F492705

General Info

Members Datasets Scaffolds Average Seq Length
1297 407 2594 309

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0214254|Ga0373931_0214254_41_1006
Length 321
Sequence MAAPLTDPEGDPMQATSKIWMNGELVDWADATVHVGAHGLHYGTGVFEGVRAYETPRGTAIFRLTEHFERLHASAKLLYMDLPYSVEQLKAATWDLLGANAIPECYIRPIAFFGYGQLGVATRSNPVEVAIMCWPWGTYLGEEALANGIRAKISSWRRIGSNTIPHAAKATGVYLNSMLAVSEANRAGYEEAILLSEDGGYVADGSGENIFIVRDGIIYTPDLSVSILSGITRDAVIQIAQDLGHRVVEKPIIRTDLYLADEIFMCGTAAEVTPIREIDDHVIGPPGPVTREIQQAYLDTVHGRSERWAQWLEYAPSRTGA

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
188 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
191 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
250 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
253 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
256 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
257 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
258 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
259 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
260 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
403 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
404 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 11.49
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0214254 3300035691 Bacteria 1157
2 JGI24751J29686_10035121 3300002459 Unclassified 1039
3 Ga0070658_10003658 3300005327 Bacteria 12592
4 Ga0070658_10030476 3300005327 Bacteria 4333
5 Ga0070683_100000774 3300005329 Bacteria 23517
6 Ga0070683_100045882 3300005329 Bacteria 4034
7 Ga0070683_100051507 3300005329 Bacteria 3812
8 Ga0070683_100112904 3300005329 Bacteria 2564
9 Ga0070683_100126187 3300005329 Bacteria 2419
10 Ga0070690_100045434 3300005330 Bacteria 2790
11 Ga0070690_100121173 3300005330 Bacteria 1756
12 Ga0070677_10066824 3300005333 Bacteria 1500
13 Ga0068869_100026863 3300005334 Bacteria 4009
14 Ga0068869_100162571 3300005334 Bacteria 1739
15 Ga0070666_10047569 3300005335 Bacteria 2880
16 Ga0070680_100102156 3300005336 Bacteria 2381
17 Ga0070680_100153889 3300005336 Bacteria 1931
18 Ga0070680_100241485 3300005336 Bacteria 1527
19 Ga0070682_100008755 3300005337 Bacteria 5711
20 Ga0070682_100019169 3300005337 Bacteria 4009
21 Ga0070682_100135795 3300005337 Bacteria 1670
22 Ga0070682_100175446 3300005337 Bacteria 1493
23 Ga0070682_100332828 3300005337 Bacteria 1126
24 Ga0068868_100010563 3300005338 Bacteria 6692
25 Ga0068868_100025923 3300005338 Bacteria 4463
26 Ga0068868_100054127 3300005338 Bacteria 3162
27 Ga0070660_100004783 3300005339 Bacteria 9363
28 Ga0070660_100049490 3300005339 Bacteria 3231
29 Ga0070691_10019049 3300005341 Bacteria 3164
30 Ga0070661_100009372 3300005344 Bacteria 6774
31 Ga0070661_100015472 3300005344 Bacteria 5383
32 Ga0070661_100058564 3300005344 Bacteria 2823
33 Ga0070692_10042048 3300005345 Bacteria 2344
34 Ga0070692_10088641 3300005345 Bacteria 1678
35 Ga0070668_100002933 3300005347 Bacteria 12606
36 Ga0070668_100226679 3300005347 Bacteria 1543
37 Ga0070675_100141251 3300005354 Bacteria 2058
38 Ga0070675_100244732 3300005354 Bacteria 1568
39 Ga0070675_100255883 3300005354 Bacteria 1533
40 Ga0070674_100014394 3300005356 Bacteria 4920
41 Ga0070674_100021548 3300005356 Bacteria 4140
42 Ga0070673_100072358 3300005364 Bacteria 2772
43 Ga0070673_100256895 3300005364 Bacteria 1525
44 Ga0070688_100010726 3300005365 Bacteria 5063
45 Ga0070659_100005871 3300005366 Bacteria 8844
46 Ga0070659_100185823 3300005366 Bacteria 1707
47 Ga0070703_10032272 3300005406 Bacteria 1590
48 Ga0070709_10001860 3300005434 Bacteria 11446
49 Ga0070709_10010484 3300005434 Bacteria 5135
50 Ga0070709_10044279 3300005434 Bacteria 2755
51 Ga0070709_10059086 3300005434 Bacteria 2434
52 Ga0070709_10223523 3300005434 Bacteria 1344
53 Ga0070714_100008596 3300005435 Bacteria 7988
54 Ga0070714_100018091 3300005435 Bacteria 5717
55 Ga0070714_100023043 3300005435 Bacteria 5111
56 Ga0070714_100028847 3300005435 Bacteria 4608
57 Ga0070714_100033662 3300005435 Bacteria 4286
58 Ga0070714_100046710 3300005435 Bacteria 3674
59 Ga0070714_100064985 3300005435 Bacteria 3142
60 Ga0070714_100068477 3300005435 Bacteria 3062
61 Ga0070714_100124692 3300005435 Bacteria 2295
62 Ga0070714_100194509 3300005435 Bacteria 1853
63 Ga0070714_100279483 3300005435 Bacteria 1551
64 Ga0070713_100004782 3300005436 Bacteria 9167
65 Ga0070713_100007132 3300005436 Bacteria 7816
66 Ga0070713_100054334 3300005436 Bacteria 3322
67 Ga0070713_100090572 3300005436 Bacteria 2629
68 Ga0070713_100154553 3300005436 Bacteria 2044
69 Ga0070710_10002718 3300005437 Bacteria 8412
70 Ga0070710_10011425 3300005437 Bacteria 4385
71 Ga0070710_10036848 3300005437 Bacteria 2676
72 Ga0070710_10084958 3300005437 Bacteria 1855
73 Ga0070711_100001918 3300005439 Bacteria 11634
74 Ga0070711_100034422 3300005439 Bacteria 3378
75 Ga0070705_100017395 3300005440 Bacteria 3753
76 Ga0070705_100023631 3300005440 Bacteria 3305
77 Ga0070705_100037299 3300005440 Bacteria 2740
78 Ga0070700_100000585 3300005441 Bacteria 18286
79 Ga0070700_100030419 3300005441 Bacteria 3227
80 Ga0070700_100041433 3300005441 Bacteria 2823
81 Ga0070694_100019437 3300005444 Bacteria 4319
82 Ga0070694_100045131 3300005444 Bacteria 2953
83 Ga0070708_100146638 3300005445 Bacteria 2192
84 Ga0070708_100224680 3300005445 Bacteria 1761
85 Ga0070663_100014577 3300005455 Bacteria 5049
86 Ga0070663_100035554 3300005455 Bacteria 3457
87 Ga0070663_100099735 3300005455 Bacteria 2165
88 Ga0070678_100006277 3300005456 Bacteria 6960
89 Ga0070678_100009462 3300005456 Bacteria 5907
90 Ga0070678_100115188 3300005456 Bacteria 2110
91 Ga0070678_100177474 3300005456 Bacteria 1741
92 Ga0070678_100187778 3300005456 Bacteria 1697
93 Ga0070662_100070449 3300005457 Bacteria 2576
94 Ga0070681_10017483 3300005458 Bacteria 7168
95 Ga0070681_10032807 3300005458 Bacteria 5213
96 Ga0070681_10073519 3300005458 Bacteria 3380
97 Ga0070681_10160560 3300005458 Bacteria 2171
98 Ga0068867_100021336 3300005459 Bacteria 4621
99 Ga0068867_100115739 3300005459 Bacteria 2065
100 Ga0068867_100140735 3300005459 Bacteria 1885
101 Ga0070685_10018054 3300005466 Bacteria 3789
102 Ga0070685_10033577 3300005466 Bacteria 2884
103 Ga0070706_100275908 3300005467 Unclassified 1569
104 Ga0070706_100336031 3300005467 Bacteria 1408
105 Ga0070707_100006447 3300005468 Bacteria 10907
106 Ga0070707_100009913 3300005468 Bacteria 8869
107 Ga0070707_100022080 3300005468 Bacteria 6016
108 Ga0070707_100098392 3300005468 Bacteria 2833
109 Ga0070698_100004278 3300005471 Bacteria 15700
110 Ga0070698_100006489 3300005471 Bacteria 12691
111 Ga0070698_100031951 3300005471 Bacteria 5455
112 Ga0070698_100058619 3300005471 Bacteria 3892
113 Ga0070698_100113070 3300005471 Bacteria 2680
114 Ga0070699_100016876 3300005518 Bacteria 6268
115 Ga0070699_100044132 3300005518 Bacteria 3860
116 Ga0070699_100139117 3300005518 Unclassified 2143
117 Ga0070699_100193972 3300005518 Bacteria 1805
118 Ga0070679_100047267 3300005530 Bacteria 4290
119 Ga0070679_100059248 3300005530 Bacteria 3816
120 Ga0070679_100096138 3300005530 Bacteria 2950
121 Ga0070679_100164891 3300005530 Bacteria 2190
122 Ga0070684_100040661 3300005535 Bacteria 4005
123 Ga0070684_100069183 3300005535 Bacteria 3104
124 Ga0070684_100185972 3300005535 Bacteria 1889
125 Ga0070684_100274627 3300005535 Archaea 1543
126 Ga0070684_100294484 3300005535 Bacteria 1488
127 Ga0070684_100306604 3300005535 Bacteria 1458
128 Ga0070684_100436309 3300005535 Bacteria 1210
129 Ga0070697_100080435 3300005536 Bacteria 2685
130 Ga0068853_100040446 3300005539 Bacteria 3978
131 Ga0070672_100009205 3300005543 Bacteria 6799
132 Ga0070686_100171003 3300005544 Bacteria 1537
133 Ga0070695_100038311 3300005545 Bacteria 3024
134 Ga0070695_100226097 3300005545 Bacteria 1350
135 Ga0070696_100008104 3300005546 Bacteria 7023
136 Ga0070696_100025255 3300005546 Bacteria 4038
137 Ga0070696_100031997 3300005546 Bacteria 3607
138 Ga0070693_100025169 3300005547 Bacteria 3200
139 Ga0070693_100104452 3300005547 Bacteria 1732
140 Ga0070665_100107934 3300005548 Bacteria 2786
141 Ga0070704_100028416 3300005549 Bacteria 3721
142 Ga0070704_100028899 3300005549 Bacteria 3695
143 Ga0070704_100127172 3300005549 Bacteria 1968
144 Ga0068855_100034573 3300005563 Bacteria 6026
145 Ga0068855_100043411 3300005563 Bacteria 5326
146 Ga0068855_100095791 3300005563 Bacteria 3420
147 Ga0068855_100110135 3300005563 Bacteria 3161
148 Ga0068855_100220385 3300005563 Bacteria 2128
149 Ga0068855_100384975 3300005563 Bacteria 1539
150 Ga0070664_100018643 3300005564 Bacteria 5706
151 Ga0070664_100078034 3300005564 Bacteria 2848
152 Ga0068857_100153604 3300005577 Bacteria 2086
153 Ga0068854_100009762 3300005578 Bacteria 6206
154 Ga0068854_100093205 3300005578 Bacteria 2244
155 Ga0068854_100111336 3300005578 Bacteria 2065
156 Ga0068856_100013458 3300005614 Bacteria 7918
157 Ga0068856_100083049 3300005614 Bacteria 3180
158 Ga0070702_100033046 3300005615 Bacteria 2842
159 Ga0070702_100066532 3300005615 Bacteria 2114
160 Ga0068852_100024571 3300005616 Bacteria 4871
161 Ga0068852_100070996 3300005616 Bacteria 3057
162 Ga0068852_100135678 3300005616 Bacteria 2272
163 Ga0068852_100148015 3300005616 Bacteria 2180
164 Ga0068859_100319165 3300005617 Bacteria 1647
165 Ga0068864_100028758 3300005618 Bacteria 4702
166 Ga0068866_10002892 3300005718 Bacteria 7071
167 Ga0068866_10053305 3300005718 Bacteria 2068
168 Ga0068861_100007204 3300005719 Bacteria 7621
169 Ga0068861_100231391 3300005719 Bacteria 1568
170 Ga0068851_10114441 3300005834 Bacteria 1443
171 Ga0068870_10049929 3300005840 Bacteria 2209
172 Ga0068870_10181578 3300005840 Bacteria 1263
173 Ga0068863_100094656 3300005841 Bacteria 2835
174 Ga0068860_100430797 3300005843 Bacteria 1309
175 Ga0068862_100070729 3300005844 Bacteria 3012
176 Ga0081455_10013758 3300005937 Bacteria 7965
177 Ga0081455_10019652 3300005937 Bacteria 6380
178 Ga0081455_10059022 3300005937 Bacteria 3242
179 Ga0081538_10031057 3300005981 Bacteria 3612
180 Ga0081540_1000597 3300005983 Bacteria 34582
181 Ga0081540_1005959 3300005983 Bacteria 8987
182 Ga0081539_10003619 3300005985 Bacteria 18654
183 Ga0081539_10005000 3300005985 Bacteria 14006
184 Ga0070717_10011631 3300006028 Bacteria 6693
185 Ga0070717_10033584 3300006028 Bacteria 4139
186 Ga0070717_10054551 3300006028 Bacteria 3296
187 Ga0070717_10070574 3300006028 Bacteria 2912
188 Ga0075365_10006259 3300006038 Bacteria 6528
189 Ga0075365_10035777 3300006038 Bacteria 3214
190 Ga0075365_10137153 3300006038 Bacteria 1696
191 Ga0075364_10109831 3300006051 Bacteria 1839
192 Ga0075432_10000332 3300006058 Bacteria 13442
193 Ga0075432_10001329 3300006058 Bacteria 7995
194 Ga0075432_10024473 3300006058 Bacteria 2069
195 Ga0070715_10001470 3300006163 Bacteria 6850
196 Ga0070715_10003672 3300006163 Bacteria 4932
197 Ga0070715_10059989 3300006163 Bacteria 1666
198 Ga0070716_100001368 3300006173 Bacteria 10821
199 Ga0070716_100079406 3300006173 Unclassified 1954
200 Ga0070716_100147844 3300006173 Bacteria 1507
201 Ga0070716_100344156 3300006173 Bacteria 1053
202 Ga0070712_100001138 3300006175 Bacteria 16036
203 Ga0070712_100029238 3300006175 Bacteria 3693
204 Ga0070712_100229158 3300006175 Bacteria 1474
205 Ga0075367_10085053 3300006178 Bacteria 1919
206 Ga0075367_10141973 3300006178 Bacteria 1488
207 Ga0097621_100010388 3300006237 Bacteria 6810
208 Ga0097621_100170002 3300006237 Bacteria 1878
209 Ga0075370_10218896 3300006353 Bacteria 1125
210 Ga0068871_100030111 3300006358 Bacteria 4271
211 Ga0068871_100068935 3300006358 Bacteria 2904
212 Ga0075428_100009696 3300006844 Bacteria 10693
213 Ga0075428_100036032 3300006844 Bacteria 5452
214 Ga0075428_100044438 3300006844 Bacteria 4882
215 Ga0075428_100142312 3300006844 Bacteria 2607
216 Ga0075430_100008351 3300006846 Bacteria 8745
217 Ga0075431_100027269 3300006847 Bacteria 5860
218 Ga0075431_100386162 3300006847 Bacteria 1403
219 Ga0075433_10013900 3300006852 Bacteria 6565
220 Ga0075433_10089730 3300006852 Bacteria 2717
221 Ga0075433_10092652 3300006852 Bacteria 2673
222 Ga0075433_10227718 3300006852 Bacteria 1655
