 Ga0207647_100440802 179
59 3300025910 Ga0207684_10000549 Ga0207684_1000054925 179
60 3300025911 Ga0207654_10002025 Ga0207654_100020256 179
61 3300025913 Ga0207695_10001075 Ga0207695_1000107526 179
62 3300025914 Ga0207671_10000122 Ga0207671_1000012229 179
63 3300025922 Ga0207646_10000577 Ga0207646_1000057720 179
64 3300025924 Ga0207694_10000829 Ga0207694_1000082914 179
65 3300025935 Ga0207709_10238836 Ga0207709_102388362 179
66 3300025940 Ga0207691_11020483 Ga0207691_110204831 179
67 3300025949 Ga0207667_10006929 Ga0207667_100069292 179
68 3300025981 Ga0207640_10006140 Ga0207640_100061404 179
69 3300026041 Ga0207639_10048788 Ga0207639_100487883 179
70 3300026142 Ga0207698_10035262 Ga0207698_100352622 179
71 3300028379 Ga0268266_10042600 Ga0268266_100426003 179
72 3300028786 Ga0307517_10008770 Ga0307517_1000877015 179
73 3300030521 Ga0307511_10089148 Ga0307511_100891482 179
74 3300030521 Ga0307511_10145549 Ga0307511_101455492 179
75 3300031456 Ga0307513_10015029 Ga0307513_100150299 179
76 3300031507 Ga0307509_10166488 Ga0307509_101664882 179
77 3300031616 Ga0307508_10105662 Ga0307508_101056622 179
78 3300031730 Ga0307516_10010607 Ga0307516_100106072 179
79 3300031730 Ga0307516_10503110 Ga0307516_105031101 179
80 3300031852 Ga0307410_10078913 Ga0307410_100789132 179
81 3300031995 Ga0307409_100100195 Ga0307409_1001001952 179
82 3300032002 Ga0307416_100990072 Ga0307416_1009900722 179
83 3300033179 Ga0307507_10140857 Ga0307507_101408572 179
84 3300033180 Ga0307510_10152409 Ga0307510_101524092 179
85 3300035116 Ga0373945_0082988 Ga0373945_0082988_195_770 179
86 3300035692 Ga0373935_0396466 Ga0373935_0396466_325_900 179
87 3300035724 Ga0373933_0036349 Ga0373933_0036349_2101_2676 179
88 3300037312 Ga0395899_0002623 Ga0395899_0002623_2199_2738 179
89 3300039450 Ga0436363_1505785 Ga0436363_1505785_17_619 179
90 3300039453 Ga0436362_0845973 Ga0436362_0845973_315_899 179
91 3300041451 Ga0451791_0512465 Ga0451791_0512465_171_710 179
92 3300041498 Ga0451841_0752493 Ga0451841_0752493_140_679 179
93 3300044658 Ga0466972_0073178 Ga0466972_0073178_13_552 179
94 3300045049 Ga0466959_0125601 Ga0466959_0125601_621_1376 179
95 3300046455 Ga0495603_0029409 Ga0495603_0029409_924_1463 179
96 3300046455 Ga0495603_0055964 Ga0495603_0055964_551_1126 179
97 3300046459 Ga0495629_0004137 Ga0495629_0004137_257_796 179
98 3300046459 Ga0495629_0118408 Ga0495629_0118408_721_1260 179
99 3300046460 Ga0495638_0013477 Ga0495638_0013477_568_1107 179
100 3300046460 Ga0495638_0082360 Ga0495638_0082360_722_1261 179
101 3300046462 Ga0495651_0014042 Ga0495651_0014042_2289_2864 179
102 3300046463 Ga0495653_0019645 Ga0495653_0019645_170_745 179
103 3300046463 Ga0495653_0061156 Ga0495653_0061156_1975_2550 179
104 3300046463 Ga0495653_0065677 Ga0495653_0065677_1100_1675 179
105 3300046473 Ga0495582_0244922 Ga0495582_0244922_285_860 179
106 3300046476 Ga0495662_0275317 Ga0495662_0275317_168_743 179
107 3300046492 Ga0495585_0079626 Ga0495585_0079626_1059_1598 179
108 3300046492 Ga0495585_0080988 Ga0495585_0080988_849_1388 179
109 3300046499 Ga0495594_0006912 Ga0495594_0006912_4552_5091 179
110 3300046499 Ga0495594_0013664 Ga0495594_0013664_2103_2642 179
111 3300046511 Ga0495608_0029367 Ga0495608_0029367_2689_3264 179
112 3300046516 Ga0495628_0136341 Ga0495628_0136341_349_924 179
113 3300046522 Ga0495643_0001898 Ga0495643_0001898_14946_15485 179
114 3300046526 Ga0495666_0011524 Ga0495666_0011524_440_1015 179
115 3300046529 Ga0495652_0324755 Ga0495652_0324755_266_841 179
116 3300046533 Ga0495640_0160390 Ga0495640_0160390_301_876 179
117 3300046535 Ga0495586_0082919 Ga0495586_0082919_1121_1696 179
118 3300046535 Ga0495586_0087249 Ga0495586_0087249_471_1046 179
119 3300046536 Ga0495587_0240668 Ga0495587_0240668_42_617 179
120 3300046542 Ga0495597_0332363 Ga0495597_0332363_15_554 179
121 3300046557 Ga0495622_0004999 Ga0495622_0004999_2624_3163 179
122 3300046557 Ga0495622_0066602 Ga0495622_0066602_967_1506 179
123 3300046558 Ga0495633_0052786 Ga0495633_0052786_607_1146 179
124 3300046559 Ga0495667_0002034 Ga0495667_0002034_8615_9190 179
125 3300046642 Ga0495634_0101575 Ga0495634_0101575_301_876 179
126 3300046642 Ga0495634_0667932 Ga0495634_0667932_13_588 179
127 3300046660 Ga0495625_0279644 Ga0495625_0279644_250_789 179
128 3300046674 Ga0495588_0079314 Ga0495588_0079314_410_949 179
129 3300046675 Ga0495657_0025398 Ga0495657_0025398_2509_3084 179
130 3300046683 Ga0495658_0153570 Ga0495658_0153570_331_906 179
131 3300046691 Ga0495670_0004170 Ga0495670_0004170_2313_2852 179
132 3300046809 Ga0495600_0336237 Ga0495600_0336237_91_666 179
133 3300046810 Ga0495660_0006126 Ga0495660_0006126_1290_1829 179
134 3300047315 Ga0495581_0262280 Ga0495581_0262280_325_864 179
135 3300047318 Ga0495636_0343015 Ga0495636_0343015_123_662 179
136 3300047319 Ga0495674_0162255 Ga0495674_0162255_196_771 179
137 3300047321 Ga0495676_0062084 Ga0495676_0062084_185_760 179
138 3300047321 Ga0495676_0203918 Ga0495676_0203918_513_1052 179
139 3300047322 Ga0495680_0020452 Ga0495680_0020452_3072_3647 179
140 3300047323 Ga0495683_0086524 Ga0495683_0086524_270_809 179
141 3300047444 Ga0495675_0054932 Ga0495675_0054932_1114_1689 179
142 3300047446 Ga0495679_024981 Ga0495679_024981_258_797 179
143 3300047447 Ga0495685_001876 Ga0495685_001876_2785_3324 179
144 3300047470 Ga0495681_0003180 Ga0495681_0003180_9123_9662 179
145 3300047471 Ga0495684_0097621 Ga0495684_0097621_1464_2039 179
146 3300047472 Ga0495686_0071898 Ga0495686_0071898_982_1521 179
147 3300047472 Ga0495686_0238381 Ga0495686_0238381_198_737 179
148 3300048908 Ga0496105_0779095 Ga0496105_0779095_165_704 179
149 3300048913 Ga0496110_1015379 Ga0496110_1015379_47_586 179
150 3300048917 Ga0496114_0354594 Ga0496114_0354594_101_640 179
151 3300048917 Ga0496114_0373705 Ga0496114_0373705_390_929 179
152 3300048918 Ga0496115_0016929 Ga0496115_0016929_4438_5013 179
153 3300048920 Ga0496117_0053353 Ga0496117_0053353_1384_1923 179
154 3300048921 Ga0496118_0031289 Ga0496118_0031289_1384_1923 179
155 3300048927 Ga0496124_0113231 Ga0496124_0113231_415_954 179
156 3300048928 Ga0496125_0011923 Ga0496125_0011923_7796_8335 179
157 3300048929 Ga0496126_0125238 Ga0496126_0125238_1053_1592 179
158 3300049527 Ga0501311_000618 Ga0501311_000618_10_549 179
159 3300049539 Ga0501323_001795 Ga0501323_001795_1124_1663 179
160 3300049540 Ga0501324_003212 Ga0501324_003212_35_574 179
161 3300049569 Ga0501032_0023444 Ga0501032_0023444_3674_4213 179
162 3300049578 Ga0501042_0145961 Ga0501042_0145961_177_716 179
163 3300049822 Ga0501035_0597542 Ga0501035_0597542_202_741 179
164 3300049823 Ga0501044_0747551 Ga0501044_0747551_200_739 179
165 3300053077 Ga0495601_0081211 Ga0495601_0081211_1057_1632 179
166 3300053077 Ga0495601_0086161 Ga0495601_0086161_277_852 179
167 3300053085 Ga0495619_0103750 Ga0495619_0103750_258_833 179
168 3300053085 Ga0495619_0317201 Ga0495619_0317201_90_629 179
169 3300053086 Ga0500578_0027273 Ga0500578_0027273_1315_1854 179
170 3300053093 Ga0500651_0229966 Ga0500651_0229966_364_903 179
171 3300053096 Ga0500641_0077403 Ga0500641_0077403_383_922 179
172 3300053099 Ga0500654_067044 Ga0500654_067044_710_1249 179
173 3300053104 Ga0500556_0026382 Ga0500556_0026382_516_1055 179
174 3300053129 Ga0500628_003764 Ga0500628_003764_1253_1792 179
175 3300053131 Ga0500652_009578 Ga0500652_009578_2200_2739 179
176 3300053134 Ga0500658_0009142 Ga0500658_0009142_1445_1984 179
177 3300053137 Ga0500561_0001882 Ga0500561_0001882_685_1224 179
178 3300053140 Ga0500573_0117994 Ga0500573_0117994_657_1196 179
179 3300053142 Ga0500577_0156008 Ga0500577_0156008_31_570 179
180 3300053143 Ga0500579_020565 Ga0500579_020565_3240_3779 179
181 3300053146 Ga0500588_0019540 Ga0500588_0019540_442_981 179
182 3300053149 Ga0500600_0014804 Ga0500600_0014804_2887_3426 179
183 3300053152 Ga0500606_088096 Ga0500606_088096_241_780 179
184 3300053153 Ga0500616_0011658 Ga0500616_0011658_4545_5084 179
185 3300053160 Ga0500633_0009991 Ga0500633_0009991_1188_1727 179
186 3300053161 Ga0500634_0047199 Ga0500634_0047199_472_1011 179
187 3300053732 Ga0500656_001101 Ga0500656_001101_718_1257 179
188 3300053739 Ga0500587_000440 Ga0500587_000440_503_1042 179
189 iso_pu_bacteria 2731639228 2731907236 179
190 iso_pu_bacteria 2799112218 2799186590 179
191 iso_pu_bacteria 2884693830 2884704093 179
192 iso_pu_bacteria 2884994152 2884998045 179
193 iso_pu_bacteria 2895427314 2895431884 179
194 iso_pu_bacteria 2895442618 2895448552 179
195 iso_pu_bacteria 2964326757 2964328240 179
196 iso_pu_bacteria 8055037949 8055040707 179
197 3300049580 Ga0501046_0197949 Ga0501046_0197949_342_944 180
198 iso_pu_bacteria 2515154155 2515852502 180
199 iso_pu_bacteria 2643221613 2644080885 180
200 iso_pu_bacteria 2643221690 2644504751 180
201 iso_pu_bacteria 2643221694 2644523783 180
202 iso_pu_bacteria 2643221721 2644663798 180
203 iso_pu_bacteria 2643221722 2644667886 180
204 iso_pu_bacteria 2675903058 2676474503 180
205 iso_pu_bacteria 2827628540 2827633023 180
206 iso_pu_bacteria 2839986021 2839986595 180
207 iso_pu_bacteria 2839986021 2839986601 180
208 iso_pu_bacteria 2852635781 2852640054 180
209 iso_pu_bacteria 2856741275 2856742144 180
210 iso_pu_bacteria 2862178590 2862179483 180
211 iso_pu_bacteria 2862281513 2862286665 180
212 iso_pu_bacteria 2862290372 2862296055 180
213 iso_pu_bacteria 2862382967 2862392519 180
214 iso_pu_bacteria 2862507626 2862510259 180
215 iso_pu_bacteria 2862574272 2862578449 180
216 iso_pu_bacteria 2862705112 2862709571 180
217 iso_pu_bacteria 2863404153 2863411860 180
218 iso_pu_bacteria 2867346516 2867348536 180
219 iso_pu_bacteria 2867428634 2867435698 180
220 iso_pu_bacteria 2867475112 2867475976 180
221 iso_pu_bacteria 2873151551 2873154962 180
222 iso_pu_bacteria 2875391855 2875394681 180
223 iso_pu_bacteria 2877676314 2877680142 180
224 iso_pu_bacteria 2891395885 2891401064 180
225 iso_pu_bacteria 2891554331 2891560060 180
226 iso_pu_bacteria 2912715099 2912718732 180
