F492705
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1297 | 407 | 2594 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300035691|Ga0373931_0214254|Ga0373931_0214254_41_1006 |
| Length | 321 |
| Sequence | MAAPLTDPEGDPMQATSKIWMNGELVDWADATVHVGAHGLHYGTGVFEGVRAYETPRGTAIFRLTEHFERLHASAKLLYMDLPYSVEQLKAATWDLLGANAIPECYIRPIAFFGYGQLGVATRSNPVEVAIMCWPWGTYLGEEALANGIRAKISSWRRIGSNTIPHAAKATGVYLNSMLAVSEANRAGYEEAILLSEDGGYVADGSGENIFIVRDGIIYTPDLSVSILSGITRDAVIQIAQDLGHRVVEKPIIRTDLYLADEIFMCGTAAEVTPIREIDDHVIGPPGPVTREIQQAYLDTVHGRSERWAQWLEYAPSRTGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 250 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 253 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 256 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 257 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 258 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 259 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 260 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 261 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 262 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 263 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 344 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 349 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 350 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 351 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 352 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 404 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 407 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1 |
| Nodule | 0 |
| Rhizoplane | 11.49 |
| Rhizosphere | 87.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373931_0214254 | 3300035691 | Bacteria | 1157 |
| 2 | JGI24751J29686_10035121 | 3300002459 | Unclassified | 1039 |
| 3 | Ga0070658_10003658 | 3300005327 | Bacteria | 12592 |
| 4 | Ga0070658_10030476 | 3300005327 | Bacteria | 4333 |
| 5 | Ga0070683_100000774 | 3300005329 | Bacteria | 23517 |
| 6 | Ga0070683_100045882 | 3300005329 | Bacteria | 4034 |
| 7 | Ga0070683_100051507 | 3300005329 | Bacteria | 3812 |
| 8 | Ga0070683_100112904 | 3300005329 | Bacteria | 2564 |
| 9 | Ga0070683_100126187 | 3300005329 | Bacteria | 2419 |
| 10 | Ga0070690_100045434 | 3300005330 | Bacteria | 2790 |
| 11 | Ga0070690_100121173 | 3300005330 | Bacteria | 1756 |
| 12 | Ga0070677_10066824 | 3300005333 | Bacteria | 1500 |
| 13 | Ga0068869_100026863 | 3300005334 | Bacteria | 4009 |
| 14 | Ga0068869_100162571 | 3300005334 | Bacteria | 1739 |
| 15 | Ga0070666_10047569 | 3300005335 | Bacteria | 2880 |
| 16 | Ga0070680_100102156 | 3300005336 | Bacteria | 2381 |
| 17 | Ga0070680_100153889 | 3300005336 | Bacteria | 1931 |
| 18 | Ga0070680_100241485 | 3300005336 | Bacteria | 1527 |
| 19 | Ga0070682_100008755 | 3300005337 | Bacteria | 5711 |
| 20 | Ga0070682_100019169 | 3300005337 | Bacteria | 4009 |
| 21 | Ga0070682_100135795 | 3300005337 | Bacteria | 1670 |
| 22 | Ga0070682_100175446 | 3300005337 | Bacteria | 1493 |
| 23 | Ga0070682_100332828 | 3300005337 | Bacteria | 1126 |
| 24 | Ga0068868_100010563 | 3300005338 | Bacteria | 6692 |
| 25 | Ga0068868_100025923 | 3300005338 | Bacteria | 4463 |
| 26 | Ga0068868_100054127 | 3300005338 | Bacteria | 3162 |
| 27 | Ga0070660_100004783 | 3300005339 | Bacteria | 9363 |
| 28 | Ga0070660_100049490 | 3300005339 | Bacteria | 3231 |
| 29 | Ga0070691_10019049 | 3300005341 | Bacteria | 3164 |
| 30 | Ga0070661_100009372 | 3300005344 | Bacteria | 6774 |
| 31 | Ga0070661_100015472 | 3300005344 | Bacteria | 5383 |
| 32 | Ga0070661_100058564 | 3300005344 | Bacteria | 2823 |
| 33 | Ga0070692_10042048 | 3300005345 | Bacteria | 2344 |
| 34 | Ga0070692_10088641 | 3300005345 | Bacteria | 1678 |
| 35 | Ga0070668_100002933 | 3300005347 | Bacteria | 12606 |
| 36 | Ga0070668_100226679 | 3300005347 | Bacteria | 1543 |
| 37 | Ga0070675_100141251 | 3300005354 | Bacteria | 2058 |
| 38 | Ga0070675_100244732 | 3300005354 | Bacteria | 1568 |
| 39 | Ga0070675_100255883 | 3300005354 | Bacteria | 1533 |
| 40 | Ga0070674_100014394 | 3300005356 | Bacteria | 4920 |
| 41 | Ga0070674_100021548 | 3300005356 | Bacteria | 4140 |
| 42 | Ga0070673_100072358 | 3300005364 | Bacteria | 2772 |
| 43 | Ga0070673_100256895 | 3300005364 | Bacteria | 1525 |
| 44 | Ga0070688_100010726 | 3300005365 | Bacteria | 5063 |
| 45 | Ga0070659_100005871 | 3300005366 | Bacteria | 8844 |
| 46 | Ga0070659_100185823 | 3300005366 | Bacteria | 1707 |
| 47 | Ga0070703_10032272 | 3300005406 | Bacteria | 1590 |
| 48 | Ga0070709_10001860 | 3300005434 | Bacteria | 11446 |
| 49 | Ga0070709_10010484 | 3300005434 | Bacteria | 5135 |
| 50 | Ga0070709_10044279 | 3300005434 | Bacteria | 2755 |
| 51 | Ga0070709_10059086 | 3300005434 | Bacteria | 2434 |
| 52 | Ga0070709_10223523 | 3300005434 | Bacteria | 1344 |
| 53 | Ga0070714_100008596 | 3300005435 | Bacteria | 7988 |
| 54 | Ga0070714_100018091 | 3300005435 | Bacteria | 5717 |
| 55 | Ga0070714_100023043 | 3300005435 | Bacteria | 5111 |
| 56 | Ga0070714_100028847 | 3300005435 | Bacteria | 4608 |
| 57 | Ga0070714_100033662 | 3300005435 | Bacteria | 4286 |
| 58 | Ga0070714_100046710 | 3300005435 | Bacteria | 3674 |
| 59 | Ga0070714_100064985 | 3300005435 | Bacteria | 3142 |
| 60 | Ga0070714_100068477 | 3300005435 | Bacteria | 3062 |
| 61 | Ga0070714_100124692 | 3300005435 | Bacteria | 2295 |
| 62 | Ga0070714_100194509 | 3300005435 | Bacteria | 1853 |
| 63 | Ga0070714_100279483 | 3300005435 | Bacteria | 1551 |
| 64 | Ga0070713_100004782 | 3300005436 | Bacteria | 9167 |
| 65 | Ga0070713_100007132 | 3300005436 | Bacteria | 7816 |
| 66 | Ga0070713_100054334 | 3300005436 | Bacteria | 3322 |
| 67 | Ga0070713_100090572 | 3300005436 | Bacteria | 2629 |
| 68 | Ga0070713_100154553 | 3300005436 | Bacteria | 2044 |
| 69 | Ga0070710_10002718 | 3300005437 | Bacteria | 8412 |
| 70 | Ga0070710_10011425 | 3300005437 | Bacteria | 4385 |
| 71 | Ga0070710_10036848 | 3300005437 | Bacteria | 2676 |
| 72 | Ga0070710_10084958 | 3300005437 | Bacteria | 1855 |
| 73 | Ga0070711_100001918 | 3300005439 | Bacteria | 11634 |
| 74 | Ga0070711_100034422 | 3300005439 | Bacteria | 3378 |
| 75 | Ga0070705_100017395 | 3300005440 | Bacteria | 3753 |
| 76 | Ga0070705_100023631 | 3300005440 | Bacteria | 3305 |
| 77 | Ga0070705_100037299 | 3300005440 | Bacteria | 2740 |
| 78 | Ga0070700_100000585 | 3300005441 | Bacteria | 18286 |
| 79 | Ga0070700_100030419 | 3300005441 | Bacteria | 3227 |
| 80 | Ga0070700_100041433 | 3300005441 | Bacteria | 2823 |
| 81 | Ga0070694_100019437 | 3300005444 | Bacteria | 4319 |
| 82 | Ga0070694_100045131 | 3300005444 | Bacteria | 2953 |
| 83 | Ga0070708_100146638 | 3300005445 | Bacteria | 2192 |
| 84 | Ga0070708_100224680 | 3300005445 | Bacteria | 1761 |
| 85 | Ga0070663_100014577 | 3300005455 | Bacteria | 5049 |
| 86 | Ga0070663_100035554 | 3300005455 | Bacteria | 3457 |
| 87 | Ga0070663_100099735 | 3300005455 | Bacteria | 2165 |
| 88 | Ga0070678_100006277 | 3300005456 | Bacteria | 6960 |
| 89 | Ga0070678_100009462 | 3300005456 | Bacteria | 5907 |
| 90 | Ga0070678_100115188 | 3300005456 | Bacteria | 2110 |
| 91 | Ga0070678_100177474 | 3300005456 | Bacteria | 1741 |
| 92 | Ga0070678_100187778 | 3300005456 | Bacteria | 1697 |
| 93 | Ga0070662_100070449 | 3300005457 | Bacteria | 2576 |
| 94 | Ga0070681_10017483 | 3300005458 | Bacteria | 7168 |
| 95 | Ga0070681_10032807 | 3300005458 | Bacteria | 5213 |
| 96 | Ga0070681_10073519 | 3300005458 | Bacteria | 3380 |
| 97 | Ga0070681_10160560 | 3300005458 | Bacteria | 2171 |
| 98 | Ga0068867_100021336 | 3300005459 | Bacteria | 4621 |
| 99 | Ga0068867_100115739 | 3300005459 | Bacteria | 2065 |
| 100 | Ga0068867_100140735 | 3300005459 | Bacteria | 1885 |
| 101 | Ga0070685_10018054 | 3300005466 | Bacteria | 3789 |
| 102 | Ga0070685_10033577 | 3300005466 | Bacteria | 2884 |
| 103 | Ga0070706_100275908 | 3300005467 | Unclassified | 1569 |
| 104 | Ga0070706_100336031 | 3300005467 | Bacteria | 1408 |
| 105 | Ga0070707_100006447 | 3300005468 | Bacteria | 10907 |
| 106 | Ga0070707_100009913 | 3300005468 | Bacteria | 8869 |
| 107 | Ga0070707_100022080 | 3300005468 | Bacteria | 6016 |
| 108 | Ga0070707_100098392 | 3300005468 | Bacteria | 2833 |
| 109 | Ga0070698_100004278 | 3300005471 | Bacteria | 15700 |
| 110 | Ga0070698_100006489 | 3300005471 | Bacteria | 12691 |
| 111 | Ga0070698_100031951 | 3300005471 | Bacteria | 5455 |
| 112 | Ga0070698_100058619 | 3300005471 | Bacteria | 3892 |
| 113 | Ga0070698_100113070 | 3300005471 | Bacteria | 2680 |
| 114 | Ga0070699_100016876 | 3300005518 | Bacteria | 6268 |
| 115 | Ga0070699_100044132 | 3300005518 | Bacteria | 3860 |
| 116 | Ga0070699_100139117 | 3300005518 | Unclassified | 2143 |
| 117 | Ga0070699_100193972 | 3300005518 | Bacteria | 1805 |
| 118 | Ga0070679_100047267 | 3300005530 | Bacteria | 4290 |
| 119 | Ga0070679_100059248 | 3300005530 | Bacteria | 3816 |
| 120 | Ga0070679_100096138 | 3300005530 | Bacteria | 2950 |
| 121 | Ga0070679_100164891 | 3300005530 | Bacteria | 2190 |
| 122 | Ga0070684_100040661 | 3300005535 | Bacteria | 4005 |
| 123 | Ga0070684_100069183 | 3300005535 | Bacteria | 3104 |
| 124 | Ga0070684_100185972 | 3300005535 | Bacteria | 1889 |
| 125 | Ga0070684_100274627 | 3300005535 | Archaea | 1543 |
| 126 | Ga0070684_100294484 | 3300005535 | Bacteria | 1488 |
| 127 | Ga0070684_100306604 | 3300005535 | Bacteria | 1458 |
| 128 | Ga0070684_100436309 | 3300005535 | Bacteria | 1210 |
| 129 | Ga0070697_100080435 | 3300005536 | Bacteria | 2685 |
| 130 | Ga0068853_100040446 | 3300005539 | Bacteria | 3978 |
| 131 | Ga0070672_100009205 | 3300005543 | Bacteria | 6799 |
| 132 | Ga0070686_100171003 | 3300005544 | Bacteria | 1537 |
| 133 | Ga0070695_100038311 | 3300005545 | Bacteria | 3024 |
| 134 | Ga0070695_100226097 | 3300005545 | Bacteria | 1350 |
| 135 | Ga0070696_100008104 | 3300005546 | Bacteria | 7023 |
| 136 | Ga0070696_100025255 | 3300005546 | Bacteria | 4038 |
| 137 | Ga0070696_100031997 | 3300005546 | Bacteria | 3607 |
| 138 | Ga0070693_100025169 | 3300005547 | Bacteria | 3200 |
| 139 | Ga0070693_100104452 | 3300005547 | Bacteria | 1732 |
| 140 | Ga0070665_100107934 | 3300005548 | Bacteria | 2786 |
| 141 | Ga0070704_100028416 | 3300005549 | Bacteria | 3721 |
| 142 | Ga0070704_100028899 | 3300005549 | Bacteria | 3695 |
| 143 | Ga0070704_100127172 | 3300005549 | Bacteria | 1968 |
| 144 | Ga0068855_100034573 | 3300005563 | Bacteria | 6026 |
| 145 | Ga0068855_100043411 | 3300005563 | Bacteria | 5326 |
| 146 | Ga0068855_100095791 | 3300005563 | Bacteria | 3420 |
| 147 | Ga0068855_100110135 | 3300005563 | Bacteria | 3161 |
| 148 | Ga0068855_100220385 | 3300005563 | Bacteria | 2128 |
| 149 | Ga0068855_100384975 | 3300005563 | Bacteria | 1539 |
| 150 | Ga0070664_100018643 | 3300005564 | Bacteria | 5706 |
| 151 | Ga0070664_100078034 | 3300005564 | Bacteria | 2848 |
| 152 | Ga0068857_100153604 | 3300005577 | Bacteria | 2086 |
| 153 | Ga0068854_100009762 | 3300005578 | Bacteria | 6206 |
| 154 | Ga0068854_100093205 | 3300005578 | Bacteria | 2244 |
| 155 | Ga0068854_100111336 | 3300005578 | Bacteria | 2065 |
| 156 | Ga0068856_100013458 | 3300005614 | Bacteria | 7918 |
| 157 | Ga0068856_100083049 | 3300005614 | Bacteria | 3180 |
| 158 | Ga0070702_100033046 | 3300005615 | Bacteria | 2842 |
| 159 | Ga0070702_100066532 | 3300005615 | Bacteria | 2114 |
| 160 | Ga0068852_100024571 | 3300005616 | Bacteria | 4871 |
| 161 | Ga0068852_100070996 | 3300005616 | Bacteria | 3057 |
| 162 | Ga0068852_100135678 | 3300005616 | Bacteria | 2272 |
| 163 | Ga0068852_100148015 | 3300005616 | Bacteria | 2180 |
| 164 | Ga0068859_100319165 | 3300005617 | Bacteria | 1647 |
| 165 | Ga0068864_100028758 | 3300005618 | Bacteria | 4702 |
| 166 | Ga0068866_10002892 | 3300005718 | Bacteria | 7071 |
| 167 | Ga0068866_10053305 | 3300005718 | Bacteria | 2068 |
| 168 | Ga0068861_100007204 | 3300005719 | Bacteria | 7621 |
| 169 | Ga0068861_100231391 | 3300005719 | Bacteria | 1568 |
| 170 | Ga0068851_10114441 | 3300005834 | Bacteria | 1443 |
| 171 | Ga0068870_10049929 | 3300005840 | Bacteria | 2209 |
| 172 | Ga0068870_10181578 | 3300005840 | Bacteria | 1263 |
| 173 | Ga0068863_100094656 | 3300005841 | Bacteria | 2835 |
| 174 | Ga0068860_100430797 | 3300005843 | Bacteria | 1309 |
| 175 | Ga0068862_100070729 | 3300005844 | Bacteria | 3012 |
| 176 | Ga0081455_10013758 | 3300005937 | Bacteria | 7965 |
| 177 | Ga0081455_10019652 | 3300005937 | Bacteria | 6380 |
| 178 | Ga0081455_10059022 | 3300005937 | Bacteria | 3242 |
| 179 | Ga0081538_10031057 | 3300005981 | Bacteria | 3612 |
| 180 | Ga0081540_1000597 | 3300005983 | Bacteria | 34582 |
| 181 | Ga0081540_1005959 | 3300005983 | Bacteria | 8987 |
| 182 | Ga0081539_10003619 | 3300005985 | Bacteria | 18654 |
| 183 | Ga0081539_10005000 | 3300005985 | Bacteria | 14006 |
| 184 | Ga0070717_10011631 | 3300006028 | Bacteria | 6693 |
| 185 | Ga0070717_10033584 | 3300006028 | Bacteria | 4139 |
| 186 | Ga0070717_10054551 | 3300006028 | Bacteria | 3296 |
| 187 | Ga0070717_10070574 | 3300006028 | Bacteria | 2912 |
| 188 | Ga0075365_10006259 | 3300006038 | Bacteria | 6528 |
| 189 | Ga0075365_10035777 | 3300006038 | Bacteria | 3214 |
| 190 | Ga0075365_10137153 | 3300006038 | Bacteria | 1696 |
| 191 | Ga0075364_10109831 | 3300006051 | Bacteria | 1839 |
| 192 | Ga0075432_10000332 | 3300006058 | Bacteria | 13442 |
| 193 | Ga0075432_10001329 | 3300006058 | Bacteria | 7995 |
| 194 | Ga0075432_10024473 | 3300006058 | Bacteria | 2069 |
| 195 | Ga0070715_10001470 | 3300006163 | Bacteria | 6850 |
| 196 | Ga0070715_10003672 | 3300006163 | Bacteria | 4932 |
| 197 | Ga0070715_10059989 | 3300006163 | Bacteria | 1666 |
| 198 | Ga0070716_100001368 | 3300006173 | Bacteria | 10821 |
| 199 | Ga0070716_100079406 | 3300006173 | Unclassified | 1954 |
| 200 | Ga0070716_100147844 | 3300006173 | Bacteria | 1507 |
| 201 | Ga0070716_100344156 | 3300006173 | Bacteria | 1053 |
| 202 | Ga0070712_100001138 | 3300006175 | Bacteria | 16036 |
| 203 | Ga0070712_100029238 | 3300006175 | Bacteria | 3693 |
| 204 | Ga0070712_100229158 | 3300006175 | Bacteria | 1474 |
| 205 | Ga0075367_10085053 | 3300006178 | Bacteria | 1919 |
| 206 | Ga0075367_10141973 | 3300006178 | Bacteria | 1488 |
| 207 | Ga0097621_100010388 | 3300006237 | Bacteria | 6810 |
| 208 | Ga0097621_100170002 | 3300006237 | Bacteria | 1878 |
| 209 | Ga0075370_10218896 | 3300006353 | Bacteria | 1125 |
| 210 | Ga0068871_100030111 | 3300006358 | Bacteria | 4271 |
| 211 | Ga0068871_100068935 | 3300006358 | Bacteria | 2904 |
| 212 | Ga0075428_100009696 | 3300006844 | Bacteria | 10693 |
| 213 | Ga0075428_100036032 | 3300006844 | Bacteria | 5452 |
| 214 | Ga0075428_100044438 | 3300006844 | Bacteria | 4882 |
| 215 | Ga0075428_100142312 | 3300006844 | Bacteria | 2607 |
| 216 | Ga0075430_100008351 | 3300006846 | Bacteria | 8745 |
| 217 | Ga0075431_100027269 | 3300006847 | Bacteria | 5860 |
| 218 | Ga0075431_100386162 | 3300006847 | Bacteria | 1403 |
| 219 | Ga0075433_10013900 | 3300006852 | Bacteria | 6565 |
| 220 | Ga0075433_10089730 | 3300006852 | Bacteria | 2717 |
| 221 | Ga0075433_10092652 | 3300006852 | Bacteria | 2673 |
| 222 | Ga0075433_10227718 | 3300006852 | Bacteria | 1655 |
| 223 | Ga0075433_10287798 | 3300006852 | Bacteria | 1455 |
| 224 | Ga0075434_100036513 | 3300006871 | Bacteria | 4861 |
| 225 | Ga0075434_100106446 | 3300006871 | Bacteria | 2814 |
| 226 | Ga0068865_100001835 | 3300006881 | Bacteria | 12477 |
| 227 | Ga0068865_100018132 | 3300006881 | Bacteria | 4538 |
| 228 | Ga0068865_100046319 | 3300006881 | Bacteria | 2983 |
| 229 | Ga0075436_100011959 | 3300006914 | Bacteria | 5952 |
| 230 | Ga0075436_100057244 | 3300006914 | Bacteria | 2692 |
| 231 | Ga0075436_100188110 | 3300006914 | Bacteria | 1460 |