223 Ga0075433_10287798 3300006852 Bacteria 1455
224 Ga0075434_100036513 3300006871 Bacteria 4861
225 Ga0075434_100106446 3300006871 Bacteria 2814
226 Ga0068865_100001835 3300006881 Bacteria 12477
227 Ga0068865_100018132 3300006881 Bacteria 4538
228 Ga0068865_100046319 3300006881 Bacteria 2983
229 Ga0075436_100011959 3300006914 Bacteria 5952
230 Ga0075436_100057244 3300006914 Bacteria 2692
231 Ga0075436_100188110 3300006914 Bacteria 1460
232 Ga0075436_100254221 3300006914 Bacteria 1252
233 Ga0097620_100319174 3300006931 Bacteria 1647
234 Ga0075435_100002282 3300007076 Bacteria 12660
235 Ga0075435_100025481 3300007076 Bacteria 4605
236 Ga0075435_100087062 3300007076 Bacteria 2573
237 Ga0075435_100480217 3300007076 Bacteria 1073
238 Ga0105240_10011692 3300009093 Bacteria 12197
239 Ga0111539_10005072 3300009094 Bacteria 17105
240 Ga0111539_10036613 3300009094 Bacteria 5931
241 Ga0111539_10045392 3300009094 Bacteria 5260
242 Ga0111539_10117251 3300009094 Bacteria 3121
243 Ga0111539_10143875 3300009094 Bacteria 2791
244 Ga0111539_10213295 3300009094 Bacteria 2249
245 Ga0111539_10214954 3300009094 Bacteria 2240
246 Ga0111539_10670610 3300009094 Bacteria 1207
247 Ga0105245_10007371 3300009098 Bacteria 9631
248 Ga0105245_10041637 3300009098 Bacteria 4094
249 Ga0105245_10047068 3300009098 Bacteria 3855
250 Ga0105245_10047207 3300009098 Bacteria 3849
251 Ga0105245_10068259 3300009098 Bacteria 3221
252 Ga0105245_10350710 3300009098 Bacteria 1462
253 Ga0105245_10485917 3300009098 Bacteria 1249
254 Ga0105247_10011467 3300009101 Bacteria 5344
255 Ga0114129_10004388 3300009147 Bacteria 19896
256 Ga0114129_10009732 3300009147 Bacteria 13710
257 Ga0114129_10036404 3300009147 Bacteria 6950
258 Ga0114129_10072326 3300009147 Bacteria 4807
259 Ga0114129_10184776 3300009147 Bacteria 2834
260 Ga0114129_10198243 3300009147 Bacteria 2721
261 Ga0114129_10270128 3300009147 Bacteria 2275
262 Ga0114129_10453998 3300009147 Bacteria 1681
263 Ga0114129_10945521 3300009147 Bacteria 1089
264 Ga0105243_10001405 3300009148 Bacteria 21294
265 Ga0105243_10556611 3300009148 Bacteria 1097
266 Ga0105241_10019866 3300009174 Bacteria 4958
267 Ga0105241_10179491 3300009174 Bacteria 1755
268 Ga0105241_10216866 3300009174 Bacteria 1606
269 Ga0105242_10019300 3300009176 Bacteria 5340
270 Ga0105242_10125923 3300009176 Bacteria 2205
271 Ga0105242_10133654 3300009176 Bacteria 2145
272 Ga0105242_10153941 3300009176 Bacteria 2007
273 Ga0105242_10294888 3300009176 Bacteria 1478
274 Ga0105248_10032129 3300009177 Bacteria 5866
275 Ga0105248_10063386 3300009177 Bacteria 4149
276 Ga0105248_10155316 3300009177 Bacteria 2582
277 Ga0105237_10150826 3300009545 Bacteria 2321
278 Ga0105237_10250661 3300009545 Bacteria 1772
279 Ga0105237_10376803 3300009545 Bacteria 1424
280 Ga0105238_10397857 3300009551 Bacteria 1370
281 Ga0105238_10404397 3300009551 Bacteria 1359
282 Ga0105249_10009749 3300009553 Bacteria 8414
283 Ga0105249_10034744 3300009553 Bacteria 4568
284 Ga0105030_102136 3300009987 Bacteria 1731
285 Ga0105239_10017991 3300010375 Bacteria 7815
286 Ga0105239_10036876 3300010375 Bacteria 5364
287 Ga0105239_10040810 3300010375 Bacteria 5085
288 Ga0105239_10078412 3300010375 Bacteria 3635
289 Ga0105239_10091857 3300010375 Bacteria 3350
290 Ga0105239_10095193 3300010375 Bacteria 3290
291 Ga0105239_10448283 3300010375 Bacteria 1464
292 Ga0105239_10694412 3300010375 Bacteria 1163
293 Ga0105246_10024965 3300011119 Bacteria 3891
294 Ga0105246_10056219 3300011119 Bacteria 2719
295 Ga0105246_10186376 3300011119 Bacteria 1602
296 Ga0157369_10029546 3300013105 Bacteria 6056
297 Ga0157369_10035437 3300013105 Bacteria 5472
298 Ga0157369_10299042 3300013105 Bacteria 1674
299 Ga0157369_10313032 3300013105 Bacteria 1632
300 Ga0157369_10461092 3300013105 Bacteria 1316
301 Ga0157374_10031172 3300013296 Bacteria 4844
302 Ga0157374_10032676 3300013296 Bacteria 4740
303 Ga0157374_10236113 3300013296 Bacteria 1797
304 Ga0157378_10075074 3300013297 Bacteria 3043
305 Ga0163162_10019622 3300013306 Bacteria 6636
306 Ga0163162_10043152 3300013306 Bacteria 4515
307 Ga0163162_10069849 3300013306 Bacteria 3564
308 Ga0163162_10119942 3300013306 Bacteria 2733
309 Ga0163162_10281497 3300013306 Bacteria 1795
310 Ga0163162_10688202 3300013306 Bacteria 1145
311 Ga0157372_10005060 3300013307 Bacteria 14010
312 Ga0157372_10018759 3300013307 Bacteria 7443
313 Ga0157372_10033981 3300013307 Bacteria 5603
314 Ga0157372_10064830 3300013307 Bacteria 4100
315 Ga0157372_10115046 3300013307 Bacteria 3084
316 Ga0157375_10012100 3300013308 Bacteria 7645
317 Ga0157375_10093279 3300013308 Bacteria 3076
318 Ga0157375_10143337 3300013308 Bacteria 2518
319 Ga0157375_10161973 3300013308 Bacteria 2379
320 Ga0157375_10180123 3300013308 Bacteria 2264
321 Ga0157375_10208908 3300013308 Bacteria 2109
322 Ga0163163_10041705 3300014325 Bacteria 4490
323 Ga0163163_10043180 3300014325 Bacteria 4419
324 Ga0163163_10059442 3300014325 Bacteria 3781
325 Ga0163163_10532305 3300014325 Bacteria 1237
326 Ga0157380_10008637 3300014326 Bacteria 7282
327 Ga0157380_10017556 3300014326 Bacteria 5296
328 Ga0157380_10054326 3300014326 Bacteria 3178
329 Ga0157380_10085012 3300014326 Bacteria 2596
330 Ga0182008_10001859 3300014497 Bacteria 13731
331 Ga0157376_10011111 3300014969 Bacteria 6623
332 Ga0157376_10017188 3300014969 Bacteria 5511
333 Ga0157376_10058664 3300014969 Bacteria 3225
334 Ga0157376_10075977 3300014969 Bacteria 2869
335 Ga0157376_10174927 3300014969 Bacteria 1957
336 Ga0182006_1033054 3300015261 Bacteria 2075
337 Ga0182007_10034369 3300015262 Bacteria 1714
338 Ga0182005_1050966 3300015265 Bacteria 1126
339 Ga0163161_10040170 3300017792 Bacteria 3360
340 Ga0163161_10111624 3300017792 Bacteria 2044
341 Ga0163161_10140267 3300017792 Bacteria 1830
342 Ga0197907_10473388 3300020069 Bacteria 1260
343 Ga0197907_10923252 3300020069 Bacteria 1398
344 Ga0206356_11213931 3300020070 Bacteria 1100
345 Ga0206354_10223969 3300020081 Bacteria 2124
346 Ga0206353_12050450 3300020082 Bacteria 1238
347 Ga0213871_10004391 3300021441 Bacteria 2817
348 Ga0207653_10000706 3300025885 Bacteria 11458
349 Ga0207692_10127069 3300025898 Bacteria 1435
350 Ga0207642_10025781 3300025899 Bacteria 2384
351 Ga0207642_10026068 3300025899 Bacteria 2375
352 Ga0207710_10207182 3300025900 Bacteria 970
353 Ga0207688_10001506 3300025901 Bacteria 12234
354 Ga0207688_10026312 3300025901 Bacteria 3198
355 Ga0207688_10052556 3300025901 Bacteria 2283
356 Ga0207647_10045802 3300025904 Bacteria 2727
357 Ga0207647_10054407 3300025904 Bacteria 2462
358 Ga0207685_10002057 3300025905 Bacteria 4492
359 Ga0207699_10002792 3300025906 Bacteria 8248
360 Ga0207699_10023391 3300025906 Bacteria 3363
361 Ga0207699_10032535 3300025906 Bacteria 2939
362 Ga0207699_10064178 3300025906 Bacteria 2221
363 Ga0207645_10016793 3300025907 Bacteria 4840
364 Ga0207643_10069377 3300025908 Bacteria 2026
365 Ga0207705_10020114 3300025909 Bacteria 4775
366 Ga0207684_10033327 3300025910 Bacteria 4380
367 Ga0207684_10234760 3300025910 Bacteria 1582
368 Ga0207654_10024116 3300025911 Bacteria 3267
369 Ga0207654_10254875 3300025911 Bacteria 1178
370 Ga0207707_10085241 3300025912 Bacteria 2760
371 Ga0207707_10161486 3300025912 Bacteria 1959
372 Ga0207707_10316358 3300025912 Bacteria 1348
373 Ga0207695_10080080 3300025913 Bacteria 3309
374 Ga0207693_10003257 3300025915 Bacteria 13922
375 Ga0207693_10008247 3300025915 Bacteria 8529
376 Ga0207693_10010065 3300025915 Bacteria 7682
377 Ga0207693_10068551 3300025915 Bacteria 2776
378 Ga0207693_10091164 3300025915 Bacteria 2390
379 Ga0207693_10100409 3300025915 Bacteria 2269
380 Ga0207693_10169112 3300025915 Bacteria 1721
381 Ga0207693_10217090 3300025915 Bacteria 1503
382 Ga0207663_10003189 3300025916 Bacteria 7975
383 Ga0207663_10003420 3300025916 Bacteria 7765
384 Ga0207663_10087960 3300025916 Bacteria 2053
385 Ga0207663_10102018 3300025916 Bacteria 1929
386 Ga0207660_10115663 3300025917 Bacteria 2025
387 Ga0207660_10139842 3300025917 Bacteria 1850
388 Ga0207660_10210502 3300025917 Bacteria 1522
389 Ga0207657_10001257 3300025919 Bacteria 27123
390 Ga0207657_10024586 3300025919 Bacteria 5572
391 Ga0207657_10025289 3300025919 Bacteria 5478
392 Ga0207649_10009762 3300025920 Bacteria 5257
393 Ga0207649_10131834 3300025920 Bacteria 1699
394 Ga0207646_10002821 3300025922 Bacteria 20211
395 Ga0207646_10003492 3300025922 Bacteria 17724
396 Ga0207646_10021147 3300025922 Bacteria 6019
397 Ga0207646_10335145 3300025922 Bacteria 1367
398 Ga0207681_10011318 3300025923 Bacteria 5480
399 Ga0207694_10099520 3300025924 Bacteria 2303
400 Ga0207694_10150501 3300025924 Bacteria 1875
401 Ga0207694_10279167 3300025924 Bacteria 1372
402 Ga0207694_10323004 3300025924 Bacteria 1274
403 Ga0207650_10272570 3300025925 Bacteria 1376
404 Ga0207687_10036563 3300025927 Bacteria 3345
405 Ga0207687_10060860 3300025927 Bacteria 2665
406 Ga0207687_10236544 3300025927 Bacteria 1445
407 Ga0207687_10341845 3300025927 Bacteria 1217
408 Ga0207700_10000022 3300025928 Bacteria 166246
409 Ga0207700_10031795 3300025928 Bacteria 3754
410 Ga0207700_10044203 3300025928 Bacteria 3277
411 Ga0207700_10113520 3300025928 Bacteria 2184
412 Ga0207700_10122007 3300025928 Bacteria 2115
413 Ga0207664_10013893 3300025929 Bacteria 5800
414 Ga0207664_10030458 3300025929 Bacteria 4120
415 Ga0207664_10045034 3300025929 Bacteria 3458
416 Ga0207664_10067147 3300025929 Bacteria 2877
417 Ga0207664_10077608 3300025929 Bacteria 2692
418 Ga0207664_10090520 3300025929 Bacteria 2507
419 Ga0207664_10164354 3300025929 Bacteria 1895
420 Ga0207664_10199161 3300025929 Bacteria 1728
421 Ga0207664_10247947 3300025929 Bacteria 1553
422 Ga0207664_10255617 3300025929 Bacteria 1531
423 Ga0207644_10096116 3300025931 Bacteria 2217
424 Ga0207644_10170350 3300025931 Bacteria 1699
425 Ga0207644_10193021 3300025931 Bacteria 1602
426 Ga0207644_10287266 3300025931 Bacteria 1322
427 Ga0207690_10021692 3300025932 Bacteria 3986
428 Ga0207706_10110601 3300025933 Bacteria 2417
429 Ga0207686_10171676 3300025934 Bacteria 1530
430 Ga0207709_10074230 3300025935 Bacteria 2170
431 Ga0207670_10118608 3300025936 Bacteria 1919
432 Ga0207670_10132922 3300025936 Bacteria 1825
433 Ga0207669_10041985 3300025937 Bacteria 2666
434 Ga0207669_10349636 3300025937 Bacteria 1141
435 Ga0207704_10008355 3300025938 Bacteria 4945
436 Ga0207665_10001486 3300025939 Bacteria 15761
437 Ga0207665_10005029 3300025939 Bacteria 8826
438 Ga0207665_10006641 3300025939 Bacteria 7676
439 Ga0207665_10017861 3300025939 Bacteria 4663
440 Ga0207665_10017917 3300025939 Bacteria 4655
441 Ga0207665_10127788 3300025939 Unclassified 1801
442 Ga0207665_10174995 3300025939 Bacteria 1552
443 Ga0207691_10039931 3300025940 Bacteria 4340
444 Ga0207691_10267028 3300025940 Bacteria 1474
445 Ga0207689_10079904 3300025942 Bacteria 2688
446 Ga0207661_10000280 3300025944 Bacteria 32687
447 Ga0207661_10014641 3300025944 Bacteria 5753
448 Ga0207661_10025935 3300025944 Bacteria 4461
449 Ga0207661_10365157 3300025944 Bacteria 1304
450 Ga0207679_10006334 3300025945 Bacteria 7477
451 Ga0207667_10083314 3300025949 Bacteria 3311
452 Ga0207667_10114568 3300025949 Bacteria 2779
453 Ga0207651_10169266 3300025960 Bacteria 1721
454 Ga0207712_10003543 3300025961 Bacteria 9848
455 Ga0207712_10061376 3300025961 Bacteria 2668
456 Ga0207712_10124700 3300025961 Bacteria 1954
457 Ga0207668_10015573 3300025972 Bacteria 4726
458 Ga0207640_10100837 3300025981 Bacteria 2024
459 Ga0207640_10110630 3300025981 Bacteria 1946
460 Ga0207677_10271905 3300026023 Bacteria 1387
461 Ga0207639_10136895 3300026041 Bacteria 2035
462 Ga0207639_10385523 3300026041 Bacteria 1259
463 Ga0207678_10010336 3300026067 Bacteria 8192
464 Ga0207678_10013645 3300026067 Bacteria 7135
465 Ga0207678_10054124 3300026067 Bacteria 3456
466 Ga0207708_10001375 3300026075 Bacteria 18308
467 Ga0207708_10015219 3300026075 Bacteria 5767
468 Ga0207708_10027151 3300026075 Bacteria 4335
469 Ga0207708_10063147 3300026075 Bacteria 2830
470 Ga0207702_10011811 3300026078 Bacteria 7271
471 Ga0207702_10029366 3300026078 Bacteria 4575