227 iso_pu_bacteria 2918501144 2918504620 180
228 iso_pu_bacteria 2919468124 2919471456 180
229 iso_pu_bacteria 2932431166 2932434730 180
230 iso_pu_bacteria 2935890801 2935892381 180
231 iso_pu_bacteria 2946045630 2946049954 180
232 iso_pu_bacteria 2954380949 2954385074 180
233 iso_pu_bacteria 2954691527 2954695892 180
234 iso_pu_bacteria 2954701450 2954711083 180
235 iso_pu_bacteria 2966598605 2966602464 180
236 iso_pu_bacteria 2990044586 2990045583 180
237 iso_pu_bacteria 2995463766 2995468033 180
238 iso_pu_bacteria 2995726249 2995726985 180
239 iso_pu_bacteria 3002998708 3003000921 180
240 iso_pu_bacteria 3006425503 3006428474 180
241 iso_pu_bacteria 8008485437 8008485877 180
242 iso_pu_bacteria 8025478263 8025484504 180
243 iso_pu_bacteria 8025524527 8025524961 180
244 iso_pu_bacteria 8033684223 8033687542 180
245 iso_pu_bacteria 8053945823 8053951463 180
246 iso_pu_bacteria 8054160619 8054161374 180
247 iso_pu_bacteria 8055034563 8055036861 180
248 iso_pu_bacteria 8056060235 8056060990 180
249 iso_pu_bacteria 8056667051 8056669205 180
250 3300006038 Ga0075365_10230197 Ga0075365_102301972 181
251 3300046454 Ga0495592_0093513 Ga0495592_0093513_1027_1572 181
252 3300046462 Ga0495651_0000251 Ga0495651_0000251_21811_22356 181
253 3300046516 Ga0495628_0005690 Ga0495628_0005690_1549_2094 181
254 3300046529 Ga0495652_0000199 Ga0495652_0000199_43793_44338 181
255 3300046529 Ga0495652_0047643 Ga0495652_0047643_1033_1578 181
256 3300046679 Ga0495623_0321023 Ga0495623_0321023_130_675 181
257 3300046680 Ga0495646_0084121 Ga0495646_0084121_1231_1776 181
258 3300046809 Ga0495600_0011653 Ga0495600_0011653_4427_4972 181
259 3300053077 Ga0495601_0409881 Ga0495601_0409881_286_831 181
260 3300053085 Ga0495619_0105858 Ga0495619_0105858_184_729 181
261 3300053151 Ga0500604_0067508 Ga0500604_0067508_413_964 181
262 3300031665 Ga0316575_10000002 Ga0316575_1000000266 182
263 iso_pu_bacteria 2547132111 2547411635 182
264 iso_pu_bacteria 2582581313 2585305148 182
265 iso_pu_bacteria 2582581314 2585318320 182
266 iso_pu_bacteria 2616644814 2616701484 182
267 iso_pu_bacteria 2643221678 2644437585 182
268 iso_pu_bacteria 2643221714 2644627957 182
269 iso_pu_bacteria 2784132148 2784589400 182
270 iso_pu_bacteria 2784746763 2785342178 182
271 iso_pu_bacteria 2784746768 2785370479 182
272 iso_pu_bacteria 2786546132 2786671635 182
273 iso_pu_bacteria 2808606359 2808843040 182
274 iso_pu_bacteria 2808606375 2808921381 182
275 iso_pu_bacteria 2808606448 2809233062 182
276 iso_pu_bacteria 2811994879 2812357083 182
277 iso_pu_bacteria 2811994917 2812479742 182
278 iso_pu_bacteria 2946064051 2946068795 182
279 iso_pu_bacteria 2946072368 2946076841 182
280 iso_pu_bacteria 2947224130 2947228116 182
281 iso_pu_bacteria 2954002825 2954005941 182
282 iso_pu_bacteria 2954673503 2954677921 182
283 iso_pu_bacteria 2954682443 2954686236 182
284 iso_pu_bacteria 2954711539 2954715297 182
285 iso_pu_bacteria 2954721474 2954725239 182
286 iso_pu_bacteria 2954731030 2954736577 182
287 iso_pu_bacteria 2954740390 2954744172 182
288 iso_pu_bacteria 2954749733 2954755427 182
289 iso_pu_bacteria 2954759201 2954763115 182
290 iso_pu_bacteria 2990059506 2990063957 182
291 iso_pu_bacteria 3006393351 3006397265 182
292 iso_pu_bacteria 3006486233 3006492248 182
293 iso_pu_bacteria 3006493962 3006500341 182
294 iso_pu_bacteria 8008558824 8008566228 182
295 iso_pu_bacteria 8023623736 8023629554 182
296 iso_pu_bacteria 8025530807 8025538148 182
297 iso_pu_bacteria 8048406513 8048409575 182
298 iso_pu_bacteria 8056829672 8056833224 182
299 3300001989 JGI24739J22299_10054830 JGI24739J22299_100548302 183
300 3300005434 Ga0070709_10063183 Ga0070709_100631833 183
301 3300005435 Ga0070714_100017017 Ga0070714_1000170172 183
302 3300005435 Ga0070714_100082975 Ga0070714_1000829753 183
303 3300005435 Ga0070714_100254436 Ga0070714_1002544362 183
304 3300005439 Ga0070711_100042489 Ga0070711_1000424892 183
305 3300006844 Ga0075428_100013717 Ga0075428_1000137177 183
306 3300006844 Ga0075428_100223572 Ga0075428_1002235722 183
307 3300006880 Ga0075429_100184222 Ga0075429_1001842222 183
308 3300009147 Ga0114129_10068964 Ga0114129_100689645 183
309 3300020082 Ga0206353_10318742 Ga0206353_103187422 183
310 3300025906 Ga0207699_10069936 Ga0207699_100699361 183
311 3300025916 Ga0207663_10647442 Ga0207663_106474422 183
312 3300025929 Ga0207664_10056279 Ga0207664_100562793 183
313 3300025929 Ga0207664_10409254 Ga0207664_104092542 183
314 3300025929 Ga0207664_10768876 Ga0207664_107688761 183
315 3300031665 Ga0316575_10000356 Ga0316575_1000035614 183
316 3300031691 Ga0316579_10011102 Ga0316579_100111025 183
317 3300031727 Ga0316576_10000206 Ga0316576_1000020610 183
318 3300031727 Ga0316576_10001306 Ga0316576_100013063 183
319 3300031727 Ga0316576_10257292 Ga0316576_102572922 183
320 3300031727 Ga0316576_10353518 Ga0316576_103535182 183
321 3300031733 Ga0316577_10020948 Ga0316577_100209481 183
322 3300032133 Ga0316583_10037055 Ga0316583_100370552 183
323 3300032139 Ga0316580_10013909 Ga0316580_100139092 183
324 3300033179 Ga0307507_10000013 Ga0307507_1000001367 183
325 3300035398 Ga0316574_0209927 Ga0316574_0209927_253_804 183
326 3300036647 Ga0316582_0025759 Ga0316582_0025759_197_748 183
327 3300036712 Ga0316584_0000468 Ga0316584_0000468_6753_7304 183
328 3300036712 Ga0316584_0367146 Ga0316584_0367146_70_621 183
329 3300037588 Ga0316581_0002277 Ga0316581_0002277_667_1218 183
330 3300044683 Ga0466965_0083545 Ga0466965_0083545_197_748 183
331 3300044693 Ga0466961_0056218 Ga0466961_0056218_1829_2380 183
332 3300044706 Ga0466964_0080868 Ga0466964_0080868_501_1052 183
333 3300044765 Ga0466970_0011402 Ga0466970_0011402_3938_4489 183
334 3300044842 Ga0466957_0031489 Ga0466957_0031489_2561_3112 183
335 3300045976 Ga0466967_0105117 Ga0466967_0105117_571_1122 183
336 3300045976 Ga0466967_1645105 Ga0466967_1645105_77_628 183
337 3300048907 Ga0496104_1182853 Ga0496104_1182853_71_622 183
338 3300048921 Ga0496118_0053609 Ga0496118_0053609_764_1318 183
339 3300048925 Ga0496122_0130527 Ga0496122_0130527_357_908 183
340 3300049571 Ga0501034_0012571 Ga0501034_0012571_3585_4136 183
341 3300049578 Ga0501042_0234895 Ga0501042_0234895_529_1080 183
342 3300050507 nmdc:mga05p37_59022_c1 nmdc:mga05p37_59022_c1_685_1236 183
343 3300050508 nmdc:mga09592_189829_c1 nmdc:mga09592_189829_c1_1070_1621 183
344 3300050509 nmdc:mga0qj67_187915_c1 nmdc:mga0qj67_187915_c1_1016_1567 183
345 3300050510 nmdc:mga06r32_977402_c1 nmdc:mga06r32_977402_c1_17_568 183
346 3300053153 Ga0500616_0003674 Ga0500616_0003674_9151_9702 183
347 3300060353 Ga0501082_0008414 Ga0501082_0008414_2252_2803 183
348 iso_pu_bacteria 2554235005 2554257041 183
349 iso_pu_bacteria 2643221587 2643947631 183
350 iso_pu_bacteria 2643221670 2644390187 183
351 iso_pu_bacteria 2643221677 2644435323 183
352 3300005327 Ga0070658_10095112 Ga0070658_100951122 184
353 3300005329 Ga0070683_100135277 Ga0070683_1001352772 184
354 3300005336 Ga0070680_100237792 Ga0070680_1002377921 184
355 3300005341 Ga0070691_10026742 Ga0070691_100267423 184
356 3300005355 Ga0070671_100378328 Ga0070671_1003783282 184
357 3300005367 Ga0070667_100122393 Ga0070667_1001223931 184
358 3300005434 Ga0070709_10000658 Ga0070709_1000065814 184
359 3300005435 Ga0070714_100007011 Ga0070714_1000070112 184
360 3300005435 Ga0070714_100042447 Ga0070714_1000424473 184
361 3300005435 Ga0070714_100084104 Ga0070714_1000841043 184
362 3300005435 Ga0070714_100126586 Ga0070714_1001265862 184
363 3300005435 Ga0070714_100710830 Ga0070714_1007108301 184
364 3300005436 Ga0070713_100083338 Ga0070713_1000833383 184
365 3300005436 Ga0070713_100084766 Ga0070713_1000847663 184
366 3300005436 Ga0070713_100096675 Ga0070713_1000966752 184
367 3300005436 Ga0070713_100107677 Ga0070713_1001076772 184
368 3300005436 Ga0070713_101711383 Ga0070713_1017113831 184
369 3300005437 Ga0070710_10002868 Ga0070710_100028687 184
370 3300005439 Ga0070711_100002814 Ga0070711_1000028148 184
371 3300005439 Ga0070711_100104285 Ga0070711_1001042851 184
372 3300005439 Ga0070711_100270564 Ga0070711_1002705643 184
373 3300005439 Ga0070711_100493291 Ga0070711_1004932911 184
374 3300005455 Ga0070663_100474322 Ga0070663_1004743221 184
375 3300005456 Ga0070678_100236706 Ga0070678_1002367063 184
376 3300005458 Ga0070681_10115673 Ga0070681_101156732 184
377 3300005458 Ga0070681_10182789 Ga0070681_101827892 184
378 3300005467 Ga0070706_100005954 Ga0070706_1000059543 184
379 3300005467 Ga0070706_100038357 Ga0070706_1000383574 184
380 3300005467 Ga0070706_100291256 Ga0070706_1002912562 184
381 3300005467 Ga0070706_100409956 Ga0070706_1004099562 184
382 3300005468 Ga0070707_100023123 Ga0070707_1000231232 184
383 3300005468 Ga0070707_100398034 Ga0070707_1003980342 184
384 3300005471 Ga0070698_100000680 Ga0070698_10000068024 184
385 3300005471 Ga0070698_100041951 Ga0070698_1000419512 184
386 3300005471 Ga0070698_100051264 Ga0070698_1000512643 184
387 3300005518 Ga0070699_100044519 Ga0070699_1000445192 184
388 3300005518 Ga0070699_100359689 Ga0070699_1003596891 184
389 3300005518 Ga0070699_100667491 Ga0070699_1006674912 184
390 3300005536 Ga0070697_100073899 Ga0070697_1000738992 184
391 3300005536 Ga0070697_100168505 Ga0070697_1001685052 184
392 3300005545 Ga0070695_100668750 Ga0070695_1006687501 184
393 3300005546 Ga0070696_100511849 Ga0070696_1005118492 184
394 3300005548 Ga0070665_100172659 Ga0070665_1001726592 184
395 3300005563 Ga0068855_100110791 Ga0068855_1001107913 184
396 3300005564 Ga0070664_100893661 Ga0070664_1008936612 184
397 3300005578 Ga0068854_100788008 Ga0068854_1007880082 184
398 3300005617 Ga0068859_100737826 Ga0068859_1007378262 184
399 3300005841 Ga0068863_100121156 Ga0068863_1001211563 184
400 3300005843 Ga0068860_100126846 Ga0068860_1001268463 184
401 3300005983 Ga0081540_1003225 Ga0081540_10032256 184
402 3300005983 Ga0081540_1155036 Ga0081540_11550361 184
403 3300006028 Ga0070717_10004476 Ga0070717_1000447610 184
