F492672

General Info

Members Datasets Scaffolds Average Seq Length
1294 402 1296 145

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0010674|Ga0495673_0010674_3367_3900
Length 177
Sequence MGLSRRIRPQAGSDGERVRRAAMSCGLEERLYMKGLLQRVRGARVDVAGQTVGAIDQGLLVLVGIEPHDTQASADKLLHKLLNYRVFSDSEGKMNLSLSDVSGGLLLVSQFTLAADTKSGMRPSFSKAAPPALGAELFEYLVSKAKSSHATVQTGQFGADMQVHLVNDGPVTFLLET

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
83 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
84 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
85 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
158 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
176 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
177 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
207 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
219 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
222 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
223 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
227 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
228 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
229 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
230 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
234 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
235 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
236 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
237 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
238 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
239 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
240 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
241 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
242 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
243 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
244 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
245 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
246 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
247 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
248 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
249 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
250 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
251 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
252 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
255 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
256 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
257 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
258 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
259 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
260 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
261 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
262 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
263 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
277 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
362 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
363 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
364 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
373 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
374 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
375 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
382 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
383 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
392 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
393 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
394 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
399 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
400 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
401 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.51
Nodule 1
Rhizoplane 1.85
Rhizosphere 79.68
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1652 2124908027 Bacteria 30845
2 MRS2a_Contig_26165 2124908027 Bacteria 966
3 SwRhRL2b_contig_3940779 2162886007 Bacteria 956
4 SwRhRL2b_contig_70830 2162886007 Bacteria 2326
5 MRS1b_contig_5249422 2162886011 Bacteria 1777
6 JGI25162J39368_1000098 3300002737 Bacteria 95821
7 JGI25162J39368_1000129 3300002737 Bacteria 83712
8 JGI25163J39215_1002778 3300002771 Bacteria 1633
9 JGI25163J39215_1003023 3300002771 Bacteria 1466
10 JGI25164J39214_1000076 3300002772 Bacteria 95821
11 JGI25164J39214_1000101 3300002772 Bacteria 83715
12 JGI25151J46595_10046496 3300003187 Bacteria 1520
13 JGI25165J46597_1000150 3300003214 Bacteria 115430
14 JGI25165J46597_1000180 3300003214 Bacteria 95821
15 JGI25153J46596_10031647 3300003215 Bacteria 1777
16 rootH1_10035872 3300003316 Unclassified 3431
17 rootH1_10035872 3300003323 Bacteria 6513
18 rootL2_10217267 3300003322 Bacteria 2552
19 rootH1_10034721 3300003316 Bacteria 11808
20 rootH1_10034721 3300003323 Bacteria 8212
21 rootH1_10059234 3300003323 Bacteria 2665
22 Ga0006562J51391_1076555 3300003578 Bacteria 3730
23 Ga0006562J51391_1076556 3300003578 Bacteria 3460
24 Ga0055538_1000037 3300003751 Bacteria 190238
25 Ga0055539_1000048 3300003752 Bacteria 190238
26 Ga0055533_1000059 3300003756 Bacteria 190238
27 Ga0055532_1000105 3300003758 Bacteria 91428
28 Ga0055525_1000128 3300003759 Bacteria 113553
29 Ga0055537_1001077 3300003773 Bacteria 12069
30 Ga0055536_1000312 3300003781 Bacteria 36538
31 Ga0055536_1000424 3300003781 Bacteria 30127
32 Ga0055534_1000296 3300003784 Bacteria 33373
33 Ga0055528_1001392 3300003790 Bacteria 14850
34 Ga0055530_10000639 3300003791 Bacteria 30128
35 Ga0055530_10001069 3300003791 Bacteria 21600
36 Ga0055540_1000217 3300003792 Bacteria 54396
37 Ga0055540_1000339 3300003792 Bacteria 40092
38 Ga0055540_1001192 3300003792 Bacteria 16028
39 Ga0055540_1008969 3300003792 Bacteria 3526
40 Ga0055531_10000238 3300003794 Bacteria 60414
41 Ga0055531_10000275 3300003794 Bacteria 53122
42 Ga0055541_1000035 3300003841 Bacteria 190238
43 Ga0065714_10004152 3300005288 Bacteria 8202
44 Ga0065714_10004743 3300005288 Bacteria 5776
45 Ga0065714_10005538 3300005288 Bacteria 3833
46 Ga0065714_10007187 3300005288 Bacteria 3714
47 Ga0065714_10011991 3300005288 Bacteria 2023
48 Ga0065714_10026002 3300005288 Bacteria 1134
49 Ga0065714_10072198 3300005288 Bacteria 3414
50 Ga0065714_10076478 3300005288 Bacteria 2780
51 Ga0065714_10094649 3300005288 Bacteria 1809
52 Ga0065714_10173479 3300005288 Bacteria 993
53 Ga0065714_10217137 3300005288 Bacteria 850
54 Ga0065714_10392414 3300005288 Bacteria 587
55 Ga0065704_10000725 3300005289 Bacteria 14051
56 Ga0065704_10008367 3300005289 Bacteria 2131
57 Ga0065704_10031111 3300005289 Bacteria 1244
58 Ga0065704_10046756 3300005289 Bacteria 821
59 Ga0065704_10071344 3300005289 Bacteria 11608
60 Ga0065704_10088763 3300005289 Bacteria 2905
61 Ga0065712_10004358 3300005290 Bacteria 10357
62 Ga0065715_10012984 3300005293 Bacteria 4474
63 Ga0070676_10416140 3300005328 Bacteria 938
64 Ga0070676_10767531 3300005328 Bacteria 709
65 Ga0070683_100617932 3300005329 Bacteria 1037
66 Ga0070670_100000321 3300005331 Bacteria 40888
67 Ga0070670_100061634 3300005331 Bacteria 3219
68 Ga0070670_100245727 3300005331 Bacteria 1558
69 Ga0070670_101562085 3300005331 Bacteria 606
70 Ga0068869_101174372 3300005334 Bacteria 674
71 Ga0070661_100000501 3300005344 Bacteria 30057
72 Ga0070661_100133391 3300005344 Bacteria 1867
73 Ga0070661_100196805 3300005344 Bacteria 1539
74 Ga0070668_101268721 3300005347 Bacteria 669
75 Ga0070669_100000233 3300005353 Bacteria 46639
76 Ga0070669_100000265 3300005353 Bacteria 42842
77 Ga0070669_100186631 3300005353 Bacteria 1625
78 Ga0070675_100076352 3300005354 Bacteria 2787
79 Ga0070675_100971129 3300005354 Bacteria 780
80 Ga0070671_100812068 3300005355 Bacteria 815
81 Ga0070671_100900204 3300005355 Bacteria 773
82 Ga0070671_101308310 3300005355 Bacteria 639
83 Ga0070674_100276038 3300005356 Bacteria 1330
84 Ga0070674_100520133 3300005356 Bacteria 994
85 Ga0070673_102029460 3300005364 Bacteria 546
86 Ga0070659_100199724 3300005366 Bacteria 1646
87 Ga0070659_100525198 3300005366 Bacteria 1011
88 Ga0070667_100098163 3300005367 Bacteria 2527
89 Ga0070663_100187479 3300005455 Bacteria 1608
90 Ga0070663_100252767 3300005455 Bacteria 1395
91 Ga0070678_100368113 3300005456 Bacteria 1240
92 Ga0070678_100551066 3300005456 Bacteria 1024
93 Ga0070678_101905939 3300005456 Bacteria 561
94 Ga0070662_100000348 3300005457 Bacteria 27713
95 Ga0070662_100014630 3300005457 Bacteria 5246
96 Ga0068867_100029643 3300005459 Bacteria 3943
97 Ga0070685_10332816 3300005466 Bacteria 1033
98 Ga0068853_100000029 3300005539 Bacteria 121775
99 Ga0070686_100268760 3300005544 Bacteria 1253
100 Ga0070665_100112245 3300005548 Bacteria 2728
101 Ga0070665_100192682 3300005548 Bacteria 2039
102 Ga0070665_100458478 3300005548 Bacteria 1285
103 Ga0070665_100745358 3300005548 Bacteria 992
104 Ga0068855_100664263 3300005563 Bacteria 1118
105 Ga0070664_100000531 3300005564 Bacteria 29123
106 Ga0070664_100307290 3300005564 Bacteria 1434
107 Ga0070664_100536864 3300005564 Bacteria 1081
108 Ga0068857_100588801 3300005577 Bacteria 1051
109 Ga0068854_100006958 3300005578 Bacteria 7217
110 Ga0068854_100016734 3300005578 Bacteria 4893
111 Ga0070702_100256402 3300005615 Bacteria 1188
112 Ga0068866_10281112 3300005718 Bacteria 1031
113 Ga0068851_10000024 3300005834 Bacteria 125917
114 Ga0075368_10165566 3300006042 Bacteria 928
115 Ga0075363_100007346 3300006048 Bacteria 5056
116 Ga0075363_100022665 3300006048 Bacteria 3176
117 Ga0075363_100029510 3300006048 Bacteria 2832