| 232 | Ga0075436_100254221 | 3300006914 | Bacteria | 1252 |
| 233 | Ga0097620_100319174 | 3300006931 | Bacteria | 1647 |
| 234 | Ga0075435_100002282 | 3300007076 | Bacteria | 12660 |
| 235 | Ga0075435_100025481 | 3300007076 | Bacteria | 4605 |
| 236 | Ga0075435_100087062 | 3300007076 | Bacteria | 2573 |
| 237 | Ga0075435_100480217 | 3300007076 | Bacteria | 1073 |
| 238 | Ga0105240_10011692 | 3300009093 | Bacteria | 12197 |
| 239 | Ga0111539_10005072 | 3300009094 | Bacteria | 17105 |
| 240 | Ga0111539_10036613 | 3300009094 | Bacteria | 5931 |
| 241 | Ga0111539_10045392 | 3300009094 | Bacteria | 5260 |
| 242 | Ga0111539_10117251 | 3300009094 | Bacteria | 3121 |
| 243 | Ga0111539_10143875 | 3300009094 | Bacteria | 2791 |
| 244 | Ga0111539_10213295 | 3300009094 | Bacteria | 2249 |
| 245 | Ga0111539_10214954 | 3300009094 | Bacteria | 2240 |
| 246 | Ga0111539_10670610 | 3300009094 | Bacteria | 1207 |
| 247 | Ga0105245_10007371 | 3300009098 | Bacteria | 9631 |
| 248 | Ga0105245_10041637 | 3300009098 | Bacteria | 4094 |
| 249 | Ga0105245_10047068 | 3300009098 | Bacteria | 3855 |
| 250 | Ga0105245_10047207 | 3300009098 | Bacteria | 3849 |
| 251 | Ga0105245_10068259 | 3300009098 | Bacteria | 3221 |
| 252 | Ga0105245_10350710 | 3300009098 | Bacteria | 1462 |
| 253 | Ga0105245_10485917 | 3300009098 | Bacteria | 1249 |
| 254 | Ga0105247_10011467 | 3300009101 | Bacteria | 5344 |
| 255 | Ga0114129_10004388 | 3300009147 | Bacteria | 19896 |
| 256 | Ga0114129_10009732 | 3300009147 | Bacteria | 13710 |
| 257 | Ga0114129_10036404 | 3300009147 | Bacteria | 6950 |
| 258 | Ga0114129_10072326 | 3300009147 | Bacteria | 4807 |
| 259 | Ga0114129_10184776 | 3300009147 | Bacteria | 2834 |
| 260 | Ga0114129_10198243 | 3300009147 | Bacteria | 2721 |
| 261 | Ga0114129_10270128 | 3300009147 | Bacteria | 2275 |
| 262 | Ga0114129_10453998 | 3300009147 | Bacteria | 1681 |
| 263 | Ga0114129_10945521 | 3300009147 | Bacteria | 1089 |
| 264 | Ga0105243_10001405 | 3300009148 | Bacteria | 21294 |
| 265 | Ga0105243_10556611 | 3300009148 | Bacteria | 1097 |
| 266 | Ga0105241_10019866 | 3300009174 | Bacteria | 4958 |
| 267 | Ga0105241_10179491 | 3300009174 | Bacteria | 1755 |
| 268 | Ga0105241_10216866 | 3300009174 | Bacteria | 1606 |
| 269 | Ga0105242_10019300 | 3300009176 | Bacteria | 5340 |
| 270 | Ga0105242_10125923 | 3300009176 | Bacteria | 2205 |
| 271 | Ga0105242_10133654 | 3300009176 | Bacteria | 2145 |
| 272 | Ga0105242_10153941 | 3300009176 | Bacteria | 2007 |
| 273 | Ga0105242_10294888 | 3300009176 | Bacteria | 1478 |
| 274 | Ga0105248_10032129 | 3300009177 | Bacteria | 5866 |
| 275 | Ga0105248_10063386 | 3300009177 | Bacteria | 4149 |
| 276 | Ga0105248_10155316 | 3300009177 | Bacteria | 2582 |
| 277 | Ga0105237_10150826 | 3300009545 | Bacteria | 2321 |
| 278 | Ga0105237_10250661 | 3300009545 | Bacteria | 1772 |
| 279 | Ga0105237_10376803 | 3300009545 | Bacteria | 1424 |
| 280 | Ga0105238_10397857 | 3300009551 | Bacteria | 1370 |
| 281 | Ga0105238_10404397 | 3300009551 | Bacteria | 1359 |
| 282 | Ga0105249_10009749 | 3300009553 | Bacteria | 8414 |
| 283 | Ga0105249_10034744 | 3300009553 | Bacteria | 4568 |
| 284 | Ga0105030_102136 | 3300009987 | Bacteria | 1731 |
| 285 | Ga0105239_10017991 | 3300010375 | Bacteria | 7815 |
| 286 | Ga0105239_10036876 | 3300010375 | Bacteria | 5364 |
| 287 | Ga0105239_10040810 | 3300010375 | Bacteria | 5085 |
| 288 | Ga0105239_10078412 | 3300010375 | Bacteria | 3635 |
| 289 | Ga0105239_10091857 | 3300010375 | Bacteria | 3350 |
| 290 | Ga0105239_10095193 | 3300010375 | Bacteria | 3290 |
| 291 | Ga0105239_10448283 | 3300010375 | Bacteria | 1464 |
| 292 | Ga0105239_10694412 | 3300010375 | Bacteria | 1163 |
| 293 | Ga0105246_10024965 | 3300011119 | Bacteria | 3891 |
| 294 | Ga0105246_10056219 | 3300011119 | Bacteria | 2719 |
| 295 | Ga0105246_10186376 | 3300011119 | Bacteria | 1602 |
| 296 | Ga0157369_10029546 | 3300013105 | Bacteria | 6056 |
| 297 | Ga0157369_10035437 | 3300013105 | Bacteria | 5472 |
| 298 | Ga0157369_10299042 | 3300013105 | Bacteria | 1674 |
| 299 | Ga0157369_10313032 | 3300013105 | Bacteria | 1632 |
| 300 | Ga0157369_10461092 | 3300013105 | Bacteria | 1316 |
| 301 | Ga0157374_10031172 | 3300013296 | Bacteria | 4844 |
| 302 | Ga0157374_10032676 | 3300013296 | Bacteria | 4740 |
| 303 | Ga0157374_10236113 | 3300013296 | Bacteria | 1797 |
| 304 | Ga0157378_10075074 | 3300013297 | Bacteria | 3043 |
| 305 | Ga0163162_10019622 | 3300013306 | Bacteria | 6636 |
| 306 | Ga0163162_10043152 | 3300013306 | Bacteria | 4515 |
| 307 | Ga0163162_10069849 | 3300013306 | Bacteria | 3564 |
| 308 | Ga0163162_10119942 | 3300013306 | Bacteria | 2733 |
| 309 | Ga0163162_10281497 | 3300013306 | Bacteria | 1795 |
| 310 | Ga0163162_10688202 | 3300013306 | Bacteria | 1145 |
| 311 | Ga0157372_10005060 | 3300013307 | Bacteria | 14010 |
| 312 | Ga0157372_10018759 | 3300013307 | Bacteria | 7443 |
| 313 | Ga0157372_10033981 | 3300013307 | Bacteria | 5603 |
| 314 | Ga0157372_10064830 | 3300013307 | Bacteria | 4100 |
| 315 | Ga0157372_10115046 | 3300013307 | Bacteria | 3084 |
| 316 | Ga0157375_10012100 | 3300013308 | Bacteria | 7645 |
| 317 | Ga0157375_10093279 | 3300013308 | Bacteria | 3076 |
| 318 | Ga0157375_10143337 | 3300013308 | Bacteria | 2518 |
| 319 | Ga0157375_10161973 | 3300013308 | Bacteria | 2379 |
| 320 | Ga0157375_10180123 | 3300013308 | Bacteria | 2264 |
| 321 | Ga0157375_10208908 | 3300013308 | Bacteria | 2109 |
| 322 | Ga0163163_10041705 | 3300014325 | Bacteria | 4490 |
| 323 | Ga0163163_10043180 | 3300014325 | Bacteria | 4419 |
| 324 | Ga0163163_10059442 | 3300014325 | Bacteria | 3781 |
| 325 | Ga0163163_10532305 | 3300014325 | Bacteria | 1237 |
| 326 | Ga0157380_10008637 | 3300014326 | Bacteria | 7282 |
| 327 | Ga0157380_10017556 | 3300014326 | Bacteria | 5296 |
| 328 | Ga0157380_10054326 | 3300014326 | Bacteria | 3178 |
| 329 | Ga0157380_10085012 | 3300014326 | Bacteria | 2596 |
| 330 | Ga0182008_10001859 | 3300014497 | Bacteria | 13731 |
| 331 | Ga0157376_10011111 | 3300014969 | Bacteria | 6623 |
| 332 | Ga0157376_10017188 | 3300014969 | Bacteria | 5511 |
| 333 | Ga0157376_10058664 | 3300014969 | Bacteria | 3225 |
| 334 | Ga0157376_10075977 | 3300014969 | Bacteria | 2869 |
| 335 | Ga0157376_10174927 | 3300014969 | Bacteria | 1957 |
| 336 | Ga0182006_1033054 | 3300015261 | Bacteria | 2075 |
| 337 | Ga0182007_10034369 | 3300015262 | Bacteria | 1714 |
| 338 | Ga0182005_1050966 | 3300015265 | Bacteria | 1126 |
| 339 | Ga0163161_10040170 | 3300017792 | Bacteria | 3360 |
| 340 | Ga0163161_10111624 | 3300017792 | Bacteria | 2044 |
| 341 | Ga0163161_10140267 | 3300017792 | Bacteria | 1830 |
| 342 | Ga0197907_10473388 | 3300020069 | Bacteria | 1260 |
| 343 | Ga0197907_10923252 | 3300020069 | Bacteria | 1398 |
| 344 | Ga0206356_11213931 | 3300020070 | Bacteria | 1100 |
| 345 | Ga0206354_10223969 | 3300020081 | Bacteria | 2124 |
| 346 | Ga0206353_12050450 | 3300020082 | Bacteria | 1238 |
| 347 | Ga0213871_10004391 | 3300021441 | Bacteria | 2817 |
| 348 | Ga0207653_10000706 | 3300025885 | Bacteria | 11458 |
| 349 | Ga0207692_10127069 | 3300025898 | Bacteria | 1435 |
| 350 | Ga0207642_10025781 | 3300025899 | Bacteria | 2384 |
| 351 | Ga0207642_10026068 | 3300025899 | Bacteria | 2375 |
| 352 | Ga0207710_10207182 | 3300025900 | Bacteria | 970 |
| 353 | Ga0207688_10001506 | 3300025901 | Bacteria | 12234 |
| 354 | Ga0207688_10026312 | 3300025901 | Bacteria | 3198 |
| 355 | Ga0207688_10052556 | 3300025901 | Bacteria | 2283 |
| 356 | Ga0207647_10045802 | 3300025904 | Bacteria | 2727 |
| 357 | Ga0207647_10054407 | 3300025904 | Bacteria | 2462 |
| 358 | Ga0207685_10002057 | 3300025905 | Bacteria | 4492 |
| 359 | Ga0207699_10002792 | 3300025906 | Bacteria | 8248 |
| 360 | Ga0207699_10023391 | 3300025906 | Bacteria | 3363 |
| 361 | Ga0207699_10032535 | 3300025906 | Bacteria | 2939 |
| 362 | Ga0207699_10064178 | 3300025906 | Bacteria | 2221 |
| 363 | Ga0207645_10016793 | 3300025907 | Bacteria | 4840 |
| 364 | Ga0207643_10069377 | 3300025908 | Bacteria | 2026 |
| 365 | Ga0207705_10020114 | 3300025909 | Bacteria | 4775 |
| 366 | Ga0207684_10033327 | 3300025910 | Bacteria | 4380 |
| 367 | Ga0207684_10234760 | 3300025910 | Bacteria | 1582 |
| 368 | Ga0207654_10024116 | 3300025911 | Bacteria | 3267 |
| 369 | Ga0207654_10254875 | 3300025911 | Bacteria | 1178 |
| 370 | Ga0207707_10085241 | 3300025912 | Bacteria | 2760 |
| 371 | Ga0207707_10161486 | 3300025912 | Bacteria | 1959 |
| 372 | Ga0207707_10316358 | 3300025912 | Bacteria | 1348 |
| 373 | Ga0207695_10080080 | 3300025913 | Bacteria | 3309 |
| 374 | Ga0207693_10003257 | 3300025915 | Bacteria | 13922 |
| 375 | Ga0207693_10008247 | 3300025915 | Bacteria | 8529 |
| 376 | Ga0207693_10010065 | 3300025915 | Bacteria | 7682 |
| 377 | Ga0207693_10068551 | 3300025915 | Bacteria | 2776 |
| 378 | Ga0207693_10091164 | 3300025915 | Bacteria | 2390 |
| 379 | Ga0207693_10100409 | 3300025915 | Bacteria | 2269 |
| 380 | Ga0207693_10169112 | 3300025915 | Bacteria | 1721 |
| 381 | Ga0207693_10217090 | 3300025915 | Bacteria | 1503 |
| 382 | Ga0207663_10003189 | 3300025916 | Bacteria | 7975 |
| 383 | Ga0207663_10003420 | 3300025916 | Bacteria | 7765 |
| 384 | Ga0207663_10087960 | 3300025916 | Bacteria | 2053 |
| 385 | Ga0207663_10102018 | 3300025916 | Bacteria | 1929 |
| 386 | Ga0207660_10115663 | 3300025917 | Bacteria | 2025 |
| 387 | Ga0207660_10139842 | 3300025917 | Bacteria | 1850 |
| 388 | Ga0207660_10210502 | 3300025917 | Bacteria | 1522 |
| 389 | Ga0207657_10001257 | 3300025919 | Bacteria | 27123 |
| 390 | Ga0207657_10024586 | 3300025919 | Bacteria | 5572 |
| 391 | Ga0207657_10025289 | 3300025919 | Bacteria | 5478 |
| 392 | Ga0207649_10009762 | 3300025920 | Bacteria | 5257 |
| 393 | Ga0207649_10131834 | 3300025920 | Bacteria | 1699 |
| 394 | Ga0207646_10002821 | 3300025922 | Bacteria | 20211 |
| 395 | Ga0207646_10003492 | 3300025922 | Bacteria | 17724 |
| 396 | Ga0207646_10021147 | 3300025922 | Bacteria | 6019 |
| 397 | Ga0207646_10335145 | 3300025922 | Bacteria | 1367 |
| 398 | Ga0207681_10011318 | 3300025923 | Bacteria | 5480 |
| 399 | Ga0207694_10099520 | 3300025924 | Bacteria | 2303 |
| 400 | Ga0207694_10150501 | 3300025924 | Bacteria | 1875 |
| 401 | Ga0207694_10279167 | 3300025924 | Bacteria | 1372 |
| 402 | Ga0207694_10323004 | 3300025924 | Bacteria | 1274 |
| 403 | Ga0207650_10272570 | 3300025925 | Bacteria | 1376 |
| 404 | Ga0207687_10036563 | 3300025927 | Bacteria | 3345 |
| 405 | Ga0207687_10060860 | 3300025927 | Bacteria | 2665 |
| 406 | Ga0207687_10236544 | 3300025927 | Bacteria | 1445 |
| 407 | Ga0207687_10341845 | 3300025927 | Bacteria | 1217 |
| 408 | Ga0207700_10000022 | 3300025928 | Bacteria | 166246 |
| 409 | Ga0207700_10031795 | 3300025928 | Bacteria | 3754 |
| 410 | Ga0207700_10044203 | 3300025928 | Bacteria | 3277 |
| 411 | Ga0207700_10113520 | 3300025928 | Bacteria | 2184 |
| 412 | Ga0207700_10122007 | 3300025928 | Bacteria | 2115 |
| 413 | Ga0207664_10013893 | 3300025929 | Bacteria | 5800 |
| 414 | Ga0207664_10030458 | 3300025929 | Bacteria | 4120 |
| 415 | Ga0207664_10045034 | 3300025929 | Bacteria | 3458 |
| 416 | Ga0207664_10067147 | 3300025929 | Bacteria | 2877 |
| 417 | Ga0207664_10077608 | 3300025929 | Bacteria | 2692 |
| 418 | Ga0207664_10090520 | 3300025929 | Bacteria | 2507 |
| 419 | Ga0207664_10164354 | 3300025929 | Bacteria | 1895 |
| 420 | Ga0207664_10199161 | 3300025929 | Bacteria | 1728 |
| 421 | Ga0207664_10247947 | 3300025929 | Bacteria | 1553 |
| 422 | Ga0207664_10255617 | 3300025929 | Bacteria | 1531 |
| 423 | Ga0207644_10096116 | 3300025931 | Bacteria | 2217 |
| 424 | Ga0207644_10170350 | 3300025931 | Bacteria | 1699 |
| 425 | Ga0207644_10193021 | 3300025931 | Bacteria | 1602 |
| 426 | Ga0207644_10287266 | 3300025931 | Bacteria | 1322 |
| 427 | Ga0207690_10021692 | 3300025932 | Bacteria | 3986 |
| 428 | Ga0207706_10110601 | 3300025933 | Bacteria | 2417 |
| 429 | Ga0207686_10171676 | 3300025934 | Bacteria | 1530 |
| 430 | Ga0207709_10074230 | 3300025935 | Bacteria | 2170 |
| 431 | Ga0207670_10118608 | 3300025936 | Bacteria | 1919 |
| 432 | Ga0207670_10132922 | 3300025936 | Bacteria | 1825 |
| 433 | Ga0207669_10041985 | 3300025937 | Bacteria | 2666 |
| 434 | Ga0207669_10349636 | 3300025937 | Bacteria | 1141 |
| 435 | Ga0207704_10008355 | 3300025938 | Bacteria | 4945 |
| 436 | Ga0207665_10001486 | 3300025939 | Bacteria | 15761 |
| 437 | Ga0207665_10005029 | 3300025939 | Bacteria | 8826 |
| 438 | Ga0207665_10006641 | 3300025939 | Bacteria | 7676 |
| 439 | Ga0207665_10017861 | 3300025939 | Bacteria | 4663 |
| 440 | Ga0207665_10017917 | 3300025939 | Bacteria | 4655 |
| 441 | Ga0207665_10127788 | 3300025939 | Unclassified | 1801 |
| 442 | Ga0207665_10174995 | 3300025939 | Bacteria | 1552 |
| 443 | Ga0207691_10039931 | 3300025940 | Bacteria | 4340 |
| 444 | Ga0207691_10267028 | 3300025940 | Bacteria | 1474 |
| 445 | Ga0207689_10079904 | 3300025942 | Bacteria | 2688 |
| 446 | Ga0207661_10000280 | 3300025944 | Bacteria | 32687 |
| 447 | Ga0207661_10014641 | 3300025944 | Bacteria | 5753 |
| 448 | Ga0207661_10025935 | 3300025944 | Bacteria | 4461 |
| 449 | Ga0207661_10365157 | 3300025944 | Bacteria | 1304 |
| 450 | Ga0207679_10006334 | 3300025945 | Bacteria | 7477 |
| 451 | Ga0207667_10083314 | 3300025949 | Bacteria | 3311 |
| 452 | Ga0207667_10114568 | 3300025949 | Bacteria | 2779 |
| 453 | Ga0207651_10169266 | 3300025960 | Bacteria | 1721 |
| 454 | Ga0207712_10003543 | 3300025961 | Bacteria | 9848 |
| 455 | Ga0207712_10061376 | 3300025961 | Bacteria | 2668 |
| 456 | Ga0207712_10124700 | 3300025961 | Bacteria | 1954 |
| 457 | Ga0207668_10015573 | 3300025972 | Bacteria | 4726 |
| 458 | Ga0207640_10100837 | 3300025981 | Bacteria | 2024 |
| 459 | Ga0207640_10110630 | 3300025981 | Bacteria | 1946 |
| 460 | Ga0207677_10271905 | 3300026023 | Bacteria | 1387 |
| 461 | Ga0207639_10136895 | 3300026041 | Bacteria | 2035 |
| 462 | Ga0207639_10385523 | 3300026041 | Bacteria | 1259 |
| 463 | Ga0207678_10010336 | 3300026067 | Bacteria | 8192 |
| 464 | Ga0207678_10013645 | 3300026067 | Bacteria | 7135 |
| 465 | Ga0207678_10054124 | 3300026067 | Bacteria | 3456 |
| 466 | Ga0207708_10001375 | 3300026075 | Bacteria | 18308 |
| 467 | Ga0207708_10015219 | 3300026075 | Bacteria | 5767 |
| 468 | Ga0207708_10027151 | 3300026075 | Bacteria | 4335 |
| 469 | Ga0207708_10063147 | 3300026075 | Bacteria | 2830 |
| 470 | Ga0207702_10011811 | 3300026078 | Bacteria | 7271 |
| 471 | Ga0207702_10029366 | 3300026078 | Bacteria | 4575 |
| 472 | Ga0207702_10060850 | 3300026078 | Bacteria | 3219 |
| 473 | Ga0207702_10105371 | 3300026078 | Bacteria | 2497 |
| 474 | Ga0207702_10263209 | 3300026078 | Bacteria | 1624 |
| 475 | Ga0207648_10001234 | 3300026089 | Bacteria | 28707 |
| 476 | Ga0207648_10003746 | 3300026089 | Bacteria | 15895 |
| 477 | Ga0207648_10083381 | 3300026089 | Bacteria | 2788 |
| 478 | Ga0207648_10137097 | 3300026089 | Bacteria | 2156 |
| 479 | Ga0207648_10316633 | 3300026089 | Bacteria | 1401 |
| 480 | Ga0207676_10023155 | 3300026095 | Bacteria | 4577 |
| 481 | Ga0207674_10017679 | 3300026116 | Bacteria | 7772 |
| 482 | Ga0207674_10286795 | 3300026116 | Bacteria | 1595 |
| 483 | Ga0207675_100003926 | 3300026118 | Bacteria | 14437 |
| 484 | Ga0207675_100059947 | 3300026118 | Bacteria | 3552 |
| 485 | Ga0207675_100243088 | 3300026118 | Bacteria | 1740 |
| 486 | Ga0207683_10000251 | 3300026121 | Bacteria | 47816 |
| 487 | Ga0207683_10004522 | 3300026121 | Bacteria | 11992 |
| 488 | Ga0207683_10059248 | 3300026121 | Bacteria | 3364 |
| 489 | Ga0207683_10192608 | 3300026121 | Bacteria | 1851 |
| 490 | Ga0207683_10388632 | 3300026121 | Bacteria | 1283 |
| 491 | Ga0207683_10409490 | 3300026121 | Bacteria | 1248 |