404 3300006028 Ga0070717_10065248 Ga0070717_100652483 184
405 3300006028 Ga0070717_10114967 Ga0070717_101149672 184
406 3300006028 Ga0070717_10123979 Ga0070717_101239793 184
407 3300006163 Ga0070715_10038014 Ga0070715_100380143 184
408 3300006163 Ga0070715_10071889 Ga0070715_100718892 184
409 3300006173 Ga0070716_100004007 Ga0070716_1000040077 184
410 3300006173 Ga0070716_100222343 Ga0070716_1002223432 184
411 3300006175 Ga0070712_100224202 Ga0070712_1002242022 184
412 3300006175 Ga0070712_100235700 Ga0070712_1002357002 184
413 3300006175 Ga0070712_100562509 Ga0070712_1005625092 184
414 3300006237 Ga0097621_100031362 Ga0097621_1000313623 184
415 3300006237 Ga0097621_100105362 Ga0097621_1001053622 184
416 3300006353 Ga0075370_10271902 Ga0075370_102719022 184
417 3300006852 Ga0075433_10011945 Ga0075433_100119453 184
418 3300006852 Ga0075433_10027801 Ga0075433_100278013 184
419 3300006871 Ga0075434_100017170 Ga0075434_1000171702 184
420 3300006871 Ga0075434_100848954 Ga0075434_1008489541 184
421 3300006914 Ga0075436_100002907 Ga0075436_1000029072 184
422 3300006914 Ga0075436_100026649 Ga0075436_1000266492 184
423 3300006931 Ga0097620_100737656 Ga0097620_1007376562 184
424 3300007076 Ga0075435_100038265 Ga0075435_1000382654 184
425 3300007076 Ga0075435_100128010 Ga0075435_1001280102 184
426 3300009093 Ga0105240_10002593 Ga0105240_1000259318 184
427 3300009094 Ga0111539_10217332 Ga0111539_102173323 184
428 3300009098 Ga0105245_10022695 Ga0105245_100226952 184
429 3300009101 Ga0105247_10140142 Ga0105247_101401422 184
430 3300009147 Ga0114129_10008421 Ga0114129_1000842110 184
431 3300009148 Ga0105243_10364898 Ga0105243_103648982 184
432 3300009148 Ga0105243_10534848 Ga0105243_105348482 184
433 3300009174 Ga0105241_10001133 Ga0105241_1000113312 184
434 3300009174 Ga0105241_10054363 Ga0105241_100543632 184
435 3300009174 Ga0105241_10197349 Ga0105241_101973492 184
436 3300009177 Ga0105248_10301486 Ga0105248_103014862 184
437 3300009545 Ga0105237_10033948 Ga0105237_100339485 184
438 3300009545 Ga0105237_10587634 Ga0105237_105876342 184
439 3300009551 Ga0105238_10019076 Ga0105238_100190763 184
440 3300009553 Ga0105249_10574137 Ga0105249_105741372 184
441 3300010375 Ga0105239_10080227 Ga0105239_100802274 184
442 3300011119 Ga0105246_10173966 Ga0105246_101739662 184
443 3300013104 Ga0157370_10024372 Ga0157370_100243724 184
444 3300013105 Ga0157369_10231037 Ga0157369_102310372 184
445 3300013296 Ga0157374_10009898 Ga0157374_100098982 184
446 3300013296 Ga0157374_10028904 Ga0157374_100289042 184
447 3300013297 Ga0157378_10174862 Ga0157378_101748622 184
448 3300013306 Ga0163162_10490143 Ga0163162_104901432 184
449 3300013307 Ga0157372_10062057 Ga0157372_100620573 184
450 3300013307 Ga0157372_10188025 Ga0157372_101880252 184
451 3300013307 Ga0157372_10457540 Ga0157372_104575402 184
452 3300013308 Ga0157375_10277578 Ga0157375_102775782 184
453 3300014325 Ga0163163_10003442 Ga0163163_1000344214 184
454 3300014745 Ga0157377_10155670 Ga0157377_101556701 184
455 3300014968 Ga0157379_10002390 Ga0157379_1000239015 184
456 3300014969 Ga0157376_10007343 Ga0157376_100073432 184
457 3300014969 Ga0157376_10102298 Ga0157376_101022983 184
458 3300014969 Ga0157376_10520189 Ga0157376_105201892 184
459 3300020070 Ga0206356_10039005 Ga0206356_100390052 184
460 3300021388 Ga0213875_10016990 Ga0213875_100169904 184
461 3300021388 Ga0213875_10042697 Ga0213875_100426972 184
462 3300024225 Ga0224572_1002611 Ga0224572_10026112 184
463 3300024227 Ga0228598_1030632 Ga0228598_10306321 184
464 3300025898 Ga0207692_10000198 Ga0207692_100001982 184
465 3300025898 Ga0207692_10005056 Ga0207692_100050562 184
466 3300025898 Ga0207692_10007347 Ga0207692_100073474 184
467 3300025898 Ga0207692_10026163 Ga0207692_100261633 184
468 3300025898 Ga0207692_10039943 Ga0207692_100399432 184
469 3300025905 Ga0207685_10007645 Ga0207685_100076452 184
470 3300025905 Ga0207685_10028498 Ga0207685_100284981 184
471 3300025905 Ga0207685_10048016 Ga0207685_100480161 184
472 3300025906 Ga0207699_10000355 Ga0207699_100003557 184
473 3300025906 Ga0207699_10008211 Ga0207699_100082112 184
474 3300025906 Ga0207699_10013730 Ga0207699_100137303 184
475 3300025906 Ga0207699_10014905 Ga0207699_100149052 184
476 3300025910 Ga0207684_10001867 Ga0207684_100018672 184
477 3300025910 Ga0207684_10023269 Ga0207684_100232693 184
478 3300025910 Ga0207684_10304429 Ga0207684_103044292 184
479 3300025912 Ga0207707_10214262 Ga0207707_102142621 184
480 3300025915 Ga0207693_10012402 Ga0207693_100124022 184
481 3300025915 Ga0207693_10018785 Ga0207693_100187852 184
482 3300025915 Ga0207693_10056204 Ga0207693_100562042 184
483 3300025915 Ga0207693_10088416 Ga0207693_100884162 184
484 3300025915 Ga0207693_10166610 Ga0207693_101666102 184
485 3300025916 Ga0207663_10057034 Ga0207663_100570342 184
486 3300025916 Ga0207663_10990230 Ga0207663_109902301 184
487 3300025917 Ga0207660_10372919 Ga0207660_103729192 184
488 3300025922 Ga0207646_10017839 Ga0207646_100178394 184
489 3300025922 Ga0207646_10077134 Ga0207646_100771343 184
490 3300025922 Ga0207646_10104929 Ga0207646_101049292 184
491 3300025922 Ga0207646_10314217 Ga0207646_103142172 184
492 3300025928 Ga0207700_10000427 Ga0207700_1000042710 184
493 3300025928 Ga0207700_10008608 Ga0207700_100086082 184
494 3300025928 Ga0207700_10008868 Ga0207700_100088682 184
495 3300025928 Ga0207700_10037684 Ga0207700_100376842 184
496 3300025928 Ga0207700_10081039 Ga0207700_100810392 184
497 3300025928 Ga0207700_10111952 Ga0207700_101119522 184
498 3300025928 Ga0207700_10111987 Ga0207700_101119872 184
499 3300025928 Ga0207700_10293449 Ga0207700_102934491 184
500 3300025929 Ga0207664_10006111 Ga0207664_100061113 184
501 3300025929 Ga0207664_10010058 Ga0207664_100100585 184
502 3300025929 Ga0207664_10029954 Ga0207664_100299542 184
503 3300025929 Ga0207664_10039826 Ga0207664_100398263 184
504 3300025929 Ga0207664_10075145 Ga0207664_100751452 184
505 3300025929 Ga0207664_10172013 Ga0207664_101720132 184
506 3300025939 Ga0207665_10001080 Ga0207665_1000108019 184
507 3300025939 Ga0207665_10003971 Ga0207665_100039713 184
508 3300025939 Ga0207665_10007451 Ga0207665_100074513 184
509 3300025940 Ga0207691_10137592 Ga0207691_101375922 184
510 3300025941 Ga0207711_10115701 Ga0207711_101157012 184
511 3300025944 Ga0207661_10138298 Ga0207661_101382982 184
512 3300025949 Ga0207667_10094891 Ga0207667_100948912 184
513 3300025949 Ga0207667_10287468 Ga0207667_102874682 184
514 3300025986 Ga0207658_10386164 Ga0207658_103861642 184
515 3300026035 Ga0207703_10146273 Ga0207703_101462732 184
516 3300026067 Ga0207678_10084430 Ga0207678_100844303 184
517 3300026067 Ga0207678_10486158 Ga0207678_104861582 184
518 3300026088 Ga0207641_10059677 Ga0207641_100596773 184
519 3300026116 Ga0207674_10214750 Ga0207674_102147502 184
520 3300026121 Ga0207683_10188808 Ga0207683_101888082 184
521 3300027907 Ga0207428_10053288 Ga0207428_100532883 184
522 3300028800 Ga0265338_10000718 Ga0265338_1000071823 184
523 3300031507 Ga0307509_10030305 Ga0307509_100303052 184
524 3300031595 Ga0265313_10125733 Ga0265313_101257332 184
525 3300031901 Ga0307406_10521558 Ga0307406_105215581 184
526 3300031911 Ga0307412_10168871 Ga0307412_101688712 184
527 3300031995 Ga0307409_100192306 Ga0307409_1001923062 184
528 3300032002 Ga0307416_100148139 Ga0307416_1001481392 184
529 3300032002 Ga0307416_100759353 Ga0307416_1007593531 184
530 3300032004 Ga0307414_10112584 Ga0307414_101125842 184
531 3300032004 Ga0307414_10405169 Ga0307414_104051692 184
532 3300032004 Ga0307414_10867056 Ga0307414_108670561 184
533 3300032005 Ga0307411_10117908 Ga0307411_101179083 184
534 3300032005 Ga0307411_10592719 Ga0307411_105927192 184
535 3300032126 Ga0307415_100561399 Ga0307415_1005613991 184
536 3300032126 Ga0307415_100829103 Ga0307415_1008291031 184
537 3300034819 Ga0373958_0106638 Ga0373958_0106638_41_631 184
538 3300035083 Ga0373926_0040258 Ga0373926_0040258_374_964 184
539 3300035083 Ga0373926_0139670 Ga0373926_0139670_163_753 184
540 3300035085 Ga0373929_0037106 Ga0373929_0037106_437_1027 184
541 3300035086 Ga0373934_0000184 Ga0373934_0000184_20480_21070 184
542 3300035086 Ga0373934_0002392 Ga0373934_0002392_2951_3541 184
543 3300035086 Ga0373934_0018608 Ga0373934_0018608_1750_2409 184
544 3300035086 Ga0373934_0019406 Ga0373934_0019406_216_806 184
545 3300035090 Ga0373949_0038148 Ga0373949_0038148_173_763 184
546 3300035091 Ga0373951_0030281 Ga0373951_0030281_30_620 184
547 3300035092 Ga0373952_0048375 Ga0373952_0048375_347_937 184
548 3300035111 Ga0373923_0006465 Ga0373923_0006465_3165_3755 184
549 3300035111 Ga0373923_0030219 Ga0373923_0030219_1445_2110 184
550 3300035111 Ga0373923_0048861 Ga0373923_0048861_523_1113 184
551 3300035111 Ga0373923_0084512 Ga0373923_0084512_589_1206 184
552 3300035111 Ga0373923_0109734 Ga0373923_0109734_284_838 184
553 3300035113 Ga0373936_0032597 Ga0373936_0032597_854_1444 184
554 3300035113 Ga0373936_0046718 Ga0373936_0046718_919_1578 184
555 3300035113 Ga0373936_0100073 Ga0373936_0100073_415_1080 184
556 3300035113 Ga0373936_0170120 Ga0373936_0170120_278_868 184
557 3300035114 Ga0373939_0057298 Ga0373939_0057298_41_631 184
558 3300035115 Ga0373941_0078018 Ga0373941_0078018_437_1027 184
559 3300035116 Ga0373945_0009754 Ga0373945_0009754_1901_2491 184
560 3300035116 Ga0373945_0049152 Ga0373945_0049152_378_1061 184
561 3300035116 Ga0373945_0131611 Ga0373945_0131611_385_972 184
562 3300035117 Ga0373953_0000116 Ga0373953_0000116_9628_10218 184
563 3300035117 Ga0373953_0005235 Ga0373953_0005235_3082_3672 184
564 3300035117 Ga0373953_0012677 Ga0373953_0012677_1080_1667 184
565 3300035117 Ga0373953_0026389 Ga0373953_0026389_236_895 184
566 3300035118 Ga0373954_0001000 Ga0373954_0001000_3656_4246 184
567 3300035118 Ga0373954_0024414 Ga0373954_0024414_1700_2290 184
568 3300035118 Ga0373954_0106711 Ga0373954_0106711_10_600 184
569 3300035119 Ga0373956_0000136 Ga0373956_0000136_1467_2057 184