472 Ga0207702_10060850 3300026078 Bacteria 3219
473 Ga0207702_10105371 3300026078 Bacteria 2497
474 Ga0207702_10263209 3300026078 Bacteria 1624
475 Ga0207648_10001234 3300026089 Bacteria 28707
476 Ga0207648_10003746 3300026089 Bacteria 15895
477 Ga0207648_10083381 3300026089 Bacteria 2788
478 Ga0207648_10137097 3300026089 Bacteria 2156
479 Ga0207648_10316633 3300026089 Bacteria 1401
480 Ga0207676_10023155 3300026095 Bacteria 4577
481 Ga0207674_10017679 3300026116 Bacteria 7772
482 Ga0207674_10286795 3300026116 Bacteria 1595
483 Ga0207675_100003926 3300026118 Bacteria 14437
484 Ga0207675_100059947 3300026118 Bacteria 3552
485 Ga0207675_100243088 3300026118 Bacteria 1740
486 Ga0207683_10000251 3300026121 Bacteria 47816
487 Ga0207683_10004522 3300026121 Bacteria 11992
488 Ga0207683_10059248 3300026121 Bacteria 3364
489 Ga0207683_10192608 3300026121 Bacteria 1851
490 Ga0207683_10388632 3300026121 Bacteria 1283
491 Ga0207683_10409490 3300026121 Bacteria 1248
492 Ga0207698_10010071 3300026142 Bacteria 6055
493 Ga0207698_10147529 3300026142 Bacteria 2037
494 Ga0207698_10265814 3300026142 Bacteria 1578
495 Ga0207428_10002020 3300027907 Bacteria 20504
496 Ga0207428_10002720 3300027907 Bacteria 17619
497 Ga0207428_10008046 3300027907 Bacteria 9568
498 Ga0207428_10046911 3300027907 Bacteria 3472
499 Ga0207428_10122285 3300027907 Bacteria 1996
500 Ga0268266_10022986 3300028379 Bacteria 5306
501 Ga0268265_10059734 3300028380 Bacteria 2919
502 Ga0268264_10266914 3300028381 Bacteria 1597
503 Ga0265326_10006881 3300028558 Bacteria 3505
504 Ga0265319_1002220 3300028563 Bacteria 10804
505 Ga0265319_1005651 3300028563 Bacteria 5946
506 Ga0265319_1064900 3300028563 Bacteria 1178
507 Ga0265334_10004270 3300028573 Bacteria 6377
508 Ga0265334_10011991 3300028573 Bacteria 3642
509 Ga0265318_10000734 3300028577 Bacteria 21933
510 Ga0265318_10002508 3300028577 Bacteria 9755
511 Ga0265318_10037984 3300028577 Bacteria 1843
512 Ga0265318_10110827 3300028577 Bacteria 1009
513 Ga0265322_10010859 3300028654 Bacteria 2644
514 Ga0265336_10001597 3300028666 Bacteria 10143
515 Ga0265338_10004917 3300028800 Bacteria 17768
516 Ga0265338_10005528 3300028800 Bacteria 16465
517 Ga0265338_10009821 3300028800 Bacteria 11344
518 Ga0265338_10021214 3300028800 Bacteria 6784
519 Ga0265338_10098710 3300028800 Bacteria 2388
520 Ga0265338_10107088 3300028800 Bacteria 2262
521 Ga0265324_10012360 3300029957 Bacteria 3220
522 Ga0265330_10000357 3300031235 Bacteria 32239
523 Ga0265332_10039483 3300031238 Bacteria 2045
524 Ga0265328_10000859 3300031239 Bacteria 14109
525 Ga0265320_10004932 3300031240 Bacteria 8659
526 Ga0265320_10048374 3300031240 Bacteria 2076
527 Ga0265325_10000216 3300031241 Bacteria 41023
528 Ga0265325_10118839 3300031241 Bacteria 1276
529 Ga0265329_10002217 3300031242 Bacteria 8969
530 Ga0265340_10000237 3300031247 Bacteria 28491
531 Ga0265340_10010730 3300031247 Bacteria 4894
532 Ga0265339_10002326 3300031249 Bacteria 13687
533 Ga0265339_10027575 3300031249 Bacteria 3239
534 Ga0265331_10005322 3300031250 Bacteria 7786
535 Ga0265327_10019761 3300031251 Bacteria 4128
536 Ga0265327_10032651 3300031251 Bacteria 2910
537 Ga0265316_10005904 3300031344 Bacteria 11799
538 Ga0265316_10011799 3300031344 Bacteria 7861
539 Ga0307408_100231576 3300031548 Bacteria 1513
540 Ga0307408_100357173 3300031548 Bacteria 1242
541 Ga0265313_10002904 3300031595 Bacteria 14329
542 Ga0265313_10007879 3300031595 Bacteria 7180
543 Ga0265314_10006843 3300031711 Bacteria 9990
544 Ga0265314_10017052 3300031711 Bacteria 5711
545 Ga0265342_10015601 3300031712 Bacteria 4993
546 Ga0307405_10038398 3300031731 Bacteria 2886
547 Ga0307413_10030326 3300031824 Bacteria 3037
548 Ga0307413_10060944 3300031824 Bacteria 2325
549 Ga0307410_10043797 3300031852 Bacteria 2968
550 Ga0307406_10002364 3300031901 Bacteria 10263
551 Ga0307407_10003046 3300031903 Bacteria 6750
552 Ga0307412_10038336 3300031911 Bacteria 3085
553 Ga0307409_100007208 3300031995 Bacteria 6629
554 Ga0307409_100166387 3300031995 Bacteria 1935
555 Ga0307416_100013284 3300032002 Bacteria 5591
556 Ga0307416_100058645 3300032002 Bacteria 3123
557 Ga0307416_100270197 3300032002 Bacteria 1669
558 Ga0307414_10155165 3300032004 Bacteria 1811
559 Ga0307411_10088562 3300032005 Bacteria 2153
560 Ga0307415_100336566 3300032126 Bacteria 1265
561 Ga0373948_0003010 3300034817 Bacteria 2550
562 Ga0373938_0006132 3300034957 Bacteria 2066
563 Ga0373938_0036267 3300034957 Bacteria 1078
564 Ga0373929_0002076 3300035085 Bacteria 3726
565 Ga0373934_0014655 3300035086 Bacteria 2971
566 Ga0373940_0000644 3300035088 Bacteria 5587
567 Ga0373949_0001669 3300035090 Bacteria 6193
568 Ga0373949_0007979 3300035090 Bacteria 2318
569 Ga0373949_0015264 3300035090 Bacteria 1714
570 Ga0373951_0018291 3300035091 Bacteria 1591
571 Ga0373932_0000955 3300035112 Bacteria 8467
572 Ga0373932_0045477 3300035112 Bacteria 1284
573 Ga0373939_0004436 3300035114 Bacteria 3318
574 Ga0373939_0014911 3300035114 Bacteria 2024
575 Ga0373941_0058134 3300035115 Bacteria 1250
576 Ga0373945_0118856 3300035116 Bacteria 1049
577 Ga0373960_0004625 3300035121 Bacteria 3159
578 Ga0373960_0058424 3300035121 Bacteria 1163
579 Ga0373943_0007478 3300035170 Bacteria 4908
580 Ga0373943_0140320 3300035170 Bacteria 1301
581 Ga0373946_0017487 3300035171 Bacteria 2744
582 Ga0373942_0007780 3300035207 Bacteria 2491
583 Ga0373962_0004080 3300035242 Bacteria 3521
584 Ga0373924_0051072 3300035410 Bacteria 1714
585 Ga0373931_0056119 3300035691 Bacteria 2109
586 Ga0373931_0063264 3300035691 Bacteria 1999
587 Ga0373931_0083920 3300035691 Bacteria 1763
588 Ga0373935_0052177 3300035692 Bacteria 2599
589 Ga0373947_0003496 3300035725 Bacteria 9281
590 Ga0373947_0005768 3300035725 Bacteria 7223
591 Ga0373937_0001174 3300036401 Bacteria 22003
592 Ga0373937_0086770 3300036401 Bacteria 2896
593 Ga0373925_0007274 3300037068 Bacteria 8091
594 Ga0373925_0054682 3300037068 Bacteria 2986
595 Ga0373925_0154791 3300037068 Bacteria 1802
596 Ga0395899_0004656 3300037312 Bacteria 10700
597 Ga0395899_0009584 3300037312 Bacteria 7434
598 Ga0395899_0039313 3300037312 Bacteria 3541
599 Ga0395899_0040595 3300037312 Bacteria 3480
600 Ga0395899_0256010 3300037312 Unclassified 1199
601 Ga0395899_0329452 3300037312 Unclassified 1026
602 Ga0395900_0003839 3300037418 Bacteria 16059
603 Ga0395900_0010317 3300037418 Bacteria 9557
604 Ga0395900_0016318 3300037418 Bacteria 7570
605 Ga0395900_0029564 3300037418 Bacteria 5621
606 Ga0395900_0040183 3300037418 Bacteria 4821
607 Ga0395900_0047824 3300037418 Bacteria 4406
608 Ga0395900_0072142 3300037418 Bacteria 3550
609 Ga0395900_0090962 3300037418 Bacteria 3136
610 Ga0395900_0107597 3300037418 Bacteria 2864
611 Ga0395900_0124571 3300037418 Bacteria 2643
612 Ga0395900_0161682 3300037418 Bacteria 2283
613 Ga0395900_0286256 3300037418 Bacteria 1638
614 Ga0395900_0381048 3300037418 Bacteria 1378
615 Ga0395898_0001992 3300037466 Bacteria 25640
616 Ga0395898_0003792 3300037466 Bacteria 16730
617 Ga0395898_0010547 3300037466 Bacteria 9649
618 Ga0395898_0012146 3300037466 Bacteria 8912
619 Ga0395898_0025341 3300037466 Bacteria 5977
620 Ga0395898_0028380 3300037466 Bacteria 5608
621 Ga0395898_0031218 3300037466 Bacteria 5325
622 Ga0395898_0039909 3300037466 Bacteria 4644
623 Ga0395898_0049122 3300037466 Bacteria 4135
624 Ga0395898_0052956 3300037466 Bacteria 3964
625 Ga0395898_0060052 3300037466 Bacteria 3696
626 Ga0395898_0092161 3300037466 Bacteria 2914
627 Ga0395898_0120938 3300037466 Bacteria 2509
628 Ga0395898_0127139 3300037466 Bacteria 2442
629 Ga0395898_0164050 3300037466 Bacteria 2125
630 Ga0395898_0281374 3300037466 Bacteria 1587
631 Ga0395898_0334224 3300037466 Bacteria 1445
632 Ga0395898_0422703 3300037466 Bacteria 1270
633 Ga0395905_0001840 3300037471 Bacteria 24490
634 Ga0395905_0002457 3300037471 Bacteria 20517
635 Ga0395905_0003930 3300037471 Bacteria 15641
636 Ga0395905_0004274 3300037471 Bacteria 14898
637 Ga0395905_0006320 3300037471 Bacteria 11941
638 Ga0395905_0012444 3300037471 Bacteria 8191
639 Ga0395905_0017732 3300037471 Bacteria 6760
640 Ga0395905_0062762 3300037471 Bacteria 3475
641 Ga0395905_0099246 3300037471 Bacteria 2735
642 Ga0395905_0194691 3300037471 Bacteria 1901
643 Ga0395901_0001040 3300038443 Bacteria 29939
644 Ga0395901_0004438 3300038443 Bacteria 14157
645 Ga0395901_0004875 3300038443 Bacteria 13543
646 Ga0395901_0011218 3300038443 Bacteria 9078
647 Ga0395901_0023144 3300038443 Bacteria 6369
648 Ga0395901_0028999 3300038443 Bacteria 5693
649 Ga0395901_0059447 3300038443 Bacteria 3976
650 Ga0395901_0082444 3300038443 Bacteria 3360
651 Ga0395901_0096979 3300038443 Bacteria 3090
652 Ga0395901_0099884 3300038443 Bacteria 3043
653 Ga0395901_0112710 3300038443 Bacteria 2856
654 Ga0395901_0119723 3300038443 Bacteria 2766
655 Ga0395901_0121275 3300038443 Bacteria 2748
656 Ga0395901_0155774 3300038443 Bacteria 2399
657 Ga0395901_0172347 3300038443 Unclassified 2270
658 Ga0395901_0201991 3300038443 Bacteria 2083
659 Ga0395901_0281511 3300038443 Bacteria 1728
660 Ga0395901_0348272 3300038443 Bacteria 1529
661 Ga0395901_0723937 3300038443 Bacteria 990
662 Ga0436360_0528706 3300039438 Bacteria 4291
663 Ga0436363_1061005 3300039450 Bacteria 2484
664 Ga0439461_0008683 3300041410 Bacteria 1827
665 Ga0451798_0460313 3300041458 Bacteria 957
666 Ga0451807_2328025 3300041486 Bacteria 1653
667 Ga0451807_2624602 3300041486 Bacteria 2915
668 Ga0451845_0113855 3300041501 Bacteria 1599
669 Ga0451847_0267910 3300041503 Bacteria 2801
670 Ga0451853_0756687 3300041512 Bacteria 2805
671 Ga0451853_2766170 3300041512 Bacteria 2084
672 Ga0451853_2770344 3300041512 Bacteria 1020
673 Ga0439433_0003811 3300041999 Bacteria 3242
674 Ga0439448_0013879 3300042005 Bacteria 2425
675 Ga0439451_029938 3300042009 Bacteria 1095
676 Ga0439462_0001422 3300042015 Bacteria 5326
677 Ga0450907_005687 3300042146 Bacteria 2099
678 Ga0439446_0037476 3300042156 Bacteria 1419
679 Ga0439434_0045506 3300042435 Bacteria 1353
680 Ga0439460_0039973 3300042461 Bacteria 1373
681 Ga0450918_006509 3300042531 Bacteria 2080
682 Ga0466969_0023324 3300044656 Bacteria 3189
683 Ga0466965_0033661 3300044683 Bacteria 2505
684 Ga0466966_0056185 3300044684 Bacteria 2491
685 Ga0466961_0018479 3300044693 Bacteria 4484
686 Ga0466961_0037920 3300044693 Bacteria 3091
687 Ga0466961_0096049 3300044693 Bacteria 1869
688 Ga0466961_0254389 3300044693 Bacteria 1078
689 Ga0466963_0000672 3300044694 Bacteria 16561
690 Ga0466963_0001044 3300044694 Bacteria 14373
691 Ga0466963_0001079 3300044694 Bacteria 14245
692 Ga0466963_0001179 3300044694 Bacteria 13728
693 Ga0466963_0003075 3300044694 Bacteria 9453
694 Ga0466963_0003353 3300044694 Bacteria 9146
695 Ga0466963_0003990 3300044694 Bacteria 8536
696 Ga0466963_0006135 3300044694 Bacteria 7089
697 Ga0466963_0017626 3300044694 Bacteria 4453
698 Ga0466963_0073664 3300044694 Bacteria 2302
699 Ga0466963_0123202 3300044694 Bacteria 1785
700 Ga0466964_0002042 3300044706 Bacteria 7098
701 Ga0466964_0237508 3300044706 Bacteria 892
702 Ga0466971_0001056 3300044719 Bacteria 11415
703 Ga0466971_0005889 3300044719 Bacteria 5336
704 Ga0466971_0006326 3300044719 Bacteria 5139
705 Ga0466971_0018405 3300044719 Bacteria 3094
706 Ga0466971_0140155 3300044719 Bacteria 1126
707 Ga0466971_0148192 3300044719 Bacteria 1095
708 Ga0466968_0001252 3300044735 Bacteria 9028
709 Ga0466968_0049138 3300044735 Bacteria 1796
710 Ga0466968_0064230 3300044735 Bacteria 1587
711 Ga0466968_0068194 3300044735 Bacteria 1544
712 Ga0466968_0087490 3300044735 Bacteria 1376
713 Ga0466970_0097685 3300044765 Bacteria 1598
714 Ga0466970_0302357 3300044765 Bacteria 902
715 Ga0466957_0002132 3300044842 Bacteria 10588
716 Ga0466957_0010016 3300044842 Bacteria 5426
717 Ga0466957_0040303 3300044842 Bacteria 2820
718 Ga0466957_0040881 3300044842 Bacteria 2802
719 Ga0466957_0113371 3300044842 Bacteria 1722
720 Ga0466957_0128244 3300044842 Bacteria 1623
721 Ga0466957_0151658 3300044842 Bacteria 1499
722 Ga0466957_0397770 3300044842 Bacteria 942
723 Ga0466960_0002057 3300044901 Bacteria 7475
724 Ga0466960_0002959 3300044901 Bacteria 6474