118 Ga0075363_100072448 3300006048 Bacteria 1873
119 Ga0075364_10242399 3300006051 Bacteria 1224
120 Ga0075364_10331714 3300006051 Bacteria 1036
121 Ga0075364_10376387 3300006051 Bacteria 968
122 Ga0075432_10004532 3300006058 Bacteria 4731
123 Ga0075432_10005717 3300006058 Bacteria 4233
124 Ga0075432_10017130 3300006058 Bacteria 2472
125 Ga0075432_10017356 3300006058 Bacteria 2455
126 Ga0075432_10114074 3300006058 Bacteria 1010
127 Ga0075362_10006101 3300006177 Bacteria 4465
128 Ga0075362_10021790 3300006177 Bacteria 2694
129 Ga0075362_10094758 3300006177 Bacteria 1389
130 Ga0075369_10009329 3300006186 Bacteria 3808
131 Ga0075366_10007585 3300006195 Bacteria 6002
132 Ga0075366_10010713 3300006195 Bacteria 5154
133 Ga0075366_10038276 3300006195 Bacteria 2832
134 Ga0075366_10167715 3300006195 Bacteria 1332
135 Ga0075366_10745554 3300006195 Bacteria 608
136 Ga0075370_10030289 3300006353 Bacteria 3018
137 Ga0068865_100602307 3300006881 Bacteria 929
138 Ga0068865_100693823 3300006881 Bacteria 869
139 Ga0075436_100154385 3300006914 Bacteria 1616
140 Ga0075436_100683476 3300006914 Bacteria 760
141 Ga0075436_100885633 3300006914 Bacteria 667
142 Ga0075436_101009991 3300006914 Bacteria 624
143 Ga0099823_1010535 3300006944 Bacteria 9374
144 Ga0079104_1000423 3300006946 Bacteria 48297
145 Ga0079104_1001311 3300006946 Bacteria 17103
146 Ga0079104_1025028 3300006946 Bacteria 1564
147 Ga0099826_10001277 3300006948 Bacteria 14803
148 Ga0099826_10083078 3300006948 Bacteria 1987
149 Ga0099826_10086190 3300006948 Bacteria 1937
150 Ga0105251_10000191 3300009011 Bacteria 62283
151 Ga0105251_10002391 3300009011 Bacteria 14832
152 Ga0105251_10002825 3300009011 Bacteria 13133
153 Ga0105251_10010047 3300009011 Bacteria 5531
154 Ga0105251_10015601 3300009011 Bacteria 4143
155 Ga0105251_10060306 3300009011 Bacteria 1786
156 Ga0105251_10069504 3300009011 Bacteria 1641
157 Ga0105251_10069981 3300009011 Bacteria 1635
158 Ga0105251_10120773 3300009011 Bacteria 1190
159 Ga0105251_10124198 3300009011 Bacteria 1172
160 Ga0105251_10251038 3300009011 Bacteria 797
161 Ga0105251_10347369 3300009011 Bacteria 677
162 Ga0105244_10005637 3300009036 Bacteria 8272
163 Ga0105244_10006932 3300009036 Bacteria 7265
164 Ga0105244_10007352 3300009036 Bacteria 7000
165 Ga0105244_10008094 3300009036 Bacteria 6605
166 Ga0105244_10017040 3300009036 Bacteria 4118
167 Ga0105244_10032241 3300009036 Bacteria 2775
168 Ga0105244_10032876 3300009036 Bacteria 2741
169 Ga0105244_10081298 3300009036 Bacteria 1603
170 Ga0105244_10108062 3300009036 Bacteria 1356
171 Ga0105244_10117698 3300009036 Bacteria 1288
172 Ga0105244_10146400 3300009036 Bacteria 1134
173 Ga0105244_10154859 3300009036 Bacteria 1097
174 Ga0105244_10159624 3300009036 Bacteria 1077
175 Ga0105244_10217218 3300009036 Bacteria 898
176 Ga0105244_10222090 3300009036 Bacteria 886
177 Ga0105244_10243957 3300009036 Bacteria 838
178 Ga0105250_10000251 3300009092 Bacteria 44435
179 Ga0105250_10000651 3300009092 Bacteria 22012
180 Ga0105250_10002675 3300009092 Bacteria 8828
181 Ga0105250_10008561 3300009092 Bacteria 4338
182 Ga0105250_10053522 3300009092 Bacteria 1619
183 Ga0105250_10053808 3300009092 Bacteria 1614
184 Ga0105250_10057061 3300009092 Bacteria 1567
185 Ga0105250_10132908 3300009092 Bacteria 1028
186 Ga0105250_10142351 3300009092 Bacteria 994
187 Ga0105250_10299056 3300009092 Bacteria 696
188 Ga0105250_10306330 3300009092 Bacteria 688
189 Ga0105243_10000299 3300009148 Bacteria 54796
190 Ga0105243_10001658 3300009148 Bacteria 19274
191 Ga0105243_10007582 3300009148 Bacteria 8339
192 Ga0105243_10007826 3300009148 Bacteria 8216
193 Ga0105243_10029031 3300009148 Bacteria 4251
194 Ga0105243_10191408 3300009148 Bacteria 1787
195 Ga0105243_10265075 3300009148 Bacteria 1540
196 Ga0105243_10426699 3300009148 Bacteria 1238
197 Ga0105243_11040697 3300009148 Bacteria 824
198 Ga0105242_10002000 3300009176 Bacteria 16049
199 Ga0105242_10021110 3300009176 Bacteria 5110
200 Ga0105242_10819856 3300009176 Bacteria 923
201 Ga0105248_10014147 3300009177 Bacteria 8784
202 Ga0105237_10001517 3300009545 Bacteria 30445
203 Ga0105237_10186491 3300009545 Bacteria 2074
204 Ga0105249_10025181 3300009553 Bacteria 5355
205 Ga0105239_10572521 3300010375 Bacteria 1287
206 Ga0105246_10000445 3300011119 Bacteria 22189
207 Ga0105246_10002318 3300011119 Bacteria 11498
208 Ga0105246_10005000 3300011119 Bacteria 8066
209 Ga0105246_10034243 3300011119 Bacteria 3383
210 Ga0105246_10105454 3300011119 Bacteria 2060
211 Ga0157340_1000406 3300012473 Bacteria 1670
212 Ga0157336_1004931 3300012477 Bacteria 863
213 Ga0157345_1000173 3300012498 Bacteria 10374
214 Ga0157345_1001176 3300012498 Bacteria 1875
215 Ga0157347_1003443 3300012502 Bacteria 1419
216 Ga0157347_1009340 3300012502 Bacteria 1013
217 Ga0157373_10004675 3300013100 Bacteria 10293
218 Ga0157373_10012300 3300013100 Bacteria 6292
219 Ga0157373_10019102 3300013100 Bacteria 4989
220 Ga0157373_10030552 3300013100 Bacteria 3877
221 Ga0157373_10146868 3300013100 Bacteria 1659
222 Ga0157373_10169170 3300013100 Bacteria 1538
223 Ga0157373_10170281 3300013100 Bacteria 1532
224 Ga0157373_10245635 3300013100 Bacteria 1266
225 Ga0157373_10378711 3300013100 Bacteria 1012
226 Ga0157373_10434930 3300013100 Bacteria 943
227 Ga0157373_10526504 3300013100 Bacteria 855
228 Ga0157373_10619343 3300013100 Bacteria 789
229 Ga0157371_10000238 3300013102 Bacteria 78535
230 Ga0157371_10002603 3300013102 Bacteria 17131
231 Ga0157371_10006450 3300013102 Bacteria 9673
232 Ga0157371_10019314 3300013102 Bacteria 5027
233 Ga0157371_10037713 3300013102 Bacteria 3458
234 Ga0157371_10489164 3300013102 Bacteria 908
235 Ga0157371_10616652 3300013102 Bacteria 808
236 Ga0157371_11352583 3300013102 Bacteria 552
237 Ga0157370_10003628 3300013104 Bacteria 18058
238 Ga0157370_10095789 3300013104 Bacteria 2785
239 Ga0157370_10135516 3300013104 Bacteria 2295
240 Ga0157370_10156160 3300013104 Bacteria 2122
241 Ga0157370_10197817 3300013104 Bacteria 1865
242 Ga0157370_10215088 3300013104 Bacteria 1781
243 Ga0157370_10237571 3300013104 Bacteria 1686
244 Ga0157370_10263433 3300013104 Bacteria 1593
245 Ga0157370_10369500 3300013104 Bacteria 1322
246 Ga0157370_10436396 3300013104 Bacteria 1204
247 Ga0157370_10457150 3300013104 Bacteria 1174
248 Ga0157370_10484168 3300013104 Bacteria 1137
249 Ga0157370_11952538 3300013104 Bacteria 526
250 Ga0157369_10040455 3300013105 Bacteria 5088
251 Ga0157369_10115623 3300013105 Bacteria 2849
252 Ga0157369_10122183 3300013105 Bacteria 2762
253 Ga0157369_10323167 3300013105 Bacteria 1604
254 Ga0157369_10323580 3300013105 Bacteria 1603
255 Ga0157369_10496008 3300013105 Bacteria 1263
256 Ga0157378_10135724 3300013297 Bacteria 2281
257 Ga0163162_10008219 3300013306 Bacteria 10183
258 Ga0163162_10035391 3300013306 Bacteria 4975
259 Ga0163162_10088475 3300013306 Bacteria 3176
260 Ga0163162_10108847 3300013306 Bacteria 2868
261 Ga0163162_10188413 3300013306 Bacteria 2190
262 Ga0163162_10944443 3300013306 Bacteria 974
263 Ga0163162_11799778 3300013306 Bacteria 700
264 Ga0157372_10011625 3300013307 Bacteria 9372
265 Ga0157375_10008818 3300013308 Bacteria 8831
266 Ga0157375_10043933 3300013308 Bacteria 4336
267 Ga0157375_10326675 3300013308 Bacteria 1699
268 Ga0157375_10365496 3300013308 Bacteria 1609
269 Ga0157375_11224997 3300013308 Bacteria 881
270 Ga0157375_11313747 3300013308 Bacteria 850
271 Ga0157375_11374783 3300013308 Bacteria 831
272 Ga0157375_11941674 3300013308 Bacteria 699
273 Ga0157380_10423910 3300014326 Bacteria 1270
274 Ga0157380_12424941 3300014326 Bacteria 590
275 Ga0182008_10005144 3300014497 Bacteria 7504
276 Ga0182008_10006051 3300014497 Bacteria 6806
277 Ga0182008_10006281 3300014497 Bacteria 6669
278 Ga0182008_10008204 3300014497 Bacteria 5717
279 Ga0182008_10024942 3300014497 Bacteria 3041
280 Ga0182008_10034886 3300014497 Bacteria 2521
281 Ga0182008_10073622 3300014497 Bacteria 1681
282 Ga0182008_10093758 3300014497 Bacteria 1481
283 Ga0182008_10105369 3300014497 Bacteria 1395
284 Ga0182008_10234898 3300014497 Bacteria 942
285 Ga0182008_10296659 3300014497 Bacteria 845
286 Ga0182008_10651189 3300014497 Bacteria 597
287 Ga0157376_10639699 3300014969 Bacteria 1063
288 Ga0157376_11474043 3300014969 Bacteria 713
289 Ga0182006_1001876 3300015261 Bacteria 12029
290 Ga0182006_1002366 3300015261 Bacteria 10330
291 Ga0182006_1004424 3300015261 Bacteria 6938
292 Ga0182006_1007210 3300015261 Bacteria 5106
293 Ga0182006_1022158 3300015261 Bacteria 2643
294 Ga0182006_1023709 3300015261 Bacteria 2539
295 Ga0182006_1035699 3300015261 Bacteria 1979
296 Ga0182006_1078988 3300015261 Bacteria 1204
297 Ga0182006_1111716 3300015261 Bacteria 958
298 Ga0182006_1122520 3300015261 Bacteria 902
299 Ga0182006_1216138 3300015261 Bacteria 632
300 Ga0182007_10000427 3300015262 Bacteria 25789
301 Ga0182007_10034013 3300015262 Bacteria 1724
302 Ga0182007_10045281 3300015262 Bacteria 1459
303 Ga0182007_10100388 3300015262 Bacteria 958
304 Ga0182005_1001211 3300015265 Bacteria 10664
305 Ga0182005_1004330 3300015265 Bacteria 4611
306 Ga0182005_1018016 3300015265 Bacteria 1953
307 Ga0182005_1057604 3300015265 Bacteria 1059
308 Ga0182005_1073143 3300015265 Bacteria 942
309 Ga0182005_1077814 3300015265 Bacteria 914
310 Ga0163161_10005861 3300017792 Bacteria 8519
311 Ga0163161_10023992 3300017792 Bacteria 4305
312 Ga0163161_10049953 3300017792 Bacteria 3024
313 Ga0163161_10271320 3300017792 Bacteria 1328
314 Ga0163161_10638270 3300017792 Bacteria 881