570 3300035119 Ga0373956_0011462 Ga0373956_0011462_410_1000 184
571 3300035119 Ga0373956_0103573 Ga0373956_0103573_170_757 184
572 3300035119 Ga0373956_0109470 Ga0373956_0109470_478_1068 184
573 3300035120 Ga0373957_0000035 Ga0373957_0000035_9851_10441 184
574 3300035120 Ga0373957_0002953 Ga0373957_0002953_845_1435 184
575 3300035120 Ga0373957_0003000 Ga0373957_0003000_2765_3430 184
576 3300035120 Ga0373957_0018235 Ga0373957_0018235_523_1113 184
577 3300035120 Ga0373957_0061778 Ga0373957_0061778_854_1441 184
578 3300035170 Ga0373943_0494058 Ga0373943_0494058_97_684 184
579 3300035171 Ga0373946_0132812 Ga0373946_0132812_348_965 184
580 3300035171 Ga0373946_0299054 Ga0373946_0299054_72_662 184
581 3300035172 Ga0373955_0000072 Ga0373955_0000072_15991_16581 184
582 3300035172 Ga0373955_0010552 Ga0373955_0010552_3248_3907 184
583 3300035172 Ga0373955_0042016 Ga0373955_0042016_808_1398 184
584 3300035172 Ga0373955_0048357 Ga0373955_0048357_226_816 184
585 3300035172 Ga0373955_0091799 Ga0373955_0091799_410_997 184
586 3300035172 Ga0373955_0264755 Ga0373955_0264755_408_998 184
587 3300035242 Ga0373962_0009821 Ga0373962_0009821_169_759 184
588 3300035398 Ga0316574_0021271 Ga0316574_0021271_2087_2644 184
589 3300035410 Ga0373924_0001000 Ga0373924_0001000_358_948 184
590 3300035410 Ga0373924_0002302 Ga0373924_0002302_229_819 184
591 3300035410 Ga0373924_0012374 Ga0373924_0012374_1411_2001 184
592 3300035410 Ga0373924_0026843 Ga0373924_0026843_1478_2143 184
593 3300035691 Ga0373931_0143278 Ga0373931_0143278_776_1366 184
594 3300035691 Ga0373931_0291280 Ga0373931_0291280_31_615 184
595 3300035691 Ga0373931_0550532 Ga0373931_0550532_90_680 184
596 3300035692 Ga0373935_0045702 Ga0373935_0045702_195_785 184
597 3300035692 Ga0373935_0120221 Ga0373935_0120221_1103_1729 184
598 3300035692 Ga0373935_0151149 Ga0373935_0151149_154_813 184
599 3300035692 Ga0373935_0170699 Ga0373935_0170699_506_1165 184
600 3300035695 Ga0373927_0080460 Ga0373927_0080460_1294_1881 184
601 3300035724 Ga0373933_0000327 Ga0373933_0000327_14049_14639 184
602 3300035724 Ga0373933_0006553 Ga0373933_0006553_3739_4329 184
603 3300035724 Ga0373933_0018940 Ga0373933_0018940_1029_1619 184
604 3300035724 Ga0373933_0200604 Ga0373933_0200604_663_1250 184
605 3300035725 Ga0373947_0075049 Ga0373947_0075049_1176_1766 184
606 3300035725 Ga0373947_0100587 Ga0373947_0100587_265_924 184
607 3300035725 Ga0373947_0129409 Ga0373947_0129409_118_783 184
608 3300035725 Ga0373947_0161540 Ga0373947_0161540_335_961 184
609 3300036401 Ga0373937_0000010 Ga0373937_0000010_72957_73547 184
610 3300036401 Ga0373937_0001685 Ga0373937_0001685_1321_1911 184
611 3300036401 Ga0373937_0009917 Ga0373937_0009917_3054_3713 184
612 3300036401 Ga0373937_0017506 Ga0373937_0017506_227_817 184
613 3300036401 Ga0373937_0803493 Ga0373937_0803493_233_820 184
614 3300036712 Ga0316584_0733065 Ga0316584_0733065_36_593 184
615 3300037068 Ga0373925_0103218 Ga0373925_0103218_1167_1757 184
616 3300037068 Ga0373925_0134396 Ga0373925_0134396_1318_1905 184
617 3300037068 Ga0373925_0300626 Ga0373925_0300626_475_1134 184
618 3300037068 Ga0373925_0377747 Ga0373925_0377747_368_958 184
619 3300037853 Ga0436364_0849349 Ga0436364_0849349_15_659 184
620 3300037853 Ga0436364_0894524 Ga0436364_0894524_292_897 184
621 3300037853 Ga0436364_1059010 Ga0436364_1059010_14496_15077 184
622 3300041456 Ga0451795_0794252 Ga0451795_0794252_370_924 184
623 3300041460 Ga0451802_1325708 Ga0451802_1325708_386_940 184
624 3300044656 Ga0466969_0004692 Ga0466969_0004692_329_883 184
625 3300044656 Ga0466969_0007675 Ga0466969_0007675_2045_2599 184
626 3300044656 Ga0466969_0018099 Ga0466969_0018099_654_1208 184
627 3300044656 Ga0466969_0107910 Ga0466969_0107910_309_872 184
628 3300044658 Ga0466972_0164257 Ga0466972_0164257_318_881 184
629 3300044683 Ga0466965_0129997 Ga0466965_0129997_687_1241 184
630 3300044683 Ga0466965_0194482 Ga0466965_0194482_198_767 184
631 3300044684 Ga0466966_0001731 Ga0466966_0001731_7343_7897 184
632 3300044684 Ga0466966_0015224 Ga0466966_0015224_4263_4817 184
633 3300044684 Ga0466966_0035646 Ga0466966_0035646_195_758 184
634 3300044684 Ga0466966_0274986 Ga0466966_0274986_272_826 184
635 3300044693 Ga0466961_0006951 Ga0466961_0006951_6596_7150 184
636 3300044693 Ga0466961_0037073 Ga0466961_0037073_678_1232 184
637 3300044693 Ga0466961_0060219 Ga0466961_0060219_1004_1567 184
638 3300044693 Ga0466961_0412060 Ga0466961_0412060_47_601 184
639 3300044694 Ga0466963_0180150 Ga0466963_0180150_692_1279 184
640 3300044694 Ga0466963_0759646 Ga0466963_0759646_67_654 184
641 3300044719 Ga0466971_0040149 Ga0466971_0040149_405_968 184
642 3300044719 Ga0466971_0048922 Ga0466971_0048922_548_1102 184
643 3300044765 Ga0466970_0007649 Ga0466970_0007649_3576_4130 184
644 3300044901 Ga0466960_0171059 Ga0466960_0171059_304_873 184
645 3300045049 Ga0466959_0012149 Ga0466959_0012149_694_1257 184
646 3300045049 Ga0466959_0015474 Ga0466959_0015474_1634_2188 184
647 3300045049 Ga0466959_0024315 Ga0466959_0024315_3745_4299 184
648 3300045836 Ga0466958_0070274 Ga0466958_0070274_814_1377 184
649 3300045836 Ga0466958_0127815 Ga0466958_0127815_780_1334 184
650 3300046454 Ga0495592_0000136 Ga0495592_0000136_40622_41212 184
651 3300046454 Ga0495592_0006355 Ga0495592_0006355_512_1066 184
652 3300046454 Ga0495592_0015144 Ga0495592_0015144_4211_4801 184
653 3300046454 Ga0495592_0075441 Ga0495592_0075441_1511_2170 184
654 3300046454 Ga0495592_0131556 Ga0495592_0131556_382_1047 184
655 3300046454 Ga0495592_0180425 Ga0495592_0180425_243_830 184
656 3300046455 Ga0495603_0073210 Ga0495603_0073210_1137_1724 184
657 3300046459 Ga0495629_0009288 Ga0495629_0009288_1318_1908 184
658 3300046459 Ga0495629_0010861 Ga0495629_0010861_1954_2508 184
659 3300046459 Ga0495629_0011501 Ga0495629_0011501_5669_6259 184
660 3300046459 Ga0495629_0062453 Ga0495629_0062453_200_754 184
661 3300046459 Ga0495629_0242946 Ga0495629_0242946_396_983 184
662 3300046461 Ga0495641_0014933 Ga0495641_0014933_2116_2706 184
663 3300046461 Ga0495641_0041104 Ga0495641_0041104_155_838 184
664 3300046461 Ga0495641_0043399 Ga0495641_0043399_843_1433 184
665 3300046462 Ga0495651_0000047 Ga0495651_0000047_72957_73547 184
666 3300046462 Ga0495651_0006816 Ga0495651_0006816_5368_5922 184
667 3300046462 Ga0495651_0015668 Ga0495651_0015668_2260_2850 184
668 3300046462 Ga0495651_0123334 Ga0495651_0123334_573_1160 184
669 3300046463 Ga0495653_0000753 Ga0495653_0000753_12344_12934 184
670 3300046463 Ga0495653_0016556 Ga0495653_0016556_3551_4138 184
671 3300046463 Ga0495653_0039630 Ga0495653_0039630_1934_2488 184
672 3300046463 Ga0495653_0149206 Ga0495653_0149206_810_1469 184
673 3300046463 Ga0495653_0195548 Ga0495653_0195548_16_681 184
674 3300046472 Ga0495580_0035896 Ga0495580_0035896_1291_1845 184
675 3300046473 Ga0495582_0004891 Ga0495582_0004891_6452_7117 184
676 3300046473 Ga0495582_0041169 Ga0495582_0041169_1788_2378 184
677 3300046473 Ga0495582_0538378 Ga0495582_0538378_61_648 184
678 3300046475 Ga0495639_0009946 Ga0495639_0009946_839_1504 184
679 3300046476 Ga0495662_0000990 Ga0495662_0000990_7471_8025 184
680 3300046476 Ga0495662_0016011 Ga0495662_0016011_1560_2225 184
681 3300046476 Ga0495662_0017846 Ga0495662_0017846_1321_1911 184
682 3300046476 Ga0495662_0023647 Ga0495662_0023647_437_991 184
683 3300046476 Ga0495662_0069877 Ga0495662_0069877_179_766 184
684 3300046477 Ga0495664_0006683 Ga0495664_0006683_347_901 184
685 3300046477 Ga0495664_0007598 Ga0495664_0007598_840_1466 184
686 3300046477 Ga0495664_0012044 Ga0495664_0012044_537_1220 184
687 3300046477 Ga0495664_0033188 Ga0495664_0033188_212_871 184
688 3300046492 Ga0495585_0009338 Ga0495585_0009338_5244_5798 184
689 3300046499 Ga0495594_0051380 Ga0495594_0051380_1500_2090 184
690 3300046511 Ga0495608_0000089 Ga0495608_0000089_23982_24572 184
691 3300046511 Ga0495608_0005222 Ga0495608_0005222_587_1252 184
692 3300046511 Ga0495608_0010518 Ga0495608_0010518_4211_4801 184
693 3300046511 Ga0495608_0012351 Ga0495608_0012351_4026_4580 184
694 3300046511 Ga0495608_0030063 Ga0495608_0030063_2048_2707 184
695 3300046514 Ga0495618_0027385 Ga0495618_0027385_2785_3375 184
696 3300046514 Ga0495618_0152604 Ga0495618_0152604_135_761 184
697 3300046514 Ga0495618_0306676 Ga0495618_0306676_48_731 184
698 3300046516 Ga0495628_0000325 Ga0495628_0000325_26560_27150 184
699 3300046516 Ga0495628_0003602 Ga0495628_0003602_5697_6251 184
700 3300046516 Ga0495628_0032896 Ga0495628_0032896_180_839 184
701 3300046516 Ga0495628_0039248 Ga0495628_0039248_2207_2866 184
702 3300046516 Ga0495628_0043744 Ga0495628_0043744_2519_3184 184
703 3300046516 Ga0495628_0113392 Ga0495628_0113392_173_763 184
704 3300046516 Ga0495628_0169940 Ga0495628_0169940_859_1446 184
705 3300046517 Ga0495630_0054579 Ga0495630_0054579_301_891 184
706 3300046517 Ga0495630_0076461 Ga0495630_0076461_1750_2304 184
707 3300046517 Ga0495630_0098499 Ga0495630_0098499_301_891 184
708 3300046517 Ga0495630_0176416 Ga0495630_0176416_922_1548 184
709 3300046517 Ga0495630_0190313 Ga0495630_0190313_930_1517 184
710 3300046517 Ga0495630_0199897 Ga0495630_0199897_304_858 184
711 3300046518 Ga0495631_0093134 Ga0495631_0093134_43_597 184
712 3300046519 Ga0495632_0167646 Ga0495632_0167646_287_841 184
713 3300046526 Ga0495666_0000558 Ga0495666_0000558_11125_11679 184
714 3300046526 Ga0495666_0129906 Ga0495666_0129906_560_1150 184
715 3300046526 Ga0495666_0169154 Ga0495666_0169154_193_780 184
716 3300046529 Ga0495652_0000982 Ga0495652_0000982_15992_16582 184
717 3300046529 Ga0495652_0017286 Ga0495652_0017286_3866_4525 184
718 3300046529 Ga0495652_0023352 Ga0495652_0023352_213_803 184
719 3300046529 Ga0495652_0031986 Ga0495652_0031986_2140_2694 184
720 3300046529 Ga0495652_0062877 Ga0495652_0062877_1302_1889 184
721 3300046529 Ga0495652_0084586 Ga0495652_0084586_289_879 184
722 3300046529 Ga0495652_0140223 Ga0495652_0140223_261_920 184
723 3300046531 Ga0495665_0003003 Ga0495665_0003003_3491_4156 184