725 Ga0466959_0007586 3300045049 Bacteria 7625
726 Ga0466959_0018754 3300045049 Bacteria 5081
727 Ga0466959_0089047 3300045049 Bacteria 2218
728 Ga0451576_0047599 3300045051 Bacteria 4507
729 Ga0466958_0001285 3300045836 Bacteria 11795
730 Ga0466958_0004493 3300045836 Bacteria 7367
731 Ga0466958_0004496 3300045836 Bacteria 7365
732 Ga0466958_0019532 3300045836 Bacteria 3945
733 Ga0466958_0026927 3300045836 Bacteria 3399
734 Ga0466958_0039301 3300045836 Bacteria 2842
735 Ga0466958_0071587 3300045836 Bacteria 2123
736 Ga0466958_0084413 3300045836 Bacteria 1958
737 Ga0466967_0000042 3300045976 Bacteria 45895
738 Ga0466967_0000848 3300045976 Bacteria 16203
739 Ga0466967_0003680 3300045976 Bacteria 10091
740 Ga0466967_0008701 3300045976 Bacteria 7471
741 Ga0466967_0011597 3300045976 Bacteria 6689
742 Ga0466967_0016125 3300045976 Bacteria 5881
743 Ga0466967_0019905 3300045976 Bacteria 5410
744 Ga0466967_0024949 3300045976 Bacteria 4922
745 Ga0466967_0040079 3300045976 Bacteria 4031
746 Ga0466967_0061596 3300045976 Bacteria 3329
747 Ga0466967_0064811 3300045976 Bacteria 3250
748 Ga0466967_0171842 3300045976 Bacteria 2040
749 Ga0466967_0264766 3300045976 Bacteria 1645
750 Ga0466967_0273653 3300045976 Bacteria 1619
751 Ga0466967_0322689 3300045976 Bacteria 1489
752 Ga0466967_0477265 3300045976 Bacteria 1221
753 Ga0495592_0001132 3300046454 Bacteria 18548
754 Ga0495592_0001599 3300046454 Bacteria 15848
755 Ga0495592_0077191 3300046454 Bacteria 2415
756 Ga0495603_0004184 3300046455 Bacteria 8595
757 Ga0495603_0018464 3300046455 Bacteria 4219
758 Ga0495603_0028450 3300046455 Bacteria 3371
759 Ga0495629_0002118 3300046459 Bacteria 15381
760 Ga0495629_0020884 3300046459 Bacteria 4673
761 Ga0495629_0120417 3300046459 Bacteria 1828
762 Ga0495629_0292885 3300046459 Bacteria 1115
763 Ga0495641_0002878 3300046461 Bacteria 13289
764 Ga0495641_0011445 3300046461 Bacteria 5053
765 Ga0495641_0034128 3300046461 Bacteria 2407
766 Ga0495641_0098897 3300046461 Bacteria 1302
767 Ga0495641_0100468 3300046461 Bacteria 1291
768 Ga0495651_0000916 3300046462 Bacteria 22898
769 Ga0495651_0031492 3300046462 Bacteria 4136
770 Ga0495651_0258577 3300046462 Bacteria 1185
771 Ga0495653_0009559 3300046463 Bacteria 7931
772 Ga0495653_0229089 3300046463 Bacteria 1245
773 Ga0495582_0058745 3300046473 Bacteria 2121
774 Ga0495582_0243668 3300046473 Bacteria 1030
775 Ga0495605_0110224 3300046474 Bacteria 1257
776 Ga0495639_0002041 3300046475 Bacteria 8932
777 Ga0495639_0016589 3300046475 Bacteria 3199
778 Ga0495639_0064124 3300046475 Bacteria 1688
779 Ga0495662_0008706 3300046476 Bacteria 4987
780 Ga0495584_0034095 3300046491 Bacteria 2576
781 Ga0495584_0105757 3300046491 Bacteria 1423
782 Ga0495585_0089347 3300046492 Bacteria 1661
783 Ga0495594_0001425 3300046499 Bacteria 12405
784 Ga0495594_0179974 3300046499 Bacteria 1203
785 Ga0495596_0023239 3300046500 Bacteria 2517
786 Ga0495608_0006157 3300046511 Bacteria 8518
787 Ga0495608_0029181 3300046511 Bacteria 3745
788 Ga0495608_0031911 3300046511 Bacteria 3560
789 Ga0495608_0048065 3300046511 Bacteria 2836
790 Ga0495618_0025325 3300046514 Bacteria 3681
791 Ga0495618_0112438 3300046514 Bacteria 1744
792 Ga0495618_0236731 3300046514 Bacteria 1148
793 Ga0495628_0001072 3300046516 Bacteria 25092
794 Ga0495628_0042328 3300046516 Bacteria 3632
795 Ga0495628_0299499 3300046516 Bacteria 1190
796 Ga0495630_0036488 3300046517 Bacteria 3675
797 Ga0495630_0046601 3300046517 Bacteria 3240
798 Ga0495630_0125164 3300046517 Bacteria 1950
799 Ga0495637_0053884 3300046520 Bacteria 1673
800 Ga0495644_0004757 3300046523 Bacteria 5332
801 Ga0495644_0030662 3300046523 Bacteria 2031
802 Ga0495663_0021388 3300046525 Bacteria 1863
803 Ga0495663_0070241 3300046525 Bacteria 1114
804 Ga0495666_0001079 3300046526 Bacteria 12994
805 Ga0495652_0007424 3300046529 Bacteria 10107
806 Ga0495652_0030241 3300046529 Bacteria 4751
807 Ga0495652_0084008 3300046529 Bacteria 2619
808 Ga0495652_0187569 3300046529 Bacteria 1581
809 Ga0495665_0015929 3300046531 Bacteria 4050
810 Ga0495665_0212414 3300046531 Bacteria 1001
811 Ga0495640_0014512 3300046533 Bacteria 5956
812 Ga0495640_0052261 3300046533 Bacteria 2807
813 Ga0495640_0283578 3300046533 Bacteria 1031
814 Ga0495586_0100307 3300046535 Bacteria 1606
815 Ga0495587_0000220 3300046536 Bacteria 42423
816 Ga0495587_0068241 3300046536 Bacteria 2071
817 Ga0495645_0000706 3300046543 Bacteria 22898
818 Ga0495645_0060499 3300046543 Bacteria 2745
819 Ga0495645_0245434 3300046543 Bacteria 1192
820 Ga0495667_0004967 3300046559 Bacteria 8995
821 Ga0495667_0116125 3300046559 Bacteria 1729
822 Ga0495656_0059590 3300046615 Bacteria 1661
823 Ga0495634_0058991 3300046642 Bacteria 2557
824 Ga0495634_0085572 3300046642 Bacteria 2054
825 Ga0495611_0015632 3300046648 Bacteria 3245
826 Ga0495635_0015500 3300046663 Bacteria 5327
827 Ga0495588_0002838 3300046674 Bacteria 7454
828 Ga0495657_0009407 3300046675 Bacteria 7408
829 Ga0495657_0027543 3300046675 Bacteria 4009
830 Ga0495599_0000198 3300046678 Bacteria 40015
831 Ga0495599_0015183 3300046678 Bacteria 4776
832 Ga0495623_0000661 3300046679 Bacteria 22896
833 Ga0495623_0038013 3300046679 Bacteria 3078
834 Ga0495646_0002159 3300046680 Bacteria 11967
835 Ga0495646_0070564 3300046680 Bacteria 2057
836 Ga0495647_0000355 3300046681 Bacteria 12961
837 Ga0495647_0040272 3300046681 Bacteria 1775
838 Ga0495658_0025460 3300046683 Bacteria 3162
839 Ga0495658_0055767 3300046683 Bacteria 2252
840 Ga0495658_0177299 3300046683 Bacteria 1321
841 Ga0495613_0004573 3300046689 Bacteria 10377
842 Ga0495613_0015395 3300046689 Bacteria 5687
843 Ga0495613_0081136 3300046689 Bacteria 2357
844 Ga0495613_0115401 3300046689 Bacteria 1933
845 Ga0495613_0138467 3300046689 Bacteria 1740
846 Ga0495624_0004708 3300046690 Bacteria 9933
847 Ga0495624_0011872 3300046690 Bacteria 5974
848 Ga0495624_0024328 3300046690 Bacteria 3986
849 Ga0495624_0208791 3300046690 Bacteria 1185
850 Ga0495589_0140399 3300046794 Bacteria 1157
851 Ga0495600_0069418 3300046809 Bacteria 2303
852 Ga0495660_0114815 3300046810 Bacteria 1370
853 Ga0495581_0003685 3300047315 Bacteria 8821
854 Ga0495581_0111033 3300047315 Bacteria 1594
855 Ga0495581_0111804 3300047315 Bacteria 1588
856 Ga0495604_0006194 3300047317 Bacteria 9496
857 Ga0495604_0031702 3300047317 Bacteria 4192
858 Ga0495636_0080833 3300047318 Bacteria 1399
859 Ga0495674_0034864 3300047319 Bacteria 4546
860 Ga0495674_0054512 3300047319 Bacteria 3511
861 Ga0495674_0078767 3300047319 Bacteria 2831
862 Ga0495674_0128173 3300047319 Bacteria 2139
863 Ga0495674_0153284 3300047319 Bacteria 1931
864 Ga0495674_0289316 3300047319 Bacteria 1340
865 Ga0495674_0429559 3300047319 Bacteria 1063
866 Ga0495676_0001358 3300047321 Bacteria 21032
867 Ga0495676_0031321 3300047321 Bacteria 4500
868 Ga0495676_0031322 3300047321 Bacteria 4500
869 Ga0495676_0048611 3300047321 Bacteria 3418
870 Ga0495676_0142571 3300047321 Bacteria 1715
871 Ga0495676_0185727 3300047321 Bacteria 1454
872 Ga0495680_0011878 3300047322 Bacteria 7684
873 Ga0495680_0026376 3300047322 Bacteria 4790
874 Ga0495680_0034667 3300047322 Bacteria 4072
875 Ga0495680_0127759 3300047322 Bacteria 1870
876 Ga0495680_0163869 3300047322 Bacteria 1613
877 Ga0495675_0000397 3300047444 Bacteria 30165
878 Ga0495675_0105317 3300047444 Bacteria 1763
879 Ga0495675_0158855 3300047444 Bacteria 1393
880 Ga0495685_047960 3300047447 Bacteria 1452
881 Ga0495684_0016118 3300047471 Bacteria 5753
882 Ga0495684_0024665 3300047471 Bacteria 4628
883 Ga0495684_0064227 3300047471 Bacteria 2790
884 Ga0495684_0073314 3300047471 Bacteria 2601
885 Ga0495684_0075107 3300047471 Bacteria 2568
886 Ga0495593_0001535 3300047673 Bacteria 13598
887 Ga0495602_0001486 3300048088 Bacteria 23321
888 Ga0495602_0044851 3300048088 Bacteria 4006
889 Ga0495602_0115103 3300048088 Bacteria 2176
890 Ga0495602_0125837 3300048088 Bacteria 2053
891 Ga0495602_0249292 3300048088 Bacteria 1324
892 Ga0495614_0000987 3300048089 Bacteria 12107
893 Ga0496100_0010344 3300048903 Bacteria 5278
894 Ga0496100_0029865 3300048903 Bacteria 3376
895 Ga0496100_0038773 3300048903 Bacteria 3021
896 Ga0496100_0045026 3300048903 Bacteria 2830
897 Ga0496100_0083975 3300048903 Bacteria 2158
898 Ga0496100_0090101 3300048903 Bacteria 2091
899 Ga0496100_0100524 3300048903 Bacteria 1992
900 Ga0496100_0131184 3300048903 Bacteria 1765
901 Ga0496101_0010547 3300048904 Bacteria 6103
902 Ga0496101_0012903 3300048904 Bacteria 5588
903 Ga0496101_0022317 3300048904 Bacteria 4356
904 Ga0496101_0027709 3300048904 Bacteria 3949
905 Ga0496101_0063533 3300048904 Bacteria 2687
906 Ga0496101_0073160 3300048904 Bacteria 2517
907 Ga0496102_0025643 3300048905 Bacteria 5251
908 Ga0496102_0049220 3300048905 Bacteria 3834
909 Ga0496102_0050992 3300048905 Bacteria 3770
910 Ga0496102_0089814 3300048905 Bacteria 2843
911 Ga0496102_0218890 3300048905 Bacteria 1794
912 Ga0496102_0227781 3300048905 Bacteria 1757
913 Ga0496102_0251161 3300048905 Bacteria 1668
914 Ga0496102_0256087 3300048905 Bacteria 1650
915 Ga0496103_0004207 3300048906 Bacteria 8734
916 Ga0496103_0022803 3300048906 Bacteria 3771
917 Ga0496103_0043306 3300048906 Bacteria 2771
918 Ga0496103_0193363 3300048906 Bacteria 1308
919 Ga0496104_0000762 3300048907 Bacteria 27565
920 Ga0496104_0003786 3300048907 Bacteria 13090
921 Ga0496104_0007525 3300048907 Bacteria 9627
922 Ga0496104_0014730 3300048907 Bacteria 7068
923 Ga0496104_0015022 3300048907 Bacteria 7005
924 Ga0496104_0022899 3300048907 Bacteria 5739
925 Ga0496104_0063201 3300048907 Bacteria 3511
926 Ga0496104_0063735 3300048907 Bacteria 3496
927 Ga0496104_0086782 3300048907 Bacteria 2987
928 Ga0496104_0098329 3300048907 Bacteria 2801
929 Ga0496104_0132758 3300048907 Bacteria 2392
930 Ga0496104_0335493 3300048907 Bacteria 1425
931 Ga0496105_0001467 3300048908 Bacteria 16639
932 Ga0496105_0002609 3300048908 Bacteria 13113
933 Ga0496105_0003350 3300048908 Bacteria 11842
934 Ga0496105_0012928 3300048908 Bacteria 6616
935 Ga0496105_0016790 3300048908 Bacteria 5851
936 Ga0496105_0041895 3300048908 Bacteria 3774
937 Ga0496105_0147054 3300048908 Bacteria 1937
938 Ga0496105_0159547 3300048908 Bacteria 1851
939 Ga0496105_0189692 3300048908 Bacteria 1681
940 Ga0496105_0229584 3300048908 Bacteria 1508
941 Ga0496106_0003112 3300048909 Bacteria 12393
942 Ga0496106_0013604 3300048909 Bacteria 6007
943 Ga0496106_0075564 3300048909 Bacteria 2581
944 Ga0496106_0160191 3300048909 Bacteria 1779
945 Ga0496106_0217619 3300048909 Bacteria 1522
946 Ga0496106_0248262 3300048909 Bacteria 1422
947 Ga0496106_0255901 3300048909 Bacteria 1400
948 Ga0496106_0269936 3300048909 Bacteria 1362
949 Ga0496107_0008446 3300048910 Bacteria 7128
950 Ga0496107_0059860 3300048910 Bacteria 2756
951 Ga0496107_0093113 3300048910 Bacteria 2203
952 Ga0496107_0110318 3300048910 Bacteria 2022
953 Ga0496107_0138004 3300048910 Bacteria 1802
954 Ga0496108_0007426 3300048911 Bacteria 8885
955 Ga0496108_0016964 3300048911 Bacteria 5951
956 Ga0496108_0019890 3300048911 Bacteria 5514
957 Ga0496108_0020099 3300048911 Bacteria 5487
958 Ga0496108_0020363 3300048911 Bacteria 5452
959 Ga0496108_0031526 3300048911 Bacteria 4399
960 Ga0496108_0037674 3300048911 Bacteria 4029
961 Ga0496108_0039838 3300048911 Bacteria 3916
962 Ga0496108_0257854 3300048911 Bacteria 1517
963 Ga0496108_0295160 3300048911 Bacteria 1411
964 Ga0496109_0001678 3300048912 Bacteria 18457
965 Ga0496109_0005820 3300048912 Bacteria 10327
966 Ga0496109_0006942 3300048912 Bacteria 9557
967 Ga0496109_0007370 3300048912 Bacteria 9309
968 Ga0496109_0021042 3300048912 Bacteria 5768
969 Ga0496109_0027321 3300048912 Bacteria 5094
970 Ga0496109_0028172 3300048912 Bacteria 5022
971 Ga0496109_0031372 3300048912 Bacteria 4768
972 Ga0496109_0040527 3300048912 Bacteria 4218
973 Ga0496109_0047246 3300048912 Bacteria 3913
974 Ga0496109_0053762 3300048912 Bacteria 3674
975 Ga0496109_0062147 3300048912 Bacteria 3415
976 Ga0496109_0084681 3300048912 Bacteria 2925
977 Ga0496109_0085770 3300048912 Bacteria 2907
978 Ga0496109_0105382 3300048912 Bacteria 2618