| 492 | Ga0207698_10010071 | 3300026142 | Bacteria | 6055 |
| 493 | Ga0207698_10147529 | 3300026142 | Bacteria | 2037 |
| 494 | Ga0207698_10265814 | 3300026142 | Bacteria | 1578 |
| 495 | Ga0207428_10002020 | 3300027907 | Bacteria | 20504 |
| 496 | Ga0207428_10002720 | 3300027907 | Bacteria | 17619 |
| 497 | Ga0207428_10008046 | 3300027907 | Bacteria | 9568 |
| 498 | Ga0207428_10046911 | 3300027907 | Bacteria | 3472 |
| 499 | Ga0207428_10122285 | 3300027907 | Bacteria | 1996 |
| 500 | Ga0268266_10022986 | 3300028379 | Bacteria | 5306 |
| 501 | Ga0268265_10059734 | 3300028380 | Bacteria | 2919 |
| 502 | Ga0268264_10266914 | 3300028381 | Bacteria | 1597 |
| 503 | Ga0265326_10006881 | 3300028558 | Bacteria | 3505 |
| 504 | Ga0265319_1002220 | 3300028563 | Bacteria | 10804 |
| 505 | Ga0265319_1005651 | 3300028563 | Bacteria | 5946 |
| 506 | Ga0265319_1064900 | 3300028563 | Bacteria | 1178 |
| 507 | Ga0265334_10004270 | 3300028573 | Bacteria | 6377 |
| 508 | Ga0265334_10011991 | 3300028573 | Bacteria | 3642 |
| 509 | Ga0265318_10000734 | 3300028577 | Bacteria | 21933 |
| 510 | Ga0265318_10002508 | 3300028577 | Bacteria | 9755 |
| 511 | Ga0265318_10037984 | 3300028577 | Bacteria | 1843 |
| 512 | Ga0265318_10110827 | 3300028577 | Bacteria | 1009 |
| 513 | Ga0265322_10010859 | 3300028654 | Bacteria | 2644 |
| 514 | Ga0265336_10001597 | 3300028666 | Bacteria | 10143 |
| 515 | Ga0265338_10004917 | 3300028800 | Bacteria | 17768 |
| 516 | Ga0265338_10005528 | 3300028800 | Bacteria | 16465 |
| 517 | Ga0265338_10009821 | 3300028800 | Bacteria | 11344 |
| 518 | Ga0265338_10021214 | 3300028800 | Bacteria | 6784 |
| 519 | Ga0265338_10098710 | 3300028800 | Bacteria | 2388 |
| 520 | Ga0265338_10107088 | 3300028800 | Bacteria | 2262 |
| 521 | Ga0265324_10012360 | 3300029957 | Bacteria | 3220 |
| 522 | Ga0265330_10000357 | 3300031235 | Bacteria | 32239 |
| 523 | Ga0265332_10039483 | 3300031238 | Bacteria | 2045 |
| 524 | Ga0265328_10000859 | 3300031239 | Bacteria | 14109 |
| 525 | Ga0265320_10004932 | 3300031240 | Bacteria | 8659 |
| 526 | Ga0265320_10048374 | 3300031240 | Bacteria | 2076 |
| 527 | Ga0265325_10000216 | 3300031241 | Bacteria | 41023 |
| 528 | Ga0265325_10118839 | 3300031241 | Bacteria | 1276 |
| 529 | Ga0265329_10002217 | 3300031242 | Bacteria | 8969 |
| 530 | Ga0265340_10000237 | 3300031247 | Bacteria | 28491 |
| 531 | Ga0265340_10010730 | 3300031247 | Bacteria | 4894 |
| 532 | Ga0265339_10002326 | 3300031249 | Bacteria | 13687 |
| 533 | Ga0265339_10027575 | 3300031249 | Bacteria | 3239 |
| 534 | Ga0265331_10005322 | 3300031250 | Bacteria | 7786 |
| 535 | Ga0265327_10019761 | 3300031251 | Bacteria | 4128 |
| 536 | Ga0265327_10032651 | 3300031251 | Bacteria | 2910 |
| 537 | Ga0265316_10005904 | 3300031344 | Bacteria | 11799 |
| 538 | Ga0265316_10011799 | 3300031344 | Bacteria | 7861 |
| 539 | Ga0307408_100231576 | 3300031548 | Bacteria | 1513 |
| 540 | Ga0307408_100357173 | 3300031548 | Bacteria | 1242 |
| 541 | Ga0265313_10002904 | 3300031595 | Bacteria | 14329 |
| 542 | Ga0265313_10007879 | 3300031595 | Bacteria | 7180 |
| 543 | Ga0265314_10006843 | 3300031711 | Bacteria | 9990 |
| 544 | Ga0265314_10017052 | 3300031711 | Bacteria | 5711 |
| 545 | Ga0265342_10015601 | 3300031712 | Bacteria | 4993 |
| 546 | Ga0307405_10038398 | 3300031731 | Bacteria | 2886 |
| 547 | Ga0307413_10030326 | 3300031824 | Bacteria | 3037 |
| 548 | Ga0307413_10060944 | 3300031824 | Bacteria | 2325 |
| 549 | Ga0307410_10043797 | 3300031852 | Bacteria | 2968 |
| 550 | Ga0307406_10002364 | 3300031901 | Bacteria | 10263 |
| 551 | Ga0307407_10003046 | 3300031903 | Bacteria | 6750 |
| 552 | Ga0307412_10038336 | 3300031911 | Bacteria | 3085 |
| 553 | Ga0307409_100007208 | 3300031995 | Bacteria | 6629 |
| 554 | Ga0307409_100166387 | 3300031995 | Bacteria | 1935 |
| 555 | Ga0307416_100013284 | 3300032002 | Bacteria | 5591 |
| 556 | Ga0307416_100058645 | 3300032002 | Bacteria | 3123 |
| 557 | Ga0307416_100270197 | 3300032002 | Bacteria | 1669 |
| 558 | Ga0307414_10155165 | 3300032004 | Bacteria | 1811 |
| 559 | Ga0307411_10088562 | 3300032005 | Bacteria | 2153 |
| 560 | Ga0307415_100336566 | 3300032126 | Bacteria | 1265 |
| 561 | Ga0373948_0003010 | 3300034817 | Bacteria | 2550 |
| 562 | Ga0373938_0006132 | 3300034957 | Bacteria | 2066 |
| 563 | Ga0373938_0036267 | 3300034957 | Bacteria | 1078 |
| 564 | Ga0373929_0002076 | 3300035085 | Bacteria | 3726 |
| 565 | Ga0373934_0014655 | 3300035086 | Bacteria | 2971 |
| 566 | Ga0373940_0000644 | 3300035088 | Bacteria | 5587 |
| 567 | Ga0373949_0001669 | 3300035090 | Bacteria | 6193 |
| 568 | Ga0373949_0007979 | 3300035090 | Bacteria | 2318 |
| 569 | Ga0373949_0015264 | 3300035090 | Bacteria | 1714 |
| 570 | Ga0373951_0018291 | 3300035091 | Bacteria | 1591 |
| 571 | Ga0373932_0000955 | 3300035112 | Bacteria | 8467 |
| 572 | Ga0373932_0045477 | 3300035112 | Bacteria | 1284 |
| 573 | Ga0373939_0004436 | 3300035114 | Bacteria | 3318 |
| 574 | Ga0373939_0014911 | 3300035114 | Bacteria | 2024 |
| 575 | Ga0373941_0058134 | 3300035115 | Bacteria | 1250 |
| 576 | Ga0373945_0118856 | 3300035116 | Bacteria | 1049 |
| 577 | Ga0373960_0004625 | 3300035121 | Bacteria | 3159 |
| 578 | Ga0373960_0058424 | 3300035121 | Bacteria | 1163 |
| 579 | Ga0373943_0007478 | 3300035170 | Bacteria | 4908 |
| 580 | Ga0373943_0140320 | 3300035170 | Bacteria | 1301 |
| 581 | Ga0373946_0017487 | 3300035171 | Bacteria | 2744 |
| 582 | Ga0373942_0007780 | 3300035207 | Bacteria | 2491 |
| 583 | Ga0373962_0004080 | 3300035242 | Bacteria | 3521 |
| 584 | Ga0373924_0051072 | 3300035410 | Bacteria | 1714 |
| 585 | Ga0373931_0056119 | 3300035691 | Bacteria | 2109 |
| 586 | Ga0373931_0063264 | 3300035691 | Bacteria | 1999 |
| 587 | Ga0373931_0083920 | 3300035691 | Bacteria | 1763 |
| 588 | Ga0373935_0052177 | 3300035692 | Bacteria | 2599 |
| 589 | Ga0373947_0003496 | 3300035725 | Bacteria | 9281 |
| 590 | Ga0373947_0005768 | 3300035725 | Bacteria | 7223 |
| 591 | Ga0373937_0001174 | 3300036401 | Bacteria | 22003 |
| 592 | Ga0373937_0086770 | 3300036401 | Bacteria | 2896 |
| 593 | Ga0373925_0007274 | 3300037068 | Bacteria | 8091 |
| 594 | Ga0373925_0054682 | 3300037068 | Bacteria | 2986 |
| 595 | Ga0373925_0154791 | 3300037068 | Bacteria | 1802 |
| 596 | Ga0395899_0004656 | 3300037312 | Bacteria | 10700 |
| 597 | Ga0395899_0009584 | 3300037312 | Bacteria | 7434 |
| 598 | Ga0395899_0039313 | 3300037312 | Bacteria | 3541 |
| 599 | Ga0395899_0040595 | 3300037312 | Bacteria | 3480 |
| 600 | Ga0395899_0256010 | 3300037312 | Unclassified | 1199 |
| 601 | Ga0395899_0329452 | 3300037312 | Unclassified | 1026 |
| 602 | Ga0395900_0003839 | 3300037418 | Bacteria | 16059 |
| 603 | Ga0395900_0010317 | 3300037418 | Bacteria | 9557 |
| 604 | Ga0395900_0016318 | 3300037418 | Bacteria | 7570 |
| 605 | Ga0395900_0029564 | 3300037418 | Bacteria | 5621 |
| 606 | Ga0395900_0040183 | 3300037418 | Bacteria | 4821 |
| 607 | Ga0395900_0047824 | 3300037418 | Bacteria | 4406 |
| 608 | Ga0395900_0072142 | 3300037418 | Bacteria | 3550 |
| 609 | Ga0395900_0090962 | 3300037418 | Bacteria | 3136 |
| 610 | Ga0395900_0107597 | 3300037418 | Bacteria | 2864 |
| 611 | Ga0395900_0124571 | 3300037418 | Bacteria | 2643 |
| 612 | Ga0395900_0161682 | 3300037418 | Bacteria | 2283 |
| 613 | Ga0395900_0286256 | 3300037418 | Bacteria | 1638 |
| 614 | Ga0395900_0381048 | 3300037418 | Bacteria | 1378 |
| 615 | Ga0395898_0001992 | 3300037466 | Bacteria | 25640 |
| 616 | Ga0395898_0003792 | 3300037466 | Bacteria | 16730 |
| 617 | Ga0395898_0010547 | 3300037466 | Bacteria | 9649 |
| 618 | Ga0395898_0012146 | 3300037466 | Bacteria | 8912 |
| 619 | Ga0395898_0025341 | 3300037466 | Bacteria | 5977 |
| 620 | Ga0395898_0028380 | 3300037466 | Bacteria | 5608 |
| 621 | Ga0395898_0031218 | 3300037466 | Bacteria | 5325 |
| 622 | Ga0395898_0039909 | 3300037466 | Bacteria | 4644 |
| 623 | Ga0395898_0049122 | 3300037466 | Bacteria | 4135 |
| 624 | Ga0395898_0052956 | 3300037466 | Bacteria | 3964 |
| 625 | Ga0395898_0060052 | 3300037466 | Bacteria | 3696 |
| 626 | Ga0395898_0092161 | 3300037466 | Bacteria | 2914 |
| 627 | Ga0395898_0120938 | 3300037466 | Bacteria | 2509 |
| 628 | Ga0395898_0127139 | 3300037466 | Bacteria | 2442 |
| 629 | Ga0395898_0164050 | 3300037466 | Bacteria | 2125 |
| 630 | Ga0395898_0281374 | 3300037466 | Bacteria | 1587 |
| 631 | Ga0395898_0334224 | 3300037466 | Bacteria | 1445 |
| 632 | Ga0395898_0422703 | 3300037466 | Bacteria | 1270 |
| 633 | Ga0395905_0001840 | 3300037471 | Bacteria | 24490 |
| 634 | Ga0395905_0002457 | 3300037471 | Bacteria | 20517 |
| 635 | Ga0395905_0003930 | 3300037471 | Bacteria | 15641 |
| 636 | Ga0395905_0004274 | 3300037471 | Bacteria | 14898 |
| 637 | Ga0395905_0006320 | 3300037471 | Bacteria | 11941 |
| 638 | Ga0395905_0012444 | 3300037471 | Bacteria | 8191 |
| 639 | Ga0395905_0017732 | 3300037471 | Bacteria | 6760 |
| 640 | Ga0395905_0062762 | 3300037471 | Bacteria | 3475 |
| 641 | Ga0395905_0099246 | 3300037471 | Bacteria | 2735 |
| 642 | Ga0395905_0194691 | 3300037471 | Bacteria | 1901 |
| 643 | Ga0395901_0001040 | 3300038443 | Bacteria | 29939 |
| 644 | Ga0395901_0004438 | 3300038443 | Bacteria | 14157 |
| 645 | Ga0395901_0004875 | 3300038443 | Bacteria | 13543 |
| 646 | Ga0395901_0011218 | 3300038443 | Bacteria | 9078 |
| 647 | Ga0395901_0023144 | 3300038443 | Bacteria | 6369 |
| 648 | Ga0395901_0028999 | 3300038443 | Bacteria | 5693 |
| 649 | Ga0395901_0059447 | 3300038443 | Bacteria | 3976 |
| 650 | Ga0395901_0082444 | 3300038443 | Bacteria | 3360 |
| 651 | Ga0395901_0096979 | 3300038443 | Bacteria | 3090 |
| 652 | Ga0395901_0099884 | 3300038443 | Bacteria | 3043 |
| 653 | Ga0395901_0112710 | 3300038443 | Bacteria | 2856 |
| 654 | Ga0395901_0119723 | 3300038443 | Bacteria | 2766 |
| 655 | Ga0395901_0121275 | 3300038443 | Bacteria | 2748 |
| 656 | Ga0395901_0155774 | 3300038443 | Bacteria | 2399 |
| 657 | Ga0395901_0172347 | 3300038443 | Unclassified | 2270 |
| 658 | Ga0395901_0201991 | 3300038443 | Bacteria | 2083 |
| 659 | Ga0395901_0281511 | 3300038443 | Bacteria | 1728 |
| 660 | Ga0395901_0348272 | 3300038443 | Bacteria | 1529 |
| 661 | Ga0395901_0723937 | 3300038443 | Bacteria | 990 |
| 662 | Ga0436360_0528706 | 3300039438 | Bacteria | 4291 |
| 663 | Ga0436363_1061005 | 3300039450 | Bacteria | 2484 |
| 664 | Ga0439461_0008683 | 3300041410 | Bacteria | 1827 |
| 665 | Ga0451798_0460313 | 3300041458 | Bacteria | 957 |
| 666 | Ga0451807_2328025 | 3300041486 | Bacteria | 1653 |
| 667 | Ga0451807_2624602 | 3300041486 | Bacteria | 2915 |
| 668 | Ga0451845_0113855 | 3300041501 | Bacteria | 1599 |
| 669 | Ga0451847_0267910 | 3300041503 | Bacteria | 2801 |
| 670 | Ga0451853_0756687 | 3300041512 | Bacteria | 2805 |
| 671 | Ga0451853_2766170 | 3300041512 | Bacteria | 2084 |
| 672 | Ga0451853_2770344 | 3300041512 | Bacteria | 1020 |
| 673 | Ga0439433_0003811 | 3300041999 | Bacteria | 3242 |
| 674 | Ga0439448_0013879 | 3300042005 | Bacteria | 2425 |
| 675 | Ga0439451_029938 | 3300042009 | Bacteria | 1095 |
| 676 | Ga0439462_0001422 | 3300042015 | Bacteria | 5326 |
| 677 | Ga0450907_005687 | 3300042146 | Bacteria | 2099 |
| 678 | Ga0439446_0037476 | 3300042156 | Bacteria | 1419 |
| 679 | Ga0439434_0045506 | 3300042435 | Bacteria | 1353 |
| 680 | Ga0439460_0039973 | 3300042461 | Bacteria | 1373 |
| 681 | Ga0450918_006509 | 3300042531 | Bacteria | 2080 |
| 682 | Ga0466969_0023324 | 3300044656 | Bacteria | 3189 |
| 683 | Ga0466965_0033661 | 3300044683 | Bacteria | 2505 |
| 684 | Ga0466966_0056185 | 3300044684 | Bacteria | 2491 |
| 685 | Ga0466961_0018479 | 3300044693 | Bacteria | 4484 |
| 686 | Ga0466961_0037920 | 3300044693 | Bacteria | 3091 |
| 687 | Ga0466961_0096049 | 3300044693 | Bacteria | 1869 |
| 688 | Ga0466961_0254389 | 3300044693 | Bacteria | 1078 |
| 689 | Ga0466963_0000672 | 3300044694 | Bacteria | 16561 |
| 690 | Ga0466963_0001044 | 3300044694 | Bacteria | 14373 |
| 691 | Ga0466963_0001079 | 3300044694 | Bacteria | 14245 |
| 692 | Ga0466963_0001179 | 3300044694 | Bacteria | 13728 |
| 693 | Ga0466963_0003075 | 3300044694 | Bacteria | 9453 |
| 694 | Ga0466963_0003353 | 3300044694 | Bacteria | 9146 |
| 695 | Ga0466963_0003990 | 3300044694 | Bacteria | 8536 |
| 696 | Ga0466963_0006135 | 3300044694 | Bacteria | 7089 |
| 697 | Ga0466963_0017626 | 3300044694 | Bacteria | 4453 |
| 698 | Ga0466963_0073664 | 3300044694 | Bacteria | 2302 |
| 699 | Ga0466963_0123202 | 3300044694 | Bacteria | 1785 |
| 700 | Ga0466964_0002042 | 3300044706 | Bacteria | 7098 |
| 701 | Ga0466964_0237508 | 3300044706 | Bacteria | 892 |
| 702 | Ga0466971_0001056 | 3300044719 | Bacteria | 11415 |
| 703 | Ga0466971_0005889 | 3300044719 | Bacteria | 5336 |
| 704 | Ga0466971_0006326 | 3300044719 | Bacteria | 5139 |
| 705 | Ga0466971_0018405 | 3300044719 | Bacteria | 3094 |
| 706 | Ga0466971_0140155 | 3300044719 | Bacteria | 1126 |
| 707 | Ga0466971_0148192 | 3300044719 | Bacteria | 1095 |
| 708 | Ga0466968_0001252 | 3300044735 | Bacteria | 9028 |
| 709 | Ga0466968_0049138 | 3300044735 | Bacteria | 1796 |
| 710 | Ga0466968_0064230 | 3300044735 | Bacteria | 1587 |
| 711 | Ga0466968_0068194 | 3300044735 | Bacteria | 1544 |
| 712 | Ga0466968_0087490 | 3300044735 | Bacteria | 1376 |
| 713 | Ga0466970_0097685 | 3300044765 | Bacteria | 1598 |
| 714 | Ga0466970_0302357 | 3300044765 | Bacteria | 902 |
| 715 | Ga0466957_0002132 | 3300044842 | Bacteria | 10588 |
| 716 | Ga0466957_0010016 | 3300044842 | Bacteria | 5426 |
| 717 | Ga0466957_0040303 | 3300044842 | Bacteria | 2820 |
| 718 | Ga0466957_0040881 | 3300044842 | Bacteria | 2802 |
| 719 | Ga0466957_0113371 | 3300044842 | Bacteria | 1722 |
| 720 | Ga0466957_0128244 | 3300044842 | Bacteria | 1623 |
| 721 | Ga0466957_0151658 | 3300044842 | Bacteria | 1499 |
| 722 | Ga0466957_0397770 | 3300044842 | Bacteria | 942 |
| 723 | Ga0466960_0002057 | 3300044901 | Bacteria | 7475 |
| 724 | Ga0466960_0002959 | 3300044901 | Bacteria | 6474 |
| 725 | Ga0466959_0007586 | 3300045049 | Bacteria | 7625 |
| 726 | Ga0466959_0018754 | 3300045049 | Bacteria | 5081 |
| 727 | Ga0466959_0089047 | 3300045049 | Bacteria | 2218 |
| 728 | Ga0451576_0047599 | 3300045051 | Bacteria | 4507 |
| 729 | Ga0466958_0001285 | 3300045836 | Bacteria | 11795 |
| 730 | Ga0466958_0004493 | 3300045836 | Bacteria | 7367 |
| 731 | Ga0466958_0004496 | 3300045836 | Bacteria | 7365 |
| 732 | Ga0466958_0019532 | 3300045836 | Bacteria | 3945 |
| 733 | Ga0466958_0026927 | 3300045836 | Bacteria | 3399 |
| 734 | Ga0466958_0039301 | 3300045836 | Bacteria | 2842 |
| 735 | Ga0466958_0071587 | 3300045836 | Bacteria | 2123 |
| 736 | Ga0466958_0084413 | 3300045836 | Bacteria | 1958 |
| 737 | Ga0466967_0000042 | 3300045976 | Bacteria | 45895 |
| 738 | Ga0466967_0000848 | 3300045976 | Bacteria | 16203 |
| 739 | Ga0466967_0003680 | 3300045976 | Bacteria | 10091 |
| 740 | Ga0466967_0008701 | 3300045976 | Bacteria | 7471 |
| 741 | Ga0466967_0011597 | 3300045976 | Bacteria | 6689 |
| 742 | Ga0466967_0016125 | 3300045976 | Bacteria | 5881 |
| 743 | Ga0466967_0019905 | 3300045976 | Bacteria | 5410 |
| 744 | Ga0466967_0024949 | 3300045976 | Bacteria | 4922 |
| 745 | Ga0466967_0040079 | 3300045976 | Bacteria | 4031 |
| 746 | Ga0466967_0061596 | 3300045976 | Bacteria | 3329 |
| 747 | Ga0466967_0064811 | 3300045976 | Bacteria | 3250 |
| 748 | Ga0466967_0171842 | 3300045976 | Bacteria | 2040 |
| 749 | Ga0466967_0264766 | 3300045976 | Bacteria | 1645 |
| 750 | Ga0466967_0273653 | 3300045976 | Bacteria | 1619 |
| 751 | Ga0466967_0322689 | 3300045976 | Bacteria | 1489 |
| 752 | Ga0466967_0477265 | 3300045976 | Bacteria | 1221 |
| 753 | Ga0495592_0001132 | 3300046454 | Bacteria | 18548 |
| 754 | Ga0495592_0001599 | 3300046454 | Bacteria | 15848 |