724 3300046531 Ga0495665_0014672 Ga0495665_0014672_809_1399 184
725 3300046531 Ga0495665_0017945 Ga0495665_0017945_2061_2615 184
726 3300046531 Ga0495665_0209156 Ga0495665_0209156_283_873 184
727 3300046531 Ga0495665_0284761 Ga0495665_0284761_133_723 184
728 3300046533 Ga0495640_0012287 Ga0495640_0012287_3150_3809 184
729 3300046533 Ga0495640_0013458 Ga0495640_0013458_5325_5915 184
730 3300046533 Ga0495640_0047394 Ga0495640_0047394_833_1498 184
731 3300046533 Ga0495640_0107147 Ga0495640_0107147_732_1319 184
732 3300046533 Ga0495640_0116559 Ga0495640_0116559_1085_1639 184
733 3300046535 Ga0495586_0001586 Ga0495586_0001586_1070_1624 184
734 3300046535 Ga0495586_0001723 Ga0495586_0001723_10361_11026 184
735 3300046535 Ga0495586_0038041 Ga0495586_0038041_901_1527 184
736 3300046535 Ga0495586_0127408 Ga0495586_0127408_616_1203 184
737 3300046536 Ga0495587_0000074 Ga0495587_0000074_24232_24822 184
738 3300046536 Ga0495587_0012793 Ga0495587_0012793_1524_2111 184
739 3300046536 Ga0495587_0024905 Ga0495587_0024905_301_891 184
740 3300046536 Ga0495587_0025699 Ga0495587_0025699_723_1382 184
741 3300046536 Ga0495587_0111917 Ga0495587_0111917_207_872 184
742 3300046542 Ga0495597_0221597 Ga0495597_0221597_72_626 184
743 3300046543 Ga0495645_0003455 Ga0495645_0003455_9556_10110 184
744 3300046543 Ga0495645_0014924 Ga0495645_0014924_686_1240 184
745 3300046543 Ga0495645_0017450 Ga0495645_0017450_3922_4605 184
746 3300046543 Ga0495645_0035334 Ga0495645_0035334_263_850 184
747 3300046543 Ga0495645_0063472 Ga0495645_0063472_657_1316 184
748 3300046543 Ga0495645_0076533 Ga0495645_0076533_877_1467 184
749 3300046543 Ga0495645_0281841 Ga0495645_0281841_215_874 184
750 3300046557 Ga0495622_0063860 Ga0495622_0063860_350_904 184
751 3300046559 Ga0495667_0000064 Ga0495667_0000064_64831_65421 184
752 3300046559 Ga0495667_0000347 Ga0495667_0000347_16305_16964 184
753 3300046559 Ga0495667_0008486 Ga0495667_0008486_919_1584 184
754 3300046559 Ga0495667_0022169 Ga0495667_0022169_1792_2346 184
755 3300046559 Ga0495667_0038878 Ga0495667_0038878_1257_1847 184
756 3300046559 Ga0495667_0088717 Ga0495667_0088717_741_1328 184
757 3300046642 Ga0495634_0006199 Ga0495634_0006199_7831_8496 184
758 3300046642 Ga0495634_0032561 Ga0495634_0032561_301_891 184
759 3300046642 Ga0495634_0036650 Ga0495634_0036650_2288_2842 184
760 3300046648 Ga0495611_0013516 Ga0495611_0013516_1826_2380 184
761 3300046663 Ga0495635_0023230 Ga0495635_0023230_1595_2185 184
762 3300046663 Ga0495635_0045888 Ga0495635_0045888_532_1119 184
763 3300046663 Ga0495635_0051031 Ga0495635_0051031_171_830 184
764 3300046663 Ga0495635_0103554 Ga0495635_0103554_607_1266 184
765 3300046663 Ga0495635_0375411 Ga0495635_0375411_292_846 184
766 3300046663 Ga0495635_0624193 Ga0495635_0624193_51_641 184
767 3300046674 Ga0495588_0033389 Ga0495588_0033389_574_1128 184
768 3300046674 Ga0495588_0153539 Ga0495588_0153539_532_1119 184
769 3300046674 Ga0495588_0243192 Ga0495588_0243192_185_739 184
770 3300046675 Ga0495657_0000009 Ga0495657_0000009_192732_193322 184
771 3300046675 Ga0495657_0015381 Ga0495657_0015381_3755_4345 184
772 3300046675 Ga0495657_0023773 Ga0495657_0023773_415_1074 184
773 3300046675 Ga0495657_0030262 Ga0495657_0030262_2728_3282 184
774 3300046675 Ga0495657_0204768 Ga0495657_0204768_537_1127 184
775 3300046678 Ga0495599_0000084 Ga0495599_0000084_40617_41207 184
776 3300046678 Ga0495599_0024103 Ga0495599_0024103_196_786 184
777 3300046678 Ga0495599_0257210 Ga0495599_0257210_16_699 184
778 3300046678 Ga0495599_0271365 Ga0495599_0271365_227_853 184
779 3300046679 Ga0495623_0000168 Ga0495623_0000168_16004_16594 184
780 3300046679 Ga0495623_0016760 Ga0495623_0016760_1965_2555 184
781 3300046679 Ga0495623_0019236 Ga0495623_0019236_1592_2182 184
782 3300046679 Ga0495623_0024851 Ga0495623_0024851_2546_3100 184
783 3300046679 Ga0495623_0135912 Ga0495623_0135912_536_1123 184
784 3300046679 Ga0495623_0210545 Ga0495623_0210545_261_920 184
785 3300046680 Ga0495646_0006779 Ga0495646_0006779_4804_5358 184
786 3300046680 Ga0495646_0010288 Ga0495646_0010288_1981_2646 184
787 3300046680 Ga0495646_0030816 Ga0495646_0030816_1564_2154 184
788 3300046680 Ga0495646_0264135 Ga0495646_0264135_138_797 184
789 3300046681 Ga0495647_0024412 Ga0495647_0024412_764_1351 184
790 3300046683 Ga0495658_0014985 Ga0495658_0014985_3165_3830 184
791 3300046689 Ga0495613_0000387 Ga0495613_0000387_22235_22789 184
792 3300046689 Ga0495613_0002214 Ga0495613_0002214_8008_8691 184
793 3300046689 Ga0495613_0004116 Ga0495613_0004116_4578_5132 184
794 3300046689 Ga0495613_0082328 Ga0495613_0082328_708_1298 184
795 3300046689 Ga0495613_0238367 Ga0495613_0238367_471_1061 184
796 3300046690 Ga0495624_0009562 Ga0495624_0009562_666_1331 184
797 3300046690 Ga0495624_0024942 Ga0495624_0024942_2365_2955 184
798 3300046690 Ga0495624_0082931 Ga0495624_0082931_1366_1953 184
799 3300046690 Ga0495624_0113025 Ga0495624_0113025_210_800 184
800 3300046794 Ga0495589_0141399 Ga0495589_0141399_343_897 184
801 3300046809 Ga0495600_0009602 Ga0495600_0009602_2620_3210 184
802 3300046809 Ga0495600_0012067 Ga0495600_0012067_3941_4606 184
803 3300046809 Ga0495600_0015357 Ga0495600_0015357_629_1219 184
804 3300046809 Ga0495600_0020564 Ga0495600_0020564_3370_4029 184
805 3300046809 Ga0495600_0086335 Ga0495600_0086335_292_846 184
806 3300046809 Ga0495600_0178561 Ga0495600_0178561_405_959 184
807 3300046809 Ga0495600_0223964 Ga0495600_0223964_349_936 184
808 3300047315 Ga0495581_0003195 Ga0495581_0003195_1884_2567 184
809 3300047315 Ga0495581_0061905 Ga0495581_0061905_1483_2073 184
810 3300047315 Ga0495581_0099920 Ga0495581_0099920_929_1519 184
811 3300047315 Ga0495581_0173333 Ga0495581_0173333_275_829 184
812 3300047317 Ga0495604_0000070 Ga0495604_0000070_16005_16595 184
813 3300047317 Ga0495604_0001476 Ga0495604_0001476_12266_12820 184
814 3300047317 Ga0495604_0002049 Ga0495604_0002049_5368_5922 184
815 3300047317 Ga0495604_0018002 Ga0495604_0018002_2856_3446 184
816 3300047317 Ga0495604_0066109 Ga0495604_0066109_1411_1998 184
817 3300047317 Ga0495604_0081059 Ga0495604_0081059_723_1382 184
818 3300047317 Ga0495604_0233206 Ga0495604_0233206_537_1202 184
819 3300047317 Ga0495604_0404711 Ga0495604_0404711_221_880 184
820 3300047319 Ga0495674_0018316 Ga0495674_0018316_3451_4110 184
821 3300047319 Ga0495674_0051585 Ga0495674_0051585_1034_1588 184
822 3300047319 Ga0495674_0109000 Ga0495674_0109000_672_1259 184
823 3300047319 Ga0495674_0204688 Ga0495674_0204688_807_1433 184
824 3300047319 Ga0495674_0241459 Ga0495674_0241459_32_622 184
825 3300047320 Ga0495672_0425365 Ga0495672_0425365_11_565 184
826 3300047321 Ga0495676_0027215 Ga0495676_0027215_4141_4695 184
827 3300047321 Ga0495676_0257478 Ga0495676_0257478_480_1139 184
828 3300047321 Ga0495676_0481799 Ga0495676_0481799_20_646 184
829 3300047322 Ga0495680_0000195 Ga0495680_0000195_24234_24824 184
830 3300047322 Ga0495680_0004196 Ga0495680_0004196_10138_10797 184
831 3300047322 Ga0495680_0007153 Ga0495680_0007153_9063_9653 184
832 3300047322 Ga0495680_0017098 Ga0495680_0017098_4069_4734 184
833 3300047322 Ga0495680_0027349 Ga0495680_0027349_3425_4012 184
834 3300047444 Ga0495675_0002990 Ga0495675_0002990_2065_2655 184
835 3300047444 Ga0495675_0003023 Ga0495675_0003023_3670_4260 184
836 3300047444 Ga0495675_0017663 Ga0495675_0017663_979_1533 184
837 3300047444 Ga0495675_0021862 Ga0495675_0021862_1652_2311 184
838 3300047444 Ga0495675_0027933 Ga0495675_0027933_1404_1958 184
839 3300047444 Ga0495675_0139644 Ga0495675_0139644_513_1100 184
840 3300047471 Ga0495684_0017677 Ga0495684_0017677_2713_3372 184
841 3300047471 Ga0495684_0123162 Ga0495684_0123162_740_1327 184
842 3300047673 Ga0495593_0006130 Ga0495593_0006130_2811_3476 184
843 3300047673 Ga0495593_0021962 Ga0495593_0021962_301_891 184
844 3300047673 Ga0495593_0035826 Ga0495593_0035826_633_1220 184
845 3300047673 Ga0495593_0037710 Ga0495593_0037710_191_781 184
846 3300047673 Ga0495593_0050511 Ga0495593_0050511_194_748 184
847 3300047673 Ga0495593_0065512 Ga0495593_0065512_780_1334 184
848 3300048088 Ga0495602_0000122 Ga0495602_0000122_24737_25327 184
849 3300048088 Ga0495602_0030008 Ga0495602_0030008_4414_5073 184
850 3300048088 Ga0495602_0033322 Ga0495602_0033322_3388_3978 184
851 3300048088 Ga0495602_0061115 Ga0495602_0061115_1910_2464 184
852 3300048088 Ga0495602_0068896 Ga0495602_0068896_2005_2592 184
853 3300048088 Ga0495602_0070400 Ga0495602_0070400_2342_2932 184
854 3300048088 Ga0495602_0211322 Ga0495602_0211322_209_799 184
855 3300048088 Ga0495602_0291745 Ga0495602_0291745_247_906 184
856 3300048089 Ga0495614_0000388 Ga0495614_0000388_9689_10243 184
857 3300048089 Ga0495614_0042976 Ga0495614_0042976_456_1046 184
858 3300048089 Ga0495614_0202979 Ga0495614_0202979_201_866 184
859 3300048903 Ga0496100_0054621 Ga0496100_0054621_641_1231 184
860 3300048903 Ga0496100_0297860 Ga0496100_0297860_215_805 184
861 3300048904 Ga0496101_0059634 Ga0496101_0059634_347_937 184
862 3300048904 Ga0496101_0078212 Ga0496101_0078212_1676_2266 184
863 3300048904 Ga0496101_0364105 Ga0496101_0364105_54_608 184
864 3300048905 Ga0496102_0064355 Ga0496102_0064355_156_746 184
865 3300048907 Ga0496104_0000909 Ga0496104_0000909_10494_11084 184
866 3300048907 Ga0496104_0055242 Ga0496104_0055242_721_1308 184
867 3300048907 Ga0496104_0074102 Ga0496104_0074102_954_1544 184
868 3300048908 Ga0496105_0009583 Ga0496105_0009583_994_1584 184
869 3300048908 Ga0496105_0056371 Ga0496105_0056371_1601_2188 184
870 3300048909 Ga0496106_0014561 Ga0496106_0014561_2586_3140 184
871 3300048909 Ga0496106_0028480 Ga0496106_0028480_2183_2773 184
872 3300048909 Ga0496106_0106933 Ga0496106_0106933_1383_1970 184
873 3300048909 Ga0496106_0414000 Ga0496106_0414000_362_952 184
874 3300048910 Ga0496107_0215977 Ga0496107_0215977_344_934 184
875 3300048911 Ga0496108_0001829 Ga0496108_0001829_14060_14647 184
876 3300048911 Ga0496108_0019071 Ga0496108_0019071_4456_5046 184
877 3300048911 Ga0496108_0065031 Ga0496108_0065031_251_841 184