979 Ga0496109_0171550 3300048912 Bacteria 2035
980 Ga0496109_0266110 3300048912 Bacteria 1615
981 Ga0496109_0297703 3300048912 Bacteria 1521
982 Ga0496109_0479104 3300048912 Bacteria 1175
983 Ga0496110_0004864 3300048913 Bacteria 10479
984 Ga0496110_0009208 3300048913 Bacteria 7979
985 Ga0496110_0011684 3300048913 Bacteria 7202
986 Ga0496110_0016094 3300048913 Bacteria 6237
987 Ga0496110_0020715 3300048913 Bacteria 5553
988 Ga0496110_0133261 3300048913 Bacteria 2244
989 Ga0496110_0188400 3300048913 Bacteria 1873
990 Ga0496111_0000087 3300048914 Bacteria 38807
991 Ga0496111_0000169 3300048914 Bacteria 29654
992 Ga0496111_0005536 3300048914 Bacteria 8113
993 Ga0496111_0015572 3300048914 Bacteria 5224
994 Ga0496111_0023702 3300048914 Bacteria 4311
995 Ga0496111_0049805 3300048914 Bacteria 3020
996 Ga0496111_0186932 3300048914 Bacteria 1540
997 Ga0496111_0245787 3300048914 Archaea 1328
998 Ga0496112_0000851 3300048915 Bacteria 21796
999 Ga0496112_0002074 3300048915 Bacteria 15896
1000 Ga0496112_0008833 3300048915 Bacteria 9040
1001 Ga0496112_0010874 3300048915 Bacteria 8283
1002 Ga0496112_0012920 3300048915 Bacteria 7692
1003 Ga0496112_0016175 3300048915 Bacteria 6979
1004 Ga0496112_0033998 3300048915 Bacteria 4960
1005 Ga0496112_0070960 3300048915 Bacteria 3442
1006 Ga0496112_0094249 3300048915 Bacteria 2964
1007 Ga0496112_0125551 3300048915 Bacteria 2537
1008 Ga0496112_0138402 3300048915 Bacteria 2404
1009 Ga0496112_0248630 3300048915 Bacteria 1730
1010 Ga0496112_0283648 3300048915 Bacteria 1603
1011 Ga0496112_0307198 3300048915 Bacteria 1531
1012 Ga0496112_0366714 3300048915 Bacteria 1382
1013 Ga0496113_0000554 3300048916 Bacteria 18536
1014 Ga0496113_0010767 3300048916 Bacteria 6064
1015 Ga0496113_0030604 3300048916 Bacteria 3898
1016 Ga0496113_0068576 3300048916 Bacteria 2692
1017 Ga0496113_0106403 3300048916 Bacteria 2179
1018 Ga0496113_0145685 3300048916 Bacteria 1866
1019 Ga0496113_0357363 3300048916 Bacteria 1172
1020 Ga0496114_0001058 3300048917 Bacteria 20693
1021 Ga0496114_0009256 3300048917 Bacteria 7812
1022 Ga0496114_0015503 3300048917 Bacteria 6127
1023 Ga0496114_0019602 3300048917 Bacteria 5481
1024 Ga0496114_0032440 3300048917 Bacteria 4299
1025 Ga0496114_0085386 3300048917 Bacteria 2673
1026 Ga0496114_0103239 3300048917 Bacteria 2437
1027 Ga0496114_0116692 3300048917 Bacteria 2292
1028 Ga0496114_0214923 3300048917 Bacteria 1687
1029 Ga0496114_0263675 3300048917 Bacteria 1517
1030 Ga0496114_0305446 3300048917 Bacteria 1405
1031 Ga0496114_0320328 3300048917 Bacteria 1370
1032 Ga0496114_0467677 3300048917 Bacteria 1116
1033 Ga0496115_0006404 3300048918 Bacteria 8625
1034 Ga0496115_0007807 3300048918 Bacteria 7888
1035 Ga0496115_0029957 3300048918 Bacteria 4279
1036 Ga0496115_0037556 3300048918 Bacteria 3838
1037 Ga0496115_0082577 3300048918 Bacteria 2618
1038 Ga0496115_0111812 3300048918 Bacteria 2244
1039 Ga0501031_0004099 3300049568 Bacteria 9412
1040 Ga0501031_0012817 3300049568 Bacteria 5477
1041 Ga0501031_0015523 3300049568 Bacteria 4943
1042 Ga0501031_0107483 3300049568 Bacteria 1822
1043 Ga0501031_0162375 3300049568 Bacteria 1460
1044 Ga0501031_0227203 3300049568 Bacteria 1215
1045 Ga0501032_0035979 3300049569 Bacteria 3382
1046 Ga0501033_0057657 3300049570 Bacteria 2869
1047 Ga0501033_0110163 3300049570 Bacteria 2004
1048 Ga0501034_0055570 3300049571 Bacteria 3984
1049 Ga0501034_0328561 3300049571 Bacteria 1461
1050 Ga0501036_0001027 3300049572 Bacteria 21086
1051 Ga0501036_0030129 3300049572 Bacteria 4584
1052 Ga0501036_0038811 3300049572 Bacteria 4031
1053 Ga0501036_0094818 3300049572 Bacteria 2522
1054 Ga0501036_0134814 3300049572 Bacteria 2084
1055 Ga0501036_0167895 3300049572 Bacteria 1849
1056 Ga0501036_0241326 3300049572 Bacteria 1515
1057 Ga0501037_0008607 3300049573 Bacteria 7483
1058 Ga0501037_0134529 3300049573 Bacteria 1771
1059 Ga0501038_0011389 3300049574 Bacteria 8116
1060 Ga0501038_0027212 3300049574 Bacteria 5090
1061 Ga0501038_0096340 3300049574 Bacteria 2470
1062 Ga0501038_0125209 3300049574 Bacteria 2116
1063 Ga0501038_0153325 3300049574 Bacteria 1877
1064 Ga0501039_0017673 3300049575 Bacteria 5470
1065 Ga0501039_0038348 3300049575 Bacteria 3700
1066 Ga0501039_0050226 3300049575 Bacteria 3226
1067 Ga0501039_0058486 3300049575 Bacteria 2986
1068 Ga0501039_0134433 3300049575 Bacteria 1941
1069 Ga0501039_0167927 3300049575 Bacteria 1725
1070 Ga0501040_0087473 3300049576 Bacteria 2163
1071 Ga0501040_0104245 3300049576 Bacteria 1980
1072 Ga0501040_0208319 3300049576 Bacteria 1389
1073 Ga0501041_0027037 3300049577 Bacteria 3455
1074 Ga0501041_0039808 3300049577 Bacteria 2852
1075 Ga0501041_0072234 3300049577 Bacteria 2119
1076 Ga0501041_0081685 3300049577 Bacteria 1990
1077 Ga0501041_0100191 3300049577 Bacteria 1793
1078 Ga0501041_0115855 3300049577 Bacteria 1664
1079 Ga0501042_0000334 3300049578 Bacteria 23630
1080 Ga0501042_0026797 3300049578 Bacteria 4049
1081 Ga0501042_0041803 3300049578 Bacteria 3261
1082 Ga0501042_0066661 3300049578 Bacteria 2573
1083 Ga0501042_0078895 3300049578 Bacteria 2358
1084 Ga0501042_0084497 3300049578 Bacteria 2276
1085 Ga0501042_0086270 3300049578 Bacteria 2251
1086 Ga0501042_0118211 3300049578 Bacteria 1908
1087 Ga0501042_0134003 3300049578 Bacteria 1786
1088 Ga0501042_0212804 3300049578 Bacteria 1394
1089 Ga0501042_0293926 3300049578 Bacteria 1173
1090 Ga0501043_0097097 3300049579 Bacteria 2316
1091 Ga0501043_0118017 3300049579 Bacteria 2081
1092 Ga0501043_0286752 3300049579 Bacteria 1261
1093 Ga0501046_0019986 3300049580 Bacteria 5545
1094 Ga0501046_0022389 3300049580 Bacteria 5205
1095 Ga0501046_0142452 3300049580 Bacteria 1813
1096 Ga0501047_0293558 3300049581 Bacteria 1469
1097 Ga0501048_0002894 3300049582 Bacteria 13102
1098 Ga0501048_0003753 3300049582 Bacteria 11591
1099 Ga0501048_0060796 3300049582 Bacteria 2676
1100 Ga0501048_0123692 3300049582 Bacteria 1829
1101 Ga0501048_0160224 3300049582 Bacteria 1592
1102 Ga0501048_0224726 3300049582 Bacteria 1332
1103 Ga0501067_0004777 3300049583 Bacteria 7510
1104 Ga0501067_0008835 3300049583 Bacteria 5581
1105 Ga0501067_0016414 3300049583 Bacteria 4091
1106 Ga0501067_0029527 3300049583 Bacteria 3039
1107 Ga0501067_0035407 3300049583 Bacteria 2772
1108 Ga0501068_0102208 3300049584 Bacteria 1777
1109 Ga0501068_0244102 3300049584 Bacteria 1143
1110 Ga0501069_0006563 3300049585 Bacteria 6082
1111 Ga0501069_0010165 3300049585 Bacteria 4977
1112 Ga0501069_0044822 3300049585 Bacteria 2449
1113 Ga0501069_0064797 3300049585 Bacteria 2042
1114 Ga0501069_0090185 3300049585 Bacteria 1733
1115 Ga0501069_0112788 3300049585 Bacteria 1549
1116 Ga0501069_0156653 3300049585 Bacteria 1310
1117 Ga0501069_0192839 3300049585 Bacteria 1179
1118 Ga0501070_0012254 3300049586 Bacteria 7237
1119 Ga0501070_0029191 3300049586 Bacteria 4625
1120 Ga0501070_0038651 3300049586 Bacteria 3982
1121 Ga0501070_0129386 3300049586 Bacteria 2086
1122 Ga0501070_0214491 3300049586 Bacteria 1579
1123 Ga0501070_0318248 3300049586 Bacteria 1266
1124 Ga0501070_0382388 3300049586 Bacteria 1140
1125 Ga0501071_0000345 3300049587 Bacteria 22601
1126 Ga0501071_0000651 3300049587 Bacteria 18127
1127 Ga0501071_0004549 3300049587 Bacteria 8800
1128 Ga0501071_0023965 3300049587 Bacteria 4266
1129 Ga0501071_0030981 3300049587 Bacteria 3787
1130 Ga0501071_0065632 3300049587 Bacteria 2636
1131 Ga0501071_0092372 3300049587 Bacteria 2224
1132 Ga0501071_0157307 3300049587 Bacteria 1697
1133 Ga0501072_0004103 3300049588 Bacteria 11025
1134 Ga0501072_0011364 3300049588 Bacteria 6804
1135 Ga0501072_0055933 3300049588 Bacteria 3110
1136 Ga0501072_0098642 3300049588 Bacteria 2322
1137 Ga0501072_0131272 3300049588 Bacteria 1996
1138 Ga0501072_0131654 3300049588 Bacteria 1993
1139 Ga0501072_0140478 3300049588 Bacteria 1925
1140 Ga0501072_0257150 3300049588 Bacteria 1390
1141 Ga0501073_0091237 3300049589 Bacteria 2117
1142 Ga0501073_0140866 3300049589 Bacteria 1671
1143 Ga0501073_0183644 3300049589 Bacteria 1448
1144 Ga0501073_0236590 3300049589 Bacteria 1261
1145 Ga0501074_0000765 3300049590 Bacteria 20232
1146 Ga0501074_0025731 3300049590 Bacteria 4270
1147 Ga0501074_0043447 3300049590 Bacteria 3253
1148 Ga0501074_0046599 3300049590 Bacteria 3134
1149 Ga0501074_0048279 3300049590 Bacteria 3075
1150 Ga0501074_0062128 3300049590 Bacteria 2690
1151 Ga0501075_0005215 3300049591 Bacteria 8887
1152 Ga0501075_0006054 3300049591 Bacteria 8297
1153 Ga0501075_0029033 3300049591 Bacteria 4088
1154 Ga0501075_0038185 3300049591 Bacteria 3589
1155 Ga0501075_0050468 3300049591 Bacteria 3127
1156 Ga0501075_0076718 3300049591 Bacteria 2528
1157 Ga0501075_0088665 3300049591 Bacteria 2346
1158 Ga0501075_0253102 3300049591 Bacteria 1342
1159 Ga0501075_0317699 3300049591 Bacteria 1187
1160 Ga0501076_0001235 3300049592 Bacteria 17016
1161 Ga0501076_0001689 3300049592 Bacteria 14898
1162 Ga0501076_0006917 3300049592 Bacteria 8240
1163 Ga0501076_0027563 3300049592 Bacteria 4405
1164 Ga0501076_0042028 3300049592 Bacteria 3599
1165 Ga0501076_0097859 3300049592 Bacteria 2363
1166 Ga0501076_0164777 3300049592 Bacteria 1806
1167 Ga0501076_0204025 3300049592 Bacteria 1615
1168 Ga0501076_0396075 3300049592 Bacteria 1135
1169 Ga0501077_0002770 3300049593 Bacteria 10511
1170 Ga0501077_0002957 3300049593 Bacteria 10198
1171 Ga0501077_0003278 3300049593 Bacteria 9747
1172 Ga0501077_0004842 3300049593 Bacteria 8180
1173 Ga0501077_0022027 3300049593 Bacteria 4035
1174 Ga0501077_0030518 3300049593 Bacteria 3430
1175 Ga0501077_0043829 3300049593 Bacteria 2843
1176 Ga0501079_0001742 3300049741 Bacteria 15514
1177 Ga0501079_0014007 3300049741 Bacteria 6116
1178 Ga0501079_0015752 3300049741 Bacteria 5776
1179 Ga0501079_0047722 3300049741 Bacteria 3304
1180 Ga0501079_0064690 3300049741 Bacteria 2821
1181 Ga0501079_0072254 3300049741 Bacteria 2666
1182 Ga0501079_0073185 3300049741 Bacteria 2648
1183 Ga0501079_0129038 3300049741 Bacteria 1967
1184 Ga0501079_0208308 3300049741 Bacteria 1527
1185 Ga0501079_0242642 3300049741 Bacteria 1408
1186 Ga0501079_0292218 3300049741 Bacteria 1275
1187 Ga0501079_0323427 3300049741 Bacteria 1207
1188 Ga0501080_0001741 3300049742 Bacteria 18642
1189 Ga0501080_0014743 3300049742 Bacteria 7197
1190 Ga0501080_0021050 3300049742 Bacteria 6037
1191 Ga0501080_0100701 3300049742 Bacteria 2680
1192 Ga0501080_0432652 3300049742 Bacteria 1181
1193 Ga0501080_0480838 3300049742 Bacteria 1111
1194 Ga0501080_0540195 3300049742 Bacteria 1039
1195 Ga0501081_0011390 3300049743 Bacteria 5820
1196 Ga0501081_0033516 3300049743 Bacteria 3490
1197 Ga0501081_0066525 3300049743 Bacteria 2506
1198 Ga0501081_0090187 3300049743 Bacteria 2154
1199 Ga0501081_0478007 3300049743 Bacteria 927
1200 Ga0501083_0002789 3300049744 Bacteria 12083
1201 Ga0501083_0106251 3300049744 Bacteria 1848
1202 Ga0501035_0055540 3300049822 Bacteria 3535
1203 Ga0501035_0057550 3300049822 Bacteria 3466
1204 Ga0501035_0144311 3300049822 Bacteria 2068
1205 Ga0501044_0064260 3300049823 Bacteria 3747
1206 Ga0501044_0266320 3300049823 Bacteria 1651
1207 Ga0501044_0354121 3300049823 Bacteria 1387
1208 Ga0501045_0000466 3300049824 Bacteria 25136
1209 Ga0501045_0021227 3300049824 Bacteria 4643
1210 Ga0501045_0024988 3300049824 Bacteria 4292
1211 Ga0501045_0070220 3300049824 Bacteria 2576
1212 Ga0501045_0153931 3300049824 Bacteria 1711
1213 Ga0501045_0194885 3300049824 Bacteria 1510
1214 Ga0501045_0210014 3300049824 Bacteria 1450
1215 Ga0501045_0258341 3300049824 Bacteria 1296
1216 nmdc:mga03n38_53242_c1 3300050490 Bacteria 1814
1217 nmdc:mga0yw44_24081_c1 3300050492 Bacteria 3440
1218 nmdc:mga0yw44_61198_c1 3300050492 Bacteria 2309
1219 nmdc:mga0yw44_89141_c1 3300050492 Bacteria 1946
1220 nmdc:mga06z11_121520_c1 3300050494 Bacteria 1457
1221 nmdc:mga07m45_153117_c1 3300050496 Bacteria 1337
1222 nmdc:mga05p37_138911_c1 3300050507 Bacteria 2978
1223 nmdc:mga05p37_163762_c1 3300050507 Bacteria 2715
1224 nmdc:mga05p37_197477_c1 3300050507 Bacteria 2439
1225 nmdc:mga05p37_205886_c1 3300050507 Bacteria 2380
1226 nmdc:mga05p37_24832_c1 3300050507 Bacteria 7286
1227 nmdc:mga05p37_301408_c1 3300050507 Bacteria 1904