| 755 | Ga0495592_0077191 | 3300046454 | Bacteria | 2415 |
| 756 | Ga0495603_0004184 | 3300046455 | Bacteria | 8595 |
| 757 | Ga0495603_0018464 | 3300046455 | Bacteria | 4219 |
| 758 | Ga0495603_0028450 | 3300046455 | Bacteria | 3371 |
| 759 | Ga0495629_0002118 | 3300046459 | Bacteria | 15381 |
| 760 | Ga0495629_0020884 | 3300046459 | Bacteria | 4673 |
| 761 | Ga0495629_0120417 | 3300046459 | Bacteria | 1828 |
| 762 | Ga0495629_0292885 | 3300046459 | Bacteria | 1115 |
| 763 | Ga0495641_0002878 | 3300046461 | Bacteria | 13289 |
| 764 | Ga0495641_0011445 | 3300046461 | Bacteria | 5053 |
| 765 | Ga0495641_0034128 | 3300046461 | Bacteria | 2407 |
| 766 | Ga0495641_0098897 | 3300046461 | Bacteria | 1302 |
| 767 | Ga0495641_0100468 | 3300046461 | Bacteria | 1291 |
| 768 | Ga0495651_0000916 | 3300046462 | Bacteria | 22898 |
| 769 | Ga0495651_0031492 | 3300046462 | Bacteria | 4136 |
| 770 | Ga0495651_0258577 | 3300046462 | Bacteria | 1185 |
| 771 | Ga0495653_0009559 | 3300046463 | Bacteria | 7931 |
| 772 | Ga0495653_0229089 | 3300046463 | Bacteria | 1245 |
| 773 | Ga0495582_0058745 | 3300046473 | Bacteria | 2121 |
| 774 | Ga0495582_0243668 | 3300046473 | Bacteria | 1030 |
| 775 | Ga0495605_0110224 | 3300046474 | Bacteria | 1257 |
| 776 | Ga0495639_0002041 | 3300046475 | Bacteria | 8932 |
| 777 | Ga0495639_0016589 | 3300046475 | Bacteria | 3199 |
| 778 | Ga0495639_0064124 | 3300046475 | Bacteria | 1688 |
| 779 | Ga0495662_0008706 | 3300046476 | Bacteria | 4987 |
| 780 | Ga0495584_0034095 | 3300046491 | Bacteria | 2576 |
| 781 | Ga0495584_0105757 | 3300046491 | Bacteria | 1423 |
| 782 | Ga0495585_0089347 | 3300046492 | Bacteria | 1661 |
| 783 | Ga0495594_0001425 | 3300046499 | Bacteria | 12405 |
| 784 | Ga0495594_0179974 | 3300046499 | Bacteria | 1203 |
| 785 | Ga0495596_0023239 | 3300046500 | Bacteria | 2517 |
| 786 | Ga0495608_0006157 | 3300046511 | Bacteria | 8518 |
| 787 | Ga0495608_0029181 | 3300046511 | Bacteria | 3745 |
| 788 | Ga0495608_0031911 | 3300046511 | Bacteria | 3560 |
| 789 | Ga0495608_0048065 | 3300046511 | Bacteria | 2836 |
| 790 | Ga0495618_0025325 | 3300046514 | Bacteria | 3681 |
| 791 | Ga0495618_0112438 | 3300046514 | Bacteria | 1744 |
| 792 | Ga0495618_0236731 | 3300046514 | Bacteria | 1148 |
| 793 | Ga0495628_0001072 | 3300046516 | Bacteria | 25092 |
| 794 | Ga0495628_0042328 | 3300046516 | Bacteria | 3632 |
| 795 | Ga0495628_0299499 | 3300046516 | Bacteria | 1190 |
| 796 | Ga0495630_0036488 | 3300046517 | Bacteria | 3675 |
| 797 | Ga0495630_0046601 | 3300046517 | Bacteria | 3240 |
| 798 | Ga0495630_0125164 | 3300046517 | Bacteria | 1950 |
| 799 | Ga0495637_0053884 | 3300046520 | Bacteria | 1673 |
| 800 | Ga0495644_0004757 | 3300046523 | Bacteria | 5332 |
| 801 | Ga0495644_0030662 | 3300046523 | Bacteria | 2031 |
| 802 | Ga0495663_0021388 | 3300046525 | Bacteria | 1863 |
| 803 | Ga0495663_0070241 | 3300046525 | Bacteria | 1114 |
| 804 | Ga0495666_0001079 | 3300046526 | Bacteria | 12994 |
| 805 | Ga0495652_0007424 | 3300046529 | Bacteria | 10107 |
| 806 | Ga0495652_0030241 | 3300046529 | Bacteria | 4751 |
| 807 | Ga0495652_0084008 | 3300046529 | Bacteria | 2619 |
| 808 | Ga0495652_0187569 | 3300046529 | Bacteria | 1581 |
| 809 | Ga0495665_0015929 | 3300046531 | Bacteria | 4050 |
| 810 | Ga0495665_0212414 | 3300046531 | Bacteria | 1001 |
| 811 | Ga0495640_0014512 | 3300046533 | Bacteria | 5956 |
| 812 | Ga0495640_0052261 | 3300046533 | Bacteria | 2807 |
| 813 | Ga0495640_0283578 | 3300046533 | Bacteria | 1031 |
| 814 | Ga0495586_0100307 | 3300046535 | Bacteria | 1606 |
| 815 | Ga0495587_0000220 | 3300046536 | Bacteria | 42423 |
| 816 | Ga0495587_0068241 | 3300046536 | Bacteria | 2071 |
| 817 | Ga0495645_0000706 | 3300046543 | Bacteria | 22898 |
| 818 | Ga0495645_0060499 | 3300046543 | Bacteria | 2745 |
| 819 | Ga0495645_0245434 | 3300046543 | Bacteria | 1192 |
| 820 | Ga0495667_0004967 | 3300046559 | Bacteria | 8995 |
| 821 | Ga0495667_0116125 | 3300046559 | Bacteria | 1729 |
| 822 | Ga0495656_0059590 | 3300046615 | Bacteria | 1661 |
| 823 | Ga0495634_0058991 | 3300046642 | Bacteria | 2557 |
| 824 | Ga0495634_0085572 | 3300046642 | Bacteria | 2054 |
| 825 | Ga0495611_0015632 | 3300046648 | Bacteria | 3245 |
| 826 | Ga0495635_0015500 | 3300046663 | Bacteria | 5327 |
| 827 | Ga0495588_0002838 | 3300046674 | Bacteria | 7454 |
| 828 | Ga0495657_0009407 | 3300046675 | Bacteria | 7408 |
| 829 | Ga0495657_0027543 | 3300046675 | Bacteria | 4009 |
| 830 | Ga0495599_0000198 | 3300046678 | Bacteria | 40015 |
| 831 | Ga0495599_0015183 | 3300046678 | Bacteria | 4776 |
| 832 | Ga0495623_0000661 | 3300046679 | Bacteria | 22896 |
| 833 | Ga0495623_0038013 | 3300046679 | Bacteria | 3078 |
| 834 | Ga0495646_0002159 | 3300046680 | Bacteria | 11967 |
| 835 | Ga0495646_0070564 | 3300046680 | Bacteria | 2057 |
| 836 | Ga0495647_0000355 | 3300046681 | Bacteria | 12961 |
| 837 | Ga0495647_0040272 | 3300046681 | Bacteria | 1775 |
| 838 | Ga0495658_0025460 | 3300046683 | Bacteria | 3162 |
| 839 | Ga0495658_0055767 | 3300046683 | Bacteria | 2252 |
| 840 | Ga0495658_0177299 | 3300046683 | Bacteria | 1321 |
| 841 | Ga0495613_0004573 | 3300046689 | Bacteria | 10377 |
| 842 | Ga0495613_0015395 | 3300046689 | Bacteria | 5687 |
| 843 | Ga0495613_0081136 | 3300046689 | Bacteria | 2357 |
| 844 | Ga0495613_0115401 | 3300046689 | Bacteria | 1933 |
| 845 | Ga0495613_0138467 | 3300046689 | Bacteria | 1740 |
| 846 | Ga0495624_0004708 | 3300046690 | Bacteria | 9933 |
| 847 | Ga0495624_0011872 | 3300046690 | Bacteria | 5974 |
| 848 | Ga0495624_0024328 | 3300046690 | Bacteria | 3986 |
| 849 | Ga0495624_0208791 | 3300046690 | Bacteria | 1185 |
| 850 | Ga0495589_0140399 | 3300046794 | Bacteria | 1157 |
| 851 | Ga0495600_0069418 | 3300046809 | Bacteria | 2303 |
| 852 | Ga0495660_0114815 | 3300046810 | Bacteria | 1370 |
| 853 | Ga0495581_0003685 | 3300047315 | Bacteria | 8821 |
| 854 | Ga0495581_0111033 | 3300047315 | Bacteria | 1594 |
| 855 | Ga0495581_0111804 | 3300047315 | Bacteria | 1588 |
| 856 | Ga0495604_0006194 | 3300047317 | Bacteria | 9496 |
| 857 | Ga0495604_0031702 | 3300047317 | Bacteria | 4192 |
| 858 | Ga0495636_0080833 | 3300047318 | Bacteria | 1399 |
| 859 | Ga0495674_0034864 | 3300047319 | Bacteria | 4546 |
| 860 | Ga0495674_0054512 | 3300047319 | Bacteria | 3511 |
| 861 | Ga0495674_0078767 | 3300047319 | Bacteria | 2831 |
| 862 | Ga0495674_0128173 | 3300047319 | Bacteria | 2139 |
| 863 | Ga0495674_0153284 | 3300047319 | Bacteria | 1931 |
| 864 | Ga0495674_0289316 | 3300047319 | Bacteria | 1340 |
| 865 | Ga0495674_0429559 | 3300047319 | Bacteria | 1063 |
| 866 | Ga0495676_0001358 | 3300047321 | Bacteria | 21032 |
| 867 | Ga0495676_0031321 | 3300047321 | Bacteria | 4500 |
| 868 | Ga0495676_0031322 | 3300047321 | Bacteria | 4500 |
| 869 | Ga0495676_0048611 | 3300047321 | Bacteria | 3418 |
| 870 | Ga0495676_0142571 | 3300047321 | Bacteria | 1715 |
| 871 | Ga0495676_0185727 | 3300047321 | Bacteria | 1454 |
| 872 | Ga0495680_0011878 | 3300047322 | Bacteria | 7684 |
| 873 | Ga0495680_0026376 | 3300047322 | Bacteria | 4790 |
| 874 | Ga0495680_0034667 | 3300047322 | Bacteria | 4072 |
| 875 | Ga0495680_0127759 | 3300047322 | Bacteria | 1870 |
| 876 | Ga0495680_0163869 | 3300047322 | Bacteria | 1613 |
| 877 | Ga0495675_0000397 | 3300047444 | Bacteria | 30165 |
| 878 | Ga0495675_0105317 | 3300047444 | Bacteria | 1763 |
| 879 | Ga0495675_0158855 | 3300047444 | Bacteria | 1393 |
| 880 | Ga0495685_047960 | 3300047447 | Bacteria | 1452 |
| 881 | Ga0495684_0016118 | 3300047471 | Bacteria | 5753 |
| 882 | Ga0495684_0024665 | 3300047471 | Bacteria | 4628 |
| 883 | Ga0495684_0064227 | 3300047471 | Bacteria | 2790 |
| 884 | Ga0495684_0073314 | 3300047471 | Bacteria | 2601 |
| 885 | Ga0495684_0075107 | 3300047471 | Bacteria | 2568 |
| 886 | Ga0495593_0001535 | 3300047673 | Bacteria | 13598 |
| 887 | Ga0495602_0001486 | 3300048088 | Bacteria | 23321 |
| 888 | Ga0495602_0044851 | 3300048088 | Bacteria | 4006 |
| 889 | Ga0495602_0115103 | 3300048088 | Bacteria | 2176 |
| 890 | Ga0495602_0125837 | 3300048088 | Bacteria | 2053 |
| 891 | Ga0495602_0249292 | 3300048088 | Bacteria | 1324 |
| 892 | Ga0495614_0000987 | 3300048089 | Bacteria | 12107 |
| 893 | Ga0496100_0010344 | 3300048903 | Bacteria | 5278 |
| 894 | Ga0496100_0029865 | 3300048903 | Bacteria | 3376 |
| 895 | Ga0496100_0038773 | 3300048903 | Bacteria | 3021 |
| 896 | Ga0496100_0045026 | 3300048903 | Bacteria | 2830 |
| 897 | Ga0496100_0083975 | 3300048903 | Bacteria | 2158 |
| 898 | Ga0496100_0090101 | 3300048903 | Bacteria | 2091 |
| 899 | Ga0496100_0100524 | 3300048903 | Bacteria | 1992 |
| 900 | Ga0496100_0131184 | 3300048903 | Bacteria | 1765 |
| 901 | Ga0496101_0010547 | 3300048904 | Bacteria | 6103 |
| 902 | Ga0496101_0012903 | 3300048904 | Bacteria | 5588 |
| 903 | Ga0496101_0022317 | 3300048904 | Bacteria | 4356 |
| 904 | Ga0496101_0027709 | 3300048904 | Bacteria | 3949 |
| 905 | Ga0496101_0063533 | 3300048904 | Bacteria | 2687 |
| 906 | Ga0496101_0073160 | 3300048904 | Bacteria | 2517 |
| 907 | Ga0496102_0025643 | 3300048905 | Bacteria | 5251 |
| 908 | Ga0496102_0049220 | 3300048905 | Bacteria | 3834 |
| 909 | Ga0496102_0050992 | 3300048905 | Bacteria | 3770 |
| 910 | Ga0496102_0089814 | 3300048905 | Bacteria | 2843 |
| 911 | Ga0496102_0218890 | 3300048905 | Bacteria | 1794 |
| 912 | Ga0496102_0227781 | 3300048905 | Bacteria | 1757 |
| 913 | Ga0496102_0251161 | 3300048905 | Bacteria | 1668 |
| 914 | Ga0496102_0256087 | 3300048905 | Bacteria | 1650 |
| 915 | Ga0496103_0004207 | 3300048906 | Bacteria | 8734 |
| 916 | Ga0496103_0022803 | 3300048906 | Bacteria | 3771 |
| 917 | Ga0496103_0043306 | 3300048906 | Bacteria | 2771 |
| 918 | Ga0496103_0193363 | 3300048906 | Bacteria | 1308 |
| 919 | Ga0496104_0000762 | 3300048907 | Bacteria | 27565 |
| 920 | Ga0496104_0003786 | 3300048907 | Bacteria | 13090 |
| 921 | Ga0496104_0007525 | 3300048907 | Bacteria | 9627 |
| 922 | Ga0496104_0014730 | 3300048907 | Bacteria | 7068 |
| 923 | Ga0496104_0015022 | 3300048907 | Bacteria | 7005 |
| 924 | Ga0496104_0022899 | 3300048907 | Bacteria | 5739 |
| 925 | Ga0496104_0063201 | 3300048907 | Bacteria | 3511 |
| 926 | Ga0496104_0063735 | 3300048907 | Bacteria | 3496 |
| 927 | Ga0496104_0086782 | 3300048907 | Bacteria | 2987 |
| 928 | Ga0496104_0098329 | 3300048907 | Bacteria | 2801 |
| 929 | Ga0496104_0132758 | 3300048907 | Bacteria | 2392 |
| 930 | Ga0496104_0335493 | 3300048907 | Bacteria | 1425 |
| 931 | Ga0496105_0001467 | 3300048908 | Bacteria | 16639 |
| 932 | Ga0496105_0002609 | 3300048908 | Bacteria | 13113 |
| 933 | Ga0496105_0003350 | 3300048908 | Bacteria | 11842 |
| 934 | Ga0496105_0012928 | 3300048908 | Bacteria | 6616 |
| 935 | Ga0496105_0016790 | 3300048908 | Bacteria | 5851 |
| 936 | Ga0496105_0041895 | 3300048908 | Bacteria | 3774 |
| 937 | Ga0496105_0147054 | 3300048908 | Bacteria | 1937 |
| 938 | Ga0496105_0159547 | 3300048908 | Bacteria | 1851 |
| 939 | Ga0496105_0189692 | 3300048908 | Bacteria | 1681 |
| 940 | Ga0496105_0229584 | 3300048908 | Bacteria | 1508 |
| 941 | Ga0496106_0003112 | 3300048909 | Bacteria | 12393 |
| 942 | Ga0496106_0013604 | 3300048909 | Bacteria | 6007 |
| 943 | Ga0496106_0075564 | 3300048909 | Bacteria | 2581 |
| 944 | Ga0496106_0160191 | 3300048909 | Bacteria | 1779 |
| 945 | Ga0496106_0217619 | 3300048909 | Bacteria | 1522 |
| 946 | Ga0496106_0248262 | 3300048909 | Bacteria | 1422 |
| 947 | Ga0496106_0255901 | 3300048909 | Bacteria | 1400 |
| 948 | Ga0496106_0269936 | 3300048909 | Bacteria | 1362 |
| 949 | Ga0496107_0008446 | 3300048910 | Bacteria | 7128 |
| 950 | Ga0496107_0059860 | 3300048910 | Bacteria | 2756 |
| 951 | Ga0496107_0093113 | 3300048910 | Bacteria | 2203 |
| 952 | Ga0496107_0110318 | 3300048910 | Bacteria | 2022 |
| 953 | Ga0496107_0138004 | 3300048910 | Bacteria | 1802 |
| 954 | Ga0496108_0007426 | 3300048911 | Bacteria | 8885 |
| 955 | Ga0496108_0016964 | 3300048911 | Bacteria | 5951 |
| 956 | Ga0496108_0019890 | 3300048911 | Bacteria | 5514 |
| 957 | Ga0496108_0020099 | 3300048911 | Bacteria | 5487 |
| 958 | Ga0496108_0020363 | 3300048911 | Bacteria | 5452 |
| 959 | Ga0496108_0031526 | 3300048911 | Bacteria | 4399 |
| 960 | Ga0496108_0037674 | 3300048911 | Bacteria | 4029 |
| 961 | Ga0496108_0039838 | 3300048911 | Bacteria | 3916 |
| 962 | Ga0496108_0257854 | 3300048911 | Bacteria | 1517 |
| 963 | Ga0496108_0295160 | 3300048911 | Bacteria | 1411 |
| 964 | Ga0496109_0001678 | 3300048912 | Bacteria | 18457 |
| 965 | Ga0496109_0005820 | 3300048912 | Bacteria | 10327 |
| 966 | Ga0496109_0006942 | 3300048912 | Bacteria | 9557 |
| 967 | Ga0496109_0007370 | 3300048912 | Bacteria | 9309 |
| 968 | Ga0496109_0021042 | 3300048912 | Bacteria | 5768 |
| 969 | Ga0496109_0027321 | 3300048912 | Bacteria | 5094 |
| 970 | Ga0496109_0028172 | 3300048912 | Bacteria | 5022 |
| 971 | Ga0496109_0031372 | 3300048912 | Bacteria | 4768 |
| 972 | Ga0496109_0040527 | 3300048912 | Bacteria | 4218 |
| 973 | Ga0496109_0047246 | 3300048912 | Bacteria | 3913 |
| 974 | Ga0496109_0053762 | 3300048912 | Bacteria | 3674 |
| 975 | Ga0496109_0062147 | 3300048912 | Bacteria | 3415 |
| 976 | Ga0496109_0084681 | 3300048912 | Bacteria | 2925 |
| 977 | Ga0496109_0085770 | 3300048912 | Bacteria | 2907 |
| 978 | Ga0496109_0105382 | 3300048912 | Bacteria | 2618 |
| 979 | Ga0496109_0171550 | 3300048912 | Bacteria | 2035 |
| 980 | Ga0496109_0266110 | 3300048912 | Bacteria | 1615 |
| 981 | Ga0496109_0297703 | 3300048912 | Bacteria | 1521 |
| 982 | Ga0496109_0479104 | 3300048912 | Bacteria | 1175 |
| 983 | Ga0496110_0004864 | 3300048913 | Bacteria | 10479 |
| 984 | Ga0496110_0009208 | 3300048913 | Bacteria | 7979 |
| 985 | Ga0496110_0011684 | 3300048913 | Bacteria | 7202 |
| 986 | Ga0496110_0016094 | 3300048913 | Bacteria | 6237 |
| 987 | Ga0496110_0020715 | 3300048913 | Bacteria | 5553 |
| 988 | Ga0496110_0133261 | 3300048913 | Bacteria | 2244 |
| 989 | Ga0496110_0188400 | 3300048913 | Bacteria | 1873 |
| 990 | Ga0496111_0000087 | 3300048914 | Bacteria | 38807 |
| 991 | Ga0496111_0000169 | 3300048914 | Bacteria | 29654 |
| 992 | Ga0496111_0005536 | 3300048914 | Bacteria | 8113 |
| 993 | Ga0496111_0015572 | 3300048914 | Bacteria | 5224 |
| 994 | Ga0496111_0023702 | 3300048914 | Bacteria | 4311 |
| 995 | Ga0496111_0049805 | 3300048914 | Bacteria | 3020 |
| 996 | Ga0496111_0186932 | 3300048914 | Bacteria | 1540 |
| 997 | Ga0496111_0245787 | 3300048914 | Archaea | 1328 |
| 998 | Ga0496112_0000851 | 3300048915 | Bacteria | 21796 |
| 999 | Ga0496112_0002074 | 3300048915 | Bacteria | 15896 |
| 1000 | Ga0496112_0008833 | 3300048915 | Bacteria | 9040 |
| 1001 | Ga0496112_0010874 | 3300048915 | Bacteria | 8283 |
| 1002 | Ga0496112_0012920 | 3300048915 | Bacteria | 7692 |
| 1003 | Ga0496112_0016175 | 3300048915 | Bacteria | 6979 |
| 1004 | Ga0496112_0033998 | 3300048915 | Bacteria | 4960 |
| 1005 | Ga0496112_0070960 | 3300048915 | Bacteria | 3442 |
| 1006 | Ga0496112_0094249 | 3300048915 | Bacteria | 2964 |
| 1007 | Ga0496112_0125551 | 3300048915 | Bacteria | 2537 |
| 1008 | Ga0496112_0138402 | 3300048915 | Bacteria | 2404 |
| 1009 | Ga0496112_0248630 | 3300048915 | Bacteria | 1730 |
| 1010 | Ga0496112_0283648 | 3300048915 | Bacteria | 1603 |
| 1011 | Ga0496112_0307198 | 3300048915 | Bacteria | 1531 |
| 1012 | Ga0496112_0366714 | 3300048915 | Bacteria | 1382 |
| 1013 | Ga0496113_0000554 | 3300048916 | Bacteria | 18536 |
| 1014 | Ga0496113_0010767 | 3300048916 | Bacteria | 6064 |
| 1015 | Ga0496113_0030604 | 3300048916 | Bacteria | 3898 |
| 1016 | Ga0496113_0068576 | 3300048916 | Bacteria | 2692 |
| 1017 | Ga0496113_0106403 | 3300048916 | Bacteria | 2179 |
| 1018 | Ga0496113_0145685 | 3300048916 | Bacteria | 1866 |