315 Ga0163161_11251544 3300017792 Bacteria 643
316 Ga0209435_100571 3300025206 Bacteria 6909
317 Ga0209760_100080 3300025207 Bacteria 77279
318 Ga0209760_100159 3300025207 Bacteria 40609
319 Ga0209784_100028 3300025224 Bacteria 357464
320 Ga0209566_100028 3300025225 Bacteria 357464
321 Ga0209674_100047 3300025226 Bacteria 357464
322 Ga0209147_100031 3300025229 Bacteria 357464
323 Ga0209563_100050 3300025230 Bacteria 357464
324 Ga0209563_101807 3300025230 Bacteria 5299
325 Ga0207427_100014 3300025231 Bacteria 561361
326 Ga0207427_100016 3300025231 Bacteria 538697
327 Ga0209437_100011 3300025233 Bacteria 818520
328 Ga0209437_100016 3300025233 Bacteria 710118
329 Ga0209437_101954 3300025233 Bacteria 4279
330 Ga0209258_102000 3300025242 Bacteria 5893
331 Ga0207425_1000381 3300025245 Bacteria 30305
332 Ga0207425_1014827 3300025245 Bacteria 1764
333 Ga0209646_1001004 3300025246 Bacteria 8665
334 Ga0209677_100029 3300025253 Bacteria 357464
335 Ga0209759_1001687 3300025256 Bacteria 11491
336 Ga0209759_1014277 3300025256 Bacteria 2109
337 Ga0209233_1000019 3300025261 Bacteria 818520
338 Ga0209233_1000036 3300025261 Bacteria 561361
339 Ga0209565_1000020 3300025263 Bacteria 432627
340 Ga0209673_1000072 3300025273 Bacteria 236935
341 Ga0209673_1001259 3300025273 Bacteria 26104
342 Ga0209673_1003690 3300025273 Bacteria 8809
343 Ga0209675_1000014 3300025291 Bacteria 421902
344 Ga0209675_1004181 3300025291 Bacteria 6530
345 Ga0209676_1000025 3300025292 Bacteria 577569
346 Ga0209676_1000032 3300025292 Bacteria 469558
347 Ga0209676_1000208 3300025292 Bacteria 130879
348 Ga0209676_1005146 3300025292 Bacteria 6957
349 Ga0209676_1027400 3300025292 Bacteria 1794
350 Ga0209025_1005088 3300025294 Bacteria 10941
351 Ga0209025_1020897 3300025294 Bacteria 3552
352 Ga0209564_1036277 3300025295 Bacteria 1410
353 Ga0209758_1000278 3300025297 Bacteria 102052
354 Ga0209050_1000025 3300025298 Bacteria 528225
355 Ga0209050_1000028 3300025298 Bacteria 477133
356 Ga0209050_1000381 3300025298 Bacteria 83623
357 Ga0209050_1001504 3300025298 Bacteria 24641
358 Ga0209050_1069416 3300025298 Bacteria 793
359 Ga0209256_1026888 3300025299 Bacteria 1649
360 Ga0209256_1068908 3300025299 Bacteria 801
361 Ga0209051_1000026 3300025303 Bacteria 413311
362 Ga0209051_1000080 3300025303 Bacteria 199694
363 Ga0209051_1000299 3300025303 Bacteria 78310
364 Ga0209051_1005384 3300025303 Bacteria 7506
365 Ga0209051_1100734 3300025303 Bacteria 778
366 Ga0209257_1000034 3300025304 Bacteria 662719
367 Ga0209257_1009273 3300025304 Bacteria 5321
368 Ga0209257_1011454 3300025304 Bacteria 4268
369 Ga0207656_10000008 3300025321 Bacteria 275365
370 Ga0207656_10104439 3300025321 Bacteria 1302
371 Ga0207696_1000020 3300025711 Bacteria 434998
372 Ga0207696_1000057 3300025711 Bacteria 249404
373 Ga0207696_1000074 3300025711 Bacteria 215333
374 Ga0207696_1000084 3300025711 Bacteria 196086
375 Ga0207696_1002384 3300025711 Bacteria 9269
376 Ga0207696_1005097 3300025711 Bacteria 5517
377 Ga0207696_1005477 3300025711 Bacteria 5262
378 Ga0207696_1023916 3300025711 Bacteria 1922
379 Ga0207696_1035644 3300025711 Bacteria 1480
380 Ga0207655_1000014 3300025728 Bacteria 607124
381 Ga0207655_1000556 3300025728 Bacteria 46531
382 Ga0207655_1000904 3300025728 Bacteria 30971
383 Ga0207655_1001007 3300025728 Bacteria 28675
384 Ga0207655_1001055 3300025728 Bacteria 27513
385 Ga0207655_1001386 3300025728 Bacteria 22646
386 Ga0207655_1004166 3300025728 Bacteria 10378
387 Ga0207655_1004170 3300025728 Bacteria 10372
388 Ga0207655_1005009 3300025728 Bacteria 9169
389 Ga0207655_1005255 3300025728 Bacteria 8886
390 Ga0207655_1009660 3300025728 Bacteria 5962
391 Ga0207655_1011028 3300025728 Bacteria 5422
392 Ga0207655_1016324 3300025728 Bacteria 4069
393 Ga0207655_1021554 3300025728 Bacteria 3266
394 Ga0207655_1035433 3300025728 Bacteria 2228
395 Ga0207655_1039663 3300025728 Bacteria 2041
396 Ga0207655_1053812 3300025728 Bacteria 1606
397 Ga0207655_1056176 3300025728 Bacteria 1554
398 Ga0207655_1128570 3300025728 Bacteria 829
399 Ga0207655_1167372 3300025728 Bacteria 682
400 Ga0207713_1000031 3300025735 Bacteria 283971
401 Ga0207713_1000114 3300025735 Bacteria 132170
402 Ga0207713_1000537 3300025735 Bacteria 38140
403 Ga0207713_1001614 3300025735 Bacteria 17583
404 Ga0207713_1002914 3300025735 Bacteria 11981
405 Ga0207713_1003925 3300025735 Bacteria 9897
406 Ga0207713_1004305 3300025735 Bacteria 9276
407 Ga0207713_1005389 3300025735 Bacteria 8022
408 Ga0207713_1005934 3300025735 Bacteria 7539
409 Ga0207713_1006025 3300025735 Bacteria 7475
410 Ga0207713_1009636 3300025735 Bacteria 5420
411 Ga0207713_1010800 3300025735 Bacteria 5024
412 Ga0207713_1024858 3300025735 Bacteria 2780
413 Ga0207713_1030350 3300025735 Bacteria 2408
414 Ga0207713_1044595 3300025735 Bacteria 1820
415 Ga0207713_1046577 3300025735 Bacteria 1762
416 Ga0207713_1157521 3300025735 Bacteria 727
417 Ga0207688_10744947 3300025901 Bacteria 620
418 Ga0207645_10036430 3300025907 Bacteria 3158
419 Ga0207645_10613575 3300025907 Bacteria 739
420 Ga0207671_10000015 3300025914 Bacteria 439607
421 Ga0207671_10166643 3300025914 Bacteria 1709
422 Ga0207671_10549803 3300025914 Bacteria 920
423 Ga0207649_10000001 3300025920 Bacteria 537851
424 Ga0207649_10326114 3300025920 Bacteria 1129
425 Ga0207681_10000379 3300025923 Bacteria 31387
426 Ga0207681_10001521 3300025923 Bacteria 14951
427 Ga0207681_10002578 3300025923 Bacteria 11488
428 Ga0207681_11014209 3300025923 Bacteria 696
429 Ga0207650_10000239 3300025925 Bacteria 60879
430 Ga0207650_10000329 3300025925 Bacteria 46145
431 Ga0207650_10053499 3300025925 Bacteria 2992
432 Ga0207650_11462323 3300025925 Bacteria 581
433 Ga0207659_10239755 3300025926 Bacteria 1466
434 Ga0207644_10445748 3300025931 Bacteria 1063
435 Ga0207644_10518137 3300025931 Bacteria 985
436 Ga0207644_11298967 3300025931 Bacteria 611
437 Ga0207690_10141781 3300025932 Bacteria 1772
438 Ga0207690_10551870 3300025932 Bacteria 937
439 Ga0207706_10000885 3300025933 Bacteria 30776
440 Ga0207706_10160774 3300025933 Bacteria 1974
441 Ga0207706_10491963 3300025933 Bacteria 1059
442 Ga0207686_10001443 3300025934 Bacteria 13471
443 Ga0207686_10014509 3300025934 Bacteria 4388
444 Ga0207686_10714036 3300025934 Bacteria 798
445 Ga0207709_10000022 3300025935 Bacteria 383573
446 Ga0207709_10000451 3300025935 Bacteria 38328
447 Ga0207709_10001509 3300025935 Bacteria 16086
448 Ga0207709_10004140 3300025935 Bacteria 8442
449 Ga0207709_10008684 3300025935 Bacteria 5606
450 Ga0207709_10013550 3300025935 Bacteria 4497
451 Ga0207709_10021524 3300025935 Bacteria 3651
452 Ga0207709_10027989 3300025935 Bacteria 3254
453 Ga0207669_10240291 3300025937 Bacteria 1342
454 Ga0207704_10289805 3300025938 Bacteria 1249
455 Ga0207704_10618613 3300025938 Bacteria 889
456 Ga0207711_10236287 3300025941 Bacteria 1675
457 Ga0207689_10282336 3300025942 Bacteria 1375
458 Ga0207679_10000009 3300025945 Bacteria 357262
459 Ga0207667_11460403 3300025949 Bacteria 656
460 Ga0207712_10063690 3300025961 Bacteria 2626
461 Ga0207668_12052355 3300025972 Bacteria 515
462 Ga0207640_10004861 3300025981 Bacteria 7298
463 Ga0207658_10120938 3300025986 Bacteria 2088
464 Ga0207639_10000099 3300026041 Bacteria 71467
465 Ga0207678_10007570 3300026067 Bacteria 9599
466 Ga0207678_11683684 3300026067 Bacteria 557
467 Ga0207648_10010854 3300026089 Bacteria 8610
468 Ga0207648_10115196 3300026089 Bacteria 2362
469 Ga0207683_10385230 3300026121 Bacteria 1289
470 Ga0207683_10448574 3300026121 Bacteria 1189
471 Ga0209281_1000026 3300027111 Bacteria 465877
472 Ga0209281_1000033 3300027111 Bacteria 383539
473 Ga0209281_1012387 3300027111 Bacteria 1875
474 Ga0209389_1000099 3300027296 Bacteria 79310
475 Ga0209389_1010492 3300027296 Bacteria 8348
476 Ga0209371_1000078 3300027312 Bacteria 190779
477 Ga0209371_1000630 3300027312 Bacteria 31210
478 Ga0209969_1000907 3300027360 Bacteria 4014
479 Ga0209981_1000751 3300027378 Bacteria 4094
480 Ga0209984_1006030 3300027424 Bacteria 1476
481 Ga0209999_1033803 3300027543 Bacteria 951
482 Ga0209999_1046123 3300027543 Bacteria 820
483 Ga0210002_1045935 3300027617 Bacteria 747
484 Ga0209983_1002302 3300027665 Bacteria 4186
485 Ga0209282_1000360 3300027666 Bacteria 22327
486 Ga0209971_1001257 3300027682 Bacteria 6334
487 Ga0209974_10006221 3300027876 Bacteria 4179
488 Ga0209974_10245320 3300027876 Bacteria 673
489 Ga0207428_10057273 3300027907 Bacteria 3094
490 Ga0207428_10742045 3300027907 Bacteria 700
491 Ga0268266_10047572 3300028379 Bacteria 3676
492 Ga0268266_10132598 3300028379 Bacteria 2229
493 Ga0268266_10228166 3300028379 Bacteria 1714
494 Ga0268266_10570751 3300028379 Bacteria 1085
495 Ga0307517_10072123 3300028786 Bacteria 3083
496 Ga0307517_10317691 3300028786 Bacteria 863
497 Ga0307517_10447645 3300028786 Bacteria 670
498 Ga0307515_10005480 3300028794 Bacteria 25692
499 Ga0307515_10282386 3300028794 Bacteria 1366
500 Ga0307515_10302575 3300028794 Bacteria 1283
501 Ga0268256_1000237 3300030500 Bacteria 57957
502 Ga0268256_1000273 3300030500 Bacteria 53445
503 Ga0307511_10040776 3300030521 Bacteria 3935
504 Ga0307511_10239710 3300030521 Bacteria 886
505 Ga0307511_10269721 3300030521 Bacteria 798
506 Ga0316177_1100029 3300030731 Bacteria 2994
507 Ga0316179_1054624 3300030734 Bacteria 4514
508 Ga0316178_1083481 3300030735 Bacteria 46215
509 Ga0316183_1034892 3300030742 Bacteria 745
510 Ga0316183_1095561 3300030742 Bacteria 3796
511 Ga0316183_1155856 3300030742 Bacteria 1529