1228 nmdc:mga05p37_325938_c1 3300050507 Bacteria 1816
1229 nmdc:mga05p37_36994_c1 3300050507 Bacteria 5987
1230 nmdc:mga05p37_397190_c1 3300050507 Bacteria 1611
1231 nmdc:mga05p37_524882_c1 3300050507 Bacteria 1353
1232 nmdc:mga05p37_778672_c1 3300050507 Bacteria 1050
1233 nmdc:mga05p37_7975_c1 3300050507 Bacteria 12501
1234 nmdc:mga09592_268488_c1 3300050508 Bacteria 1480
1235 nmdc:mga09592_313131_c1 3300050508 Bacteria 1360
1236 nmdc:mga0qj67_22002_c1 3300050509 Bacteria 4894
1237 nmdc:mga06r32_18303_c1 3300050510 Bacteria 6412
1238 nmdc:mga06r32_246323_c1 3300050510 Bacteria 1775
1239 nmdc:mga06r32_413387_c1 3300050510 Bacteria 1330
1240 nmdc:mga06r32_59154_c1 3300050510 Bacteria 3684
1241 nmdc:mga08y16_338472_c1 3300050511 Bacteria 1547
1242 nmdc:mga08y16_38551_c1 3300050511 Bacteria 5018
1243 nmdc:mga08y16_38628_c1 3300050511 Bacteria 5011
1244 nmdc:mga08y16_46381_c1 3300050511 Bacteria 4550
1245 nmdc:mga08y16_48743_c1 3300050511 Bacteria 4433
1246 nmdc:mga08y16_70469_c1 3300050511 Bacteria 3644
1247 nmdc:mga0n895_22483_c1 3300050512 Bacteria 5913
1248 nmdc:mga0n895_24597_c1 3300050512 Bacteria 5678
1249 nmdc:mga0n895_2766_c1 3300050512 Bacteria 13861
1250 nmdc:mga0n895_32662_c1 3300050512 Bacteria 4997
1251 nmdc:mga0n895_746978_c1 3300050512 Bacteria 972
1252 nmdc:mga0rr50_2093_c1 3300050513 Bacteria 11154
1253 nmdc:mga0rr50_21347_c1 3300050513 Bacteria 4419
1254 nmdc:mga08x19_75551_c1 3300050514 Bacteria 2203
1255 nmdc:mga08x19_7697_c1 3300050514 Bacteria 6396
1256 nmdc:mga0a205_135556_c1 3300050515 Bacteria 2363
1257 nmdc:mga0a205_185775_c1 3300050515 Bacteria 1972
1258 nmdc:mga0a205_2963_c1 3300050515 Bacteria 15060
1259 nmdc:mga0a205_377473_c1 3300050515 Bacteria 1283
1260 nmdc:mga0a205_5364_c2 3300050515 Bacteria 10398
1261 nmdc:mga0a205_82072_c1 3300050515 Bacteria 2608
1262 Ga0495601_0000554 3300053077 Bacteria 19791
1263 Ga0495601_0005595 3300053077 Bacteria 7329
1264 Ga0495601_0054791 3300053077 Bacteria 2523
1265 Ga0495601_0277829 3300053077 Bacteria 1092
1266 Ga0495612_0062475 3300053078 Bacteria 1544
1267 Ga0495595_0004995 3300053084 Bacteria 5357
1268 Ga0495595_0135643 3300053084 Bacteria 1205
1269 Ga0495619_0011831 3300053085 Bacteria 5497
1270 Ga0495619_0037689 3300053085 Bacteria 3152
1271 Ga0495619_0119965 3300053085 Bacteria 1803
1272 Ga0501084_0001413 3300054114 Bacteria 19014
1273 Ga0501084_0005329 3300054114 Bacteria 10530
1274 Ga0501084_0011565 3300054114 Bacteria 7307
1275 Ga0501084_0012787 3300054114 Bacteria 6953
1276 Ga0501084_0025635 3300054114 Bacteria 4917
1277 Ga0501084_0054611 3300054114 Bacteria 3341
1278 Ga0501084_0232423 3300054114 Bacteria 1556
1279 Ga0590077_029194 3300059426 Bacteria 1199
1280 Ga0587082_013214 3300059504 Bacteria 1241
1281 Ga0501082_0004874 3300060353 Bacteria 11709
1282 Ga0501082_0041542 3300060353 Bacteria 3965
1283 Ga0501082_0055012 3300060353 Bacteria 3429
1284 Ga0501082_0091858 3300060353 Bacteria 2621
1285 Ga0501082_0125999 3300060353 Bacteria 2221
1286 Ga0501082_0290676 3300060353 Bacteria 1423
1287 Ga0466962_0000503 3300061719 Bacteria 16987
1288 Ga0466962_0002558 3300061719 Bacteria 8638
1289 Ga0466962_0019082 3300061719 Bacteria 3293
1290 Ga0466962_0104416 3300061719 Bacteria 1361
1291 Ga0466962_0115071 3300061719 Bacteria 1296
1292 Ga0530510_0001475 3300061734 Bacteria 15786
1293 Ga0530510_0008884 3300061734 Bacteria 7033
1294 Ga0530510_0065612 3300061734 Bacteria 2631
1295 Ga0530510_0134861 3300061734 Bacteria 1817
1296 Ga0530510_0383345 3300061734 Bacteria 1058
1297 Ga0530510_0416766 3300061734 Bacteria 1013
1298 Ga0373931_0214254
1299 JGI24751J29686_10035121
1300 Ga0070658_10003658
1301 Ga0070658_10030476
1302 Ga0070683_100000774
1303 Ga0070683_100045882
1304 Ga0070683_100051507
1305 Ga0070683_100112904
1306 Ga0070683_100126187
1307 Ga0070690_100045434
1308 Ga0070690_100121173
1309 Ga0070677_10066824
1310 Ga0068869_100026863
1311 Ga0068869_100162571
1312 Ga0070666_10047569
1313 Ga0070680_100102156
1314 Ga0070680_100153889
1315 Ga0070680_100241485
1316 Ga0070682_100008755
1317 Ga0070682_100019169
1318 Ga0070682_100135795
1319 Ga0070682_100175446
1320 Ga0070682_100332828
1321 Ga0068868_100010563
1322 Ga0068868_100025923
1323 Ga0068868_100054127
1324 Ga0070660_100004783
1325 Ga0070660_100049490
1326 Ga0070691_10019049
1327 Ga0070661_100009372
1328 Ga0070661_100015472
1329 Ga0070661_100058564
1330 Ga0070692_10042048
1331 Ga0070692_10088641
1332 Ga0070668_100002933
1333 Ga0070668_100226679
1334 Ga0070675_100141251
1335 Ga0070675_100244732
1336 Ga0070675_100255883
1337 Ga0070674_100014394
1338 Ga0070674_100021548
1339 Ga0070673_100072358
1340 Ga0070673_100256895
1341 Ga0070688_100010726
1342 Ga0070659_100005871
1343 Ga0070659_100185823
1344 Ga0070703_10032272
1345 Ga0070709_10001860
1346 Ga0070709_10010484
1347 Ga0070709_10044279
1348 Ga0070709_10059086
1349 Ga0070709_10223523
1350 Ga0070714_100008596
1351 Ga0070714_100018091
1352 Ga0070714_100023043
1353 Ga0070714_100028847
1354 Ga0070714_100033662
1355 Ga0070714_100046710
1356 Ga0070714_100064985
1357 Ga0070714_100068477
1358 Ga0070714_100124692
1359 Ga0070714_100194509
1360 Ga0070714_100279483
1361 Ga0070713_100004782
1362 Ga0070713_100007132
1363 Ga0070713_100054334
1364 Ga0070713_100090572
1365 Ga0070713_100154553
1366 Ga0070710_10002718
1367 Ga0070710_10011425
1368 Ga0070710_10036848
1369 Ga0070710_10084958
1370 Ga0070711_100001918
1371 Ga0070711_100034422
1372 Ga0070705_100017395
1373 Ga0070705_100023631
1374 Ga0070705_100037299
1375 Ga0070700_100000585
1376 Ga0070700_100030419
1377 Ga0070700_100041433
1378 Ga0070694_100019437
1379 Ga0070694_100045131
1380 Ga0070708_100146638
1381 Ga0070708_100224680
1382 Ga0070663_100014577
1383 Ga0070663_100035554
1384 Ga0070663_100099735
1385 Ga0070678_100006277
1386 Ga0070678_100009462
1387 Ga0070678_100115188
1388 Ga0070678_100177474
1389 Ga0070678_100187778
1390 Ga0070662_100070449
1391 Ga0070681_10017483
1392 Ga0070681_10032807
1393 Ga0070681_10073519
1394 Ga0070681_10160560
1395 Ga0068867_100021336
1396 Ga0068867_100115739
1397 Ga0068867_100140735
1398 Ga0070685_10018054
1399 Ga0070685_10033577
1400 Ga0070706_100275908
1401 Ga0070706_100336031
1402 Ga0070707_100006447
1403 Ga0070707_100009913
1404 Ga0070707_100022080
1405 Ga0070707_100098392
1406 Ga0070698_100004278
1407 Ga0070698_100006489
1408 Ga0070698_100031951
1409 Ga0070698_100058619
1410 Ga0070698_100113070
1411 Ga0070699_100016876
1412 Ga0070699_100044132
1413 Ga0070699_100139117
1414 Ga0070699_100193972
1415 Ga0070679_100047267
1416 Ga0070679_100059248
1417 Ga0070679_100096138
1418 Ga0070679_100164891
1419 Ga0070684_100040661
1420 Ga0070684_100069183
1421 Ga0070684_100185972
1422 Ga0070684_100274627
1423 Ga0070684_100294484
1424 Ga0070684_100306604
1425 Ga0070684_100436309
1426 Ga0070697_100080435
1427 Ga0068853_100040446
1428 Ga0070672_100009205
1429 Ga0070686_100171003
1430 Ga0070695_100038311
1431 Ga0070695_100226097
1432 Ga0070696_100008104
1433 Ga0070696_100025255
1434 Ga0070696_100031997
1435 Ga0070693_100025169
1436 Ga0070693_100104452
1437 Ga0070665_100107934
1438 Ga0070704_100028416
1439 Ga0070704_100028899
1440 Ga0070704_100127172
1441 Ga0068855_100034573
1442 Ga0068855_100043411
1443 Ga0068855_100095791
1444 Ga0068855_100110135
1445 Ga0068855_100220385
1446 Ga0068855_100384975
1447 Ga0070664_100018643
1448 Ga0070664_100078034
1449 Ga0068857_100153604
1450 Ga0068854_100009762
1451 Ga0068854_100093205
1452 Ga0068854_100111336
1453 Ga0068856_100013458
1454 Ga0068856_100083049
1455 Ga0070702_100033046
1456 Ga0070702_100066532
1457 Ga0068852_100024571
1458 Ga0068852_100070996
1459 Ga0068852_100135678
1460 Ga0068852_100148015
1461 Ga0068859_100319165
1462 Ga0068864_100028758
1463 Ga0068866_10002892
1464 Ga0068866_10053305
1465 Ga0068861_100007204
1466 Ga0068861_100231391
1467 Ga0068851_10114441
1468 Ga0068870_10049929
1469 Ga0068870_10181578
1470 Ga0068863_100094656
1471 Ga0068860_100430797
1472 Ga0068862_100070729
1473 Ga0081455_10013758
1474 Ga0081455_10019652
1475 Ga0081455_10059022
1476 Ga0081538_10031057
1477 Ga0081540_1000597
1478 Ga0081540_1005959
1479 Ga0081539_10003619
1480 Ga0081539_10005000
1481 Ga0070717_10011631
1482 Ga0070717_10033584
1483 Ga0070717_10054551
1484 Ga0070717_10070574
1485 Ga0075365_10006259
1486 Ga0075365_10035777
1487 Ga0075365_10137153
1488 Ga0075364_10109831
1489 Ga0075432_10000332
1490 Ga0075432_10001329
1491 Ga0075432_10024473
1492 Ga0070715_10001470
1493 Ga0070715_10003672
1494 Ga0070715_10059989
1495 Ga0070716_100001368
1496 Ga0070716_100079406
1497 Ga0070716_100147844
1498 Ga0070716_100344156
1499 Ga0070712_100001138
1500 Ga0070712_100029238
1501 Ga0070712_100229158
1502 Ga0075367_10085053
1503 Ga0075367_10141973
1504 Ga0097621_100010388
1505 Ga0097621_100170002
1506 Ga0075370_10218896
1507 Ga0068871_100030111
1508 Ga0068871_100068935
1509 Ga0075428_100009696
1510 Ga0075428_100036032
1511 Ga0075428_100044438
1512 Ga0075428_100142312
1513 Ga0075430_100008351
1514 Ga0075431_100027269
1515 Ga0075431_100386162
1516 Ga0075433_10013900
1517 Ga0075433_10089730
1518 Ga0075433_10092652
1519 Ga0075433_10227718
1520 Ga0075433_10287798
1521 Ga0075434_100036513
1522 Ga0075434_100106446
1523 Ga0068865_100001835
1524 Ga0068865_100018132
1525 Ga0068865_100046319
1526 Ga0075436_100011959
1527 Ga0075436_100057244
1528 Ga0075436_100188110
1529 Ga0075436_100254221
1530 Ga0097620_100319174
1531 Ga0075435_100002282
1532 Ga0075435_100025481
1533 Ga0075435_100087062
1534 Ga0075435_100480217
1535 Ga0105240_10011692
1536 Ga0111539_10005072
1537 Ga0111539_10036613
1538 Ga0111539_10045392
1539 Ga0111539_10117251
1540 Ga0111539_10143875
1541 Ga0111539_10213295
1542 Ga0111539_10214954
1543 Ga0111539_10670610
1544 Ga0105245_10007371
1545 Ga0105245_10041637
1546 Ga0105245_10047068
1547 Ga0105245_10047207
1548 Ga0105245_10068259
1549 Ga0105245_10350710
1550 Ga0105245_10485917
1551 Ga0105247_10011467
1552 Ga0114129_10004388
1553 Ga0114129_10009732
1554 Ga0114129_10036404
1555 Ga0114129_10072326
1556 Ga0114129_10184776
1557 Ga0114129_10198243
1558 Ga0114129_10270128
1559 Ga0114129_10453998
1560 Ga0114129_10945521
1561 Ga0105243_10001405
1562 Ga0105243_10556611
1563 Ga0105241_10019866
1564 Ga0105241_10179491
1565 Ga0105241_10216866
1566 Ga0105242_10019300
1567 Ga0105242_10125923
1568 Ga0105242_10133654
1569 Ga0105242_10153941
1570 Ga0105242_10294888
1571 Ga0105248_10032129
1572 Ga0105248_10063386
1573 Ga0105248_10155316
1574 Ga0105237_10150826
1575 Ga0105237_10250661
1576 Ga0105237_10376803
1577 Ga0105238_10397857
1578 Ga0105238_10404397
1579 Ga0105249_10009749
1580 Ga0105249_10034744
1581 Ga0105030_102136
1582 Ga0105239_10017991
1583 Ga0105239_10036876
1584 Ga0105239_10040810
1585 Ga0105239_10078412
1586 Ga0105239_10091857
1587 Ga0105239_10095193
1588 Ga0105239_10448283
1589 Ga0105239_10694412
1590 Ga0105246_10024965
1591 Ga0105246_10056219
1592 Ga0105246_10186376
1593 Ga0157369_10029546
1594 Ga0157369_10035437
1595 Ga0157369_10299042
1596 Ga0157369_10313032
1597 Ga0157369_10461092
1598 Ga0157374_10031172
1599 Ga0157374_10032676
1600 Ga0157374_10236113
1601 Ga0157378_10075074
1602 Ga0163162_10019622
1603 Ga0163162_10043152
1604 Ga0163162_10069849
1605 Ga0163162_10119942
1606 Ga0163162_10281497
1607 Ga0163162_10688202
1608 Ga0157372_10005060
1609 Ga0157372_10018759
1610 Ga0157372_10033981
1611 Ga0157372_10064830
1612 Ga0157372_10115046
1613 Ga0157375_10012100
1614 Ga0157375_10093279
1615 Ga0157375_10143337
1616 Ga0157375_10161973
1617 Ga0157375_10180123
1618 Ga0157375_10208908
1619 Ga0163163_10041705
1620 Ga0163163_10043180
1621 Ga0163163_10059442
1622 Ga0163163_10532305
1623 Ga0157380_10008637
1624 Ga0157380_10017556
1625 Ga0157380_10054326
1626 Ga0157380_10085012
1627 Ga0182008_10001859
1628 Ga0157376_10011111
1629 Ga0157376_10017188
1630 Ga0157376_10058664
1631 Ga0157376_10075977
1632 Ga0157376_10174927
1633 Ga0182006_1033054
1634 Ga0182007_10034369
1635 Ga0182005_1050966
1636 Ga0163161_10040170
1637 Ga0163161_10111624
1638 Ga0163161_10140267
1639 Ga0197907_10473388
1640 Ga0197907_10923252
1641 Ga0206356_11213931
1642 Ga0206354_10223969