| 1019 | Ga0496113_0357363 | 3300048916 | Bacteria | 1172 |
| 1020 | Ga0496114_0001058 | 3300048917 | Bacteria | 20693 |
| 1021 | Ga0496114_0009256 | 3300048917 | Bacteria | 7812 |
| 1022 | Ga0496114_0015503 | 3300048917 | Bacteria | 6127 |
| 1023 | Ga0496114_0019602 | 3300048917 | Bacteria | 5481 |
| 1024 | Ga0496114_0032440 | 3300048917 | Bacteria | 4299 |
| 1025 | Ga0496114_0085386 | 3300048917 | Bacteria | 2673 |
| 1026 | Ga0496114_0103239 | 3300048917 | Bacteria | 2437 |
| 1027 | Ga0496114_0116692 | 3300048917 | Bacteria | 2292 |
| 1028 | Ga0496114_0214923 | 3300048917 | Bacteria | 1687 |
| 1029 | Ga0496114_0263675 | 3300048917 | Bacteria | 1517 |
| 1030 | Ga0496114_0305446 | 3300048917 | Bacteria | 1405 |
| 1031 | Ga0496114_0320328 | 3300048917 | Bacteria | 1370 |
| 1032 | Ga0496114_0467677 | 3300048917 | Bacteria | 1116 |
| 1033 | Ga0496115_0006404 | 3300048918 | Bacteria | 8625 |
| 1034 | Ga0496115_0007807 | 3300048918 | Bacteria | 7888 |
| 1035 | Ga0496115_0029957 | 3300048918 | Bacteria | 4279 |
| 1036 | Ga0496115_0037556 | 3300048918 | Bacteria | 3838 |
| 1037 | Ga0496115_0082577 | 3300048918 | Bacteria | 2618 |
| 1038 | Ga0496115_0111812 | 3300048918 | Bacteria | 2244 |
| 1039 | Ga0501031_0004099 | 3300049568 | Bacteria | 9412 |
| 1040 | Ga0501031_0012817 | 3300049568 | Bacteria | 5477 |
| 1041 | Ga0501031_0015523 | 3300049568 | Bacteria | 4943 |
| 1042 | Ga0501031_0107483 | 3300049568 | Bacteria | 1822 |
| 1043 | Ga0501031_0162375 | 3300049568 | Bacteria | 1460 |
| 1044 | Ga0501031_0227203 | 3300049568 | Bacteria | 1215 |
| 1045 | Ga0501032_0035979 | 3300049569 | Bacteria | 3382 |
| 1046 | Ga0501033_0057657 | 3300049570 | Bacteria | 2869 |
| 1047 | Ga0501033_0110163 | 3300049570 | Bacteria | 2004 |
| 1048 | Ga0501034_0055570 | 3300049571 | Bacteria | 3984 |
| 1049 | Ga0501034_0328561 | 3300049571 | Bacteria | 1461 |
| 1050 | Ga0501036_0001027 | 3300049572 | Bacteria | 21086 |
| 1051 | Ga0501036_0030129 | 3300049572 | Bacteria | 4584 |
| 1052 | Ga0501036_0038811 | 3300049572 | Bacteria | 4031 |
| 1053 | Ga0501036_0094818 | 3300049572 | Bacteria | 2522 |
| 1054 | Ga0501036_0134814 | 3300049572 | Bacteria | 2084 |
| 1055 | Ga0501036_0167895 | 3300049572 | Bacteria | 1849 |
| 1056 | Ga0501036_0241326 | 3300049572 | Bacteria | 1515 |
| 1057 | Ga0501037_0008607 | 3300049573 | Bacteria | 7483 |
| 1058 | Ga0501037_0134529 | 3300049573 | Bacteria | 1771 |
| 1059 | Ga0501038_0011389 | 3300049574 | Bacteria | 8116 |
| 1060 | Ga0501038_0027212 | 3300049574 | Bacteria | 5090 |
| 1061 | Ga0501038_0096340 | 3300049574 | Bacteria | 2470 |
| 1062 | Ga0501038_0125209 | 3300049574 | Bacteria | 2116 |
| 1063 | Ga0501038_0153325 | 3300049574 | Bacteria | 1877 |
| 1064 | Ga0501039_0017673 | 3300049575 | Bacteria | 5470 |
| 1065 | Ga0501039_0038348 | 3300049575 | Bacteria | 3700 |
| 1066 | Ga0501039_0050226 | 3300049575 | Bacteria | 3226 |
| 1067 | Ga0501039_0058486 | 3300049575 | Bacteria | 2986 |
| 1068 | Ga0501039_0134433 | 3300049575 | Bacteria | 1941 |
| 1069 | Ga0501039_0167927 | 3300049575 | Bacteria | 1725 |
| 1070 | Ga0501040_0087473 | 3300049576 | Bacteria | 2163 |
| 1071 | Ga0501040_0104245 | 3300049576 | Bacteria | 1980 |
| 1072 | Ga0501040_0208319 | 3300049576 | Bacteria | 1389 |
| 1073 | Ga0501041_0027037 | 3300049577 | Bacteria | 3455 |
| 1074 | Ga0501041_0039808 | 3300049577 | Bacteria | 2852 |
| 1075 | Ga0501041_0072234 | 3300049577 | Bacteria | 2119 |
| 1076 | Ga0501041_0081685 | 3300049577 | Bacteria | 1990 |
| 1077 | Ga0501041_0100191 | 3300049577 | Bacteria | 1793 |
| 1078 | Ga0501041_0115855 | 3300049577 | Bacteria | 1664 |
| 1079 | Ga0501042_0000334 | 3300049578 | Bacteria | 23630 |
| 1080 | Ga0501042_0026797 | 3300049578 | Bacteria | 4049 |
| 1081 | Ga0501042_0041803 | 3300049578 | Bacteria | 3261 |
| 1082 | Ga0501042_0066661 | 3300049578 | Bacteria | 2573 |
| 1083 | Ga0501042_0078895 | 3300049578 | Bacteria | 2358 |
| 1084 | Ga0501042_0084497 | 3300049578 | Bacteria | 2276 |
| 1085 | Ga0501042_0086270 | 3300049578 | Bacteria | 2251 |
| 1086 | Ga0501042_0118211 | 3300049578 | Bacteria | 1908 |
| 1087 | Ga0501042_0134003 | 3300049578 | Bacteria | 1786 |
| 1088 | Ga0501042_0212804 | 3300049578 | Bacteria | 1394 |
| 1089 | Ga0501042_0293926 | 3300049578 | Bacteria | 1173 |
| 1090 | Ga0501043_0097097 | 3300049579 | Bacteria | 2316 |
| 1091 | Ga0501043_0118017 | 3300049579 | Bacteria | 2081 |
| 1092 | Ga0501043_0286752 | 3300049579 | Bacteria | 1261 |
| 1093 | Ga0501046_0019986 | 3300049580 | Bacteria | 5545 |
| 1094 | Ga0501046_0022389 | 3300049580 | Bacteria | 5205 |
| 1095 | Ga0501046_0142452 | 3300049580 | Bacteria | 1813 |
| 1096 | Ga0501047_0293558 | 3300049581 | Bacteria | 1469 |
| 1097 | Ga0501048_0002894 | 3300049582 | Bacteria | 13102 |
| 1098 | Ga0501048_0003753 | 3300049582 | Bacteria | 11591 |
| 1099 | Ga0501048_0060796 | 3300049582 | Bacteria | 2676 |
| 1100 | Ga0501048_0123692 | 3300049582 | Bacteria | 1829 |
| 1101 | Ga0501048_0160224 | 3300049582 | Bacteria | 1592 |
| 1102 | Ga0501048_0224726 | 3300049582 | Bacteria | 1332 |
| 1103 | Ga0501067_0004777 | 3300049583 | Bacteria | 7510 |
| 1104 | Ga0501067_0008835 | 3300049583 | Bacteria | 5581 |
| 1105 | Ga0501067_0016414 | 3300049583 | Bacteria | 4091 |
| 1106 | Ga0501067_0029527 | 3300049583 | Bacteria | 3039 |
| 1107 | Ga0501067_0035407 | 3300049583 | Bacteria | 2772 |
| 1108 | Ga0501068_0102208 | 3300049584 | Bacteria | 1777 |
| 1109 | Ga0501068_0244102 | 3300049584 | Bacteria | 1143 |
| 1110 | Ga0501069_0006563 | 3300049585 | Bacteria | 6082 |
| 1111 | Ga0501069_0010165 | 3300049585 | Bacteria | 4977 |
| 1112 | Ga0501069_0044822 | 3300049585 | Bacteria | 2449 |
| 1113 | Ga0501069_0064797 | 3300049585 | Bacteria | 2042 |
| 1114 | Ga0501069_0090185 | 3300049585 | Bacteria | 1733 |
| 1115 | Ga0501069_0112788 | 3300049585 | Bacteria | 1549 |
| 1116 | Ga0501069_0156653 | 3300049585 | Bacteria | 1310 |
| 1117 | Ga0501069_0192839 | 3300049585 | Bacteria | 1179 |
| 1118 | Ga0501070_0012254 | 3300049586 | Bacteria | 7237 |
| 1119 | Ga0501070_0029191 | 3300049586 | Bacteria | 4625 |
| 1120 | Ga0501070_0038651 | 3300049586 | Bacteria | 3982 |
| 1121 | Ga0501070_0129386 | 3300049586 | Bacteria | 2086 |
| 1122 | Ga0501070_0214491 | 3300049586 | Bacteria | 1579 |
| 1123 | Ga0501070_0318248 | 3300049586 | Bacteria | 1266 |
| 1124 | Ga0501070_0382388 | 3300049586 | Bacteria | 1140 |
| 1125 | Ga0501071_0000345 | 3300049587 | Bacteria | 22601 |
| 1126 | Ga0501071_0000651 | 3300049587 | Bacteria | 18127 |
| 1127 | Ga0501071_0004549 | 3300049587 | Bacteria | 8800 |
| 1128 | Ga0501071_0023965 | 3300049587 | Bacteria | 4266 |
| 1129 | Ga0501071_0030981 | 3300049587 | Bacteria | 3787 |
| 1130 | Ga0501071_0065632 | 3300049587 | Bacteria | 2636 |
| 1131 | Ga0501071_0092372 | 3300049587 | Bacteria | 2224 |
| 1132 | Ga0501071_0157307 | 3300049587 | Bacteria | 1697 |
| 1133 | Ga0501072_0004103 | 3300049588 | Bacteria | 11025 |
| 1134 | Ga0501072_0011364 | 3300049588 | Bacteria | 6804 |
| 1135 | Ga0501072_0055933 | 3300049588 | Bacteria | 3110 |
| 1136 | Ga0501072_0098642 | 3300049588 | Bacteria | 2322 |
| 1137 | Ga0501072_0131272 | 3300049588 | Bacteria | 1996 |
| 1138 | Ga0501072_0131654 | 3300049588 | Bacteria | 1993 |
| 1139 | Ga0501072_0140478 | 3300049588 | Bacteria | 1925 |
| 1140 | Ga0501072_0257150 | 3300049588 | Bacteria | 1390 |
| 1141 | Ga0501073_0091237 | 3300049589 | Bacteria | 2117 |
| 1142 | Ga0501073_0140866 | 3300049589 | Bacteria | 1671 |
| 1143 | Ga0501073_0183644 | 3300049589 | Bacteria | 1448 |
| 1144 | Ga0501073_0236590 | 3300049589 | Bacteria | 1261 |
| 1145 | Ga0501074_0000765 | 3300049590 | Bacteria | 20232 |
| 1146 | Ga0501074_0025731 | 3300049590 | Bacteria | 4270 |
| 1147 | Ga0501074_0043447 | 3300049590 | Bacteria | 3253 |
| 1148 | Ga0501074_0046599 | 3300049590 | Bacteria | 3134 |
| 1149 | Ga0501074_0048279 | 3300049590 | Bacteria | 3075 |
| 1150 | Ga0501074_0062128 | 3300049590 | Bacteria | 2690 |
| 1151 | Ga0501075_0005215 | 3300049591 | Bacteria | 8887 |
| 1152 | Ga0501075_0006054 | 3300049591 | Bacteria | 8297 |
| 1153 | Ga0501075_0029033 | 3300049591 | Bacteria | 4088 |
| 1154 | Ga0501075_0038185 | 3300049591 | Bacteria | 3589 |
| 1155 | Ga0501075_0050468 | 3300049591 | Bacteria | 3127 |
| 1156 | Ga0501075_0076718 | 3300049591 | Bacteria | 2528 |
| 1157 | Ga0501075_0088665 | 3300049591 | Bacteria | 2346 |
| 1158 | Ga0501075_0253102 | 3300049591 | Bacteria | 1342 |
| 1159 | Ga0501075_0317699 | 3300049591 | Bacteria | 1187 |
| 1160 | Ga0501076_0001235 | 3300049592 | Bacteria | 17016 |
| 1161 | Ga0501076_0001689 | 3300049592 | Bacteria | 14898 |
| 1162 | Ga0501076_0006917 | 3300049592 | Bacteria | 8240 |
| 1163 | Ga0501076_0027563 | 3300049592 | Bacteria | 4405 |
| 1164 | Ga0501076_0042028 | 3300049592 | Bacteria | 3599 |
| 1165 | Ga0501076_0097859 | 3300049592 | Bacteria | 2363 |
| 1166 | Ga0501076_0164777 | 3300049592 | Bacteria | 1806 |
| 1167 | Ga0501076_0204025 | 3300049592 | Bacteria | 1615 |
| 1168 | Ga0501076_0396075 | 3300049592 | Bacteria | 1135 |
| 1169 | Ga0501077_0002770 | 3300049593 | Bacteria | 10511 |
| 1170 | Ga0501077_0002957 | 3300049593 | Bacteria | 10198 |
| 1171 | Ga0501077_0003278 | 3300049593 | Bacteria | 9747 |
| 1172 | Ga0501077_0004842 | 3300049593 | Bacteria | 8180 |
| 1173 | Ga0501077_0022027 | 3300049593 | Bacteria | 4035 |
| 1174 | Ga0501077_0030518 | 3300049593 | Bacteria | 3430 |
| 1175 | Ga0501077_0043829 | 3300049593 | Bacteria | 2843 |
| 1176 | Ga0501079_0001742 | 3300049741 | Bacteria | 15514 |
| 1177 | Ga0501079_0014007 | 3300049741 | Bacteria | 6116 |
| 1178 | Ga0501079_0015752 | 3300049741 | Bacteria | 5776 |
| 1179 | Ga0501079_0047722 | 3300049741 | Bacteria | 3304 |
| 1180 | Ga0501079_0064690 | 3300049741 | Bacteria | 2821 |
| 1181 | Ga0501079_0072254 | 3300049741 | Bacteria | 2666 |
| 1182 | Ga0501079_0073185 | 3300049741 | Bacteria | 2648 |
| 1183 | Ga0501079_0129038 | 3300049741 | Bacteria | 1967 |
| 1184 | Ga0501079_0208308 | 3300049741 | Bacteria | 1527 |
| 1185 | Ga0501079_0242642 | 3300049741 | Bacteria | 1408 |
| 1186 | Ga0501079_0292218 | 3300049741 | Bacteria | 1275 |
| 1187 | Ga0501079_0323427 | 3300049741 | Bacteria | 1207 |
| 1188 | Ga0501080_0001741 | 3300049742 | Bacteria | 18642 |
| 1189 | Ga0501080_0014743 | 3300049742 | Bacteria | 7197 |
| 1190 | Ga0501080_0021050 | 3300049742 | Bacteria | 6037 |
| 1191 | Ga0501080_0100701 | 3300049742 | Bacteria | 2680 |
| 1192 | Ga0501080_0432652 | 3300049742 | Bacteria | 1181 |
| 1193 | Ga0501080_0480838 | 3300049742 | Bacteria | 1111 |
| 1194 | Ga0501080_0540195 | 3300049742 | Bacteria | 1039 |
| 1195 | Ga0501081_0011390 | 3300049743 | Bacteria | 5820 |
| 1196 | Ga0501081_0033516 | 3300049743 | Bacteria | 3490 |
| 1197 | Ga0501081_0066525 | 3300049743 | Bacteria | 2506 |
| 1198 | Ga0501081_0090187 | 3300049743 | Bacteria | 2154 |
| 1199 | Ga0501081_0478007 | 3300049743 | Bacteria | 927 |
| 1200 | Ga0501083_0002789 | 3300049744 | Bacteria | 12083 |
| 1201 | Ga0501083_0106251 | 3300049744 | Bacteria | 1848 |
| 1202 | Ga0501035_0055540 | 3300049822 | Bacteria | 3535 |
| 1203 | Ga0501035_0057550 | 3300049822 | Bacteria | 3466 |
| 1204 | Ga0501035_0144311 | 3300049822 | Bacteria | 2068 |
| 1205 | Ga0501044_0064260 | 3300049823 | Bacteria | 3747 |
| 1206 | Ga0501044_0266320 | 3300049823 | Bacteria | 1651 |
| 1207 | Ga0501044_0354121 | 3300049823 | Bacteria | 1387 |
| 1208 | Ga0501045_0000466 | 3300049824 | Bacteria | 25136 |
| 1209 | Ga0501045_0021227 | 3300049824 | Bacteria | 4643 |
| 1210 | Ga0501045_0024988 | 3300049824 | Bacteria | 4292 |
| 1211 | Ga0501045_0070220 | 3300049824 | Bacteria | 2576 |
| 1212 | Ga0501045_0153931 | 3300049824 | Bacteria | 1711 |
| 1213 | Ga0501045_0194885 | 3300049824 | Bacteria | 1510 |
| 1214 | Ga0501045_0210014 | 3300049824 | Bacteria | 1450 |
| 1215 | Ga0501045_0258341 | 3300049824 | Bacteria | 1296 |
| 1216 | nmdc:mga03n38_53242_c1 | 3300050490 | Bacteria | 1814 |
| 1217 | nmdc:mga0yw44_24081_c1 | 3300050492 | Bacteria | 3440 |
| 1218 | nmdc:mga0yw44_61198_c1 | 3300050492 | Bacteria | 2309 |
| 1219 | nmdc:mga0yw44_89141_c1 | 3300050492 | Bacteria | 1946 |
| 1220 | nmdc:mga06z11_121520_c1 | 3300050494 | Bacteria | 1457 |
| 1221 | nmdc:mga07m45_153117_c1 | 3300050496 | Bacteria | 1337 |
| 1222 | nmdc:mga05p37_138911_c1 | 3300050507 | Bacteria | 2978 |
| 1223 | nmdc:mga05p37_163762_c1 | 3300050507 | Bacteria | 2715 |
| 1224 | nmdc:mga05p37_197477_c1 | 3300050507 | Bacteria | 2439 |
| 1225 | nmdc:mga05p37_205886_c1 | 3300050507 | Bacteria | 2380 |
| 1226 | nmdc:mga05p37_24832_c1 | 3300050507 | Bacteria | 7286 |
| 1227 | nmdc:mga05p37_301408_c1 | 3300050507 | Bacteria | 1904 |
| 1228 | nmdc:mga05p37_325938_c1 | 3300050507 | Bacteria | 1816 |
| 1229 | nmdc:mga05p37_36994_c1 | 3300050507 | Bacteria | 5987 |
| 1230 | nmdc:mga05p37_397190_c1 | 3300050507 | Bacteria | 1611 |
| 1231 | nmdc:mga05p37_524882_c1 | 3300050507 | Bacteria | 1353 |
| 1232 | nmdc:mga05p37_778672_c1 | 3300050507 | Bacteria | 1050 |
| 1233 | nmdc:mga05p37_7975_c1 | 3300050507 | Bacteria | 12501 |
| 1234 | nmdc:mga09592_268488_c1 | 3300050508 | Bacteria | 1480 |
| 1235 | nmdc:mga09592_313131_c1 | 3300050508 | Bacteria | 1360 |
| 1236 | nmdc:mga0qj67_22002_c1 | 3300050509 | Bacteria | 4894 |
| 1237 | nmdc:mga06r32_18303_c1 | 3300050510 | Bacteria | 6412 |
| 1238 | nmdc:mga06r32_246323_c1 | 3300050510 | Bacteria | 1775 |
| 1239 | nmdc:mga06r32_413387_c1 | 3300050510 | Bacteria | 1330 |
| 1240 | nmdc:mga06r32_59154_c1 | 3300050510 | Bacteria | 3684 |
| 1241 | nmdc:mga08y16_338472_c1 | 3300050511 | Bacteria | 1547 |
| 1242 | nmdc:mga08y16_38551_c1 | 3300050511 | Bacteria | 5018 |
| 1243 | nmdc:mga08y16_38628_c1 | 3300050511 | Bacteria | 5011 |
| 1244 | nmdc:mga08y16_46381_c1 | 3300050511 | Bacteria | 4550 |
| 1245 | nmdc:mga08y16_48743_c1 | 3300050511 | Bacteria | 4433 |
| 1246 | nmdc:mga08y16_70469_c1 | 3300050511 | Bacteria | 3644 |
| 1247 | nmdc:mga0n895_22483_c1 | 3300050512 | Bacteria | 5913 |
| 1248 | nmdc:mga0n895_24597_c1 | 3300050512 | Bacteria | 5678 |
| 1249 | nmdc:mga0n895_2766_c1 | 3300050512 | Bacteria | 13861 |
| 1250 | nmdc:mga0n895_32662_c1 | 3300050512 | Bacteria | 4997 |
| 1251 | nmdc:mga0n895_746978_c1 | 3300050512 | Bacteria | 972 |
| 1252 | nmdc:mga0rr50_2093_c1 | 3300050513 | Bacteria | 11154 |
| 1253 | nmdc:mga0rr50_21347_c1 | 3300050513 | Bacteria | 4419 |
| 1254 | nmdc:mga08x19_75551_c1 | 3300050514 | Bacteria | 2203 |
| 1255 | nmdc:mga08x19_7697_c1 | 3300050514 | Bacteria | 6396 |
| 1256 | nmdc:mga0a205_135556_c1 | 3300050515 | Bacteria | 2363 |
| 1257 | nmdc:mga0a205_185775_c1 | 3300050515 | Bacteria | 1972 |
| 1258 | nmdc:mga0a205_2963_c1 | 3300050515 | Bacteria | 15060 |
| 1259 | nmdc:mga0a205_377473_c1 | 3300050515 | Bacteria | 1283 |
| 1260 | nmdc:mga0a205_5364_c2 | 3300050515 | Bacteria | 10398 |
| 1261 | nmdc:mga0a205_82072_c1 | 3300050515 | Bacteria | 2608 |
| 1262 | Ga0495601_0000554 | 3300053077 | Bacteria | 19791 |
| 1263 | Ga0495601_0005595 | 3300053077 | Bacteria | 7329 |
| 1264 | Ga0495601_0054791 | 3300053077 | Bacteria | 2523 |
| 1265 | Ga0495601_0277829 | 3300053077 | Bacteria | 1092 |
| 1266 | Ga0495612_0062475 | 3300053078 | Bacteria | 1544 |
| 1267 | Ga0495595_0004995 | 3300053084 | Bacteria | 5357 |
| 1268 | Ga0495595_0135643 | 3300053084 | Bacteria | 1205 |
| 1269 | Ga0495619_0011831 | 3300053085 | Bacteria | 5497 |
| 1270 | Ga0495619_0037689 | 3300053085 | Bacteria | 3152 |
| 1271 | Ga0495619_0119965 | 3300053085 | Bacteria | 1803 |
| 1272 | Ga0501084_0001413 | 3300054114 | Bacteria | 19014 |
| 1273 | Ga0501084_0005329 | 3300054114 | Bacteria | 10530 |
| 1274 | Ga0501084_0011565 | 3300054114 | Bacteria | 7307 |