512 Ga0316181_1014722 3300030744 Bacteria 4220
513 Ga0265331_10018148 3300031250 Bacteria 3654
514 Ga0265327_10000151 3300031251 Bacteria 149323
515 Ga0265316_10390077 3300031344 Bacteria 1004
516 Ga0307509_10486258 3300031507 Bacteria 921
517 Ga0307408_100000002 3300031548 Bacteria 827227
518 Ga0307408_100020467 3300031548 Bacteria 4467
519 Ga0307408_100024898 3300031548 Bacteria 4092
520 Ga0307408_100038505 3300031548 Bacteria 3374
521 Ga0307408_100042854 3300031548 Bacteria 3217
522 Ga0307408_100046887 3300031548 Bacteria 3092
523 Ga0307408_100162595 3300031548 Bacteria 1774
524 Ga0307408_100303862 3300031548 Bacteria 1337
525 Ga0307408_100330940 3300031548 Bacteria 1286
526 Ga0307408_100377080 3300031548 Bacteria 1211
527 Ga0307514_10200906 3300031649 Bacteria 1253
528 Ga0316576_10039418 3300031727 Bacteria 3391
529 Ga0316578_10016599 3300031728 Bacteria 3989
530 Ga0307516_10001808 3300031730 Bacteria 29384
531 Ga0307516_10057531 3300031730 Bacteria 3787
532 Ga0307516_10154865 3300031730 Bacteria 2048
533 Ga0307516_10163587 3300031730 Bacteria 1973
534 Ga0307516_10731604 3300031730 Bacteria 648
535 Ga0307405_10001968 3300031731 Bacteria 8873
536 Ga0307405_10003360 3300031731 Bacteria 7333
537 Ga0307405_10048674 3300031731 Bacteria 2616
538 Ga0307405_10057775 3300031731 Bacteria 2438
539 Ga0307405_10182107 3300031731 Bacteria 1509
540 Ga0307405_10242227 3300031731 Bacteria 1336
541 Ga0307405_10372136 3300031731 Bacteria 1109
542 Ga0316577_10417509 3300031733 Bacteria 762
543 Ga0307413_10013326 3300031824 Bacteria 4128
544 Ga0307413_10892142 3300031824 Bacteria 754
545 Ga0307410_10216569 3300031852 Bacteria 1471
546 Ga0307406_10071304 3300031901 Bacteria 2277
547 Ga0307406_10106741 3300031901 Bacteria 1919
548 Ga0307406_10185739 3300031901 Bacteria 1517
549 Ga0307406_10230547 3300031901 Bacteria 1382
550 Ga0307407_10192852 3300031903 Bacteria 1359
551 Ga0307407_10536380 3300031903 Bacteria 863
552 Ga0307407_10951397 3300031903 Bacteria 661
553 Ga0307407_11022846 3300031903 Bacteria 639
554 Ga0307412_10002218 3300031911 Bacteria 10783
555 Ga0307412_10006543 3300031911 Bacteria 6595
556 Ga0307412_10010756 3300031911 Bacteria 5278
557 Ga0307412_10015248 3300031911 Bacteria 4550
558 Ga0307412_10074975 3300031911 Bacteria 2319
559 Ga0307412_10170795 3300031911 Bacteria 1625
560 Ga0307412_10232432 3300031911 Bacteria 1420
561 Ga0307412_10348252 3300031911 Bacteria 1188
562 Ga0307412_10450331 3300031911 Bacteria 1060
563 Ga0307412_10530109 3300031911 Bacteria 985
564 Ga0307412_10761998 3300031911 Bacteria 836
565 Ga0307412_10851231 3300031911 Bacteria 795
566 Ga0307409_100036890 3300031995 Bacteria 3598
567 Ga0307409_100107313 3300031995 Bacteria 2332
568 Ga0307409_100224347 3300031995 Bacteria 1699
569 Ga0307416_100003898 3300032002 Bacteria 8883
570 Ga0307416_100109894 3300032002 Bacteria 2426
571 Ga0307416_100140485 3300032002 Bacteria 2194
572 Ga0307416_100259050 3300032002 Bacteria 1699
573 Ga0307416_100378632 3300032002 Bacteria 1444
574 Ga0307416_100674660 3300032002 Bacteria 1120
575 Ga0307414_10031621 3300032004 Bacteria 3474
576 Ga0307414_10065210 3300032004 Bacteria 2597
577 Ga0307414_10207544 3300032004 Bacteria 1598
578 Ga0307414_10277539 3300032004 Bacteria 1406
579 Ga0307414_10317622 3300032004 Bacteria 1324
580 Ga0307414_10389349 3300032004 Bacteria 1207
581 Ga0307414_10509363 3300032004 Bacteria 1066
582 Ga0307414_10808499 3300032004 Bacteria 855
583 Ga0307414_11706282 3300032004 Bacteria 587
584 Ga0307411_10006610 3300032005 Bacteria 5819
585 Ga0307411_10056875 3300032005 Bacteria 2580
586 Ga0307411_10200087 3300032005 Bacteria 1533
587 Ga0307411_10489429 3300032005 Bacteria 1037
588 Ga0307411_10712281 3300032005 Bacteria 875
589 Ga0307411_11032619 3300032005 Bacteria 737
590 Ga0307510_10012023 3300033180 Bacteria 10259
591 Ga0373932_0154473 3300035112 Bacteria 790
592 Ga0373931_0002682 3300035691 Bacteria 7919
593 Ga0373937_0592754 3300036401 Bacteria 1052
594 Ga0316584_0243295 3300036712 Bacteria 1316
595 Ga0395905_0013719 3300037471 Bacteria 7757
596 Ga0237819_02166 3300038705 Bacteria 4197
597 Ga0400487_22015 3300039110 Bacteria 27561
598 Ga0436361_1042483 3300039447 Bacteria 6142
599 Ga0439436_0019491 3300041404 Bacteria 2024
600 Ga0439438_001375 3300041405 Bacteria 10737
601 Ga0439438_002509 3300041405 Bacteria 7794
602 Ga0439438_003719 3300041405 Bacteria 6061
603 Ga0439438_005311 3300041405 Bacteria 4763
604 Ga0439438_007105 3300041405 Bacteria 3865
605 Ga0439438_010216 3300041405 Bacteria 2981
606 Ga0439438_014706 3300041405 Bacteria 2323
607 Ga0439438_021105 3300041405 Bacteria 1820
608 Ga0439438_034280 3300041405 Bacteria 1338
609 Ga0439438_054011 3300041405 Bacteria 1015
610 Ga0439438_081881 3300041405 Bacteria 791
611 Ga0439447_001178 3300041407 Bacteria 9516
612 Ga0439447_001953 3300041407 Bacteria 7559
613 Ga0439447_003505 3300041407 Bacteria 5568
614 Ga0439447_003645 3300041407 Bacteria 5432
615 Ga0439447_018428 3300041407 Bacteria 1881
616 Ga0439447_018549 3300041407 Bacteria 1872
617 Ga0439447_045455 3300041407 Bacteria 1059
618 Ga0439447_096890 3300041407 Bacteria 677
619 Ga0439447_111532 3300041407 Bacteria 627
620 Ga0439466_0005580 3300041411 Bacteria 4802
621 Ga0439466_0008951 3300041411 Bacteria 3762
622 Ga0439466_0009184 3300041411 Bacteria 3703
623 Ga0439466_0012072 3300041411 Bacteria 3189
624 Ga0439466_0022705 3300041411 Bacteria 2212
625 Ga0439466_0023951 3300041411 Bacteria 2143
626 Ga0439466_0025331 3300041411 Bacteria 2071
627 Ga0439466_0030715 3300041411 Bacteria 1840
628 Ga0439466_0038361 3300041411 Bacteria 1609
629 Ga0439466_0061762 3300041411 Bacteria 1205
630 Ga0439466_0233480 3300041411 Bacteria 557
631 Ga0439465_0021955 3300041413 Bacteria 2004
632 Ga0451789_0877898 3300041443 Bacteria 1157
633 Ga0451797_1030840 3300041453 Bacteria 559
634 Ga0451795_1013380 3300041456 Bacteria 852
635 Ga0451802_0419198 3300041460 Bacteria 775
636 Ga0451802_0441061 3300041460 Bacteria 1173
637 Ga0451833_1324399 3300041491 Bacteria 583
638 Ga0451837_0138631 3300041494 Bacteria 688
639 Ga0439431_0005299 3300041997 Bacteria 2845
640 Ga0439431_0060161 3300041997 Bacteria 998
641 Ga0439431_0225305 3300041997 Bacteria 551
642 Ga0439433_0004071 3300041999 Bacteria 3143
643 Ga0439437_000593 3300042000 Bacteria 3628
644 Ga0439437_003374 3300042000 Bacteria 1721
645 Ga0439442_021019 3300042002 Bacteria 1353
646 Ga0439445_0063186 3300042004 Bacteria 1015
647 Ga0439432_013208 3300042006 Bacteria 2810
648 Ga0439432_013408 3300042006 Bacteria 2788
649 Ga0439432_023066 3300042006 Bacteria 2051
650 Ga0439432_067789 3300042006 Bacteria 1091
651 Ga0439432_081504 3300042006 Bacteria 979
652 Ga0439432_084569 3300042006 Bacteria 958
653 Ga0439432_097255 3300042006 Bacteria 882
654 Ga0439432_114696 3300042006 Bacteria 800
655 Ga0439449_0004040 3300042007 Bacteria 5681
656 Ga0439451_015790 3300042009 Bacteria 1522
657 Ga0439451_034881 3300042009 Bacteria 1011
658 Ga0439452_000639 3300042010 Bacteria 17643
659 Ga0439452_000699 3300042010 Bacteria 16454
660 Ga0439452_000714 3300042010 Bacteria 16190
661 Ga0439452_001159 3300042010 Bacteria 11448
662 Ga0439452_002829 3300042010 Bacteria 6260
663 Ga0439452_003967 3300042010 Bacteria 5061
664 Ga0439452_005162 3300042010 Bacteria 4248
665 Ga0439452_008268 3300042010 Bacteria 3143
666 Ga0439452_045739 3300042010 Bacteria 1017
667 Ga0439452_078563 3300042010 Bacteria 721
668 Ga0439455_0001801 3300042012 Bacteria 3730
669 Ga0439456_000319 3300042013 Bacteria 11020
670 Ga0439456_001966 3300042013 Bacteria 4139
671 Ga0439456_002979 3300042013 Bacteria 3423
672 Ga0439456_003292 3300042013 Bacteria 3269
673 Ga0439456_013995 3300042013 Bacteria 1671
674 Ga0439456_040285 3300042013 Bacteria 1011
675 Ga0439456_044318 3300042013 Bacteria 967
676 Ga0439462_0003781 3300042015 Bacteria 3652
677 Ga0439463_001078 3300042016 Bacteria 7357
678 Ga0439463_004105 3300042016 Bacteria 3657
679 Ga0439463_019064 3300042016 Bacteria 1708
680 Ga0450911_000018 3300042115 Bacteria 104759
681 Ga0450911_004958 3300042115 Bacteria 2118
682 Ga0450911_014610 3300042115 Bacteria 1042
683 Ga0450913_001277 3300042117 Bacteria 1350
684 Ga0450917_000905 3300042120 Bacteria 2178
685 Ga0450919_003620 3300042121 Bacteria 1917
686 Ga0450922_003663 3300042124 Bacteria 1412
687 Ga0450922_010403 3300042124 Bacteria 890
688 Ga0450923_012516 3300042125 Bacteria 1545
689 Ga0450888_005682 3300042126 Bacteria 1337
690 Ga0450890_003656 3300042127 Bacteria 2035
691 Ga0450891_002048 3300042129 Bacteria 2055
692 Ga0450892_000203 3300042130 Bacteria 7032
693 Ga0450894_012435 3300042131 Bacteria 1113
694 Ga0450896_025919 3300042133 Bacteria 873
695 Ga0450900_000189 3300042136 Bacteria 3982
696 Ga0450902_005404 3300042137 Bacteria 1927
697 Ga0450903_009291 3300042138 Bacteria 1603
698 Ga0450903_011572 3300042138 Bacteria 1419
699 Ga0450903_021148 3300042138 Bacteria 1005
700 Ga0450903_056177 3300042138 Bacteria 573
701 Ga0450904_000142 3300042139 Bacteria 15885
702 Ga0450904_010499 3300042139 Bacteria 915
703 Ga0450905_000352 3300042142 Bacteria 5527
704 Ga0450905_003902 3300042142 Bacteria 1964
705 Ga0450905_024187 3300042142 Bacteria 909
706 Ga0450905_033854 3300042142 Bacteria 796
707 Ga0450906_002984 3300042145 Bacteria 3670
708 Ga0450906_008733 3300042145 Bacteria 1949
709 Ga0450906_045074 3300042145 Bacteria 778
710 Ga0450907_001203 3300042146 Bacteria 5856
711 Ga0450907_008179 3300042146 Bacteria 1740
712 Ga0450910_000909 3300042147 Bacteria 3573