878 3300048912 Ga0496109_0286016 Ga0496109_0286016_238_828 184
879 3300048912 Ga0496109_0537695 Ga0496109_0537695_30_620 184
880 3300048913 Ga0496110_0039855 Ga0496110_0039855_331_921 184
881 3300048914 Ga0496111_0176849 Ga0496111_0176849_159_746 184
882 3300048914 Ga0496111_0348790 Ga0496111_0348790_268_858 184
883 3300048915 Ga0496112_0000817 Ga0496112_0000817_17057_17647 184
884 3300048915 Ga0496112_0098289 Ga0496112_0098289_665_1252 184
885 3300048916 Ga0496113_0020163 Ga0496113_0020163_900_1490 184
886 3300048917 Ga0496114_0012843 Ga0496114_0012843_4908_5498 184
887 3300048917 Ga0496114_0155272 Ga0496114_0155272_417_1004 184
888 3300048921 Ga0496118_0034550 Ga0496118_0034550_2959_3513 184
889 3300048922 Ga0496119_0070378 Ga0496119_0070378_1056_1610 184
890 3300048925 Ga0496122_0000206 Ga0496122_0000206_41105_41659 184
891 3300048925 Ga0496122_0000583 Ga0496122_0000583_74133_74687 184
892 3300048926 Ga0496123_0000112 Ga0496123_0000112_122352_122906 184
893 3300048927 Ga0496124_0000290 Ga0496124_0000290_30192_30746 184
894 3300048928 Ga0496125_0000069 Ga0496125_0000069_65949_66503 184
895 3300048929 Ga0496126_0088751 Ga0496126_0088751_158_736 184
896 3300049162 Ga0501307_030584 Ga0501307_030584_141_695 184
897 3300049529 Ga0501313_040960 Ga0501313_040960_43_597 184
898 3300049568 Ga0501031_0057014 Ga0501031_0057014_677_1231 184
899 3300049568 Ga0501031_0118152 Ga0501031_0118152_340_894 184
900 3300049569 Ga0501032_0045515 Ga0501032_0045515_1552_2106 184
901 3300049569 Ga0501032_0449553 Ga0501032_0449553_143_697 184
902 3300049569 Ga0501032_0528863 Ga0501032_0528863_134_688 184
903 3300049570 Ga0501033_0037370 Ga0501033_0037370_1164_1718 184
904 3300049570 Ga0501033_0057008 Ga0501033_0057008_689_1243 184
905 3300049570 Ga0501033_0066039 Ga0501033_0066039_1324_1878 184
906 3300049570 Ga0501033_0090480 Ga0501033_0090480_1623_2177 184
907 3300049570 Ga0501033_0656214 Ga0501033_0656214_99_653 184
908 3300049571 Ga0501034_0122802 Ga0501034_0122802_1006_1560 184
909 3300049571 Ga0501034_0144207 Ga0501034_0144207_240_794 184
910 3300049571 Ga0501034_0173514 Ga0501034_0173514_360_914 184
911 3300049571 Ga0501034_0184832 Ga0501034_0184832_1356_1910 184
912 3300049571 Ga0501034_0196901 Ga0501034_0196901_709_1263 184
913 3300049572 Ga0501036_0010825 Ga0501036_0010825_282_836 184
914 3300049572 Ga0501036_0019020 Ga0501036_0019020_1942_2496 184
915 3300049572 Ga0501036_0103822 Ga0501036_0103822_784_1338 184
916 3300049573 Ga0501037_0034235 Ga0501037_0034235_1967_2521 184
917 3300049574 Ga0501038_0002444 Ga0501038_0002444_5602_6156 184
918 3300049574 Ga0501038_0033075 Ga0501038_0033075_2569_3123 184
919 3300049574 Ga0501038_0056405 Ga0501038_0056405_2043_2597 184
920 3300049575 Ga0501039_0101931 Ga0501039_0101931_236_790 184
921 3300049575 Ga0501039_0394748 Ga0501039_0394748_460_1014 184
922 3300049577 Ga0501041_0055004 Ga0501041_0055004_1429_1992 184
923 3300049578 Ga0501042_0130741 Ga0501042_0130741_437_991 184
924 3300049579 Ga0501043_0050030 Ga0501043_0050030_1709_2263 184
925 3300049579 Ga0501043_0050056 Ga0501043_0050056_736_1290 184
926 3300049579 Ga0501043_0087964 Ga0501043_0087964_1653_2207 184
927 3300049579 Ga0501043_0375761 Ga0501043_0375761_327_881 184
928 3300049580 Ga0501046_0010869 Ga0501046_0010869_1071_1625 184
929 3300049580 Ga0501046_0258282 Ga0501046_0258282_673_1227 184
930 3300049581 Ga0501047_0000072 Ga0501047_0000072_27466_28020 184
931 3300049581 Ga0501047_0002236 Ga0501047_0002236_4785_5339 184
932 3300049581 Ga0501047_0023511 Ga0501047_0023511_1092_1646 184
933 3300049581 Ga0501047_0032695 Ga0501047_0032695_569_1123 184
934 3300049581 Ga0501047_0131287 Ga0501047_0131287_458_1012 184
935 3300049581 Ga0501047_0162290 Ga0501047_0162290_1381_1935 184
936 3300049581 Ga0501047_0402959 Ga0501047_0402959_543_1097 184
937 3300049582 Ga0501048_0099477 Ga0501048_0099477_816_1370 184
938 3300049584 Ga0501068_0509124 Ga0501068_0509124_155_709 184
939 3300049586 Ga0501070_0012353 Ga0501070_0012353_3683_4237 184
940 3300049586 Ga0501070_0042504 Ga0501070_0042504_1117_1671 184
941 3300049586 Ga0501070_0121758 Ga0501070_0121758_862_1416 184
942 3300049587 Ga0501071_1189265 Ga0501071_1189265_23_577 184
943 3300049588 Ga0501072_0148963 Ga0501072_0148963_941_1495 184
944 3300049741 Ga0501079_0562151 Ga0501079_0562151_330_884 184
945 3300049744 Ga0501083_0010851 Ga0501083_0010851_278_832 184
946 3300049822 Ga0501035_0003491 Ga0501035_0003491_11558_12112 184
947 3300049822 Ga0501035_0032338 Ga0501035_0032338_3245_3799 184
948 3300049822 Ga0501035_0039755 Ga0501035_0039755_1640_2194 184
949 3300049822 Ga0501035_0087511 Ga0501035_0087511_600_1154 184
950 3300049822 Ga0501035_0187169 Ga0501035_0187169_779_1333 184
951 3300049823 Ga0501044_0013235 Ga0501044_0013235_712_1266 184
952 3300049823 Ga0501044_0018277 Ga0501044_0018277_489_1043 184
953 3300049823 Ga0501044_0123954 Ga0501044_0123954_477_1031 184
954 3300049823 Ga0501044_0305518 Ga0501044_0305518_196_750 184
955 3300049823 Ga0501044_0456093 Ga0501044_0456093_315_869 184
956 3300049823 Ga0501044_0512674 Ga0501044_0512674_409_963 184
957 3300049823 Ga0501044_0818626 Ga0501044_0818626_99_653 184
958 3300049824 Ga0501045_0094604 Ga0501045_0094604_851_1405 184
959 3300049824 Ga0501045_0667884 Ga0501045_0667884_180_734 184
960 3300050492 nmdc:mga0yw44_240120_c1 nmdc:mga0yw44_240120_c1_304_858 184
961 3300050507 nmdc:mga05p37_21063_c1 nmdc:mga05p37_21063_c1_6766_7356 184
962 3300050511 nmdc:mga08y16_79556_c1 nmdc:mga08y16_79556_c1_1562_2152 184
963 3300050512 nmdc:mga0n895_5271_c1 nmdc:mga0n895_5271_c1_9892_10476 184
964 3300050512 nmdc:mga0n895_59113_c1 nmdc:mga0n895_59113_c1_1191_1781 184
965 3300050513 nmdc:mga0rr50_121363_c1 nmdc:mga0rr50_121363_c1_789_1379 184
966 3300050513 nmdc:mga0rr50_179158_c1 nmdc:mga0rr50_179158_c1_889_1506 184
967 3300050513 nmdc:mga0rr50_23778_c1 nmdc:mga0rr50_23778_c1_2002_2586 184
968 3300050514 nmdc:mga08x19_13898_c1 nmdc:mga08x19_13898_c1_2323_2913 184
969 3300050514 nmdc:mga08x19_68539_c1 nmdc:mga08x19_68539_c1_759_1343 184
970 3300050515 nmdc:mga0a205_41756_c1 nmdc:mga0a205_41756_c1_1191_1781 184
971 3300050515 nmdc:mga0a205_9759_c1 nmdc:mga0a205_9759_c1_664_1248 184
972 3300053077 Ga0495601_0010340 Ga0495601_0010340_308_934 184
973 3300053077 Ga0495601_0011920 Ga0495601_0011920_2238_2921 184
974 3300053077 Ga0495601_0036290 Ga0495601_0036290_1028_1582 184
975 3300053077 Ga0495601_0182998 Ga0495601_0182998_407_1066 184
976 3300053078 Ga0495612_0009788 Ga0495612_0009788_49_636 184
977 3300053078 Ga0495612_0015980 Ga0495612_0015980_191_781 184
978 3300053078 Ga0495612_0073321 Ga0495612_0073321_655_1209 184
979 3300053078 Ga0495612_0075689 Ga0495612_0075689_110_736 184
980 3300053078 Ga0495612_0076115 Ga0495612_0076115_29_712 184
981 3300053078 Ga0495612_0101488 Ga0495612_0101488_168_758 184
982 3300053078 Ga0495612_0189865 Ga0495612_0189865_97_756 184
983 3300053084 Ga0495595_0000288 Ga0495595_0000288_10075_10665 184
984 3300053084 Ga0495595_0004237 Ga0495595_0004237_3634_4293 184
985 3300053084 Ga0495595_0065626 Ga0495595_0065626_988_1578 184
986 3300053085 Ga0495619_0014125 Ga0495619_0014125_697_1287 184
987 3300053085 Ga0495619_0029190 Ga0495619_0029190_1422_2105 184
988 3300053085 Ga0495619_0052770 Ga0495619_0052770_1256_1843 184
989 3300053085 Ga0495619_0288624 Ga0495619_0288624_199_858 184
990 3300053101 Ga0500553_037039 Ga0500553_037039_1082_1636 184
991 3300053123 Ga0500614_011290 Ga0500614_011290_746_1300 184
992 3300060353 Ga0501082_0017727 Ga0501082_0017727_3840_4394 184
993 3300060353 Ga0501082_1058406 Ga0501082_1058406_29_583 184
994 3300061719 Ga0466962_0048045 Ga0466962_0048045_485_1039 184
995 3300061719 Ga0466962_0053482 Ga0466962_0053482_807_1361 184
996 3300061719 Ga0466962_0374035 Ga0466962_0374035_111_665 184
997 3300044684 Ga0466966_0007222 Ga0466966_0007222_238_900 185
998 3300044693 Ga0466961_0012581 Ga0466961_0012581_133_795 185
999 3300044719 Ga0466971_0005777 Ga0466971_0005777_10_672 185
1000 3300044719 Ga0466971_0209622 Ga0466971_0209622_43_705 185
1001 3300045049 Ga0466959_0097990 Ga0466959_0097990_512_1174 185
1002 3300045049 Ga0466959_0218628 Ga0466959_0218628_577_1239 185
1003 3300045836 Ga0466958_0014280 Ga0466958_0014280_60_722 185
1004 3300061719 Ga0466962_0008705 Ga0466962_0008705_789_1451 185
1005 3300001989 JGI24739J22299_10010829 JGI24739J22299_100108292 186
1006 3300002067 JGI24735J21928_10082150 JGI24735J21928_100821502 186
1007 3300003215 JGI25153J46596_10033766 JGI25153J46596_100337662 186
1008 3300003322 rootL2_10055055 rootL2_100550552 186
1009 3300005539 Ga0068853_100168810 Ga0068853_1001688102 186
1010 3300005548 Ga0070665_100093875 Ga0070665_1000938751 186
1011 3300005564 Ga0070664_100358433 Ga0070664_1003584332 186
1012 3300005937 Ga0081455_10309069 Ga0081455_103090691 186
1013 3300005985 Ga0081539_10066960 Ga0081539_100669602 186
1014 3300006048 Ga0075363_100066381 Ga0075363_1000663812 186
1015 3300006178 Ga0075367_10120663 Ga0075367_101206632 186
1016 3300006852 Ga0075433_11107116 Ga0075433_111071162 186
1017 3300006871 Ga0075434_100141004 Ga0075434_1001410042 186
1018 3300006881 Ga0068865_100312719 Ga0068865_1003127192 186
1019 3300009011 Ga0105251_10042952 Ga0105251_100429522 186
1020 3300009036 Ga0105244_10138189 Ga0105244_101381892 186
1021 3300009101 Ga0105247_10097872 Ga0105247_100978722 186
1022 3300009148 Ga0105243_10501073 Ga0105243_105010731 186
1023 3300009177 Ga0105248_10112199 Ga0105248_101121992 186
1024 3300009545 Ga0105237_10525944 Ga0105237_105259441 186
1025 3300011119 Ga0105246_10012385 Ga0105246_100123852 186
1026 3300011119 Ga0105246_10157689 Ga0105246_101576891 186
1027 3300011119 Ga0105246_10655340 Ga0105246_106553401 186
1028 3300013306 Ga0163162_10391453 Ga0163162_103914531 186
1029 3300013307 Ga0157372_10281353 Ga0157372_102813532 186
1030 3300014326 Ga0157380_10255069 Ga0157380_102550692 186
1031 3300015261 Ga0182006_1047820 Ga0182006_10478202 186