| 1275 | Ga0501084_0012787 | 3300054114 | Bacteria | 6953 |
| 1276 | Ga0501084_0025635 | 3300054114 | Bacteria | 4917 |
| 1277 | Ga0501084_0054611 | 3300054114 | Bacteria | 3341 |
| 1278 | Ga0501084_0232423 | 3300054114 | Bacteria | 1556 |
| 1279 | Ga0590077_029194 | 3300059426 | Bacteria | 1199 |
| 1280 | Ga0587082_013214 | 3300059504 | Bacteria | 1241 |
| 1281 | Ga0501082_0004874 | 3300060353 | Bacteria | 11709 |
| 1282 | Ga0501082_0041542 | 3300060353 | Bacteria | 3965 |
| 1283 | Ga0501082_0055012 | 3300060353 | Bacteria | 3429 |
| 1284 | Ga0501082_0091858 | 3300060353 | Bacteria | 2621 |
| 1285 | Ga0501082_0125999 | 3300060353 | Bacteria | 2221 |
| 1286 | Ga0501082_0290676 | 3300060353 | Bacteria | 1423 |
| 1287 | Ga0466962_0000503 | 3300061719 | Bacteria | 16987 |
| 1288 | Ga0466962_0002558 | 3300061719 | Bacteria | 8638 |
| 1289 | Ga0466962_0019082 | 3300061719 | Bacteria | 3293 |
| 1290 | Ga0466962_0104416 | 3300061719 | Bacteria | 1361 |
| 1291 | Ga0466962_0115071 | 3300061719 | Bacteria | 1296 |
| 1292 | Ga0530510_0001475 | 3300061734 | Bacteria | 15786 |
| 1293 | Ga0530510_0008884 | 3300061734 | Bacteria | 7033 |
| 1294 | Ga0530510_0065612 | 3300061734 | Bacteria | 2631 |
| 1295 | Ga0530510_0134861 | 3300061734 | Bacteria | 1817 |
| 1296 | Ga0530510_0383345 | 3300061734 | Bacteria | 1058 |
| 1297 | Ga0530510_0416766 | 3300061734 | Bacteria | 1013 |
| 1298 | Ga0373931_0214254 | |||
| 1299 | JGI24751J29686_10035121 | |||
| 1300 | Ga0070658_10003658 | |||
| 1301 | Ga0070658_10030476 | |||
| 1302 | Ga0070683_100000774 | |||
| 1303 | Ga0070683_100045882 | |||
| 1304 | Ga0070683_100051507 | |||
| 1305 | Ga0070683_100112904 | |||
| 1306 | Ga0070683_100126187 | |||
| 1307 | Ga0070690_100045434 | |||
| 1308 | Ga0070690_100121173 | |||
| 1309 | Ga0070677_10066824 | |||
| 1310 | Ga0068869_100026863 | |||
| 1311 | Ga0068869_100162571 | |||
| 1312 | Ga0070666_10047569 | |||
| 1313 | Ga0070680_100102156 | |||
| 1314 | Ga0070680_100153889 | |||
| 1315 | Ga0070680_100241485 | |||
| 1316 | Ga0070682_100008755 | |||
| 1317 | Ga0070682_100019169 | |||
| 1318 | Ga0070682_100135795 | |||
| 1319 | Ga0070682_100175446 | |||
| 1320 | Ga0070682_100332828 | |||
| 1321 | Ga0068868_100010563 | |||
| 1322 | Ga0068868_100025923 | |||
| 1323 | Ga0068868_100054127 | |||
| 1324 | Ga0070660_100004783 | |||
| 1325 | Ga0070660_100049490 | |||
| 1326 | Ga0070691_10019049 | |||
| 1327 | Ga0070661_100009372 | |||
| 1328 | Ga0070661_100015472 | |||
| 1329 | Ga0070661_100058564 | |||
| 1330 | Ga0070692_10042048 | |||
| 1331 | Ga0070692_10088641 | |||
| 1332 | Ga0070668_100002933 | |||
| 1333 | Ga0070668_100226679 | |||
| 1334 | Ga0070675_100141251 | |||
| 1335 | Ga0070675_100244732 | |||
| 1336 | Ga0070675_100255883 | |||
| 1337 | Ga0070674_100014394 | |||
| 1338 | Ga0070674_100021548 | |||
| 1339 | Ga0070673_100072358 | |||
| 1340 | Ga0070673_100256895 | |||
| 1341 | Ga0070688_100010726 | |||
| 1342 | Ga0070659_100005871 | |||
| 1343 | Ga0070659_100185823 | |||
| 1344 | Ga0070703_10032272 | |||
| 1345 | Ga0070709_10001860 | |||
| 1346 | Ga0070709_10010484 | |||
| 1347 | Ga0070709_10044279 | |||
| 1348 | Ga0070709_10059086 | |||
| 1349 | Ga0070709_10223523 | |||
| 1350 | Ga0070714_100008596 | |||
| 1351 | Ga0070714_100018091 | |||
| 1352 | Ga0070714_100023043 | |||
| 1353 | Ga0070714_100028847 | |||
| 1354 | Ga0070714_100033662 | |||
| 1355 | Ga0070714_100046710 | |||
| 1356 | Ga0070714_100064985 | |||
| 1357 | Ga0070714_100068477 | |||
| 1358 | Ga0070714_100124692 | |||
| 1359 | Ga0070714_100194509 | |||
| 1360 | Ga0070714_100279483 | |||
| 1361 | Ga0070713_100004782 | |||
| 1362 | Ga0070713_100007132 | |||
| 1363 | Ga0070713_100054334 | |||
| 1364 | Ga0070713_100090572 | |||
| 1365 | Ga0070713_100154553 | |||
| 1366 | Ga0070710_10002718 | |||
| 1367 | Ga0070710_10011425 | |||
| 1368 | Ga0070710_10036848 | |||
| 1369 | Ga0070710_10084958 | |||
| 1370 | Ga0070711_100001918 | |||
| 1371 | Ga0070711_100034422 | |||
| 1372 | Ga0070705_100017395 | |||
| 1373 | Ga0070705_100023631 | |||
| 1374 | Ga0070705_100037299 | |||
| 1375 | Ga0070700_100000585 | |||
| 1376 | Ga0070700_100030419 | |||
| 1377 | Ga0070700_100041433 | |||
| 1378 | Ga0070694_100019437 | |||
| 1379 | Ga0070694_100045131 | |||
| 1380 | Ga0070708_100146638 | |||
| 1381 | Ga0070708_100224680 | |||
| 1382 | Ga0070663_100014577 | |||
| 1383 | Ga0070663_100035554 | |||
| 1384 | Ga0070663_100099735 | |||
| 1385 | Ga0070678_100006277 | |||
| 1386 | Ga0070678_100009462 | |||
| 1387 | Ga0070678_100115188 | |||
| 1388 | Ga0070678_100177474 | |||
| 1389 | Ga0070678_100187778 | |||
| 1390 | Ga0070662_100070449 | |||
| 1391 | Ga0070681_10017483 | |||
| 1392 | Ga0070681_10032807 | |||
| 1393 | Ga0070681_10073519 | |||
| 1394 | Ga0070681_10160560 | |||
| 1395 | Ga0068867_100021336 | |||
| 1396 | Ga0068867_100115739 | |||
| 1397 | Ga0068867_100140735 | |||
| 1398 | Ga0070685_10018054 | |||
| 1399 | Ga0070685_10033577 | |||
| 1400 | Ga0070706_100275908 | |||
| 1401 | Ga0070706_100336031 | |||
| 1402 | Ga0070707_100006447 | |||
| 1403 | Ga0070707_100009913 | |||
| 1404 | Ga0070707_100022080 | |||
| 1405 | Ga0070707_100098392 | |||
| 1406 | Ga0070698_100004278 | |||
| 1407 | Ga0070698_100006489 | |||
| 1408 | Ga0070698_100031951 | |||
| 1409 | Ga0070698_100058619 | |||
| 1410 | Ga0070698_100113070 | |||
| 1411 | Ga0070699_100016876 | |||
| 1412 | Ga0070699_100044132 | |||
| 1413 | Ga0070699_100139117 | |||
| 1414 | Ga0070699_100193972 | |||
| 1415 | Ga0070679_100047267 | |||
| 1416 | Ga0070679_100059248 | |||
| 1417 | Ga0070679_100096138 | |||
| 1418 | Ga0070679_100164891 | |||
| 1419 | Ga0070684_100040661 | |||
| 1420 | Ga0070684_100069183 | |||
| 1421 | Ga0070684_100185972 | |||
| 1422 | Ga0070684_100274627 | |||
| 1423 | Ga0070684_100294484 | |||
| 1424 | Ga0070684_100306604 | |||
| 1425 | Ga0070684_100436309 | |||
| 1426 | Ga0070697_100080435 | |||
| 1427 | Ga0068853_100040446 | |||
| 1428 | Ga0070672_100009205 | |||
| 1429 | Ga0070686_100171003 | |||
| 1430 | Ga0070695_100038311 | |||
| 1431 | Ga0070695_100226097 | |||
| 1432 | Ga0070696_100008104 | |||
| 1433 | Ga0070696_100025255 | |||
| 1434 | Ga0070696_100031997 | |||
| 1435 | Ga0070693_100025169 | |||
| 1436 | Ga0070693_100104452 | |||
| 1437 | Ga0070665_100107934 | |||
| 1438 | Ga0070704_100028416 | |||
| 1439 | Ga0070704_100028899 | |||
| 1440 | Ga0070704_100127172 | |||
| 1441 | Ga0068855_100034573 | |||
| 1442 | Ga0068855_100043411 | |||
| 1443 | Ga0068855_100095791 | |||
| 1444 | Ga0068855_100110135 | |||
| 1445 | Ga0068855_100220385 | |||
| 1446 | Ga0068855_100384975 | |||
| 1447 | Ga0070664_100018643 | |||
| 1448 | Ga0070664_100078034 | |||
| 1449 | Ga0068857_100153604 | |||
| 1450 | Ga0068854_100009762 | |||
| 1451 | Ga0068854_100093205 | |||
| 1452 | Ga0068854_100111336 | |||
| 1453 | Ga0068856_100013458 | |||
| 1454 | Ga0068856_100083049 | |||
| 1455 | Ga0070702_100033046 | |||
| 1456 | Ga0070702_100066532 | |||
| 1457 | Ga0068852_100024571 | |||
| 1458 | Ga0068852_100070996 | |||
| 1459 | Ga0068852_100135678 | |||
| 1460 | Ga0068852_100148015 | |||
| 1461 | Ga0068859_100319165 | |||
| 1462 | Ga0068864_100028758 | |||
| 1463 | Ga0068866_10002892 | |||
| 1464 | Ga0068866_10053305 | |||
| 1465 | Ga0068861_100007204 | |||
| 1466 | Ga0068861_100231391 | |||
| 1467 | Ga0068851_10114441 | |||
| 1468 | Ga0068870_10049929 | |||
| 1469 | Ga0068870_10181578 | |||
| 1470 | Ga0068863_100094656 | |||
| 1471 | Ga0068860_100430797 | |||
| 1472 | Ga0068862_100070729 | |||
| 1473 | Ga0081455_10013758 | |||
| 1474 | Ga0081455_10019652 | |||
| 1475 | Ga0081455_10059022 | |||
| 1476 | Ga0081538_10031057 | |||
| 1477 | Ga0081540_1000597 | |||
| 1478 | Ga0081540_1005959 | |||
| 1479 | Ga0081539_10003619 | |||
| 1480 | Ga0081539_10005000 | |||
| 1481 | Ga0070717_10011631 | |||
| 1482 | Ga0070717_10033584 | |||
| 1483 | Ga0070717_10054551 | |||
| 1484 | Ga0070717_10070574 | |||
| 1485 | Ga0075365_10006259 | |||
| 1486 | Ga0075365_10035777 | |||
| 1487 | Ga0075365_10137153 | |||
| 1488 | Ga0075364_10109831 | |||
| 1489 | Ga0075432_10000332 | |||
| 1490 | Ga0075432_10001329 | |||
| 1491 | Ga0075432_10024473 | |||
| 1492 | Ga0070715_10001470 | |||
| 1493 | Ga0070715_10003672 | |||
| 1494 | Ga0070715_10059989 | |||
| 1495 | Ga0070716_100001368 | |||
| 1496 | Ga0070716_100079406 | |||
| 1497 | Ga0070716_100147844 | |||
| 1498 | Ga0070716_100344156 | |||
| 1499 | Ga0070712_100001138 | |||
| 1500 | Ga0070712_100029238 | |||
| 1501 | Ga0070712_100229158 | |||
| 1502 | Ga0075367_10085053 | |||
| 1503 | Ga0075367_10141973 | |||
| 1504 | Ga0097621_100010388 | |||
| 1505 | Ga0097621_100170002 | |||
| 1506 | Ga0075370_10218896 | |||
| 1507 | Ga0068871_100030111 | |||
| 1508 | Ga0068871_100068935 | |||
| 1509 | Ga0075428_100009696 | |||
| 1510 | Ga0075428_100036032 | |||
| 1511 | Ga0075428_100044438 | |||
| 1512 | Ga0075428_100142312 | |||
| 1513 | Ga0075430_100008351 | |||
| 1514 | Ga0075431_100027269 | |||
| 1515 | Ga0075431_100386162 | |||
| 1516 | Ga0075433_10013900 | |||
| 1517 | Ga0075433_10089730 | |||
| 1518 | Ga0075433_10092652 | |||
| 1519 | Ga0075433_10227718 | |||
| 1520 | Ga0075433_10287798 | |||
| 1521 | Ga0075434_100036513 | |||
| 1522 | Ga0075434_100106446 | |||
| 1523 | Ga0068865_100001835 | |||
| 1524 | Ga0068865_100018132 | |||
| 1525 | Ga0068865_100046319 | |||
| 1526 | Ga0075436_100011959 | |||
| 1527 | Ga0075436_100057244 | |||
| 1528 | Ga0075436_100188110 | |||
| 1529 | Ga0075436_100254221 | |||
| 1530 | Ga0097620_100319174 | |||
| 1531 | Ga0075435_100002282 | |||
| 1532 | Ga0075435_100025481 | |||
| 1533 | Ga0075435_100087062 | |||
| 1534 | Ga0075435_100480217 | |||
| 1535 | Ga0105240_10011692 | |||
| 1536 | Ga0111539_10005072 | |||
| 1537 | Ga0111539_10036613 | |||
| 1538 | Ga0111539_10045392 | |||
| 1539 | Ga0111539_10117251 | |||
| 1540 | Ga0111539_10143875 | |||
| 1541 | Ga0111539_10213295 | |||
| 1542 | Ga0111539_10214954 | |||
| 1543 | Ga0111539_10670610 | |||
| 1544 | Ga0105245_10007371 | |||
| 1545 | Ga0105245_10041637 | |||
| 1546 | Ga0105245_10047068 | |||
| 1547 | Ga0105245_10047207 | |||
| 1548 | Ga0105245_10068259 | |||
| 1549 | Ga0105245_10350710 | |||
| 1550 | Ga0105245_10485917 | |||
| 1551 | Ga0105247_10011467 | |||
| 1552 | Ga0114129_10004388 | |||
| 1553 | Ga0114129_10009732 | |||
| 1554 | Ga0114129_10036404 | |||
| 1555 | Ga0114129_10072326 | |||
| 1556 | Ga0114129_10184776 | |||
| 1557 | Ga0114129_10198243 | |||
| 1558 | Ga0114129_10270128 | |||
| 1559 | Ga0114129_10453998 | |||
| 1560 | Ga0114129_10945521 | |||
| 1561 | Ga0105243_10001405 | |||
| 1562 | Ga0105243_10556611 | |||
| 1563 | Ga0105241_10019866 | |||
| 1564 | Ga0105241_10179491 | |||
| 1565 | Ga0105241_10216866 | |||
| 1566 | Ga0105242_10019300 | |||
| 1567 | Ga0105242_10125923 | |||
| 1568 | Ga0105242_10133654 | |||
| 1569 | Ga0105242_10153941 | |||
| 1570 | Ga0105242_10294888 | |||
| 1571 | Ga0105248_10032129 | |||
| 1572 | Ga0105248_10063386 | |||
| 1573 | Ga0105248_10155316 | |||
| 1574 | Ga0105237_10150826 | |||
| 1575 | Ga0105237_10250661 | |||
| 1576 | Ga0105237_10376803 | |||
| 1577 | Ga0105238_10397857 | |||
| 1578 | Ga0105238_10404397 | |||
| 1579 | Ga0105249_10009749 | |||
| 1580 | Ga0105249_10034744 | |||
| 1581 | Ga0105030_102136 | |||
| 1582 | Ga0105239_10017991 | |||
| 1583 | Ga0105239_10036876 | |||
| 1584 | Ga0105239_10040810 | |||
| 1585 | Ga0105239_10078412 | |||
| 1586 | Ga0105239_10091857 | |||
| 1587 | Ga0105239_10095193 | |||
| 1588 | Ga0105239_10448283 | |||
| 1589 | Ga0105239_10694412 | |||
| 1590 | Ga0105246_10024965 | |||
| 1591 | Ga0105246_10056219 | |||
| 1592 | Ga0105246_10186376 | |||
| 1593 | Ga0157369_10029546 | |||
| 1594 | Ga0157369_10035437 | |||
| 1595 | Ga0157369_10299042 | |||
| 1596 | Ga0157369_10313032 | |||
| 1597 | Ga0157369_10461092 | |||
| 1598 | Ga0157374_10031172 | |||
| 1599 | Ga0157374_10032676 | |||
| 1600 | Ga0157374_10236113 | |||
| 1601 | Ga0157378_10075074 | |||
| 1602 | Ga0163162_10019622 | |||
| 1603 | Ga0163162_10043152 | |||
| 1604 | Ga0163162_10069849 | |||
| 1605 | Ga0163162_10119942 | |||
| 1606 | Ga0163162_10281497 | |||
| 1607 | Ga0163162_10688202 | |||
| 1608 | Ga0157372_10005060 | |||
| 1609 | Ga0157372_10018759 | |||
| 1610 | Ga0157372_10033981 | |||
| 1611 | Ga0157372_10064830 | |||
| 1612 | Ga0157372_10115046 | |||
| 1613 | Ga0157375_10012100 | |||
| 1614 | Ga0157375_10093279 | |||
| 1615 | Ga0157375_10143337 | |||
| 1616 | Ga0157375_10161973 | |||
| 1617 | Ga0157375_10180123 | |||
| 1618 | Ga0157375_10208908 | |||
| 1619 | Ga0163163_10041705 | |||
| 1620 | Ga0163163_10043180 | |||
| 1621 | Ga0163163_10059442 | |||
| 1622 | Ga0163163_10532305 | |||
| 1623 | Ga0157380_10008637 | |||
| 1624 | Ga0157380_10017556 | |||
| 1625 | Ga0157380_10054326 | |||
| 1626 | Ga0157380_10085012 | |||
| 1627 | Ga0182008_10001859 | |||
| 1628 | Ga0157376_10011111 | |||
| 1629 | Ga0157376_10017188 | |||
| 1630 | Ga0157376_10058664 | |||
| 1631 | Ga0157376_10075977 | |||
| 1632 | Ga0157376_10174927 | |||
| 1633 | Ga0182006_1033054 | |||
| 1634 | Ga0182007_10034369 | |||
| 1635 | Ga0182005_1050966 | |||
| 1636 | Ga0163161_10040170 | |||
| 1637 | Ga0163161_10111624 | |||
| 1638 | Ga0163161_10140267 | |||
| 1639 | Ga0197907_10473388 | |||
| 1640 | Ga0197907_10923252 | |||
| 1641 | Ga0206356_11213931 | |||
| 1642 | Ga0206354_10223969 | |||
| 1643 | Ga0206353_12050450 | |||
| 1644 | Ga0213871_10004391 | |||
| 1645 | Ga0207653_10000706 | |||
| 1646 | Ga0207692_10127069 | |||
| 1647 | Ga0207642_10025781 | |||
| 1648 | Ga0207642_10026068 | |||
| 1649 | Ga0207710_10207182 | |||
| 1650 | Ga0207688_10001506 | |||
| 1651 | Ga0207688_10026312 | |||
| 1652 | Ga0207688_10052556 | |||
| 1653 | Ga0207647_10045802 | |||
| 1654 | Ga0207647_10054407 | |||
| 1655 | Ga0207685_10002057 | |||
| 1656 | Ga0207699_10002792 | |||
| 1657 | Ga0207699_10023391 | |||
| 1658 | Ga0207699_10032535 | |||
| 1659 | Ga0207699_10064178 | |||
| 1660 | Ga0207645_10016793 | |||
| 1661 | Ga0207643_10069377 | |||
| 1662 | Ga0207705_10020114 | |||
| 1663 | Ga0207684_10033327 | |||
| 1664 | Ga0207684_10234760 | |||
| 1665 | Ga0207654_10024116 | |||
| 1666 | Ga0207654_10254875 | |||
| 1667 | Ga0207707_10085241 | |||
| 1668 | Ga0207707_10161486 | |||
| 1669 | Ga0207707_10316358 | |||
| 1670 | Ga0207695_10080080 | |||
| 1671 | Ga0207693_10003257 | |||
| 1672 | Ga0207693_10008247 | |||
| 1673 | Ga0207693_10010065 | |||
| 1674 | Ga0207693_10068551 | |||
| 1675 | Ga0207693_10091164 | |||
| 1676 | Ga0207693_10100409 | |||
| 1677 | Ga0207693_10169112 | |||
| 1678 | Ga0207693_10217090 | |||
| 1679 | Ga0207663_10003189 | |||
| 1680 | Ga0207663_10003420 | |||
| 1681 | Ga0207663_10087960 | |||
| 1682 | Ga0207663_10102018 | |||
| 1683 | Ga0207660_10115663 | |||
| 1684 | Ga0207660_10139842 | |||
| 1685 | Ga0207660_10210502 | |||
| 1686 | Ga0207657_10001257 | |||
| 1687 | Ga0207657_10024586 | |||
| 1688 | Ga0207657_10025289 | |||
| 1689 | Ga0207649_10009762 | |||
| 1690 | Ga0207649_10131834 | |||
| 1691 | Ga0207646_10002821 | |||
| 1692 | Ga0207646_10003492 | |||
| 1693 | Ga0207646_10021147 | |||
| 1694 | Ga0207646_10335145 | |||
| 1695 | Ga0207681_10011318 | |||
| 1696 | Ga0207694_10099520 | |||
| 1697 | Ga0207694_10150501 | |||
| 1698 | Ga0207694_10279167 | |||
| 1699 | Ga0207694_10323004 | |||
| 1700 | Ga0207650_10272570 | |||
| 1701 | Ga0207687_10036563 | |||
| 1702 | Ga0207687_10060860 | |||
| 1703 | Ga0207687_10236544 | |||
| 1704 | Ga0207687_10341845 | |||
| 1705 | Ga0207700_10000022 | |||
| 1706 | Ga0207700_10031795 | |||
| 1707 | Ga0207700_10044203 | |||
| 1708 | Ga0207700_10113520 | |||
| 1709 | Ga0207700_10122007 | |||
| 1710 | Ga0207664_10013893 | |||
| 1711 | Ga0207664_10030458 | |||