713 Ga0439446_0001855 3300042156 Bacteria 4951
714 Ga0439446_0019117 3300042156 Bacteria 1924
715 Ga0450908_071982 3300042184 Bacteria 614
716 Ga0450909_000684 3300042185 Bacteria 4528
717 Ga0450909_005673 3300042185 Bacteria 1797
718 Ga0439434_0001331 3300042435 Bacteria 7128
719 Ga0439434_0001998 3300042435 Bacteria 5898
720 Ga0439434_0010673 3300042435 Bacteria 2709
721 Ga0439459_0002455 3300042438 Bacteria 2858
722 Ga0439459_0006238 3300042438 Bacteria 1980
723 Ga0439464_0000180 3300042439 Bacteria 10873
724 Ga0439464_0000893 3300042439 Bacteria 6660
725 Ga0439464_0019935 3300042439 Bacteria 1833
726 Ga0439464_0104738 3300042439 Bacteria 862
727 Ga0439464_0207108 3300042439 Bacteria 627
728 Ga0439460_0008788 3300042461 Bacteria 2554
729 Ga0450916_000918 3300042530 Bacteria 2815
730 Ga0450916_004880 3300042530 Bacteria 1530
731 Ga0450918_013018 3300042531 Bacteria 1447
732 Ga0450893_0010337 3300042532 Bacteria 1532
733 Ga0450893_0037258 3300042532 Bacteria 882
734 Ga0450901_001352 3300042533 Bacteria 2813
735 Ga0451577_0023501 3300042876 Bacteria 5621
736 Ga0451577_0039819 3300042876 Bacteria 4221
737 Ga0451577_0106334 3300042876 Bacteria 2508
738 Ga0451577_0269550 3300042876 Bacteria 1542
739 Ga0451577_0591277 3300042876 Bacteria 1007
740 Ga0439440_0023405 3300042993 Bacteria 1408
741 Ga0439440_0081977 3300042993 Bacteria 854
742 Ga0466972_0076629 3300044658 Bacteria 1593
743 Ga0453684_0010847 3300044712 Bacteria 15439
744 Ga0453684_0058784 3300044712 Bacteria 4963
745 Ga0453684_0457325 3300044712 Bacteria 1420
746 Ga0466968_0056271 3300044735 Bacteria 1689
747 Ga0466970_0621982 3300044765 Bacteria 627
748 Ga0466957_0164187 3300044842 Bacteria 1444
749 Ga0466960_0017751 3300044901 Bacteria 3109
750 Ga0466959_0047625 3300045049 Bacteria 3153
751 Ga0495617_001025 3300046452 Bacteria 12855
752 Ga0495617_020886 3300046452 Bacteria 2213
753 Ga0495617_037177 3300046452 Bacteria 1631
754 Ga0495617_106919 3300046452 Bacteria 906
755 Ga0495627_000023 3300046453 Bacteria 251113
756 Ga0495627_000774 3300046453 Bacteria 23729
757 Ga0495627_002622 3300046453 Bacteria 8471
758 Ga0495627_003290 3300046453 Bacteria 7227
759 Ga0495627_003818 3300046453 Bacteria 6480
760 Ga0495627_015834 3300046453 Bacteria 2596
761 Ga0495627_062201 3300046453 Bacteria 1102
762 Ga0495627_128990 3300046453 Bacteria 712
763 Ga0495603_0092340 3300046455 Bacteria 1769
764 Ga0495603_0234268 3300046455 Bacteria 1058
765 Ga0495603_0287234 3300046455 Bacteria 945
766 Ga0495590_0037123 3300046457 Bacteria 1699
767 Ga0495590_0108306 3300046457 Bacteria 990
768 Ga0495590_0173348 3300046457 Bacteria 787
769 Ga0495591_000668 3300046458 Bacteria 25300
770 Ga0495591_001374 3300046458 Bacteria 15248
771 Ga0495591_003232 3300046458 Bacteria 8569
772 Ga0495591_004755 3300046458 Bacteria 6504
773 Ga0495591_019120 3300046458 Bacteria 2301
774 Ga0495591_019246 3300046458 Bacteria 2291
775 Ga0495591_033170 3300046458 Bacteria 1530
776 Ga0495591_095703 3300046458 Bacteria 740
777 Ga0495591_099851 3300046458 Bacteria 720
778 Ga0495591_130241 3300046458 Bacteria 610
779 Ga0495629_0083167 3300046459 Bacteria 2234
780 Ga0495638_0019354 3300046460 Bacteria 4503
781 Ga0495638_0029635 3300046460 Bacteria 3529
782 Ga0495638_0077768 3300046460 Bacteria 2019
783 Ga0495638_0155658 3300046460 Bacteria 1322
784 Ga0495638_0196197 3300046460 Bacteria 1142
785 Ga0495653_0023066 3300046463 Bacteria 5033
786 Ga0495653_0030976 3300046463 Bacteria 4255
787 Ga0495653_0698521 3300046463 Bacteria 616
788 Ga0495650_0001958 3300046471 Bacteria 18190
789 Ga0495650_0011367 3300046471 Bacteria 4882
790 Ga0495650_0012088 3300046471 Bacteria 4669
791 Ga0495650_0013501 3300046471 Bacteria 4313
792 Ga0495650_0034643 3300046471 Bacteria 2231
793 Ga0495650_0085247 3300046471 Bacteria 1210
794 Ga0495650_0173353 3300046471 Bacteria 762
795 Ga0495582_0126835 3300046473 Bacteria 1440
796 Ga0495605_0000095 3300046474 Bacteria 112622
797 Ga0495605_0000210 3300046474 Bacteria 71875
798 Ga0495605_0000677 3300046474 Bacteria 25677
799 Ga0495605_0000927 3300046474 Bacteria 20060
800 Ga0495605_0001281 3300046474 Bacteria 16654
801 Ga0495605_0002745 3300046474 Bacteria 10755
802 Ga0495605_0014191 3300046474 Bacteria 4369
803 Ga0495605_0015180 3300046474 Bacteria 4197
804 Ga0495605_0022969 3300046474 Bacteria 3286
805 Ga0495605_0075881 3300046474 Bacteria 1580
806 Ga0495605_0412072 3300046474 Bacteria 561
807 Ga0495639_0000523 3300046475 Bacteria 18023
808 Ga0495639_0275608 3300046475 Bacteria 835
809 Ga0495584_0010069 3300046491 Bacteria 4854
810 Ga0495584_0032560 3300046491 Bacteria 2638
811 Ga0495584_0098102 3300046491 Bacteria 1480
812 Ga0495584_0152129 3300046491 Bacteria 1175
813 Ga0495584_0184021 3300046491 Bacteria 1061
814 Ga0495584_0265004 3300046491 Bacteria 873
815 Ga0495585_0006945 3300046492 Bacteria 6973
816 Ga0495585_0009033 3300046492 Bacteria 6003
817 Ga0495585_0128524 3300046492 Bacteria 1335
818 Ga0495585_0246729 3300046492 Bacteria 892
819 Ga0495594_0004380 3300046499 Bacteria 7264
820 Ga0495594_0036018 3300046499 Bacteria 2697
821 Ga0495596_0002377 3300046500 Bacteria 10178
822 Ga0495596_0003170 3300046500 Bacteria 8470
823 Ga0495596_0110684 3300046500 Bacteria 1066
824 Ga0495596_0217226 3300046500 Bacteria 742
825 Ga0495607_0000069 3300046501 Bacteria 101754
826 Ga0495607_0000673 3300046501 Bacteria 33089
827 Ga0495607_0001262 3300046501 Bacteria 22625
828 Ga0495607_0003099 3300046501 Bacteria 12904
829 Ga0495607_0006625 3300046501 Bacteria 8121
830 Ga0495607_0007271 3300046501 Bacteria 7682
831 Ga0495607_0010660 3300046501 Bacteria 6163
832 Ga0495607_0013982 3300046501 Bacteria 5240
833 Ga0495607_0023745 3300046501 Bacteria 3833
834 Ga0495607_0054353 3300046501 Bacteria 2307
835 Ga0495607_0064002 3300046501 Bacteria 2078
836 Ga0495607_0074193 3300046501 Bacteria 1889
837 Ga0495607_0089093 3300046501 Bacteria 1675
838 Ga0495607_0096700 3300046501 Bacteria 1589
839 Ga0495607_0126446 3300046501 Bacteria 1336
840 Ga0495607_0167130 3300046501 Bacteria 1113
841 Ga0495607_0171672 3300046501 Bacteria 1094
842 Ga0495607_0175986 3300046501 Bacteria 1076
843 Ga0495607_0191138 3300046501 Bacteria 1019
844 Ga0495607_0196097 3300046501 Bacteria 1002
845 Ga0495607_0197701 3300046501 Bacteria 997
846 Ga0495607_0261437 3300046501 Bacteria 829
847 Ga0495607_0284074 3300046501 Bacteria 784
848 Ga0495607_0289098 3300046501 Bacteria 775
849 Ga0495607_0402426 3300046501 Bacteria 622
850 Ga0495607_0403523 3300046501 Bacteria 621
851 Ga0495583_0000015 3300046506 Bacteria 316392
852 Ga0495583_0000779 3300046506 Bacteria 39867
853 Ga0495583_0005179 3300046506 Bacteria 8978
854 Ga0495583_0008908 3300046506 Bacteria 6064
855 Ga0495583_0009541 3300046506 Bacteria 5784
856 Ga0495583_0009795 3300046506 Bacteria 5683
857 Ga0495583_0013746 3300046506 Bacteria 4496
858 Ga0495583_0019806 3300046506 Bacteria 3503
859 Ga0495583_0084235 3300046506 Bacteria 1377
860 Ga0495606_0000271 3300046507 Bacteria 90916
861 Ga0495606_0000447 3300046507 Bacteria 67335
862 Ga0495606_0008834 3300046507 Bacteria 8637
863 Ga0495606_0009017 3300046507 Bacteria 8526
864 Ga0495606_0063552 3300046507 Bacteria 2352
865 Ga0495606_0064160 3300046507 Bacteria 2339
866 Ga0495606_0102474 3300046507 Bacteria 1740
867 Ga0495606_0116497 3300046507 Bacteria 1604
868 Ga0495606_0287283 3300046507 Bacteria 896
869 Ga0495610_0006170 3300046512 Bacteria 8334
870 Ga0495610_0014582 3300046512 Bacteria 4609
871 Ga0495610_0032387 3300046512 Bacteria 2715
872 Ga0495610_0076686 3300046512 Bacteria 1545
873 Ga0495610_0120181 3300046512 Bacteria 1152
874 Ga0495610_0167234 3300046512 Bacteria 925
875 Ga0495610_0176040 3300046512 Bacteria 893
876 Ga0495610_0177490 3300046512 Bacteria 888
877 Ga0495610_0187323 3300046512 Bacteria 856
878 Ga0495616_0004341 3300046513 Bacteria 8946
879 Ga0495616_0012091 3300046513 Bacteria 4913
880 Ga0495616_0024482 3300046513 Bacteria 3238
881 Ga0495616_0028520 3300046513 Bacteria 2955
882 Ga0495616_0035911 3300046513 Bacteria 2560
883 Ga0495616_0037035 3300046513 Bacteria 2512
884 Ga0495616_0055030 3300046513 Bacteria 1971
885 Ga0495616_0056858 3300046513 Bacteria 1930
886 Ga0495616_0173134 3300046513 Bacteria 964
887 Ga0495616_0254362 3300046513 Bacteria 753
888 Ga0495616_0358908 3300046513 Bacteria 605
889 Ga0495620_0000042 3300046515 Bacteria 112107
890 Ga0495620_0001720 3300046515 Bacteria 12932
891 Ga0495620_0003398 3300046515 Bacteria 9113
892 Ga0495620_0005739 3300046515 Bacteria 6902
893 Ga0495620_0006827 3300046515 Bacteria 6239
894 Ga0495630_0124752 3300046517 Bacteria 1954
895 Ga0495631_0001164 3300046518 Bacteria 16262
896 Ga0495631_0001281 3300046518 Bacteria 15486
897 Ga0495631_0026137 3300046518 Bacteria 2683
898 Ga0495631_0027791 3300046518 Bacteria 2585
899 Ga0495631_0072952 3300046518 Bacteria 1482
900 Ga0495631_0076617 3300046518 Bacteria 1443
901 Ga0495632_0002195 3300046519 Bacteria 15057
902 Ga0495632_0002608 3300046519 Bacteria 13580
903 Ga0495632_0004428 3300046519 Bacteria 9547
904 Ga0495632_0023464 3300046519 Bacteria 3294
905 Ga0495632_0033961 3300046519 Bacteria 2614
906 Ga0495632_0035524 3300046519 Bacteria 2542
907 Ga0495632_0079736 3300046519 Bacteria 1562
908 Ga0495632_0094453 3300046519 Bacteria 1414
909 Ga0495632_0096296 3300046519 Bacteria 1398
910 Ga0495637_0000682 3300046520 Bacteria 23481
911 Ga0495637_0002317 3300046520 Bacteria 10534
912 Ga0495637_0003151 3300046520 Bacteria 8802
913 Ga0495637_0007709 3300046520 Bacteria 5323