1032 3300015262 Ga0182007_10000948 Ga0182007_100009482 186
1033 3300015265 Ga0182005_1024865 Ga0182005_10248652 186
1034 3300015688 Ga0183367_1015 Ga0183367_101564 186
1035 3300020080 Ga0206350_10371078 Ga0206350_103710782 186
1036 3300025297 Ga0209758_1020439 Ga0209758_10204392 186
1037 3300025302 Ga0207426_1072135 Ga0207426_10721351 186
1038 3300025303 Ga0209051_1112049 Ga0209051_11120491 186
1039 3300025711 Ga0207696_1038217 Ga0207696_10382172 186
1040 3300025900 Ga0207710_10263081 Ga0207710_102630811 186
1041 3300025904 Ga0207647_10007289 Ga0207647_100072892 186
1042 3300025914 Ga0207671_10858263 Ga0207671_108582632 186
1043 3300025934 Ga0207686_10347464 Ga0207686_103474642 186
1044 3300025940 Ga0207691_10930167 Ga0207691_109301671 186
1045 3300026041 Ga0207639_10023348 Ga0207639_100233482 186
1046 3300026078 Ga0207702_10019973 Ga0207702_100199732 186
1047 3300027312 Ga0209371_1008032 Ga0209371_10080322 186
1048 3300027312 Ga0209371_1018659 Ga0209371_10186592 186
1049 3300028786 Ga0307517_10012587 Ga0307517_1001258710 186
1050 3300028794 Ga0307515_10001114 Ga0307515_1000111432 186
1051 3300028794 Ga0307515_10101266 Ga0307515_101012662 186
1052 3300030500 Ga0268256_1005719 Ga0268256_10057193 186
1053 3300030500 Ga0268256_1015837 Ga0268256_10158373 186
1054 3300030521 Ga0307511_10003592 Ga0307511_1000359212 186
1055 3300030522 Ga0307512_10006056 Ga0307512_1000605611 186
1056 3300031456 Ga0307513_10036984 Ga0307513_100369842 186
1057 3300031507 Ga0307509_10174524 Ga0307509_101745242 186
1058 3300031616 Ga0307508_10019325 Ga0307508_100193256 186
1059 3300031616 Ga0307508_10191297 Ga0307508_101912972 186
1060 3300031649 Ga0307514_10001631 Ga0307514_100016312 186
1061 3300031649 Ga0307514_10022169 Ga0307514_100221694 186
1062 3300031649 Ga0307514_10303992 Ga0307514_103039921 186
1063 3300031730 Ga0307516_10051538 Ga0307516_100515383 186
1064 3300031838 Ga0307518_10039052 Ga0307518_100390522 186
1065 3300031838 Ga0307518_10169360 Ga0307518_101693602 186
1066 3300033179 Ga0307507_10097415 Ga0307507_100974152 186
1067 3300033179 Ga0307507_10136125 Ga0307507_101361252 186
1068 3300033180 Ga0307510_10045037 Ga0307510_100450372 186
1069 3300033180 Ga0307510_10245106 Ga0307510_102451062 186
1070 3300033180 Ga0307510_10287941 Ga0307510_102879412 186
1071 3300037312 Ga0395899_0203269 Ga0395899_0203269_261_821 186
1072 3300037466 Ga0395898_0031982 Ga0395898_0031982_3550_4110 186
1073 3300037466 Ga0395898_0058062 Ga0395898_0058062_703_1263 186
1074 3300037853 Ga0436364_1147169 Ga0436364_1147169_20757_21344 186
1075 3300038443 Ga0395901_1541329 Ga0395901_1541329_23_583 186
1076 3300041404 Ga0439436_0003576 Ga0439436_0003576_491_1051 186
1077 3300041404 Ga0439436_0008118 Ga0439436_0008118_187_771 186
1078 3300041406 Ga0439439_0000554 Ga0439439_0000554_627_1187 186
1079 3300041408 Ga0439453_0021310 Ga0439453_0021310_211_771 186
1080 3300041512 Ga0451853_2214190 Ga0451853_2214190_1471_2031 186
1081 3300041999 Ga0439433_0000267 Ga0439433_0000267_556_1116 186
1082 3300042002 Ga0439442_030524 Ga0439442_030524_131_691 186
1083 3300042005 Ga0439448_0009759 Ga0439448_0009759_311_871 186
1084 3300042005 Ga0439448_0125248 Ga0439448_0125248_297_857 186
1085 3300042007 Ga0439449_0003868 Ga0439449_0003868_576_1136 186
1086 3300042007 Ga0439449_0006979 Ga0439449_0006979_232_792 186
1087 3300042012 Ga0439455_0085584 Ga0439455_0085584_29_589 186
1088 3300042014 Ga0439457_000100 Ga0439457_000100_3208_3768 186
1089 3300042014 Ga0439457_001085 Ga0439457_001085_3440_4000 186
1090 3300042015 Ga0439462_0003676 Ga0439462_0003676_2245_2805 186
1091 3300042131 Ga0450894_001105 Ga0450894_001105_2073_2633 186
1092 3300042132 Ga0450895_002110 Ga0450895_002110_481_1041 186
1093 3300042134 Ga0450898_001128 Ga0450898_001128_2219_2779 186
1094 3300042135 Ga0450899_000632 Ga0450899_000632_2667_3227 186
1095 3300042138 Ga0450903_000500 Ga0450903_000500_2643_3203 186
1096 3300042145 Ga0450906_003967 Ga0450906_003967_1753_2313 186
1097 3300042157 Ga0439458_0007753 Ga0439458_0007753_1240_1800 186
1098 3300042157 Ga0439458_0073582 Ga0439458_0073582_10_570 186
1099 3300042184 Ga0450908_009782 Ga0450908_009782_704_1264 186
1100 3300044656 Ga0466969_0018877 Ga0466969_0018877_360_920 186
1101 3300044658 Ga0466972_0012556 Ga0466972_0012556_1046_1606 186
1102 3300044658 Ga0466972_0131987 Ga0466972_0131987_249_809 186
1103 3300044684 Ga0466966_0002839 Ga0466966_0002839_320_880 186
1104 3300044684 Ga0466966_0041189 Ga0466966_0041189_549_1109 186
1105 3300044693 Ga0466961_0029154 Ga0466961_0029154_2669_3229 186
1106 3300044693 Ga0466961_0142714 Ga0466961_0142714_677_1237 186
1107 3300044694 Ga0466963_0004122 Ga0466963_0004122_2198_2758 186
1108 3300044694 Ga0466963_0004646 Ga0466963_0004646_277_837 186
1109 3300044694 Ga0466963_0283112 Ga0466963_0283112_295_855 186
1110 3300044706 Ga0466964_0299217 Ga0466964_0299217_61_621 186
1111 3300044719 Ga0466971_0004706 Ga0466971_0004706_3480_4040 186
1112 3300044719 Ga0466971_0010182 Ga0466971_0010182_268_828 186
1113 3300044735 Ga0466968_0087727 Ga0466968_0087727_271_831 186
1114 3300044765 Ga0466970_0000340 Ga0466970_0000340_1028_1588 186
1115 3300044765 Ga0466970_0105706 Ga0466970_0105706_676_1236 186
1116 3300044765 Ga0466970_0264396 Ga0466970_0264396_213_773 186
1117 3300044842 Ga0466957_0000482 Ga0466957_0000482_677_1237 186
1118 3300044842 Ga0466957_0349244 Ga0466957_0349244_262_822 186
1119 3300044901 Ga0466960_0002803 Ga0466960_0002803_1384_1944 186
1120 3300045049 Ga0466959_0001725 Ga0466959_0001725_5595_6155 186
1121 3300045049 Ga0466959_0244598 Ga0466959_0244598_383_943 186
1122 3300045836 Ga0466958_0000083 Ga0466958_0000083_2614_3174 186
1123 3300045976 Ga0466967_0035261 Ga0466967_0035261_2300_2860 186
1124 3300046452 Ga0495617_003736 Ga0495617_003736_2087_2647 186
1125 3300046454 Ga0495592_0372488 Ga0495592_0372488_303_863 186
1126 3300046455 Ga0495603_0004768 Ga0495603_0004768_2070_2630 186
1127 3300046455 Ga0495603_0016026 Ga0495603_0016026_1282_1842 186
1128 3300046455 Ga0495603_0023453 Ga0495603_0023453_2494_3054 186
1129 3300046459 Ga0495629_0059207 Ga0495629_0059207_633_1193 186
1130 3300046459 Ga0495629_0065153 Ga0495629_0065153_1947_2507 186
1131 3300046459 Ga0495629_0545579 Ga0495629_0545579_16_576 186
1132 3300046460 Ga0495638_0027916 Ga0495638_0027916_1258_1818 186
1133 3300046460 Ga0495638_0040475 Ga0495638_0040475_951_1511 186
1134 3300046461 Ga0495641_0075536 Ga0495641_0075536_76_636 186
1135 3300046462 Ga0495651_0000452 Ga0495651_0000452_25685_26245 186
1136 3300046462 Ga0495651_0148793 Ga0495651_0148793_27_587 186
1137 3300046472 Ga0495580_0094787 Ga0495580_0094787_478_1038 186
1138 3300046473 Ga0495582_0122487 Ga0495582_0122487_283_843 186
1139 3300046475 Ga0495639_0082203 Ga0495639_0082203_671_1231 186
1140 3300046476 Ga0495662_0013161 Ga0495662_0013161_2429_2989 186
1141 3300046477 Ga0495664_0000447 Ga0495664_0000447_8568_9128 186
1142 3300046477 Ga0495664_0084649 Ga0495664_0084649_201_761 186
1143 3300046492 Ga0495585_0028053 Ga0495585_0028053_2513_3073 186
1144 3300046499 Ga0495594_0090696 Ga0495594_0090696_1030_1590 186
1145 3300046499 Ga0495594_0141163 Ga0495594_0141163_354_914 186
1146 3300046499 Ga0495594_0169880 Ga0495594_0169880_512_1072 186
1147 3300046501 Ga0495607_0016214 Ga0495607_0016214_1080_1640 186
1148 3300046506 Ga0495583_0015667 Ga0495583_0015667_1480_2040 186
1149 3300046507 Ga0495606_0010908 Ga0495606_0010908_1214_1774 186
1150 3300046512 Ga0495610_0028169 Ga0495610_0028169_1932_2492 186
1151 3300046513 Ga0495616_0005383 Ga0495616_0005383_5547_6107 186
1152 3300046515 Ga0495620_0031352 Ga0495620_0031352_384_944 186
1153 3300046516 Ga0495628_0076458 Ga0495628_0076458_831_1391 186
1154 3300046516 Ga0495628_0144274 Ga0495628_0144274_1085_1645 186
1155 3300046518 Ga0495631_0009662 Ga0495631_0009662_2031_2591 186
1156 3300046520 Ga0495637_0024609 Ga0495637_0024609_1141_1701 186
1157 3300046522 Ga0495643_0005581 Ga0495643_0005581_4581_5141 186
1158 3300046522 Ga0495643_0118303 Ga0495643_0118303_204_764 186
1159 3300046524 Ga0495648_0208265 Ga0495648_0208265_73_633 186
1160 3300046526 Ga0495666_0005462 Ga0495666_0005462_3297_3857 186
1161 3300046529 Ga0495652_0006292 Ga0495652_0006292_6077_6637 186
1162 3300046529 Ga0495652_0038570 Ga0495652_0038570_3350_3910 186
1163 3300046530 Ga0495654_0003823 Ga0495654_0003823_6559_7119 186
1164 3300046533 Ga0495640_0007528 Ga0495640_0007528_1316_1876 186
1165 3300046535 Ga0495586_0008008 Ga0495586_0008008_4461_5021 186
1166 3300046536 Ga0495587_0000644 Ga0495587_0000644_12459_13019 186
1167 3300046536 Ga0495587_0072375 Ga0495587_0072375_1360_1920 186
1168 3300046538 Ga0495609_0009209 Ga0495609_0009209_1828_2388 186
1169 3300046542 Ga0495597_0036879 Ga0495597_0036879_32_592 186
1170 3300046543 Ga0495645_0007656 Ga0495645_0007656_6365_6925 186
1171 3300046543 Ga0495645_0223340 Ga0495645_0223340_673_1233 186
1172 3300046557 Ga0495622_0002086 Ga0495622_0002086_4608_5168 186
1173 3300046557 Ga0495622_0045660 Ga0495622_0045660_1225_1785 186
1174 3300046558 Ga0495633_0004699 Ga0495633_0004699_3694_4254 186
1175 3300046642 Ga0495634_0000804 Ga0495634_0000804_17796_18356 186
1176 3300046648 Ga0495611_0222453 Ga0495611_0222453_292_852 186
1177 3300046660 Ga0495625_0104124 Ga0495625_0104124_293_853 186
1178 3300046660 Ga0495625_0150270 Ga0495625_0150270_780_1340 186
1179 3300046663 Ga0495635_0001573 Ga0495635_0001573_1886_2446 186
1180 3300046663 Ga0495635_0020778 Ga0495635_0020778_3717_4277 186
1181 3300046663 Ga0495635_0089295 Ga0495635_0089295_333_893 186
1182 3300046665 Ga0495661_0014414 Ga0495661_0014414_3423_3983 186
1183 3300046665 Ga0495661_0160081 Ga0495661_0160081_127_687 186
1184 3300046674 Ga0495588_0009014 Ga0495588_0009014_238_798 186
1185 3300046675 Ga0495657_0022658 Ga0495657_0022658_1260_1820 186
1186 3300046675 Ga0495657_0041850 Ga0495657_0041850_1901_2461 186
1187 3300046675 Ga0495657_0057845 Ga0495657_0057845_50_610 186