| 1712 | Ga0207664_10045034 | |||
| 1713 | Ga0207664_10067147 | |||
| 1714 | Ga0207664_10077608 | |||
| 1715 | Ga0207664_10090520 | |||
| 1716 | Ga0207664_10164354 | |||
| 1717 | Ga0207664_10199161 | |||
| 1718 | Ga0207664_10247947 | |||
| 1719 | Ga0207664_10255617 | |||
| 1720 | Ga0207644_10096116 | |||
| 1721 | Ga0207644_10170350 | |||
| 1722 | Ga0207644_10193021 | |||
| 1723 | Ga0207644_10287266 | |||
| 1724 | Ga0207690_10021692 | |||
| 1725 | Ga0207706_10110601 | |||
| 1726 | Ga0207686_10171676 | |||
| 1727 | Ga0207709_10074230 | |||
| 1728 | Ga0207670_10118608 | |||
| 1729 | Ga0207670_10132922 | |||
| 1730 | Ga0207669_10041985 | |||
| 1731 | Ga0207669_10349636 | |||
| 1732 | Ga0207704_10008355 | |||
| 1733 | Ga0207665_10001486 | |||
| 1734 | Ga0207665_10005029 | |||
| 1735 | Ga0207665_10006641 | |||
| 1736 | Ga0207665_10017861 | |||
| 1737 | Ga0207665_10017917 | |||
| 1738 | Ga0207665_10127788 | |||
| 1739 | Ga0207665_10174995 | |||
| 1740 | Ga0207691_10039931 | |||
| 1741 | Ga0207691_10267028 | |||
| 1742 | Ga0207689_10079904 | |||
| 1743 | Ga0207661_10000280 | |||
| 1744 | Ga0207661_10014641 | |||
| 1745 | Ga0207661_10025935 | |||
| 1746 | Ga0207661_10365157 | |||
| 1747 | Ga0207679_10006334 | |||
| 1748 | Ga0207667_10083314 | |||
| 1749 | Ga0207667_10114568 | |||
| 1750 | Ga0207651_10169266 | |||
| 1751 | Ga0207712_10003543 | |||
| 1752 | Ga0207712_10061376 | |||
| 1753 | Ga0207712_10124700 | |||
| 1754 | Ga0207668_10015573 | |||
| 1755 | Ga0207640_10100837 | |||
| 1756 | Ga0207640_10110630 | |||
| 1757 | Ga0207677_10271905 | |||
| 1758 | Ga0207639_10136895 | |||
| 1759 | Ga0207639_10385523 | |||
| 1760 | Ga0207678_10010336 | |||
| 1761 | Ga0207678_10013645 | |||
| 1762 | Ga0207678_10054124 | |||
| 1763 | Ga0207708_10001375 | |||
| 1764 | Ga0207708_10015219 | |||
| 1765 | Ga0207708_10027151 | |||
| 1766 | Ga0207708_10063147 | |||
| 1767 | Ga0207702_10011811 | |||
| 1768 | Ga0207702_10029366 | |||
| 1769 | Ga0207702_10060850 | |||
| 1770 | Ga0207702_10105371 | |||
| 1771 | Ga0207702_10263209 | |||
| 1772 | Ga0207648_10001234 | |||
| 1773 | Ga0207648_10003746 | |||
| 1774 | Ga0207648_10083381 | |||
| 1775 | Ga0207648_10137097 | |||
| 1776 | Ga0207648_10316633 | |||
| 1777 | Ga0207676_10023155 | |||
| 1778 | Ga0207674_10017679 | |||
| 1779 | Ga0207674_10286795 | |||
| 1780 | Ga0207675_100003926 | |||
| 1781 | Ga0207675_100059947 | |||
| 1782 | Ga0207675_100243088 | |||
| 1783 | Ga0207683_10000251 | |||
| 1784 | Ga0207683_10004522 | |||
| 1785 | Ga0207683_10059248 | |||
| 1786 | Ga0207683_10192608 | |||
| 1787 | Ga0207683_10388632 | |||
| 1788 | Ga0207683_10409490 | |||
| 1789 | Ga0207698_10010071 | |||
| 1790 | Ga0207698_10147529 | |||
| 1791 | Ga0207698_10265814 | |||
| 1792 | Ga0207428_10002020 | |||
| 1793 | Ga0207428_10002720 | |||
| 1794 | Ga0207428_10008046 | |||
| 1795 | Ga0207428_10046911 | |||
| 1796 | Ga0207428_10122285 | |||
| 1797 | Ga0268266_10022986 | |||
| 1798 | Ga0268265_10059734 | |||
| 1799 | Ga0268264_10266914 | |||
| 1800 | Ga0265326_10006881 | |||
| 1801 | Ga0265319_1002220 | |||
| 1802 | Ga0265319_1005651 | |||
| 1803 | Ga0265319_1064900 | |||
| 1804 | Ga0265334_10004270 | |||
| 1805 | Ga0265334_10011991 | |||
| 1806 | Ga0265318_10000734 | |||
| 1807 | Ga0265318_10002508 | |||
| 1808 | Ga0265318_10037984 | |||
| 1809 | Ga0265318_10110827 | |||
| 1810 | Ga0265322_10010859 | |||
| 1811 | Ga0265336_10001597 | |||
| 1812 | Ga0265338_10004917 | |||
| 1813 | Ga0265338_10005528 | |||
| 1814 | Ga0265338_10009821 | |||
| 1815 | Ga0265338_10021214 | |||
| 1816 | Ga0265338_10098710 | |||
| 1817 | Ga0265338_10107088 | |||
| 1818 | Ga0265324_10012360 | |||
| 1819 | Ga0265330_10000357 | |||
| 1820 | Ga0265332_10039483 | |||
| 1821 | Ga0265328_10000859 | |||
| 1822 | Ga0265320_10004932 | |||
| 1823 | Ga0265320_10048374 | |||
| 1824 | Ga0265325_10000216 | |||
| 1825 | Ga0265325_10118839 | |||
| 1826 | Ga0265329_10002217 | |||
| 1827 | Ga0265340_10000237 | |||
| 1828 | Ga0265340_10010730 | |||
| 1829 | Ga0265339_10002326 | |||
| 1830 | Ga0265339_10027575 | |||
| 1831 | Ga0265331_10005322 | |||
| 1832 | Ga0265327_10019761 | |||
| 1833 | Ga0265327_10032651 | |||
| 1834 | Ga0265316_10005904 | |||
| 1835 | Ga0265316_10011799 | |||
| 1836 | Ga0307408_100231576 | |||
| 1837 | Ga0307408_100357173 | |||
| 1838 | Ga0265313_10002904 | |||
| 1839 | Ga0265313_10007879 | |||
| 1840 | Ga0265314_10006843 | |||
| 1841 | Ga0265314_10017052 | |||
| 1842 | Ga0265342_10015601 | |||
| 1843 | Ga0307405_10038398 | |||
| 1844 | Ga0307413_10030326 | |||
| 1845 | Ga0307413_10060944 | |||
| 1846 | Ga0307410_10043797 | |||
| 1847 | Ga0307406_10002364 | |||
| 1848 | Ga0307407_10003046 | |||
| 1849 | Ga0307412_10038336 | |||
| 1850 | Ga0307409_100007208 | |||
| 1851 | Ga0307409_100166387 | |||
| 1852 | Ga0307416_100013284 | |||
| 1853 | Ga0307416_100058645 | |||
| 1854 | Ga0307416_100270197 | |||
| 1855 | Ga0307414_10155165 | |||
| 1856 | Ga0307411_10088562 | |||
| 1857 | Ga0307415_100336566 | |||
| 1858 | Ga0373948_0003010 | |||
| 1859 | Ga0373938_0006132 | |||
| 1860 | Ga0373938_0036267 | |||
| 1861 | Ga0373929_0002076 | |||
| 1862 | Ga0373934_0014655 | |||
| 1863 | Ga0373940_0000644 | |||
| 1864 | Ga0373949_0001669 | |||
| 1865 | Ga0373949_0007979 | |||
| 1866 | Ga0373949_0015264 | |||
| 1867 | Ga0373951_0018291 | |||
| 1868 | Ga0373932_0000955 | |||
| 1869 | Ga0373932_0045477 | |||
| 1870 | Ga0373939_0004436 | |||
| 1871 | Ga0373939_0014911 | |||
| 1872 | Ga0373941_0058134 | |||
| 1873 | Ga0373945_0118856 | |||
| 1874 | Ga0373960_0004625 | |||
| 1875 | Ga0373960_0058424 | |||
| 1876 | Ga0373943_0007478 | |||
| 1877 | Ga0373943_0140320 | |||
| 1878 | Ga0373946_0017487 | |||
| 1879 | Ga0373942_0007780 | |||
| 1880 | Ga0373962_0004080 | |||
| 1881 | Ga0373924_0051072 | |||
| 1882 | Ga0373931_0056119 | |||
| 1883 | Ga0373931_0063264 | |||
| 1884 | Ga0373931_0083920 | |||
| 1885 | Ga0373935_0052177 | |||
| 1886 | Ga0373947_0003496 | |||
| 1887 | Ga0373947_0005768 | |||
| 1888 | Ga0373937_0001174 | |||
| 1889 | Ga0373937_0086770 | |||
| 1890 | Ga0373925_0007274 | |||
| 1891 | Ga0373925_0054682 | |||
| 1892 | Ga0373925_0154791 | |||
| 1893 | Ga0395899_0004656 | |||
| 1894 | Ga0395899_0009584 | |||
| 1895 | Ga0395899_0039313 | |||
| 1896 | Ga0395899_0040595 | |||
| 1897 | Ga0395899_0256010 | |||
| 1898 | Ga0395899_0329452 | |||
| 1899 | Ga0395900_0003839 | |||
| 1900 | Ga0395900_0010317 | |||
| 1901 | Ga0395900_0016318 | |||
| 1902 | Ga0395900_0029564 | |||
| 1903 | Ga0395900_0040183 | |||
| 1904 | Ga0395900_0047824 | |||
| 1905 | Ga0395900_0072142 | |||
| 1906 | Ga0395900_0090962 | |||
| 1907 | Ga0395900_0107597 | |||
| 1908 | Ga0395900_0124571 | |||
| 1909 | Ga0395900_0161682 | |||
| 1910 | Ga0395900_0286256 | |||
| 1911 | Ga0395900_0381048 | |||
| 1912 | Ga0395898_0001992 | |||
| 1913 | Ga0395898_0003792 | |||
| 1914 | Ga0395898_0010547 | |||
| 1915 | Ga0395898_0012146 | |||
| 1916 | Ga0395898_0025341 | |||
| 1917 | Ga0395898_0028380 | |||
| 1918 | Ga0395898_0031218 | |||
| 1919 | Ga0395898_0039909 | |||
| 1920 | Ga0395898_0049122 | |||
| 1921 | Ga0395898_0052956 | |||
| 1922 | Ga0395898_0060052 | |||
| 1923 | Ga0395898_0092161 | |||
| 1924 | Ga0395898_0120938 | |||
| 1925 | Ga0395898_0127139 | |||
| 1926 | Ga0395898_0164050 | |||
| 1927 | Ga0395898_0281374 | |||
| 1928 | Ga0395898_0334224 | |||
| 1929 | Ga0395898_0422703 | |||
| 1930 | Ga0395905_0001840 | |||
| 1931 | Ga0395905_0002457 | |||
| 1932 | Ga0395905_0003930 | |||
| 1933 | Ga0395905_0004274 | |||
| 1934 | Ga0395905_0006320 | |||
| 1935 | Ga0395905_0012444 | |||
| 1936 | Ga0395905_0017732 | |||
| 1937 | Ga0395905_0062762 | |||
| 1938 | Ga0395905_0099246 | |||
| 1939 | Ga0395905_0194691 | |||
| 1940 | Ga0395901_0001040 | |||
| 1941 | Ga0395901_0004438 | |||
| 1942 | Ga0395901_0004875 | |||
| 1943 | Ga0395901_0011218 | |||
| 1944 | Ga0395901_0023144 | |||
| 1945 | Ga0395901_0028999 | |||
| 1946 | Ga0395901_0059447 | |||
| 1947 | Ga0395901_0082444 | |||
| 1948 | Ga0395901_0096979 | |||
| 1949 | Ga0395901_0099884 | |||
| 1950 | Ga0395901_0112710 | |||
| 1951 | Ga0395901_0119723 | |||
| 1952 | Ga0395901_0121275 | |||
| 1953 | Ga0395901_0155774 | |||
| 1954 | Ga0395901_0172347 | |||
| 1955 | Ga0395901_0201991 | |||
| 1956 | Ga0395901_0281511 | |||
| 1957 | Ga0395901_0348272 | |||
| 1958 | Ga0395901_0723937 | |||
| 1959 | Ga0436360_0528706 | |||
| 1960 | Ga0436363_1061005 | |||
| 1961 | Ga0439461_0008683 | |||
| 1962 | Ga0451798_0460313 | |||
| 1963 | Ga0451807_2328025 | |||
| 1964 | Ga0451807_2624602 | |||
| 1965 | Ga0451845_0113855 | |||
| 1966 | Ga0451847_0267910 | |||
| 1967 | Ga0451853_0756687 | |||
| 1968 | Ga0451853_2766170 | |||
| 1969 | Ga0451853_2770344 | |||
| 1970 | Ga0439433_0003811 | |||
| 1971 | Ga0439448_0013879 | |||
| 1972 | Ga0439451_029938 | |||
| 1973 | Ga0439462_0001422 | |||
| 1974 | Ga0450907_005687 | |||
| 1975 | Ga0439446_0037476 | |||
| 1976 | Ga0439434_0045506 | |||
| 1977 | Ga0439460_0039973 | |||
| 1978 | Ga0450918_006509 | |||
| 1979 | Ga0466969_0023324 | |||
| 1980 | Ga0466965_0033661 | |||
| 1981 | Ga0466966_0056185 | |||
| 1982 | Ga0466961_0018479 | |||
| 1983 | Ga0466961_0037920 | |||
| 1984 | Ga0466961_0096049 | |||
| 1985 | Ga0466961_0254389 | |||
| 1986 | Ga0466963_0000672 | |||
| 1987 | Ga0466963_0001044 | |||
| 1988 | Ga0466963_0001079 | |||
| 1989 | Ga0466963_0001179 | |||
| 1990 | Ga0466963_0003075 | |||
| 1991 | Ga0466963_0003353 | |||
| 1992 | Ga0466963_0003990 | |||
| 1993 | Ga0466963_0006135 | |||
| 1994 | Ga0466963_0017626 | |||
| 1995 | Ga0466963_0073664 | |||
| 1996 | Ga0466963_0123202 | |||
| 1997 | Ga0466964_0002042 | |||
| 1998 | Ga0466964_0237508 | |||
| 1999 | Ga0466971_0001056 | |||
| 2000 | Ga0466971_0005889 | |||
| 2001 | Ga0466971_0006326 | |||
| 2002 | Ga0466971_0018405 | |||
| 2003 | Ga0466971_0140155 | |||
| 2004 | Ga0466971_0148192 | |||
| 2005 | Ga0466968_0001252 | |||
| 2006 | Ga0466968_0049138 | |||
| 2007 | Ga0466968_0064230 | |||
| 2008 | Ga0466968_0068194 | |||
| 2009 | Ga0466968_0087490 | |||
| 2010 | Ga0466970_0097685 | |||
| 2011 | Ga0466970_0302357 | |||
| 2012 | Ga0466957_0002132 | |||
| 2013 | Ga0466957_0010016 | |||
| 2014 | Ga0466957_0040303 | |||
| 2015 | Ga0466957_0040881 | |||
| 2016 | Ga0466957_0113371 | |||
| 2017 | Ga0466957_0128244 | |||
| 2018 | Ga0466957_0151658 | |||
| 2019 | Ga0466957_0397770 | |||
| 2020 | Ga0466960_0002057 | |||
| 2021 | Ga0466960_0002959 | |||
| 2022 | Ga0466959_0007586 | |||
| 2023 | Ga0466959_0018754 | |||
| 2024 | Ga0466959_0089047 | |||
| 2025 | Ga0451576_0047599 | |||
| 2026 | Ga0466958_0001285 | |||
| 2027 | Ga0466958_0004493 | |||
| 2028 | Ga0466958_0004496 | |||
| 2029 | Ga0466958_0019532 | |||
| 2030 | Ga0466958_0026927 | |||
| 2031 | Ga0466958_0039301 | |||
| 2032 | Ga0466958_0071587 | |||
| 2033 | Ga0466958_0084413 | |||
| 2034 | Ga0466967_0000042 | |||
| 2035 | Ga0466967_0000848 | |||
| 2036 | Ga0466967_0003680 | |||
| 2037 | Ga0466967_0008701 | |||
| 2038 | Ga0466967_0011597 | |||
| 2039 | Ga0466967_0016125 | |||
| 2040 | Ga0466967_0019905 | |||
| 2041 | Ga0466967_0024949 | |||
| 2042 | Ga0466967_0040079 | |||
| 2043 | Ga0466967_0061596 | |||
| 2044 | Ga0466967_0064811 | |||
| 2045 | Ga0466967_0171842 | |||
| 2046 | Ga0466967_0264766 | |||
| 2047 | Ga0466967_0273653 | |||
| 2048 | Ga0466967_0322689 | |||
| 2049 | Ga0466967_0477265 | |||
| 2050 | Ga0495592_0001132 | |||
| 2051 | Ga0495592_0001599 | |||
| 2052 | Ga0495592_0077191 | |||
| 2053 | Ga0495603_0004184 | |||
| 2054 | Ga0495603_0018464 | |||
| 2055 | Ga0495603_0028450 | |||
| 2056 | Ga0495629_0002118 | |||
| 2057 | Ga0495629_0020884 | |||
| 2058 | Ga0495629_0120417 | |||
| 2059 | Ga0495629_0292885 | |||
| 2060 | Ga0495641_0002878 | |||
| 2061 | Ga0495641_0011445 | |||
| 2062 | Ga0495641_0034128 | |||
| 2063 | Ga0495641_0098897 | |||
| 2064 | Ga0495641_0100468 | |||
| 2065 | Ga0495651_0000916 | |||
| 2066 | Ga0495651_0031492 | |||
| 2067 | Ga0495651_0258577 | |||
| 2068 | Ga0495653_0009559 | |||
| 2069 | Ga0495653_0229089 | |||
| 2070 | Ga0495582_0058745 | |||
| 2071 | Ga0495582_0243668 | |||
| 2072 | Ga0495605_0110224 | |||
| 2073 | Ga0495639_0002041 | |||
| 2074 | Ga0495639_0016589 | |||
| 2075 | Ga0495639_0064124 | |||
| 2076 | Ga0495662_0008706 | |||
| 2077 | Ga0495584_0034095 | |||
| 2078 | Ga0495584_0105757 | |||
| 2079 | Ga0495585_0089347 | |||
| 2080 | Ga0495594_0001425 | |||
| 2081 | Ga0495594_0179974 | |||
| 2082 | Ga0495596_0023239 | |||
| 2083 | Ga0495608_0006157 | |||
| 2084 | Ga0495608_0029181 | |||
| 2085 | Ga0495608_0031911 | |||
| 2086 | Ga0495608_0048065 | |||
| 2087 | Ga0495618_0025325 | |||
| 2088 | Ga0495618_0112438 | |||
| 2089 | Ga0495618_0236731 | |||
| 2090 | Ga0495628_0001072 | |||
| 2091 | Ga0495628_0042328 | |||
| 2092 | Ga0495628_0299499 | |||
| 2093 | Ga0495630_0036488 | |||
| 2094 | Ga0495630_0046601 | |||
| 2095 | Ga0495630_0125164 | |||
| 2096 | Ga0495637_0053884 | |||
| 2097 | Ga0495644_0004757 | |||
| 2098 | Ga0495644_0030662 | |||
| 2099 | Ga0495663_0021388 | |||
| 2100 | Ga0495663_0070241 | |||
| 2101 | Ga0495666_0001079 | |||
| 2102 | Ga0495652_0007424 | |||
| 2103 | Ga0495652_0030241 | |||
| 2104 | Ga0495652_0084008 | |||
| 2105 | Ga0495652_0187569 | |||
| 2106 | Ga0495665_0015929 | |||
| 2107 | Ga0495665_0212414 | |||
| 2108 | Ga0495640_0014512 | |||
| 2109 | Ga0495640_0052261 | |||
| 2110 | Ga0495640_0283578 | |||
| 2111 | Ga0495586_0100307 | |||
| 2112 | Ga0495587_0000220 | |||
| 2113 | Ga0495587_0068241 | |||
| 2114 | Ga0495645_0000706 | |||
| 2115 | Ga0495645_0060499 | |||
| 2116 | Ga0495645_0245434 | |||
| 2117 | Ga0495667_0004967 | |||
| 2118 | Ga0495667_0116125 | |||
| 2119 | Ga0495656_0059590 | |||
| 2120 | Ga0495634_0058991 | |||
| 2121 | Ga0495634_0085572 | |||
| 2122 | Ga0495611_0015632 | |||
| 2123 | Ga0495635_0015500 | |||
| 2124 | Ga0495588_0002838 | |||
| 2125 | Ga0495657_0009407 | |||
| 2126 | Ga0495657_0027543 | |||
| 2127 | Ga0495599_0000198 | |||
| 2128 | Ga0495599_0015183 | |||
| 2129 | Ga0495623_0000661 | |||
| 2130 | Ga0495623_0038013 | |||
| 2131 | Ga0495646_0002159 | |||
| 2132 | Ga0495646_0070564 | |||
| 2133 | Ga0495647_0000355 | |||
| 2134 | Ga0495647_0040272 | |||
| 2135 | Ga0495658_0025460 | |||
| 2136 | Ga0495658_0055767 | |||
| 2137 | Ga0495658_0177299 | |||
| 2138 | Ga0495613_0004573 | |||
| 2139 | Ga0495613_0015395 | |||
| 2140 | Ga0495613_0081136 | |||
| 2141 | Ga0495613_0115401 | |||
| 2142 | Ga0495613_0138467 | |||
| 2143 | Ga0495624_0004708 | |||
| 2144 | Ga0495624_0011872 | |||
| 2145 | Ga0495624_0024328 | |||
| 2146 | Ga0495624_0208791 | |||
| 2147 | Ga0495589_0140399 | |||
| 2148 | Ga0495600_0069418 | |||
| 2149 | Ga0495660_0114815 | |||
| 2150 | Ga0495581_0003685 | |||
| 2151 | Ga0495581_0111033 | |||
| 2152 | Ga0495581_0111804 | |||
| 2153 | Ga0495604_0006194 | |||
| 2154 | Ga0495604_0031702 | |||
| 2155 | Ga0495636_0080833 | |||
| 2156 | Ga0495674_0034864 | |||
| 2157 | Ga0495674_0054512 | |||
| 2158 | Ga0495674_0078767 | |||
| 2159 | Ga0495674_0128173 | |||
| 2160 | Ga0495674_0153284 | |||
| 2161 | Ga0495674_0289316 | |||
| 2162 | Ga0495674_0429559 | |||
| 2163 | Ga0495676_0001358 | |||
| 2164 | Ga0495676_0031321 | |||
| 2165 | Ga0495676_0031322 | |||
| 2166 | Ga0495676_0048611 | |||
| 2167 | Ga0495676_0142571 | |||
| 2168 | Ga0495676_0185727 | |||
| 2169 | Ga0495680_0011878 | |||
| 2170 | Ga0495680_0026376 | |||
| 2171 | Ga0495680_0034667 | |||
| 2172 | Ga0495680_0127759 | |||
| 2173 | Ga0495680_0163869 | |||
| 2174 | Ga0495675_0000397 | |||
| 2175 | Ga0495675_0105317 | |||
| 2176 | Ga0495675_0158855 | |||
| 2177 | Ga0495685_047960 | |||
| 2178 | Ga0495684_0016118 | |||
| 2179 | Ga0495684_0024665 | |||
| 2180 | Ga0495684_0064227 | |||
| 2181 | Ga0495684_0073314 | |||