914 Ga0495637_0013570 3300046520 Bacteria 3864
915 Ga0495637_0027357 3300046520 Bacteria 2552
916 Ga0495637_0031226 3300046520 Bacteria 2357
917 Ga0495637_0034277 3300046520 Bacteria 2224
918 Ga0495637_0050663 3300046520 Bacteria 1741
919 Ga0495637_0054941 3300046520 Bacteria 1652
920 Ga0495637_0063336 3300046520 Bacteria 1511
921 Ga0495637_0073301 3300046520 Bacteria 1377
922 Ga0495637_0085280 3300046520 Bacteria 1253
923 Ga0495637_0099992 3300046520 Bacteria 1134
924 Ga0495637_0103776 3300046520 Bacteria 1108
925 Ga0495643_0000930 3300046522 Bacteria 30503
926 Ga0495643_0001783 3300046522 Bacteria 18444
927 Ga0495643_0016964 3300046522 Bacteria 4267
928 Ga0495643_0017839 3300046522 Bacteria 4139
929 Ga0495643_0048420 3300046522 Bacteria 2297
930 Ga0495643_0119828 3300046522 Bacteria 1330
931 Ga0495643_0140215 3300046522 Bacteria 1206
932 Ga0495643_0145605 3300046522 Bacteria 1177
933 Ga0495644_0002729 3300046523 Bacteria 7002
934 Ga0495644_0022504 3300046523 Bacteria 2402
935 Ga0495644_0085821 3300046523 Bacteria 1186
936 Ga0495648_0002138 3300046524 Bacteria 18598
937 Ga0495648_0006246 3300046524 Bacteria 9747
938 Ga0495648_0008856 3300046524 Bacteria 7872
939 Ga0495648_0019260 3300046524 Bacteria 4805
940 Ga0495648_0048792 3300046524 Bacteria 2602
941 Ga0495648_0135211 3300046524 Bacteria 1305
942 Ga0495648_0223402 3300046524 Bacteria 927
943 Ga0495648_0251585 3300046524 Bacteria 852
944 Ga0495666_0004890 3300046526 Bacteria 6775
945 Ga0495666_0011100 3300046526 Bacteria 4494
946 Ga0495642_0000803 3300046528 Bacteria 15253
947 Ga0495642_0005130 3300046528 Bacteria 5041
948 Ga0495654_0000906 3300046530 Bacteria 22097
949 Ga0495654_0002648 3300046530 Bacteria 11379
950 Ga0495654_0002748 3300046530 Bacteria 11095
951 Ga0495654_0003945 3300046530 Bacteria 8950
952 Ga0495654_0011396 3300046530 Bacteria 4813
953 Ga0495654_0013437 3300046530 Bacteria 4382
954 Ga0495654_0013804 3300046530 Bacteria 4312
955 Ga0495654_0031245 3300046530 Bacteria 2703
956 Ga0495654_0039525 3300046530 Bacteria 2354
957 Ga0495654_0051840 3300046530 Bacteria 2001
958 Ga0495654_0064157 3300046530 Bacteria 1756
959 Ga0495654_0064705 3300046530 Bacteria 1747
960 Ga0495654_0073516 3300046530 Bacteria 1616
961 Ga0495654_0112512 3300046530 Bacteria 1240
962 Ga0495654_0149179 3300046530 Bacteria 1035
963 Ga0495654_0168753 3300046530 Bacteria 955
964 Ga0495654_0201054 3300046530 Bacteria 852
965 Ga0495654_0323057 3300046530 Bacteria 625
966 Ga0495586_0010327 3300046535 Bacteria 4964
967 Ga0495587_0122589 3300046536 Bacteria 1488
968 Ga0495587_0285103 3300046536 Bacteria 925
969 Ga0495609_0000053 3300046538 Bacteria 149126
970 Ga0495609_0000133 3300046538 Bacteria 79787
971 Ga0495609_0000283 3300046538 Bacteria 46879
972 Ga0495609_0132139 3300046538 Bacteria 1068
973 Ga0495597_0000229 3300046542 Bacteria 50600
974 Ga0495597_0002956 3300046542 Bacteria 10300
975 Ga0495597_0011470 3300046542 Bacteria 4296
976 Ga0495597_0012655 3300046542 Bacteria 4062
977 Ga0495597_0014282 3300046542 Bacteria 3783
978 Ga0495597_0054769 3300046542 Bacteria 1750
979 Ga0495597_0072240 3300046542 Bacteria 1484
980 Ga0495597_0100077 3300046542 Bacteria 1223
981 Ga0495597_0125133 3300046542 Bacteria 1069
982 Ga0495597_0259725 3300046542 Bacteria 680
983 Ga0495645_0058898 3300046543 Bacteria 2786
984 Ga0495622_0002110 3300046557 Bacteria 9697
985 Ga0495622_0004661 3300046557 Bacteria 6354
986 Ga0495622_0023030 3300046557 Bacteria 2903
987 Ga0495622_0093725 3300046557 Bacteria 1378
988 Ga0495633_0000115 3300046558 Bacteria 108676
989 Ga0495633_0133937 3300046558 Bacteria 1146
990 Ga0495656_0001548 3300046615 Bacteria 7514
991 Ga0495668_0004409 3300046616 Bacteria 10009
992 Ga0495668_0025993 3300046616 Bacteria 3324
993 Ga0495668_0205537 3300046616 Bacteria 1078
994 Ga0495611_0001157 3300046648 Bacteria 13771
995 Ga0495611_0002460 3300046648 Bacteria 8459
996 Ga0495611_0023835 3300046648 Bacteria 2658
997 Ga0495611_0215245 3300046648 Bacteria 894
998 Ga0495625_0000086 3300046660 Bacteria 151735
999 Ga0495625_0002399 3300046660 Bacteria 20317
1000 Ga0495625_0009857 3300046660 Bacteria 7947
1001 Ga0495625_0010864 3300046660 Bacteria 7482
1002 Ga0495625_0028763 3300046660 Bacteria 4163
1003 Ga0495625_0051276 3300046660 Bacteria 2959
1004 Ga0495635_0002602 3300046663 Bacteria 12356
1005 Ga0495659_0001331 3300046664 Bacteria 8464
1006 Ga0495659_0002109 3300046664 Bacteria 6489
1007 Ga0495661_0000212 3300046665 Bacteria 67078
1008 Ga0495661_0000346 3300046665 Bacteria 50529
1009 Ga0495661_0001033 3300046665 Bacteria 24720
1010 Ga0495661_0001808 3300046665 Bacteria 17152
1011 Ga0495661_0009872 3300046665 Bacteria 6529
1012 Ga0495661_0028404 3300046665 Bacteria 3581
1013 Ga0495661_0124442 3300046665 Bacteria 1420
1014 Ga0495588_0005542 3300046674 Bacteria 5623
1015 Ga0495588_0027452 3300046674 Bacteria 2845
1016 Ga0495657_0374115 3300046675 Bacteria 841
1017 Ga0495646_0075649 3300046680 Bacteria 1973
1018 Ga0495646_0181899 3300046680 Bacteria 1153
1019 Ga0495669_0007452 3300046684 Bacteria 4588
1020 Ga0495613_0036114 3300046689 Bacteria 3664
1021 Ga0495624_0079940 3300046690 Bacteria 2026
1022 Ga0495670_0004647 3300046691 Bacteria 6731
1023 Ga0495670_0010384 3300046691 Bacteria 4573
1024 Ga0495670_0083661 3300046691 Bacteria 1627
1025 Ga0495670_0102838 3300046691 Bacteria 1472
1026 Ga0495670_0241339 3300046691 Bacteria 962
1027 Ga0495671_0000692 3300046692 Bacteria 24406
1028 Ga0495671_0001074 3300046692 Bacteria 18901
1029 Ga0495671_0001427 3300046692 Bacteria 16062
1030 Ga0495671_0001729 3300046692 Bacteria 14173
1031 Ga0495671_0013687 3300046692 Bacteria 4384
1032 Ga0495671_0027637 3300046692 Bacteria 2927
1033 Ga0495671_0046793 3300046692 Bacteria 2162
1034 Ga0495671_0094416 3300046692 Bacteria 1463
1035 Ga0495671_0212592 3300046692 Bacteria 937
1036 Ga0495671_0239052 3300046692 Bacteria 877
1037 Ga0495671_0424618 3300046692 Bacteria 636
1038 Ga0495649_0000186 3300046694 Bacteria 54356
1039 Ga0495649_0000839 3300046694 Bacteria 24685
1040 Ga0495649_0009899 3300046694 Bacteria 5639
1041 Ga0495649_0017116 3300046694 Bacteria 4096
1042 Ga0495649_0024221 3300046694 Bacteria 3385
1043 Ga0495649_0057577 3300046694 Bacteria 2095
1044 Ga0495649_0091270 3300046694 Bacteria 1623
1045 Ga0495649_0105430 3300046694 Bacteria 1496
1046 Ga0495649_0131841 3300046694 Bacteria 1318
1047 Ga0495589_0003163 3300046794 Bacteria 8995
1048 Ga0495589_0006094 3300046794 Bacteria 6371
1049 Ga0495589_0037907 3300046794 Bacteria 2414
1050 Ga0495589_0042577 3300046794 Bacteria 2262
1051 Ga0495589_0069038 3300046794 Bacteria 1728
1052 Ga0495589_0076295 3300046794 Bacteria 1634
1053 Ga0495600_0045251 3300046809 Bacteria 2871
1054 Ga0495600_0214212 3300046809 Bacteria 1234
1055 Ga0495660_0005301 3300046810 Bacteria 7722
1056 Ga0495660_0007051 3300046810 Bacteria 6624
1057 Ga0495660_0021391 3300046810 Bacteria 3705
1058 Ga0495660_0038615 3300046810 Bacteria 2653
1059 Ga0495660_0057984 3300046810 Bacteria 2087
1060 Ga0495660_0059936 3300046810 Bacteria 2046
1061 Ga0495660_0137788 3300046810 Bacteria 1217
1062 Ga0495660_0183748 3300046810 Bacteria 1009
1063 Ga0495660_0229542 3300046810 Bacteria 870
1064 Ga0495581_0320974 3300047315 Bacteria 905
1065 Ga0495604_0053920 3300047317 Bacteria 3105
1066 Ga0495604_0151147 3300047317 Bacteria 1650
1067 Ga0495636_0001216 3300047318 Bacteria 9745
1068 Ga0495636_0034267 3300047318 Bacteria 2089
1069 Ga0495674_0034015 3300047319 Bacteria 4612
1070 Ga0495672_0002773 3300047320 Bacteria 15673
1071 Ga0495672_0004098 3300047320 Bacteria 12155
1072 Ga0495672_0011278 3300047320 Bacteria 6315
1073 Ga0495672_0013420 3300047320 Bacteria 5654
1074 Ga0495672_0014647 3300047320 Bacteria 5358
1075 Ga0495672_0014701 3300047320 Bacteria 5345
1076 Ga0495672_0016544 3300047320 Bacteria 4963
1077 Ga0495672_0019996 3300047320 Bacteria 4399
1078 Ga0495672_0027106 3300047320 Bacteria 3646
1079 Ga0495672_0043503 3300047320 Bacteria 2700
1080 Ga0495672_0045525 3300047320 Bacteria 2624
1081 Ga0495672_0089456 3300047320 Bacteria 1694
1082 Ga0495672_0185702 3300047320 Bacteria 1049
1083 Ga0495672_0373772 3300047320 Bacteria 657
1084 Ga0495676_0000022 3300047321 Bacteria 163719
1085 Ga0495676_0056463 3300047321 Bacteria 3104
1086 Ga0495676_0084788 3300047321 Bacteria 2389
1087 Ga0495676_0104996 3300047321 Bacteria 2083
1088 Ga0495680_0006510 3300047322 Bacteria 10839
1089 Ga0495683_0000030 3300047323 Bacteria 150551
1090 Ga0495683_0000586 3300047323 Bacteria 27461
1091 Ga0495683_0001528 3300047323 Bacteria 15005
1092 Ga0495683_0011767 3300047323 Bacteria 4599
1093 Ga0495683_0033363 3300047323 Bacteria 2619
1094 Ga0495683_0041276 3300047323 Bacteria 2328
1095 Ga0495683_0076591 3300047323 Bacteria 1636
1096 Ga0495683_0086986 3300047323 Bacteria 1518
1097 Ga0495683_0225538 3300047323 Bacteria 833
1098 Ga0495687_003299 3300047443 Bacteria 11855
1099 Ga0495675_0027219 3300047444 Bacteria 3643
1100 Ga0495675_0470786 3300047444 Bacteria 724
1101 Ga0495677_0003984 3300047445 Bacteria 5706
1102 Ga0495679_000212 3300047446 Bacteria 49948
1103 Ga0495679_007212 3300047446 Bacteria 4666
1104 Ga0495679_016264 3300047446 Bacteria 2695
1105 Ga0495679_051109 3300047446 Bacteria 1240
1106 Ga0495685_158914 3300047447 Bacteria 732
1107 Ga0495673_0001151 3300047469 Bacteria 22526
1108 Ga0495673_0001766 3300047469 Bacteria 16447
1109 Ga0495673_0010284 3300047469 Bacteria 5103
1110 Ga0495673_0010674 3300047469 Bacteria 4980