1643 Ga0206353_12050450
1644 Ga0213871_10004391
1645 Ga0207653_10000706
1646 Ga0207692_10127069
1647 Ga0207642_10025781
1648 Ga0207642_10026068
1649 Ga0207710_10207182
1650 Ga0207688_10001506
1651 Ga0207688_10026312
1652 Ga0207688_10052556
1653 Ga0207647_10045802
1654 Ga0207647_10054407
1655 Ga0207685_10002057
1656 Ga0207699_10002792
1657 Ga0207699_10023391
1658 Ga0207699_10032535
1659 Ga0207699_10064178
1660 Ga0207645_10016793
1661 Ga0207643_10069377
1662 Ga0207705_10020114
1663 Ga0207684_10033327
1664 Ga0207684_10234760
1665 Ga0207654_10024116
1666 Ga0207654_10254875
1667 Ga0207707_10085241
1668 Ga0207707_10161486
1669 Ga0207707_10316358
1670 Ga0207695_10080080
1671 Ga0207693_10003257
1672 Ga0207693_10008247
1673 Ga0207693_10010065
1674 Ga0207693_10068551
1675 Ga0207693_10091164
1676 Ga0207693_10100409
1677 Ga0207693_10169112
1678 Ga0207693_10217090
1679 Ga0207663_10003189
1680 Ga0207663_10003420
1681 Ga0207663_10087960
1682 Ga0207663_10102018
1683 Ga0207660_10115663
1684 Ga0207660_10139842
1685 Ga0207660_10210502
1686 Ga0207657_10001257
1687 Ga0207657_10024586
1688 Ga0207657_10025289
1689 Ga0207649_10009762
1690 Ga0207649_10131834
1691 Ga0207646_10002821
1692 Ga0207646_10003492
1693 Ga0207646_10021147
1694 Ga0207646_10335145
1695 Ga0207681_10011318
1696 Ga0207694_10099520
1697 Ga0207694_10150501
1698 Ga0207694_10279167
1699 Ga0207694_10323004
1700 Ga0207650_10272570
1701 Ga0207687_10036563
1702 Ga0207687_10060860
1703 Ga0207687_10236544
1704 Ga0207687_10341845
1705 Ga0207700_10000022
1706 Ga0207700_10031795
1707 Ga0207700_10044203
1708 Ga0207700_10113520
1709 Ga0207700_10122007
1710 Ga0207664_10013893
1711 Ga0207664_10030458
1712 Ga0207664_10045034
1713 Ga0207664_10067147
1714 Ga0207664_10077608
1715 Ga0207664_10090520
1716 Ga0207664_10164354
1717 Ga0207664_10199161
1718 Ga0207664_10247947
1719 Ga0207664_10255617
1720 Ga0207644_10096116
1721 Ga0207644_10170350
1722 Ga0207644_10193021
1723 Ga0207644_10287266
1724 Ga0207690_10021692
1725 Ga0207706_10110601
1726 Ga0207686_10171676
1727 Ga0207709_10074230
1728 Ga0207670_10118608
1729 Ga0207670_10132922
1730 Ga0207669_10041985
1731 Ga0207669_10349636
1732 Ga0207704_10008355
1733 Ga0207665_10001486
1734 Ga0207665_10005029
1735 Ga0207665_10006641
1736 Ga0207665_10017861
1737 Ga0207665_10017917
1738 Ga0207665_10127788
1739 Ga0207665_10174995
1740 Ga0207691_10039931
1741 Ga0207691_10267028
1742 Ga0207689_10079904
1743 Ga0207661_10000280
1744 Ga0207661_10014641
1745 Ga0207661_10025935
1746 Ga0207661_10365157
1747 Ga0207679_10006334
1748 Ga0207667_10083314
1749 Ga0207667_10114568
1750 Ga0207651_10169266
1751 Ga0207712_10003543
1752 Ga0207712_10061376
1753 Ga0207712_10124700
1754 Ga0207668_10015573
1755 Ga0207640_10100837
1756 Ga0207640_10110630
1757 Ga0207677_10271905
1758 Ga0207639_10136895
1759 Ga0207639_10385523
1760 Ga0207678_10010336
1761 Ga0207678_10013645
1762 Ga0207678_10054124
1763 Ga0207708_10001375
1764 Ga0207708_10015219
1765 Ga0207708_10027151
1766 Ga0207708_10063147
1767 Ga0207702_10011811
1768 Ga0207702_10029366
1769 Ga0207702_10060850
1770 Ga0207702_10105371
1771 Ga0207702_10263209
1772 Ga0207648_10001234
1773 Ga0207648_10003746
1774 Ga0207648_10083381
1775 Ga0207648_10137097
1776 Ga0207648_10316633
1777 Ga0207676_10023155
1778 Ga0207674_10017679
1779 Ga0207674_10286795
1780 Ga0207675_100003926
1781 Ga0207675_100059947
1782 Ga0207675_100243088
1783 Ga0207683_10000251
1784 Ga0207683_10004522
1785 Ga0207683_10059248
1786 Ga0207683_10192608
1787 Ga0207683_10388632
1788 Ga0207683_10409490
1789 Ga0207698_10010071
1790 Ga0207698_10147529
1791 Ga0207698_10265814
1792 Ga0207428_10002020
1793 Ga0207428_10002720
1794 Ga0207428_10008046
1795 Ga0207428_10046911
1796 Ga0207428_10122285
1797 Ga0268266_10022986
1798 Ga0268265_10059734
1799 Ga0268264_10266914
1800 Ga0265326_10006881
1801 Ga0265319_1002220
1802 Ga0265319_1005651
1803 Ga0265319_1064900
1804 Ga0265334_10004270
1805 Ga0265334_10011991
1806 Ga0265318_10000734
1807 Ga0265318_10002508
1808 Ga0265318_10037984
1809 Ga0265318_10110827
1810 Ga0265322_10010859
1811 Ga0265336_10001597
1812 Ga0265338_10004917
1813 Ga0265338_10005528
1814 Ga0265338_10009821
1815 Ga0265338_10021214
1816 Ga0265338_10098710
1817 Ga0265338_10107088
1818 Ga0265324_10012360
1819 Ga0265330_10000357
1820 Ga0265332_10039483
1821 Ga0265328_10000859
1822 Ga0265320_10004932
1823 Ga0265320_10048374
1824 Ga0265325_10000216
1825 Ga0265325_10118839
1826 Ga0265329_10002217
1827 Ga0265340_10000237
1828 Ga0265340_10010730
1829 Ga0265339_10002326
1830 Ga0265339_10027575
1831 Ga0265331_10005322
1832 Ga0265327_10019761
1833 Ga0265327_10032651
1834 Ga0265316_10005904
1835 Ga0265316_10011799
1836 Ga0307408_100231576
1837 Ga0307408_100357173
1838 Ga0265313_10002904
1839 Ga0265313_10007879
1840 Ga0265314_10006843
1841 Ga0265314_10017052
1842 Ga0265342_10015601
1843 Ga0307405_10038398
1844 Ga0307413_10030326
1845 Ga0307413_10060944
1846 Ga0307410_10043797
1847 Ga0307406_10002364
1848 Ga0307407_10003046
1849 Ga0307412_10038336
1850 Ga0307409_100007208
1851 Ga0307409_100166387
1852 Ga0307416_100013284
1853 Ga0307416_100058645
1854 Ga0307416_100270197
1855 Ga0307414_10155165
1856 Ga0307411_10088562
1857 Ga0307415_100336566
1858 Ga0373948_0003010
1859 Ga0373938_0006132
1860 Ga0373938_0036267
1861 Ga0373929_0002076
1862 Ga0373934_0014655
1863 Ga0373940_0000644
1864 Ga0373949_0001669
1865 Ga0373949_0007979
1866 Ga0373949_0015264
1867 Ga0373951_0018291
1868 Ga0373932_0000955
1869 Ga0373932_0045477
1870 Ga0373939_0004436
1871 Ga0373939_0014911
1872 Ga0373941_0058134
1873 Ga0373945_0118856
1874 Ga0373960_0004625
1875 Ga0373960_0058424
1876 Ga0373943_0007478
1877 Ga0373943_0140320
1878 Ga0373946_0017487
1879 Ga0373942_0007780
1880 Ga0373962_0004080
1881 Ga0373924_0051072
1882 Ga0373931_0056119
1883 Ga0373931_0063264
1884 Ga0373931_0083920
1885 Ga0373935_0052177
1886 Ga0373947_0003496
1887 Ga0373947_0005768
1888 Ga0373937_0001174
1889 Ga0373937_0086770
1890 Ga0373925_0007274
1891 Ga0373925_0054682
1892 Ga0373925_0154791
1893 Ga0395899_0004656
1894 Ga0395899_0009584
1895 Ga0395899_0039313
1896 Ga0395899_0040595
1897 Ga0395899_0256010
1898 Ga0395899_0329452
1899 Ga0395900_0003839
1900 Ga0395900_0010317
1901 Ga0395900_0016318
1902 Ga0395900_0029564
1903 Ga0395900_0040183
1904 Ga0395900_0047824
1905 Ga0395900_0072142
1906 Ga0395900_0090962
1907 Ga0395900_0107597
1908 Ga0395900_0124571
1909 Ga0395900_0161682
1910 Ga0395900_0286256
1911 Ga0395900_0381048
1912 Ga0395898_0001992
1913 Ga0395898_0003792
1914 Ga0395898_0010547
1915 Ga0395898_0012146
1916 Ga0395898_0025341
1917 Ga0395898_0028380
1918 Ga0395898_0031218
1919 Ga0395898_0039909
1920 Ga0395898_0049122
1921 Ga0395898_0052956
1922 Ga0395898_0060052
1923 Ga0395898_0092161
1924 Ga0395898_0120938
1925 Ga0395898_0127139
1926 Ga0395898_0164050
1927 Ga0395898_0281374
1928 Ga0395898_0334224
1929 Ga0395898_0422703
1930 Ga0395905_0001840
1931 Ga0395905_0002457
1932 Ga0395905_0003930
1933 Ga0395905_0004274
1934 Ga0395905_0006320
1935 Ga0395905_0012444
1936 Ga0395905_0017732
1937 Ga0395905_0062762
1938 Ga0395905_0099246
1939 Ga0395905_0194691
1940 Ga0395901_0001040
1941 Ga0395901_0004438
1942 Ga0395901_0004875
1943 Ga0395901_0011218
1944 Ga0395901_0023144
1945 Ga0395901_0028999
1946 Ga0395901_0059447
1947 Ga0395901_0082444
1948 Ga0395901_0096979
1949 Ga0395901_0099884
1950 Ga0395901_0112710
1951 Ga0395901_0119723
1952 Ga0395901_0121275
1953 Ga0395901_0155774
1954 Ga0395901_0172347
1955 Ga0395901_0201991
1956 Ga0395901_0281511
1957 Ga0395901_0348272
1958 Ga0395901_0723937
1959 Ga0436360_0528706
1960 Ga0436363_1061005
1961 Ga0439461_0008683
1962 Ga0451798_0460313
1963 Ga0451807_2328025
1964 Ga0451807_2624602
1965 Ga0451845_0113855
1966 Ga0451847_0267910
1967 Ga0451853_0756687
1968 Ga0451853_2766170
1969 Ga0451853_2770344
1970 Ga0439433_0003811
1971 Ga0439448_0013879
1972 Ga0439451_029938
1973 Ga0439462_0001422
1974 Ga0450907_005687
1975 Ga0439446_0037476
1976 Ga0439434_0045506
1977 Ga0439460_0039973
1978 Ga0450918_006509
1979 Ga0466969_0023324
1980 Ga0466965_0033661
1981 Ga0466966_0056185
1982 Ga0466961_0018479
1983 Ga0466961_0037920
1984 Ga0466961_0096049
1985 Ga0466961_0254389
1986 Ga0466963_0000672
1987 Ga0466963_0001044
1988 Ga0466963_0001079
1989 Ga0466963_0001179
1990 Ga0466963_0003075
1991 Ga0466963_0003353
1992 Ga0466963_0003990
1993 Ga0466963_0006135
1994 Ga0466963_0017626
1995 Ga0466963_0073664
1996 Ga0466963_0123202
1997 Ga0466964_0002042
1998 Ga0466964_0237508
1999 Ga0466971_0001056
2000 Ga0466971_0005889
2001 Ga0466971_0006326
2002 Ga0466971_0018405
2003 Ga0466971_0140155
2004 Ga0466971_0148192
2005 Ga0466968_0001252
2006 Ga0466968_0049138
2007 Ga0466968_0064230
2008 Ga0466968_0068194
2009 Ga0466968_0087490
2010 Ga0466970_0097685
2011 Ga0466970_0302357
2012 Ga0466957_0002132
2013 Ga0466957_0010016
2014 Ga0466957_0040303
2015 Ga0466957_0040881
2016 Ga0466957_0113371
2017 Ga0466957_0128244
2018 Ga0466957_0151658
2019 Ga0466957_0397770
2020 Ga0466960_0002057
2021 Ga0466960_0002959
2022 Ga0466959_0007586
2023 Ga0466959_0018754
2024 Ga0466959_0089047
2025 Ga0451576_0047599
2026 Ga0466958_0001285
2027 Ga0466958_0004493
2028 Ga0466958_0004496
2029 Ga0466958_0019532
2030 Ga0466958_0026927
2031 Ga0466958_0039301
2032 Ga0466958_0071587
2033 Ga0466958_0084413
2034 Ga0466967_0000042
2035 Ga0466967_0000848
2036 Ga0466967_0003680
2037 Ga0466967_0008701
2038 Ga0466967_0011597
2039 Ga0466967_0016125
2040 Ga0466967_0019905
2041 Ga0466967_0024949
2042 Ga0466967_0040079
2043 Ga0466967_0061596
2044 Ga0466967_0064811
2045 Ga0466967_0171842
2046 Ga0466967_0264766
2047 Ga0466967_0273653
2048 Ga0466967_0322689
2049 Ga0466967_0477265
2050 Ga0495592_0001132
2051 Ga0495592_0001599
2052 Ga0495592_0077191
2053 Ga0495603_0004184
2054 Ga0495603_0018464
2055 Ga0495603_0028450
2056 Ga0495629_0002118
2057 Ga0495629_0020884
2058 Ga0495629_0120417
2059 Ga0495629_0292885
2060 Ga0495641_0002878
2061 Ga0495641_0011445
2062 Ga0495641_0034128
2063 Ga0495641_0098897
2064 Ga0495641_0100468
2065 Ga0495651_0000916
2066 Ga0495651_0031492
2067 Ga0495651_0258577
2068 Ga0495653_0009559
2069 Ga0495653_0229089
2070 Ga0495582_0058745
2071 Ga0495582_0243668
2072 Ga0495605_0110224
2073 Ga0495639_0002041
2074 Ga0495639_0016589
2075 Ga0495639_0064124
2076 Ga0495662_0008706
2077 Ga0495584_0034095
2078 Ga0495584_0105757
2079 Ga0495585_0089347
2080 Ga0495594_0001425
2081 Ga0495594_0179974
2082 Ga0495596_0023239
2083 Ga0495608_0006157
2084 Ga0495608_0029181
2085 Ga0495608_0031911
2086 Ga0495608_0048065
2087 Ga0495618_0025325
2088 Ga0495618_0112438
2089 Ga0495618_0236731
2090 Ga0495628_0001072
2091 Ga0495628_0042328
2092 Ga0495628_0299499
2093 Ga0495630_0036488
2094 Ga0495630_0046601
2095 Ga0495630_0125164
2096 Ga0495637_0053884
2097 Ga0495644_0004757
2098 Ga0495644_0030662
2099 Ga0495663_0021388
2100 Ga0495663_0070241
2101 Ga0495666_0001079
2102 Ga0495652_0007424
2103 Ga0495652_0030241
2104 Ga0495652_0084008
2105 Ga0495652_0187569
2106 Ga0495665_0015929
2107 Ga0495665_0212414
2108 Ga0495640_0014512
2109 Ga0495640_0052261
2110 Ga0495640_0283578
2111 Ga0495586_0100307
2112 Ga0495587_0000220
2113 Ga0495587_0068241
2114 Ga0495645_0000706
2115 Ga0495645_0060499
2116 Ga0495645_0245434
2117 Ga0495667_0004967
2118 Ga0495667_0116125
2119 Ga0495656_0059590
2120 Ga0495634_0058991
2121 Ga0495634_0085572
2122 Ga0495611_0015632
2123 Ga0495635_0015500
2124 Ga0495588_0002838
2125 Ga0495657_0009407
2126 Ga0495657_0027543
2127 Ga0495599_0000198
2128 Ga0495599_0015183
2129 Ga0495623_0000661
2130 Ga0495623_0038013
2131 Ga0495646_0002159
2132 Ga0495646_0070564
2133 Ga0495647_0000355
2134 Ga0495647_0040272
2135 Ga0495658_0025460
2136 Ga0495658_0055767
2137 Ga0495658_0177299
2138 Ga0495613_0004573
2139 Ga0495613_0015395
2140 Ga0495613_0081136
2141 Ga0495613_0115401
2142 Ga0495613_0138467
2143 Ga0495624_0004708
2144 Ga0495624_0011872
2145 Ga0495624_0024328
2146 Ga0495624_0208791
2147 Ga0495589_0140399
2148 Ga0495600_0069418
2149 Ga0495660_0114815
2150 Ga0495581_0003685
2151 Ga0495581_0111033
2152 Ga0495581_0111804
2153 Ga0495604_0006194
2154 Ga0495604_0031702