| 2182 | Ga0495684_0075107 | |||
| 2183 | Ga0495593_0001535 | |||
| 2184 | Ga0495602_0001486 | |||
| 2185 | Ga0495602_0044851 | |||
| 2186 | Ga0495602_0115103 | |||
| 2187 | Ga0495602_0125837 | |||
| 2188 | Ga0495602_0249292 | |||
| 2189 | Ga0495614_0000987 | |||
| 2190 | Ga0496100_0010344 | |||
| 2191 | Ga0496100_0029865 | |||
| 2192 | Ga0496100_0038773 | |||
| 2193 | Ga0496100_0045026 | |||
| 2194 | Ga0496100_0083975 | |||
| 2195 | Ga0496100_0090101 | |||
| 2196 | Ga0496100_0100524 | |||
| 2197 | Ga0496100_0131184 | |||
| 2198 | Ga0496101_0010547 | |||
| 2199 | Ga0496101_0012903 | |||
| 2200 | Ga0496101_0022317 | |||
| 2201 | Ga0496101_0027709 | |||
| 2202 | Ga0496101_0063533 | |||
| 2203 | Ga0496101_0073160 | |||
| 2204 | Ga0496102_0025643 | |||
| 2205 | Ga0496102_0049220 | |||
| 2206 | Ga0496102_0050992 | |||
| 2207 | Ga0496102_0089814 | |||
| 2208 | Ga0496102_0218890 | |||
| 2209 | Ga0496102_0227781 | |||
| 2210 | Ga0496102_0251161 | |||
| 2211 | Ga0496102_0256087 | |||
| 2212 | Ga0496103_0004207 | |||
| 2213 | Ga0496103_0022803 | |||
| 2214 | Ga0496103_0043306 | |||
| 2215 | Ga0496103_0193363 | |||
| 2216 | Ga0496104_0000762 | |||
| 2217 | Ga0496104_0003786 | |||
| 2218 | Ga0496104_0007525 | |||
| 2219 | Ga0496104_0014730 | |||
| 2220 | Ga0496104_0015022 | |||
| 2221 | Ga0496104_0022899 | |||
| 2222 | Ga0496104_0063201 | |||
| 2223 | Ga0496104_0063735 | |||
| 2224 | Ga0496104_0086782 | |||
| 2225 | Ga0496104_0098329 | |||
| 2226 | Ga0496104_0132758 | |||
| 2227 | Ga0496104_0335493 | |||
| 2228 | Ga0496105_0001467 | |||
| 2229 | Ga0496105_0002609 | |||
| 2230 | Ga0496105_0003350 | |||
| 2231 | Ga0496105_0012928 | |||
| 2232 | Ga0496105_0016790 | |||
| 2233 | Ga0496105_0041895 | |||
| 2234 | Ga0496105_0147054 | |||
| 2235 | Ga0496105_0159547 | |||
| 2236 | Ga0496105_0189692 | |||
| 2237 | Ga0496105_0229584 | |||
| 2238 | Ga0496106_0003112 | |||
| 2239 | Ga0496106_0013604 | |||
| 2240 | Ga0496106_0075564 | |||
| 2241 | Ga0496106_0160191 | |||
| 2242 | Ga0496106_0217619 | |||
| 2243 | Ga0496106_0248262 | |||
| 2244 | Ga0496106_0255901 | |||
| 2245 | Ga0496106_0269936 | |||
| 2246 | Ga0496107_0008446 | |||
| 2247 | Ga0496107_0059860 | |||
| 2248 | Ga0496107_0093113 | |||
| 2249 | Ga0496107_0110318 | |||
| 2250 | Ga0496107_0138004 | |||
| 2251 | Ga0496108_0007426 | |||
| 2252 | Ga0496108_0016964 | |||
| 2253 | Ga0496108_0019890 | |||
| 2254 | Ga0496108_0020099 | |||
| 2255 | Ga0496108_0020363 | |||
| 2256 | Ga0496108_0031526 | |||
| 2257 | Ga0496108_0037674 | |||
| 2258 | Ga0496108_0039838 | |||
| 2259 | Ga0496108_0257854 | |||
| 2260 | Ga0496108_0295160 | |||
| 2261 | Ga0496109_0001678 | |||
| 2262 | Ga0496109_0005820 | |||
| 2263 | Ga0496109_0006942 | |||
| 2264 | Ga0496109_0007370 | |||
| 2265 | Ga0496109_0021042 | |||
| 2266 | Ga0496109_0027321 | |||
| 2267 | Ga0496109_0028172 | |||
| 2268 | Ga0496109_0031372 | |||
| 2269 | Ga0496109_0040527 | |||
| 2270 | Ga0496109_0047246 | |||
| 2271 | Ga0496109_0053762 | |||
| 2272 | Ga0496109_0062147 | |||
| 2273 | Ga0496109_0084681 | |||
| 2274 | Ga0496109_0085770 | |||
| 2275 | Ga0496109_0105382 | |||
| 2276 | Ga0496109_0171550 | |||
| 2277 | Ga0496109_0266110 | |||
| 2278 | Ga0496109_0297703 | |||
| 2279 | Ga0496109_0479104 | |||
| 2280 | Ga0496110_0004864 | |||
| 2281 | Ga0496110_0009208 | |||
| 2282 | Ga0496110_0011684 | |||
| 2283 | Ga0496110_0016094 | |||
| 2284 | Ga0496110_0020715 | |||
| 2285 | Ga0496110_0133261 | |||
| 2286 | Ga0496110_0188400 | |||
| 2287 | Ga0496111_0000087 | |||
| 2288 | Ga0496111_0000169 | |||
| 2289 | Ga0496111_0005536 | |||
| 2290 | Ga0496111_0015572 | |||
| 2291 | Ga0496111_0023702 | |||
| 2292 | Ga0496111_0049805 | |||
| 2293 | Ga0496111_0186932 | |||
| 2294 | Ga0496111_0245787 | |||
| 2295 | Ga0496112_0000851 | |||
| 2296 | Ga0496112_0002074 | |||
| 2297 | Ga0496112_0008833 | |||
| 2298 | Ga0496112_0010874 | |||
| 2299 | Ga0496112_0012920 | |||
| 2300 | Ga0496112_0016175 | |||
| 2301 | Ga0496112_0033998 | |||
| 2302 | Ga0496112_0070960 | |||
| 2303 | Ga0496112_0094249 | |||
| 2304 | Ga0496112_0125551 | |||
| 2305 | Ga0496112_0138402 | |||
| 2306 | Ga0496112_0248630 | |||
| 2307 | Ga0496112_0283648 | |||
| 2308 | Ga0496112_0307198 | |||
| 2309 | Ga0496112_0366714 | |||
| 2310 | Ga0496113_0000554 | |||
| 2311 | Ga0496113_0010767 | |||
| 2312 | Ga0496113_0030604 | |||
| 2313 | Ga0496113_0068576 | |||
| 2314 | Ga0496113_0106403 | |||
| 2315 | Ga0496113_0145685 | |||
| 2316 | Ga0496113_0357363 | |||
| 2317 | Ga0496114_0001058 | |||
| 2318 | Ga0496114_0009256 | |||
| 2319 | Ga0496114_0015503 | |||
| 2320 | Ga0496114_0019602 | |||
| 2321 | Ga0496114_0032440 | |||
| 2322 | Ga0496114_0085386 | |||
| 2323 | Ga0496114_0103239 | |||
| 2324 | Ga0496114_0116692 | |||
| 2325 | Ga0496114_0214923 | |||
| 2326 | Ga0496114_0263675 | |||
| 2327 | Ga0496114_0305446 | |||
| 2328 | Ga0496114_0320328 | |||
| 2329 | Ga0496114_0467677 | |||
| 2330 | Ga0496115_0006404 | |||
| 2331 | Ga0496115_0007807 | |||
| 2332 | Ga0496115_0029957 | |||
| 2333 | Ga0496115_0037556 | |||
| 2334 | Ga0496115_0082577 | |||
| 2335 | Ga0496115_0111812 | |||
| 2336 | Ga0501031_0004099 | |||
| 2337 | Ga0501031_0012817 | |||
| 2338 | Ga0501031_0015523 | |||
| 2339 | Ga0501031_0107483 | |||
| 2340 | Ga0501031_0162375 | |||
| 2341 | Ga0501031_0227203 | |||
| 2342 | Ga0501032_0035979 | |||
| 2343 | Ga0501033_0057657 | |||
| 2344 | Ga0501033_0110163 | |||
| 2345 | Ga0501034_0055570 | |||
| 2346 | Ga0501034_0328561 | |||
| 2347 | Ga0501036_0001027 | |||
| 2348 | Ga0501036_0030129 | |||
| 2349 | Ga0501036_0038811 | |||
| 2350 | Ga0501036_0094818 | |||
| 2351 | Ga0501036_0134814 | |||
| 2352 | Ga0501036_0167895 | |||
| 2353 | Ga0501036_0241326 | |||
| 2354 | Ga0501037_0008607 | |||
| 2355 | Ga0501037_0134529 | |||
| 2356 | Ga0501038_0011389 | |||
| 2357 | Ga0501038_0027212 | |||
| 2358 | Ga0501038_0096340 | |||
| 2359 | Ga0501038_0125209 | |||
| 2360 | Ga0501038_0153325 | |||
| 2361 | Ga0501039_0017673 | |||
| 2362 | Ga0501039_0038348 | |||
| 2363 | Ga0501039_0050226 | |||
| 2364 | Ga0501039_0058486 | |||
| 2365 | Ga0501039_0134433 | |||
| 2366 | Ga0501039_0167927 | |||
| 2367 | Ga0501040_0087473 | |||
| 2368 | Ga0501040_0104245 | |||
| 2369 | Ga0501040_0208319 | |||
| 2370 | Ga0501041_0027037 | |||
| 2371 | Ga0501041_0039808 | |||
| 2372 | Ga0501041_0072234 | |||
| 2373 | Ga0501041_0081685 | |||
| 2374 | Ga0501041_0100191 | |||
| 2375 | Ga0501041_0115855 | |||
| 2376 | Ga0501042_0000334 | |||
| 2377 | Ga0501042_0026797 | |||
| 2378 | Ga0501042_0041803 | |||
| 2379 | Ga0501042_0066661 | |||
| 2380 | Ga0501042_0078895 | |||
| 2381 | Ga0501042_0084497 | |||
| 2382 | Ga0501042_0086270 | |||
| 2383 | Ga0501042_0118211 | |||
| 2384 | Ga0501042_0134003 | |||
| 2385 | Ga0501042_0212804 | |||
| 2386 | Ga0501042_0293926 | |||
| 2387 | Ga0501043_0097097 | |||
| 2388 | Ga0501043_0118017 | |||
| 2389 | Ga0501043_0286752 | |||
| 2390 | Ga0501046_0019986 | |||
| 2391 | Ga0501046_0022389 | |||
| 2392 | Ga0501046_0142452 | |||
| 2393 | Ga0501047_0293558 | |||
| 2394 | Ga0501048_0002894 | |||
| 2395 | Ga0501048_0003753 | |||
| 2396 | Ga0501048_0060796 | |||
| 2397 | Ga0501048_0123692 | |||
| 2398 | Ga0501048_0160224 | |||
| 2399 | Ga0501048_0224726 | |||
| 2400 | Ga0501067_0004777 | |||
| 2401 | Ga0501067_0008835 | |||
| 2402 | Ga0501067_0016414 | |||
| 2403 | Ga0501067_0029527 | |||
| 2404 | Ga0501067_0035407 | |||
| 2405 | Ga0501068_0102208 | |||
| 2406 | Ga0501068_0244102 | |||
| 2407 | Ga0501069_0006563 | |||
| 2408 | Ga0501069_0010165 | |||
| 2409 | Ga0501069_0044822 | |||
| 2410 | Ga0501069_0064797 | |||
| 2411 | Ga0501069_0090185 | |||
| 2412 | Ga0501069_0112788 | |||
| 2413 | Ga0501069_0156653 | |||
| 2414 | Ga0501069_0192839 | |||
| 2415 | Ga0501070_0012254 | |||
| 2416 | Ga0501070_0029191 | |||
| 2417 | Ga0501070_0038651 | |||
| 2418 | Ga0501070_0129386 | |||
| 2419 | Ga0501070_0214491 | |||
| 2420 | Ga0501070_0318248 | |||
| 2421 | Ga0501070_0382388 | |||
| 2422 | Ga0501071_0000345 | |||
| 2423 | Ga0501071_0000651 | |||
| 2424 | Ga0501071_0004549 | |||
| 2425 | Ga0501071_0023965 | |||
| 2426 | Ga0501071_0030981 | |||
| 2427 | Ga0501071_0065632 | |||
| 2428 | Ga0501071_0092372 | |||
| 2429 | Ga0501071_0157307 | |||
| 2430 | Ga0501072_0004103 | |||
| 2431 | Ga0501072_0011364 | |||
| 2432 | Ga0501072_0055933 | |||
| 2433 | Ga0501072_0098642 | |||
| 2434 | Ga0501072_0131272 | |||
| 2435 | Ga0501072_0131654 | |||
| 2436 | Ga0501072_0140478 | |||
| 2437 | Ga0501072_0257150 | |||
| 2438 | Ga0501073_0091237 | |||
| 2439 | Ga0501073_0140866 | |||
| 2440 | Ga0501073_0183644 | |||
| 2441 | Ga0501073_0236590 | |||
| 2442 | Ga0501074_0000765 | |||
| 2443 | Ga0501074_0025731 | |||
| 2444 | Ga0501074_0043447 | |||
| 2445 | Ga0501074_0046599 | |||
| 2446 | Ga0501074_0048279 | |||
| 2447 | Ga0501074_0062128 | |||
| 2448 | Ga0501075_0005215 | |||
| 2449 | Ga0501075_0006054 | |||
| 2450 | Ga0501075_0029033 | |||
| 2451 | Ga0501075_0038185 | |||
| 2452 | Ga0501075_0050468 | |||
| 2453 | Ga0501075_0076718 | |||
| 2454 | Ga0501075_0088665 | |||
| 2455 | Ga0501075_0253102 | |||
| 2456 | Ga0501075_0317699 | |||
| 2457 | Ga0501076_0001235 | |||
| 2458 | Ga0501076_0001689 | |||
| 2459 | Ga0501076_0006917 | |||
| 2460 | Ga0501076_0027563 | |||
| 2461 | Ga0501076_0042028 | |||
| 2462 | Ga0501076_0097859 | |||
| 2463 | Ga0501076_0164777 | |||
| 2464 | Ga0501076_0204025 | |||
| 2465 | Ga0501076_0396075 | |||
| 2466 | Ga0501077_0002770 | |||
| 2467 | Ga0501077_0002957 | |||
| 2468 | Ga0501077_0003278 | |||
| 2469 | Ga0501077_0004842 | |||
| 2470 | Ga0501077_0022027 | |||
| 2471 | Ga0501077_0030518 | |||
| 2472 | Ga0501077_0043829 | |||
| 2473 | Ga0501079_0001742 | |||
| 2474 | Ga0501079_0014007 | |||
| 2475 | Ga0501079_0015752 | |||
| 2476 | Ga0501079_0047722 | |||
| 2477 | Ga0501079_0064690 | |||
| 2478 | Ga0501079_0072254 | |||
| 2479 | Ga0501079_0073185 | |||
| 2480 | Ga0501079_0129038 | |||
| 2481 | Ga0501079_0208308 | |||
| 2482 | Ga0501079_0242642 | |||
| 2483 | Ga0501079_0292218 | |||
| 2484 | Ga0501079_0323427 | |||
| 2485 | Ga0501080_0001741 | |||
| 2486 | Ga0501080_0014743 | |||
| 2487 | Ga0501080_0021050 | |||
| 2488 | Ga0501080_0100701 | |||
| 2489 | Ga0501080_0432652 | |||
| 2490 | Ga0501080_0480838 | |||
| 2491 | Ga0501080_0540195 | |||
| 2492 | Ga0501081_0011390 | |||
| 2493 | Ga0501081_0033516 | |||
| 2494 | Ga0501081_0066525 | |||
| 2495 | Ga0501081_0090187 | |||
| 2496 | Ga0501081_0478007 | |||
| 2497 | Ga0501083_0002789 | |||
| 2498 | Ga0501083_0106251 | |||
| 2499 | Ga0501035_0055540 | |||
| 2500 | Ga0501035_0057550 | |||
| 2501 | Ga0501035_0144311 | |||
| 2502 | Ga0501044_0064260 | |||
| 2503 | Ga0501044_0266320 | |||
| 2504 | Ga0501044_0354121 | |||
| 2505 | Ga0501045_0000466 | |||
| 2506 | Ga0501045_0021227 | |||
| 2507 | Ga0501045_0024988 | |||
| 2508 | Ga0501045_0070220 | |||
| 2509 | Ga0501045_0153931 | |||
| 2510 | Ga0501045_0194885 | |||
| 2511 | Ga0501045_0210014 | |||
| 2512 | Ga0501045_0258341 | |||
| 2513 | nmdc:mga03n38_53242_c1 | |||
| 2514 | nmdc:mga0yw44_24081_c1 | |||
| 2515 | nmdc:mga0yw44_61198_c1 | |||
| 2516 | nmdc:mga0yw44_89141_c1 | |||
| 2517 | nmdc:mga06z11_121520_c1 | |||
| 2518 | nmdc:mga07m45_153117_c1 | |||
| 2519 | nmdc:mga05p37_138911_c1 | |||
| 2520 | nmdc:mga05p37_163762_c1 | |||
| 2521 | nmdc:mga05p37_197477_c1 | |||
| 2522 | nmdc:mga05p37_205886_c1 | |||
| 2523 | nmdc:mga05p37_24832_c1 | |||
| 2524 | nmdc:mga05p37_301408_c1 | |||
| 2525 | nmdc:mga05p37_325938_c1 | |||
| 2526 | nmdc:mga05p37_36994_c1 | |||
| 2527 | nmdc:mga05p37_397190_c1 | |||
| 2528 | nmdc:mga05p37_524882_c1 | |||
| 2529 | nmdc:mga05p37_778672_c1 | |||
| 2530 | nmdc:mga05p37_7975_c1 | |||
| 2531 | nmdc:mga09592_268488_c1 | |||
| 2532 | nmdc:mga09592_313131_c1 | |||
| 2533 | nmdc:mga0qj67_22002_c1 | |||
| 2534 | nmdc:mga06r32_18303_c1 | |||
| 2535 | nmdc:mga06r32_246323_c1 | |||
| 2536 | nmdc:mga06r32_413387_c1 | |||
| 2537 | nmdc:mga06r32_59154_c1 | |||
| 2538 | nmdc:mga08y16_338472_c1 | |||
| 2539 | nmdc:mga08y16_38551_c1 | |||
| 2540 | nmdc:mga08y16_38628_c1 | |||
| 2541 | nmdc:mga08y16_46381_c1 | |||
| 2542 | nmdc:mga08y16_48743_c1 | |||
| 2543 | nmdc:mga08y16_70469_c1 | |||
| 2544 | nmdc:mga0n895_22483_c1 | |||
| 2545 | nmdc:mga0n895_24597_c1 | |||
| 2546 | nmdc:mga0n895_2766_c1 | |||
| 2547 | nmdc:mga0n895_32662_c1 | |||
| 2548 | nmdc:mga0n895_746978_c1 | |||
| 2549 | nmdc:mga0rr50_2093_c1 | |||
| 2550 | nmdc:mga0rr50_21347_c1 | |||
| 2551 | nmdc:mga08x19_75551_c1 | |||
| 2552 | nmdc:mga08x19_7697_c1 | |||
| 2553 | nmdc:mga0a205_135556_c1 | |||
| 2554 | nmdc:mga0a205_185775_c1 | |||
| 2555 | nmdc:mga0a205_2963_c1 | |||
| 2556 | nmdc:mga0a205_377473_c1 | |||
| 2557 | nmdc:mga0a205_5364_c2 | |||
| 2558 | nmdc:mga0a205_82072_c1 | |||
| 2559 | Ga0495601_0000554 | |||
| 2560 | Ga0495601_0005595 | |||
| 2561 | Ga0495601_0054791 | |||
| 2562 | Ga0495601_0277829 | |||
| 2563 | Ga0495612_0062475 | |||
| 2564 | Ga0495595_0004995 | |||
| 2565 | Ga0495595_0135643 | |||
| 2566 | Ga0495619_0011831 | |||
| 2567 | Ga0495619_0037689 | |||
| 2568 | Ga0495619_0119965 | |||
| 2569 | Ga0501084_0001413 | |||
| 2570 | Ga0501084_0005329 | |||
| 2571 | Ga0501084_0011565 | |||
| 2572 | Ga0501084_0012787 | |||
| 2573 | Ga0501084_0025635 | |||
| 2574 | Ga0501084_0054611 | |||
| 2575 | Ga0501084_0232423 | |||
| 2576 | Ga0590077_029194 | |||
| 2577 | Ga0587082_013214 | |||
| 2578 | Ga0501082_0004874 | |||
| 2579 | Ga0501082_0041542 | |||
| 2580 | Ga0501082_0055012 | |||
| 2581 | Ga0501082_0091858 | |||
| 2582 | Ga0501082_0125999 | |||
| 2583 | Ga0501082_0290676 | |||
| 2584 | Ga0466962_0000503 | |||
| 2585 | Ga0466962_0002558 | |||
| 2586 | Ga0466962_0019082 | |||
| 2587 | Ga0466962_0104416 | |||
| 2588 | Ga0466962_0115071 | |||
| 2589 | Ga0530510_0001475 | |||
| 2590 | Ga0530510_0008884 | |||
| 2591 | Ga0530510_0065612 | |||
| 2592 | Ga0530510_0134861 | |||
| 2593 | Ga0530510_0383345 | |||
| 2594 | Ga0530510_0416766 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4whx-assembly1.cif.gz_E | x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate | 0.9247 | 2 | 298 |
| 1i1l-assembly1.cif.gz_A | crystal structure of eschelichia coli branched-chain amino acid aminotransferase. | 0.9236 | 3 | 302 |
| 6nst-assembly1.cif.gz_F | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9181 | 2 | 302 |
| 6nst-assembly1.cif.gz_B | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9178 | 2 | 301 |
| 6nst-assembly1.cif.gz_A | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.917 | 2 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4whxA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.929 | 5 | 129 | 3.30.470.10 |
| af_P0AB80_8_124_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9228 | 7 | 119 | 3.30.470.10 |
| 4whxA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.908 | 5 | 129 | 3.30.470.10 |
| 5ce8C01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9043 | 6 | 125 | 3.30.470.10 |
| 6gkrB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9029 | 137 | 290 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832RNB9-F1-model_v4 | Branched chain amino acid aminotransferase | 0.9738 | 167 | 302 |
GO:0008483
GO:0046394 |
| AF-A0A351XCR6-F1-model_v4 | Branched chain amino acid aminotransferase (EC 2.6.1.42) | 0.9735 | 174 | 303 |
GO:0004084
GO:0005829 GO:0046394 |
| AF-A0A3B9FPM8-F1-model_v4 | Branched-chain amino acid aminotransferase | 0.9699 | 172 | 289 |
GO:0005829
GO:0008483 GO:0008652 GO:0009082 |
| AF-A0A2R6AU00-F1-model_v4 | Branched-chain amino acid aminotransferase | 0.968 | 162 | 274 |
GO:0008483
GO:0008652 GO:0009082 |
| AF-A0A6J6ZAT6-F1-model_v4 | Unannotated protein | 0.9669 | 183 | 302 |
GO:0003824
GO:0046394 |