1188 3300046675 Ga0495657_0069033 Ga0495657_0069033_902_1462 186
1189 3300046678 Ga0495599_0133992 Ga0495599_0133992_939_1499 186
1190 3300046679 Ga0495623_0137406 Ga0495623_0137406_313_873 186
1191 3300046679 Ga0495623_0156499 Ga0495623_0156499_759_1319 186
1192 3300046680 Ga0495646_0000131 Ga0495646_0000131_12459_13019 186
1193 3300046689 Ga0495613_0229356 Ga0495613_0229356_312_878 186
1194 3300046691 Ga0495670_0222664 Ga0495670_0222664_194_754 186
1195 3300046692 Ga0495671_0013623 Ga0495671_0013623_2420_2980 186
1196 3300046694 Ga0495649_0120395 Ga0495649_0120395_491_1051 186
1197 3300046694 Ga0495649_0302760 Ga0495649_0302760_29_589 186
1198 3300046794 Ga0495589_0013467 Ga0495589_0013467_2294_2854 186
1199 3300046809 Ga0495600_0009890 Ga0495600_0009890_19_579 186
1200 3300046809 Ga0495600_0122217 Ga0495600_0122217_1103_1663 186
1201 3300046810 Ga0495660_0012927 Ga0495660_0012927_3089_3649 186
1202 3300047315 Ga0495581_0015726 Ga0495581_0015726_1156_1716 186
1203 3300047315 Ga0495581_0032518 Ga0495581_0032518_82_642 186
1204 3300047315 Ga0495581_0156169 Ga0495581_0156169_39_599 186
1205 3300047315 Ga0495581_0247640 Ga0495581_0247640_192_752 186
1206 3300047317 Ga0495604_0000385 Ga0495604_0000385_29867_30427 186
1207 3300047317 Ga0495604_0073929 Ga0495604_0073929_1660_2226 186
1208 3300047317 Ga0495604_0141052 Ga0495604_0141052_1014_1574 186
1209 3300047318 Ga0495636_0004226 Ga0495636_0004226_4863_5423 186
1210 3300047318 Ga0495636_0036138 Ga0495636_0036138_933_1493 186
1211 3300047318 Ga0495636_0088713 Ga0495636_0088713_38_598 186
1212 3300047319 Ga0495674_0053562 Ga0495674_0053562_1360_1920 186
1213 3300047319 Ga0495674_0282899 Ga0495674_0282899_351_911 186
1214 3300047321 Ga0495676_0004682 Ga0495676_0004682_1901_2461 186
1215 3300047321 Ga0495676_0076992 Ga0495676_0076992_473_1033 186
1216 3300047322 Ga0495680_0021436 Ga0495680_0021436_3199_3759 186
1217 3300047323 Ga0495683_0171299 Ga0495683_0171299_96_656 186
1218 3300047443 Ga0495687_009716 Ga0495687_009716_4487_5047 186
1219 3300047443 Ga0495687_067544 Ga0495687_067544_864_1424 186
1220 3300047443 Ga0495687_077248 Ga0495687_077248_610_1170 186
1221 3300047444 Ga0495675_0011010 Ga0495675_0011010_4920_5480 186
1222 3300047446 Ga0495679_044078 Ga0495679_044078_71_631 186
1223 3300047447 Ga0495685_009339 Ga0495685_009339_1650_2210 186
1224 3300047447 Ga0495685_011010 Ga0495685_011010_280_840 186
1225 3300047470 Ga0495681_0017515 Ga0495681_0017515_3113_3673 186
1226 3300047470 Ga0495681_0157153 Ga0495681_0157153_341_901 186
1227 3300047471 Ga0495684_0157045 Ga0495684_0157045_49_609 186
1228 3300047472 Ga0495686_0029178 Ga0495686_0029178_1050_1610 186
1229 3300047472 Ga0495686_0243020 Ga0495686_0243020_199_759 186
1230 3300047673 Ga0495593_0001454 Ga0495593_0001454_3860_4420 186
1231 3300047673 Ga0495593_0083795 Ga0495593_0083795_313_873 186
1232 3300048088 Ga0495602_0017568 Ga0495602_0017568_4798_5358 186
1233 3300048088 Ga0495602_0053483 Ga0495602_0053483_2941_3501 186
1234 3300048089 Ga0495614_0016264 Ga0495614_0016264_789_1349 186
1235 3300048089 Ga0495614_0127501 Ga0495614_0127501_271_831 186
1236 3300048091 Ga0495626_0006119 Ga0495626_0006119_4137_4697 186
1237 3300048910 Ga0496107_0113543 Ga0496107_0113543_13_573 186
1238 3300048916 Ga0496113_0570344 Ga0496113_0570344_329_892 186
1239 3300048924 Ga0496121_0254923 Ga0496121_0254923_583_1143 186
1240 3300049128 Ga0501308_040256 Ga0501308_040256_73_633 186
1241 3300049130 Ga0501310_020266 Ga0501310_020266_51_611 186
1242 3300049460 Ga0495682_0022616 Ga0495682_0022616_94_654 186
1243 3300049531 Ga0501315_000989 Ga0501315_000989_49_609 186
1244 3300049532 Ga0501316_011534 Ga0501316_011534_161_721 186
1245 3300049533 Ga0501317_001679 Ga0501317_001679_11_571 186
1246 3300049539 Ga0501323_001534 Ga0501323_001534_108_668 186
1247 3300049540 Ga0501324_006757 Ga0501324_006757_292_852 186
1248 3300049569 Ga0501032_0013368 Ga0501032_0013368_5230_5790 186
1249 3300049570 Ga0501033_0020260 Ga0501033_0020260_3918_4478 186
1250 3300049570 Ga0501033_0110208 Ga0501033_0110208_651_1232 186
1251 3300049570 Ga0501033_0179412 Ga0501033_0179412_675_1235 186
1252 3300049570 Ga0501033_0322770 Ga0501033_0322770_64_624 186
1253 3300049571 Ga0501034_0054193 Ga0501034_0054193_248_808 186
1254 3300049571 Ga0501034_0067569 Ga0501034_0067569_2585_3145 186
1255 3300049572 Ga0501036_0116899 Ga0501036_0116899_970_1530 186
1256 3300049572 Ga0501036_0121639 Ga0501036_0121639_579_1160 186
1257 3300049573 Ga0501037_0029527 Ga0501037_0029527_2336_2896 186
1258 3300049574 Ga0501038_0048790 Ga0501038_0048790_1762_2322 186
1259 3300049574 Ga0501038_0159952 Ga0501038_0159952_1048_1629 186
1260 3300049575 Ga0501039_0179252 Ga0501039_0179252_545_1126 186
1261 3300049575 Ga0501039_0495527 Ga0501039_0495527_166_726 186
1262 3300049576 Ga0501040_0015630 Ga0501040_0015630_844_1425 186
1263 3300049577 Ga0501041_0099014 Ga0501041_0099014_1010_1591 186
1264 3300049578 Ga0501042_0009583 Ga0501042_0009583_1152_1712 186
1265 3300049578 Ga0501042_0426463 Ga0501042_0426463_247_828 186
1266 3300049579 Ga0501043_0002529 Ga0501043_0002529_13949_14509 186
1267 3300049579 Ga0501043_0078531 Ga0501043_0078531_730_1290 186
1268 3300049581 Ga0501047_0052175 Ga0501047_0052175_1863_2423 186
1269 3300049581 Ga0501047_0249736 Ga0501047_0249736_1027_1587 186
1270 3300049582 Ga0501048_0024072 Ga0501048_0024072_899_1459 186
1271 3300049582 Ga0501048_0096263 Ga0501048_0096263_1097_1678 186
1272 3300049584 Ga0501068_0119074 Ga0501068_0119074_297_857 186
1273 3300049586 Ga0501070_0160054 Ga0501070_0160054_1004_1564 186
1274 3300049586 Ga0501070_0537854 Ga0501070_0537854_353_913 186
1275 3300049587 Ga0501071_0045006 Ga0501071_0045006_2170_2751 186
1276 3300049588 Ga0501072_0076238 Ga0501072_0076238_1434_2015 186
1277 3300049589 Ga0501073_0499502 Ga0501073_0499502_31_591 186
1278 3300049590 Ga0501074_0057023 Ga0501074_0057023_2060_2620 186
1279 3300049592 Ga0501076_0049046 Ga0501076_0049046_2230_2811 186
1280 3300049669 Ga0501235_037277 Ga0501235_037277_197_757 186
1281 3300049686 Ga0501257_019938 Ga0501257_019938_22_582 186
1282 3300049741 Ga0501079_0170812 Ga0501079_0170812_334_915 186
1283 3300049743 Ga0501081_0112361 Ga0501081_0112361_1181_1762 186
1284 3300049822 Ga0501035_0013355 Ga0501035_0013355_5820_6380 186
1285 3300049822 Ga0501035_0045118 Ga0501035_0045118_2437_2997 186
1286 3300049822 Ga0501035_0105874 Ga0501035_0105874_792_1373 186
1287 3300049823 Ga0501044_0002742 Ga0501044_0002742_1518_2078 186
1288 3300049823 Ga0501044_0213395 Ga0501044_0213395_1076_1636 186
1289 3300049823 Ga0501044_0412336 Ga0501044_0412336_367_948 186
1290 3300049823 Ga0501044_0601664 Ga0501044_0601664_207_767 186
1291 3300049824 Ga0501045_0068330 Ga0501045_0068330_1261_1842 186
1292 3300050494 nmdc:mga06z11_7684_c1 nmdc:mga06z11_7684_c1_3417_3977 186
1293 3300053085 Ga0495619_0271904 Ga0495619_0271904_302_862 186
1294 3300053088 Ga0500644_0038061 Ga0500644_0038061_816_1376 186
1295 3300053095 Ga0500640_005745 Ga0500640_005745_2058_2618 186
1296 3300053111 Ga0500572_021039 Ga0500572_021039_825_1385 186
1297 3300053131 Ga0500652_105384 Ga0500652_105384_160_720 186
1298 3300053140 Ga0500573_0020678 Ga0500573_0020678_698_1258 186
1299 3300053157 Ga0500624_001358 Ga0500624_001358_886_1446 186
1300 3300054114 Ga0501084_0078228 Ga0501084_0078228_1069_1650 186
1301 3300060353 Ga0501082_0051409 Ga0501082_0051409_1709_2290 186
1302 3300061719 Ga0466962_0000156 Ga0466962_0000156_5766_6326 186
1303 3300061734 Ga0530510_0479338 Ga0530510_0479338_106_687 186
1304 iso_pu_bacteria 2997451912 2997454284 186
1305 iso_pu_bacteria 8056447290 8056454018 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

16

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ohp-assembly1.cif.gz_D crystal structure of hgprt from vibrio cholerae 0.9466 14 177
2geb-assembly1.cif.gz_A crystal structure of the thermoanaerobacter tengcongensis hypoxanthine-guanine phosphoribosyltransferase l160i mutant: insights into the inhibitor design 0.9433 11 180
4rqb-assembly1.cif.gz_A crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (tetragonal space group) 0.9431 8 182
4rhu-assembly2.cif.gz_F crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease 0.9406 9 180
1r3u-assembly1.cif.gz_A crystal structure of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis 0.9392 11 180
ID Description Score Start End Superfamily
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9368 17 177 3.40.50.2020
af_I1LDB6_1_185_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9294 8 180 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9149 11 177 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9095 11 177 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9028 11 180 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A499V2Y7-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9758 3 181 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-N0E1Y8-F1-model_v4 tRNA(Ile)-lysidine synthase (EC 6.3.4.19) (tRNA(Ile)-2-lysyl-cytidine synthase) (tRNA(Ile)-lysidine synthetase) 0.9718 1 180 GO:0000287
GO:0004422
GO:0005524
GO:0005829
GO:0006166
GO:0006178
GO:0006400
GO:0032263
GO:0032264
GO:0032267
GO:0046100
AF-A0A7X7G7K8-F1-model_v4 tRNA(Ile)-lysidine synthase (EC 6.3.4.19) (tRNA(Ile)-2-lysyl-cytidine synthase) (tRNA(Ile)-lysidine synthetase) 0.9709 1 182 GO:0000287
GO:0004422
GO:0005524
GO:0005829
GO:0006166
GO:0006178
GO:0006400
GO:0016879
GO:0032263
GO:0032264
GO:0046100
GO:0052657
AF-A0A511YXU0-F1-model_v4 tRNA(Ile)-lysidine synthase (EC 6.3.4.19) (tRNA(Ile)-2-lysyl-cytidine synthase) (tRNA(Ile)-lysidine synthetase) 0.9702 2 182 GO:0000287
GO:0004422
GO:0005524
GO:0005829
GO:0006166
GO:0006178
GO:0006400
GO:0032263
GO:0032264
GO:0032267
GO:0046100
GO:0052657
AF-A0A497W816-F1-model_v4 deleted 0.9701 1 182

Feature Viewer

pLDDT pTM Quality
90.68 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map