1111 Ga0495673_0023704 3300047469 Bacteria 2979
1112 Ga0495673_0026787 3300047469 Bacteria 2750
1113 Ga0495673_0034223 3300047469 Bacteria 2350
1114 Ga0495673_0040284 3300047469 Bacteria 2112
1115 Ga0495673_0041861 3300047469 Bacteria 2059
1116 Ga0495673_0044639 3300047469 Bacteria 1976
1117 Ga0495673_0095168 3300047469 Bacteria 1211
1118 Ga0495673_0168962 3300047469 Bacteria 834
1119 Ga0495673_0257558 3300047469 Bacteria 635
1120 Ga0495681_0004261 3300047470 Bacteria 9811
1121 Ga0495681_0010344 3300047470 Bacteria 5649
1122 Ga0495681_0015920 3300047470 Bacteria 4242
1123 Ga0495681_0017912 3300047470 Bacteria 3919
1124 Ga0495681_0020316 3300047470 Bacteria 3606
1125 Ga0495681_0022387 3300047470 Bacteria 3382
1126 Ga0495681_0026912 3300047470 Bacteria 2983
1127 Ga0495681_0032028 3300047470 Bacteria 2652
1128 Ga0495681_0138606 3300047470 Bacteria 1029
1129 Ga0495681_0279286 3300047470 Bacteria 651
1130 Ga0495686_0017632 3300047472 Bacteria 4804
1131 Ga0495686_0028152 3300047472 Bacteria 3660
1132 Ga0495686_0091385 3300047472 Bacteria 1848
1133 Ga0495686_0107825 3300047472 Bacteria 1673
1134 Ga0495686_0138327 3300047472 Bacteria 1439
1135 Ga0495686_0454969 3300047472 Bacteria 679
1136 Ga0495593_0056871 3300047673 Bacteria 2055
1137 Ga0495614_0198804 3300048089 Bacteria 906
1138 Ga0495626_0000039 3300048091 Bacteria 175454
1139 Ga0495626_0002269 3300048091 Bacteria 13708
1140 Ga0495626_0003103 3300048091 Bacteria 10879
1141 Ga0495626_0005248 3300048091 Bacteria 7664
1142 Ga0495626_0035553 3300048091 Bacteria 2378
1143 Ga0495626_0065605 3300048091 Bacteria 1642
1144 Ga0495626_0088922 3300048091 Bacteria 1360
1145 Ga0495626_0111022 3300048091 Bacteria 1187
1146 Ga0496100_0279619 3300048903 Bacteria 1244
1147 Ga0496100_0801451 3300048903 Bacteria 738
1148 Ga0496101_0394760 3300048904 Bacteria 1089
1149 Ga0496102_0057328 3300048905 Bacteria 3556
1150 Ga0496102_0339044 3300048905 Bacteria 1416
1151 Ga0496103_0281042 3300048906 Bacteria 1070
1152 Ga0496105_0987647 3300048908 Bacteria 630
1153 Ga0496109_0679147 3300048912 Bacteria 967
1154 Ga0496110_0023964 3300048913 Bacteria 5198
1155 Ga0496110_0081619 3300048913 Bacteria 2883
1156 Ga0496110_0206097 3300048913 Bacteria 1787
1157 Ga0496110_0226667 3300048913 Bacteria 1699
1158 Ga0496110_1046155 3300048913 Bacteria 724
1159 Ga0496111_0312538 3300048914 Bacteria 1164
1160 Ga0496112_0575237 3300048915 Bacteria 1059
1161 Ga0496113_0564694 3300048916 Bacteria 912
1162 Ga0496114_0043752 3300048917 Bacteria 3713
1163 Ga0496114_0418561 3300048917 Bacteria 1187
1164 Ga0496114_0607051 3300048917 Bacteria 964
1165 Ga0496116_0000881 3300048919 Bacteria 37470
1166 Ga0496116_0004366 3300048919 Bacteria 13521
1167 Ga0496116_0031571 3300048919 Bacteria 3789
1168 Ga0496117_0004157 3300048920 Bacteria 16182
1169 Ga0496117_0004852 3300048920 Bacteria 14529
1170 Ga0496117_0006702 3300048920 Bacteria 11513
1171 Ga0496117_0009650 3300048920 Bacteria 8930
1172 Ga0496117_0137437 3300048920 Bacteria 1470
1173 Ga0496117_0196097 3300048920 Bacteria 1145
1174 Ga0496117_0255292 3300048920 Bacteria 953
1175 Ga0496118_0002846 3300048921 Bacteria 22590
1176 Ga0496118_0008191 3300048921 Bacteria 10872
1177 Ga0496118_0067581 3300048921 Bacteria 2601
1178 Ga0496118_0083677 3300048921 Bacteria 2229
1179 Ga0496118_0167611 3300048921 Bacteria 1347
1180 Ga0496118_0190198 3300048921 Bacteria 1228
1181 Ga0496118_0249160 3300048921 Bacteria 1010
1182 Ga0496119_0000060 3300048922 Bacteria 172646
1183 Ga0496119_0158002 3300048922 Bacteria 1208
1184 Ga0496119_0359940 3300048922 Bacteria 702
1185 Ga0496120_0002408 3300048923 Bacteria 19010
1186 Ga0496120_0141567 3300048923 Bacteria 1220
1187 Ga0496121_0001650 3300048924 Bacteria 36892
1188 Ga0496121_0012757 3300048924 Bacteria 9102
1189 Ga0496121_0014564 3300048924 Bacteria 8331
1190 Ga0496121_0024304 3300048924 Bacteria 5800
1191 Ga0496121_0179415 3300048924 Bacteria 1530
1192 Ga0496121_0329554 3300048924 Bacteria 1025
1193 Ga0496121_0381586 3300048924 Bacteria 929
1194 Ga0496122_0001366 3300048925 Bacteria 39678
1195 Ga0496122_0003210 3300048925 Bacteria 21740
1196 Ga0496122_0004537 3300048925 Bacteria 17119
1197 Ga0496122_0012547 3300048925 Bacteria 8415
1198 Ga0496122_0141210 3300048925 Bacteria 1506
1199 Ga0496122_0256966 3300048925 Bacteria 972
1200 Ga0496122_0266592 3300048925 Bacteria 946
1201 Ga0496122_0457455 3300048925 Bacteria 631
1202 Ga0496123_0000160 3300048926 Bacteria 135310
1203 Ga0496123_0000717 3300048926 Bacteria 54100
1204 Ga0496123_0001033 3300048926 Bacteria 42272
1205 Ga0496123_0030074 3300048926 Bacteria 3982
1206 Ga0496123_0193402 3300048926 Bacteria 1050
1207 Ga0496123_0194578 3300048926 Bacteria 1045
1208 Ga0496124_0000120 3300048927 Bacteria 163899
1209 Ga0496124_0002576 3300048927 Bacteria 23496
1210 Ga0496124_0007600 3300048927 Bacteria 11489
1211 Ga0496124_0008310 3300048927 Bacteria 10865
1212 Ga0496124_0011914 3300048927 Bacteria 8653
1213 Ga0496124_0030903 3300048927 Bacteria 4745
1214 Ga0496124_0032645 3300048927 Bacteria 4593
1215 Ga0496124_0035732 3300048927 Bacteria 4345
1216 Ga0496124_0050346 3300048927 Bacteria 3550
1217 Ga0496124_0076629 3300048927 Bacteria 2759
1218 Ga0496124_0162154 3300048927 Bacteria 1741
1219 Ga0496124_0172764 3300048927 Bacteria 1671
1220 Ga0496124_0244160 3300048927 Bacteria 1333
1221 Ga0496124_0281677 3300048927 Bacteria 1211
1222 Ga0496124_0362635 3300048927 Bacteria 1020
1223 Ga0496124_0379314 3300048927 Bacteria 989
1224 Ga0496124_0447029 3300048927 Bacteria 882
1225 Ga0496124_0464317 3300048927 Bacteria 859
1226 Ga0496124_0838278 3300048927 Bacteria 565
1227 Ga0496125_0002642 3300048928 Bacteria 22913
1228 Ga0496125_0008348 3300048928 Bacteria 10863
1229 Ga0496125_0010672 3300048928 Bacteria 9272
1230 Ga0496125_0012181 3300048928 Bacteria 8557
1231 Ga0496125_0103184 3300048928 Bacteria 2093
1232 Ga0496125_0309860 3300048928 Bacteria 962
1233 Ga0496125_0404684 3300048928 Bacteria 796
1234 Ga0496126_0051668 3300048929 Bacteria 3740
1235 Ga0496126_0260175 3300048929 Bacteria 1443
1236 Ga0496126_0293236 3300048929 Bacteria 1344
1237 Ga0495678_000017 3300049459 Bacteria 282592
1238 Ga0495678_000238 3300049459 Bacteria 62224
1239 Ga0495678_004233 3300049459 Bacteria 8418
1240 Ga0495678_010495 3300049459 Bacteria 4500
1241 Ga0495678_027174 3300049459 Bacteria 2430
1242 Ga0495678_043306 3300049459 Bacteria 1788
1243 Ga0495678_047688 3300049459 Bacteria 1675
1244 Ga0495678_060213 3300049459 Bacteria 1429
1245 Ga0495678_111054 3300049459 Bacteria 934
1246 Ga0495678_113107 3300049459 Bacteria 922
1247 Ga0495678_129310 3300049459 Bacteria 838
1248 Ga0495682_0000264 3300049460 Bacteria 41397
1249 Ga0495682_0002650 3300049460 Bacteria 8362
1250 Ga0495682_0022422 3300049460 Bacteria 2361
1251 Ga0501290_099620 3300049513 Bacteria 516
1252 Ga0501031_0043555 3300049568 Bacteria 2929
1253 Ga0501032_0041571 3300049569 Bacteria 3121
1254 Ga0501034_0001845 3300049571 Bacteria 26903
1255 Ga0501034_0012884 3300049571 Bacteria 8624
1256 Ga0501034_0136036 3300049571 Bacteria 2438
1257 Ga0501034_0448445 3300049571 Bacteria 1208
1258 Ga0501037_0047131 3300049573 Bacteria 3160
1259 Ga0501037_0421947 3300049573 Bacteria 913
1260 Ga0501038_0162137 3300049574 Bacteria 1816
1261 Ga0501039_0814693 3300049575 Bacteria 728
1262 Ga0501198_000007 3300049649 Bacteria 129700
1263 Ga0501222_000005 3300049662 Bacteria 129724
1264 Ga0501222_021760 3300049662 Bacteria 861
1265 Ga0501262_000596 3300049759 Bacteria 4261
1266 Ga0501035_0009715 3300049822 Bacteria 8949
1267 Ga0501226_000001 3300049853 Bacteria 432595
1268 nmdc:mga03683_176275_c1 3300050489 Bacteria 973
1269 nmdc:mga03683_2893_c1 3300050489 Bacteria 5415
1270 nmdc:mga03n38_188067_c1 3300050490 Bacteria 1062
1271 nmdc:mga03n38_56007_c1 3300050490 Bacteria 1778
1272 nmdc:mga03n38_57353_c1 3300050490 Bacteria 1761
1273 nmdc:mga0k408_12452_c1 3300050493 Bacteria 4650
1274 nmdc:mga0k408_141606_c1 3300050493 Bacteria 1431
1275 nmdc:mga0k408_171509_c1 3300050493 Bacteria 984
1276 nmdc:mga0k408_30852_c1 3300050493 Bacteria 3058
1277 nmdc:mga0k408_365840_c1 3300050493 Bacteria 859
1278 nmdc:mga0k408_427431_c1 3300050493 Bacteria 787
1279 nmdc:mga0k408_57431_c1 3300050493 Bacteria 2259
1280 nmdc:mga07m45_28923_c1 3300050496 Bacteria 3061
1281 nmdc:mga07m45_5171_c1 3300050496 Bacteria 6468
1282 nmdc:mga08x19_505988_c1 3300050514 Bacteria 853
1283 nmdc:mga08x19_787656_c1 3300050514 Bacteria 675
1284 Ga0500650_0220620 3300053098 Bacteria 858
1285 Ga0500593_011538 3300053117 Bacteria 3731
1286 Ga0500608_185401 3300053122 Bacteria 876
1287 Ga0500618_005276 3300053125 Bacteria 3960
1288 Ga0500618_066406 3300053125 Bacteria 810
1289 Ga0500658_0078798 3300053134 Bacteria 1405
1290 Ga0500659_0008444 3300053135 Bacteria 5674
1291 Ga0500559_0093430 3300053136 Bacteria 1379
1292 Ga0500573_0054738 3300053140 Bacteria 2291
1293 Ga0500577_0063217 3300053142 Bacteria 1430
1294 Ga0500586_183056 3300053145 Bacteria 697
1295 Ga0500619_000014 3300053154 Bacteria 55951
1296 Ga0500636_0337501 3300053177 Bacteria 725

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100022665 Ga0075363_1000226654 140
2 3300044658 Ga0466972_0076629 Ga0466972_0076629_232_663 140
3 3300044735 Ga0466968_0056271 Ga0466968_0056271_1071_1502 140
4 3300044765 Ga0466970_0621982 Ga0466970_0621982_57_488 140
5 3300045049 Ga0466959_0047625 Ga0466959_0047625_107_538 140
6 3300050493 nmdc:mga0k408_30852_c1 nmdc:mga0k408_30852_c1_1580_2032 142
7 3300046648 Ga0495611_0215245 Ga0495611_0215245_17_448 143