2155 Ga0495636_0080833
2156 Ga0495674_0034864
2157 Ga0495674_0054512
2158 Ga0495674_0078767
2159 Ga0495674_0128173
2160 Ga0495674_0153284
2161 Ga0495674_0289316
2162 Ga0495674_0429559
2163 Ga0495676_0001358
2164 Ga0495676_0031321
2165 Ga0495676_0031322
2166 Ga0495676_0048611
2167 Ga0495676_0142571
2168 Ga0495676_0185727
2169 Ga0495680_0011878
2170 Ga0495680_0026376
2171 Ga0495680_0034667
2172 Ga0495680_0127759
2173 Ga0495680_0163869
2174 Ga0495675_0000397
2175 Ga0495675_0105317
2176 Ga0495675_0158855
2177 Ga0495685_047960
2178 Ga0495684_0016118
2179 Ga0495684_0024665
2180 Ga0495684_0064227
2181 Ga0495684_0073314
2182 Ga0495684_0075107
2183 Ga0495593_0001535
2184 Ga0495602_0001486
2185 Ga0495602_0044851
2186 Ga0495602_0115103
2187 Ga0495602_0125837
2188 Ga0495602_0249292
2189 Ga0495614_0000987
2190 Ga0496100_0010344
2191 Ga0496100_0029865
2192 Ga0496100_0038773
2193 Ga0496100_0045026
2194 Ga0496100_0083975
2195 Ga0496100_0090101
2196 Ga0496100_0100524
2197 Ga0496100_0131184
2198 Ga0496101_0010547
2199 Ga0496101_0012903
2200 Ga0496101_0022317
2201 Ga0496101_0027709
2202 Ga0496101_0063533
2203 Ga0496101_0073160
2204 Ga0496102_0025643
2205 Ga0496102_0049220
2206 Ga0496102_0050992
2207 Ga0496102_0089814
2208 Ga0496102_0218890
2209 Ga0496102_0227781
2210 Ga0496102_0251161
2211 Ga0496102_0256087
2212 Ga0496103_0004207
2213 Ga0496103_0022803
2214 Ga0496103_0043306
2215 Ga0496103_0193363
2216 Ga0496104_0000762
2217 Ga0496104_0003786
2218 Ga0496104_0007525
2219 Ga0496104_0014730
2220 Ga0496104_0015022
2221 Ga0496104_0022899
2222 Ga0496104_0063201
2223 Ga0496104_0063735
2224 Ga0496104_0086782
2225 Ga0496104_0098329
2226 Ga0496104_0132758
2227 Ga0496104_0335493
2228 Ga0496105_0001467
2229 Ga0496105_0002609
2230 Ga0496105_0003350
2231 Ga0496105_0012928
2232 Ga0496105_0016790
2233 Ga0496105_0041895
2234 Ga0496105_0147054
2235 Ga0496105_0159547
2236 Ga0496105_0189692
2237 Ga0496105_0229584
2238 Ga0496106_0003112
2239 Ga0496106_0013604
2240 Ga0496106_0075564
2241 Ga0496106_0160191
2242 Ga0496106_0217619
2243 Ga0496106_0248262
2244 Ga0496106_0255901
2245 Ga0496106_0269936
2246 Ga0496107_0008446
2247 Ga0496107_0059860
2248 Ga0496107_0093113
2249 Ga0496107_0110318
2250 Ga0496107_0138004
2251 Ga0496108_0007426
2252 Ga0496108_0016964
2253 Ga0496108_0019890
2254 Ga0496108_0020099
2255 Ga0496108_0020363
2256 Ga0496108_0031526
2257 Ga0496108_0037674
2258 Ga0496108_0039838
2259 Ga0496108_0257854
2260 Ga0496108_0295160
2261 Ga0496109_0001678
2262 Ga0496109_0005820
2263 Ga0496109_0006942
2264 Ga0496109_0007370
2265 Ga0496109_0021042
2266 Ga0496109_0027321
2267 Ga0496109_0028172
2268 Ga0496109_0031372
2269 Ga0496109_0040527
2270 Ga0496109_0047246
2271 Ga0496109_0053762
2272 Ga0496109_0062147
2273 Ga0496109_0084681
2274 Ga0496109_0085770
2275 Ga0496109_0105382
2276 Ga0496109_0171550
2277 Ga0496109_0266110
2278 Ga0496109_0297703
2279 Ga0496109_0479104
2280 Ga0496110_0004864
2281 Ga0496110_0009208
2282 Ga0496110_0011684
2283 Ga0496110_0016094
2284 Ga0496110_0020715
2285 Ga0496110_0133261
2286 Ga0496110_0188400
2287 Ga0496111_0000087
2288 Ga0496111_0000169
2289 Ga0496111_0005536
2290 Ga0496111_0015572
2291 Ga0496111_0023702
2292 Ga0496111_0049805
2293 Ga0496111_0186932
2294 Ga0496111_0245787
2295 Ga0496112_0000851
2296 Ga0496112_0002074
2297 Ga0496112_0008833
2298 Ga0496112_0010874
2299 Ga0496112_0012920
2300 Ga0496112_0016175
2301 Ga0496112_0033998
2302 Ga0496112_0070960
2303 Ga0496112_0094249
2304 Ga0496112_0125551
2305 Ga0496112_0138402
2306 Ga0496112_0248630
2307 Ga0496112_0283648
2308 Ga0496112_0307198
2309 Ga0496112_0366714
2310 Ga0496113_0000554
2311 Ga0496113_0010767
2312 Ga0496113_0030604
2313 Ga0496113_0068576
2314 Ga0496113_0106403
2315 Ga0496113_0145685
2316 Ga0496113_0357363
2317 Ga0496114_0001058
2318 Ga0496114_0009256
2319 Ga0496114_0015503
2320 Ga0496114_0019602
2321 Ga0496114_0032440
2322 Ga0496114_0085386
2323 Ga0496114_0103239
2324 Ga0496114_0116692
2325 Ga0496114_0214923
2326 Ga0496114_0263675
2327 Ga0496114_0305446
2328 Ga0496114_0320328
2329 Ga0496114_0467677
2330 Ga0496115_0006404
2331 Ga0496115_0007807
2332 Ga0496115_0029957
2333 Ga0496115_0037556
2334 Ga0496115_0082577
2335 Ga0496115_0111812
2336 Ga0501031_0004099
2337 Ga0501031_0012817
2338 Ga0501031_0015523
2339 Ga0501031_0107483
2340 Ga0501031_0162375
2341 Ga0501031_0227203
2342 Ga0501032_0035979
2343 Ga0501033_0057657
2344 Ga0501033_0110163
2345 Ga0501034_0055570
2346 Ga0501034_0328561
2347 Ga0501036_0001027
2348 Ga0501036_0030129
2349 Ga0501036_0038811
2350 Ga0501036_0094818
2351 Ga0501036_0134814
2352 Ga0501036_0167895
2353 Ga0501036_0241326
2354 Ga0501037_0008607
2355 Ga0501037_0134529
2356 Ga0501038_0011389
2357 Ga0501038_0027212
2358 Ga0501038_0096340
2359 Ga0501038_0125209
2360 Ga0501038_0153325
2361 Ga0501039_0017673
2362 Ga0501039_0038348
2363 Ga0501039_0050226
2364 Ga0501039_0058486
2365 Ga0501039_0134433
2366 Ga0501039_0167927
2367 Ga0501040_0087473
2368 Ga0501040_0104245
2369 Ga0501040_0208319
2370 Ga0501041_0027037
2371 Ga0501041_0039808
2372 Ga0501041_0072234
2373 Ga0501041_0081685
2374 Ga0501041_0100191
2375 Ga0501041_0115855
2376 Ga0501042_0000334
2377 Ga0501042_0026797
2378 Ga0501042_0041803
2379 Ga0501042_0066661
2380 Ga0501042_0078895
2381 Ga0501042_0084497
2382 Ga0501042_0086270
2383 Ga0501042_0118211
2384 Ga0501042_0134003
2385 Ga0501042_0212804
2386 Ga0501042_0293926
2387 Ga0501043_0097097
2388 Ga0501043_0118017
2389 Ga0501043_0286752
2390 Ga0501046_0019986
2391 Ga0501046_0022389
2392 Ga0501046_0142452
2393 Ga0501047_0293558
2394 Ga0501048_0002894
2395 Ga0501048_0003753
2396 Ga0501048_0060796
2397 Ga0501048_0123692
2398 Ga0501048_0160224
2399 Ga0501048_0224726
2400 Ga0501067_0004777
2401 Ga0501067_0008835
2402 Ga0501067_0016414
2403 Ga0501067_0029527
2404 Ga0501067_0035407
2405 Ga0501068_0102208
2406 Ga0501068_0244102
2407 Ga0501069_0006563
2408 Ga0501069_0010165
2409 Ga0501069_0044822
2410 Ga0501069_0064797
2411 Ga0501069_0090185
2412 Ga0501069_0112788
2413 Ga0501069_0156653
2414 Ga0501069_0192839
2415 Ga0501070_0012254
2416 Ga0501070_0029191
2417 Ga0501070_0038651
2418 Ga0501070_0129386
2419 Ga0501070_0214491
2420 Ga0501070_0318248
2421 Ga0501070_0382388
2422 Ga0501071_0000345
2423 Ga0501071_0000651
2424 Ga0501071_0004549
2425 Ga0501071_0023965
2426 Ga0501071_0030981
2427 Ga0501071_0065632
2428 Ga0501071_0092372
2429 Ga0501071_0157307
2430 Ga0501072_0004103
2431 Ga0501072_0011364
2432 Ga0501072_0055933
2433 Ga0501072_0098642
2434 Ga0501072_0131272
2435 Ga0501072_0131654
2436 Ga0501072_0140478
2437 Ga0501072_0257150
2438 Ga0501073_0091237
2439 Ga0501073_0140866
2440 Ga0501073_0183644
2441 Ga0501073_0236590
2442 Ga0501074_0000765
2443 Ga0501074_0025731
2444 Ga0501074_0043447
2445 Ga0501074_0046599
2446 Ga0501074_0048279
2447 Ga0501074_0062128
2448 Ga0501075_0005215
2449 Ga0501075_0006054
2450 Ga0501075_0029033
2451 Ga0501075_0038185
2452 Ga0501075_0050468
2453 Ga0501075_0076718
2454 Ga0501075_0088665
2455 Ga0501075_0253102
2456 Ga0501075_0317699
2457 Ga0501076_0001235
2458 Ga0501076_0001689
2459 Ga0501076_0006917
2460 Ga0501076_0027563
2461 Ga0501076_0042028
2462 Ga0501076_0097859
2463 Ga0501076_0164777
2464 Ga0501076_0204025
2465 Ga0501076_0396075
2466 Ga0501077_0002770
2467 Ga0501077_0002957
2468 Ga0501077_0003278
2469 Ga0501077_0004842
2470 Ga0501077_0022027
2471 Ga0501077_0030518
2472 Ga0501077_0043829
2473 Ga0501079_0001742
2474 Ga0501079_0014007
2475 Ga0501079_0015752
2476 Ga0501079_0047722
2477 Ga0501079_0064690
2478 Ga0501079_0072254
2479 Ga0501079_0073185
2480 Ga0501079_0129038
2481 Ga0501079_0208308
2482 Ga0501079_0242642
2483 Ga0501079_0292218
2484 Ga0501079_0323427
2485 Ga0501080_0001741
2486 Ga0501080_0014743
2487 Ga0501080_0021050
2488 Ga0501080_0100701
2489 Ga0501080_0432652
2490 Ga0501080_0480838
2491 Ga0501080_0540195
2492 Ga0501081_0011390
2493 Ga0501081_0033516
2494 Ga0501081_0066525
2495 Ga0501081_0090187
2496 Ga0501081_0478007
2497 Ga0501083_0002789
2498 Ga0501083_0106251
2499 Ga0501035_0055540
2500 Ga0501035_0057550
2501 Ga0501035_0144311
2502 Ga0501044_0064260
2503 Ga0501044_0266320
2504 Ga0501044_0354121
2505 Ga0501045_0000466
2506 Ga0501045_0021227
2507 Ga0501045_0024988
2508 Ga0501045_0070220
2509 Ga0501045_0153931
2510 Ga0501045_0194885
2511 Ga0501045_0210014
2512 Ga0501045_0258341
2513 nmdc:mga03n38_53242_c1
2514 nmdc:mga0yw44_24081_c1
2515 nmdc:mga0yw44_61198_c1
2516 nmdc:mga0yw44_89141_c1
2517 nmdc:mga06z11_121520_c1
2518 nmdc:mga07m45_153117_c1
2519 nmdc:mga05p37_138911_c1
2520 nmdc:mga05p37_163762_c1
2521 nmdc:mga05p37_197477_c1
2522 nmdc:mga05p37_205886_c1
2523 nmdc:mga05p37_24832_c1
2524 nmdc:mga05p37_301408_c1
2525 nmdc:mga05p37_325938_c1
2526 nmdc:mga05p37_36994_c1
2527 nmdc:mga05p37_397190_c1
2528 nmdc:mga05p37_524882_c1
2529 nmdc:mga05p37_778672_c1
2530 nmdc:mga05p37_7975_c1
2531 nmdc:mga09592_268488_c1
2532 nmdc:mga09592_313131_c1
2533 nmdc:mga0qj67_22002_c1
2534 nmdc:mga06r32_18303_c1
2535 nmdc:mga06r32_246323_c1
2536 nmdc:mga06r32_413387_c1
2537 nmdc:mga06r32_59154_c1
2538 nmdc:mga08y16_338472_c1
2539 nmdc:mga08y16_38551_c1
2540 nmdc:mga08y16_38628_c1
2541 nmdc:mga08y16_46381_c1
2542 nmdc:mga08y16_48743_c1
2543 nmdc:mga08y16_70469_c1
2544 nmdc:mga0n895_22483_c1
2545 nmdc:mga0n895_24597_c1
2546 nmdc:mga0n895_2766_c1
2547 nmdc:mga0n895_32662_c1
2548 nmdc:mga0n895_746978_c1
2549 nmdc:mga0rr50_2093_c1
2550 nmdc:mga0rr50_21347_c1
2551 nmdc:mga08x19_75551_c1
2552 nmdc:mga08x19_7697_c1
2553 nmdc:mga0a205_135556_c1
2554 nmdc:mga0a205_185775_c1
2555 nmdc:mga0a205_2963_c1
2556 nmdc:mga0a205_377473_c1
2557 nmdc:mga0a205_5364_c2
2558 nmdc:mga0a205_82072_c1
2559 Ga0495601_0000554
2560 Ga0495601_0005595
2561 Ga0495601_0054791
2562 Ga0495601_0277829
2563 Ga0495612_0062475
2564 Ga0495595_0004995
2565 Ga0495595_0135643
2566 Ga0495619_0011831
2567 Ga0495619_0037689
2568 Ga0495619_0119965
2569 Ga0501084_0001413
2570 Ga0501084_0005329
2571 Ga0501084_0011565
2572 Ga0501084_0012787
2573 Ga0501084_0025635
2574 Ga0501084_0054611
2575 Ga0501084_0232423
2576 Ga0590077_029194
2577 Ga0587082_013214
2578 Ga0501082_0004874
2579 Ga0501082_0041542
2580 Ga0501082_0055012
2581 Ga0501082_0091858
2582 Ga0501082_0125999
2583 Ga0501082_0290676
2584 Ga0466962_0000503
2585 Ga0466962_0002558
2586 Ga0466962_0019082
2587 Ga0466962_0104416
2588 Ga0466962_0115071
2589 Ga0530510_0001475
2590 Ga0530510_0008884
2591 Ga0530510_0065612
2592 Ga0530510_0134861
2593 Ga0530510_0383345
2594 Ga0530510_0416766

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

45

278

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4whx-assembly1.cif.gz_E x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate 0.9247 2 298
1i1l-assembly1.cif.gz_A crystal structure of eschelichia coli branched-chain amino acid aminotransferase. 0.9236 3 302
6nst-assembly1.cif.gz_F crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9181 2 302
6nst-assembly1.cif.gz_B crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9178 2 301
6nst-assembly1.cif.gz_A crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.917 2 302
ID Description Score Start End Superfamily
4whxA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.929 5 129 3.30.470.10
af_P0AB80_8_124_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9228 7 119 3.30.470.10
4whxA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.908 5 129 3.30.470.10
5ce8C01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9043 6 125 3.30.470.10
6gkrB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9029 137 290 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A832RNB9-F1-model_v4 Branched chain amino acid aminotransferase 0.9738 167 302 GO:0008483
GO:0046394
AF-A0A351XCR6-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9735 174 303 GO:0004084
GO:0005829
GO:0046394
AF-A0A3B9FPM8-F1-model_v4 Branched-chain amino acid aminotransferase 0.9699 172 289 GO:0005829
GO:0008483
GO:0008652
GO:0009082
AF-A0A2R6AU00-F1-model_v4 Branched-chain amino acid aminotransferase 0.968 162 274 GO:0008483
GO:0008652
GO:0009082
AF-A0A6J6ZAT6-F1-model_v4 Unannotated protein 0.9669 183 302 GO:0003824
GO:0046394

Map