8 3300047469 Ga0495673_0041861 Ga0495673_0041861_890_1321 143
9 2124908027 MRS2a_Contig_1652 MRS2a_00514270 145
10 2124908027 MRS2a_Contig_26165 MRS2a_00065120 145
11 2162886007 SwRhRL2b_contig_3940779 SwRhRL2b_0573.00002040 145
12 2162886007 SwRhRL2b_contig_70830 SwRhRL2b_0031.00005300 145
13 2162886011 MRS1b_contig_5249422 MRS1b_0220.00002220 145
14 3300002737 JGI25162J39368_1000098 JGI25162J39368_100009835 145
15 3300002737 JGI25162J39368_1000129 JGI25162J39368_100012919 145
16 3300002771 JGI25163J39215_1002778 JGI25163J39215_10027782 145
17 3300002771 JGI25163J39215_1003023 JGI25163J39215_10030232 145
18 3300002772 JGI25164J39214_1000076 JGI25164J39214_100007656 145
19 3300002772 JGI25164J39214_1000101 JGI25164J39214_100010159 145
20 3300003187 JGI25151J46595_10046496 JGI25151J46595_100464962 145
21 3300003214 JGI25165J46597_1000150 JGI25165J46597_100015043 145
22 3300003214 JGI25165J46597_1000180 JGI25165J46597_100018035 145
23 3300003215 JGI25153J46596_10031647 JGI25153J46596_100316473 145
24 3300003316 rootH1_10035872 rootH1_100358724 145
25 3300003322 rootL2_10217267 rootL2_102172673 145
26 3300003323 rootH1_10034721 rootH1_100347213 145
27 3300003323 rootH1_10059234 rootH1_100592342 145
28 3300003578 Ga0006562J51391_1076555 Ga0006562J51391_10765555 145
29 3300003578 Ga0006562J51391_1076556 Ga0006562J51391_10765562 145
30 3300003751 Ga0055538_1000037 Ga0055538_1000037158 145
31 3300003752 Ga0055539_1000048 Ga0055539_1000048158 145
32 3300003756 Ga0055533_1000059 Ga0055533_1000059158 145
33 3300003758 Ga0055532_1000105 Ga0055532_100010581 145
34 3300003759 Ga0055525_1000128 Ga0055525_10001282 145
35 3300003773 Ga0055537_1001077 Ga0055537_10010778 145
36 3300003781 Ga0055536_1000312 Ga0055536_10003125 145
37 3300003781 Ga0055536_1000424 Ga0055536_100042412 145
38 3300003784 Ga0055534_1000296 Ga0055534_10002965 145
39 3300003790 Ga0055528_1001392 Ga0055528_10013925 145
40 3300003791 Ga0055530_10000639 Ga0055530_1000063916 145
41 3300003791 Ga0055530_10001069 Ga0055530_100010697 145
42 3300003792 Ga0055540_1000217 Ga0055540_100021741 145
43 3300003792 Ga0055540_1000339 Ga0055540_100033926 145
44 3300003792 Ga0055540_1001192 Ga0055540_10011922 145
45 3300003792 Ga0055540_1008969 Ga0055540_10089692 145
46 3300003794 Ga0055531_10000238 Ga0055531_1000023822 145
47 3300003794 Ga0055531_10000275 Ga0055531_1000027542 145
48 3300003841 Ga0055541_1000035 Ga0055541_10000352 145
49 3300005288 Ga0065714_10004152 Ga0065714_100041527 145
50 3300005288 Ga0065714_10004743 Ga0065714_100047433 145
51 3300005288 Ga0065714_10005538 Ga0065714_100055382 145
52 3300005288 Ga0065714_10007187 Ga0065714_100071872 145
53 3300005288 Ga0065714_10011991 Ga0065714_100119912 145
54 3300005288 Ga0065714_10026002 Ga0065714_100260021 145
55 3300005288 Ga0065714_10072198 Ga0065714_100721982 145
56 3300005288 Ga0065714_10076478 Ga0065714_100764783 145
57 3300005288 Ga0065714_10094649 Ga0065714_100946492 145
58 3300005288 Ga0065714_10173479 Ga0065714_101734791 145
59 3300005288 Ga0065714_10217137 Ga0065714_102171372 145
60 3300005288 Ga0065714_10392414 Ga0065714_103924141 145
61 3300005289 Ga0065704_10000725 Ga0065704_100007251 145
62 3300005289 Ga0065704_10008367 Ga0065704_100083673 145
63 3300005289 Ga0065704_10031111 Ga0065704_100311112 145
64 3300005289 Ga0065704_10046756 Ga0065704_100467562 145
65 3300005289 Ga0065704_10071344 Ga0065704_100713444 145
66 3300005289 Ga0065704_10088763 Ga0065704_100887632 145
67 3300005290 Ga0065712_10004358 Ga0065712_100043584 145
68 3300005293 Ga0065715_10012984 Ga0065715_100129843 145
69 3300005328 Ga0070676_10416140 Ga0070676_104161402 145
70 3300005328 Ga0070676_10767531 Ga0070676_107675312 145
71 3300005329 Ga0070683_100617932 Ga0070683_1006179322 145
72 3300005331 Ga0070670_100000321 Ga0070670_10000032112 145
73 3300005331 Ga0070670_100061634 Ga0070670_1000616343 145
74 3300005331 Ga0070670_100245727 Ga0070670_1002457271 145
75 3300005331 Ga0070670_101562085 Ga0070670_1015620851 145
76 3300005334 Ga0068869_101174372 Ga0068869_1011743721 145
77 3300005344 Ga0070661_100000501 Ga0070661_10000050111 145
78 3300005344 Ga0070661_100133391 Ga0070661_1001333911 145
79 3300005344 Ga0070661_100196805 Ga0070661_1001968051 145
80 3300005347 Ga0070668_101268721 Ga0070668_1012687211 145
81 3300005353 Ga0070669_100000233 Ga0070669_10000023328 145
82 3300005353 Ga0070669_100000265 Ga0070669_10000026524 145
83 3300005353 Ga0070669_100186631 Ga0070669_1001866313 145
84 3300005354 Ga0070675_100076352 Ga0070675_1000763522 145
85 3300005354 Ga0070675_100971129 Ga0070675_1009711292 145
86 3300005355 Ga0070671_100812068 Ga0070671_1008120682 145
87 3300005355 Ga0070671_100900204 Ga0070671_1009002041 145
88 3300005355 Ga0070671_101308310 Ga0070671_1013083101 145
89 3300005356 Ga0070674_100276038 Ga0070674_1002760382 145
90 3300005356 Ga0070674_100520133 Ga0070674_1005201332 145
91 3300005364 Ga0070673_102029460 Ga0070673_1020294601 145
92 3300005366 Ga0070659_100199724 Ga0070659_1001997241 145
93 3300005366 Ga0070659_100525198 Ga0070659_1005251981 145
94 3300005367 Ga0070667_100098163 Ga0070667_1000981632 145
95 3300005455 Ga0070663_100187479 Ga0070663_1001874792 145
96 3300005455 Ga0070663_100252767 Ga0070663_1002527672 145
97 3300005456 Ga0070678_100368113 Ga0070678_1003681132 145
98 3300005456 Ga0070678_100551066 Ga0070678_1005510662 145
99 3300005456 Ga0070678_101905939 Ga0070678_1019059391 145
100 3300005457 Ga0070662_100000348 Ga0070662_1000003487 145
101 3300005457 Ga0070662_100014630 Ga0070662_1000146303 145
102 3300005459 Ga0068867_100029643 Ga0068867_1000296433 145
103 3300005466 Ga0070685_10332816 Ga0070685_103328162 145
104 3300005539 Ga0068853_100000029 Ga0068853_10000002934 145
105 3300005544 Ga0070686_100268760 Ga0070686_1002687602 145
106 3300005548 Ga0070665_100112245 Ga0070665_1001122452 145
107 3300005548 Ga0070665_100192682 Ga0070665_1001926822 145
108 3300005548 Ga0070665_100458478 Ga0070665_1004584781 145
109 3300005548 Ga0070665_100745358 Ga0070665_1007453581 145
110 3300005563 Ga0068855_100664263 Ga0068855_1006642632 145
111 3300005564 Ga0070664_100000531 Ga0070664_1000005311 145
112 3300005564 Ga0070664_100307290 Ga0070664_1003072901 145
113 3300005564 Ga0070664_100536864 Ga0070664_1005368642 145
114 3300005577 Ga0068857_100588801 Ga0068857_1005888012 145
115 3300005578 Ga0068854_100006958 Ga0068854_1000069584 145
116 3300005578 Ga0068854_100016734 Ga0068854_1000167345 145
117 3300005615 Ga0070702_100256402 Ga0070702_1002564022 145
118 3300005718 Ga0068866_10281112 Ga0068866_102811122 145
119 3300005834 Ga0068851_10000024 Ga0068851_1000002498 145
120 3300006042 Ga0075368_10165566 Ga0075368_101655661 145
121 3300006048 Ga0075363_100007346 Ga0075363_1000073465 145
122 3300006048 Ga0075363_100029510 Ga0075363_1000295102 145
123 3300006048 Ga0075363_100072448 Ga0075363_1000724482 145
124 3300006051 Ga0075364_10242399 Ga0075364_102423992 145
125 3300006051 Ga0075364_10331714 Ga0075364_103317142 145
126 3300006051 Ga0075364_10376387 Ga0075364_103763872 145
127 3300006058 Ga0075432_10004532 Ga0075432_100045324 145
128 3300006058 Ga0075432_10005717 Ga0075432_100057175 145
129 3300006058 Ga0075432_10017130 Ga0075432_100171303 145
130 3300006058 Ga0075432_10017356 Ga0075432_100173562 145
131 3300006058 Ga0075432_10114074 Ga0075432_101140741 145
132 3300006177 Ga0075362_10006101 Ga0075362_100061014 145
133 3300006177 Ga0075362_10021790 Ga0075362_100217905 145
134 3300006177 Ga0075362_10094758 Ga0075362_100947581 145
135 3300006186 Ga0075369_10009329 Ga0075369_100093293 145
136 3300006195 Ga0075366_10007585 Ga0075366_100075856 145
137 3300006195 Ga0075366_10010713 Ga0075366_100107132 145
138 3300006195 Ga0075366_10038276 Ga0075366_100382761 145
139 3300006195 Ga0075366_10167715 Ga0075366_101677152 145
140 3300006195 Ga0075366_10745554 Ga0075366_107455541 145
141 3300006353 Ga0075370_10030289 Ga0075370_100302894 145
142 3300006881 Ga0068865_100602307 Ga0068865_1006023072 145
143 3300006881 Ga0068865_100693823 Ga0068865_1006938232 145
144 3300006914 Ga0075436_100154385 Ga0075436_1001543851 145
145 3300006914 Ga0075436_100683476 Ga0075436_1006834762 145
146 3300006914 Ga0075436_100885633 Ga0075436_1008856331 145
147 3300006914 Ga0075436_101009991 Ga0075436_1010099912 145
148 3300006944 Ga0099823_1010535 Ga0099823_10105355 145
149 3300006946 Ga0079104_1000423 Ga0079104_100042314 145
150 3300006946 Ga0079104_1001311 Ga0079104_100131111 145
151 3300006946 Ga0079104_1025028 Ga0079104_10250282 145
152 3300006948 Ga0099826_10001277 Ga0099826_100012779 145
153 3300006948 Ga0099826_10083078 Ga0099826_100830782 145
154 3300006948 Ga0099826_10086190 Ga0099826_100861902 145
155 3300009011 Ga0105251_10000191 Ga0105251_1000019141 145
156 3300009011 Ga0105251_10002391 Ga0105251_1000239110 145
157 3300009011 Ga0105251_10002825 Ga0105251_100028251 145
158 3300009011 Ga0105251_10010047 Ga0105251_100100476 145
159 3300009011 Ga0105251_10015601 Ga0105251_100156012 145
160 3300009011 Ga0105251_10060306 Ga0105251_100603062 145
161 3300009011 Ga0105251_10069504 Ga0105251_100695042 145
162 3300009011 Ga0105251_10069981 Ga0105251_100699811 145
163 3300009011 Ga0105251_10120773 Ga0105251_101207731 145
164 3300009011 Ga0105251_10124198 Ga0105251_101241981 145
165 3300009011 Ga0105251_10251038 Ga0105251_102510381 145
166 3300009011 Ga0105251_10347369 Ga0105251_103473692 145
167 3300009036 Ga0105244_10005637 Ga0105244_100056371 145
168 3300009036 Ga0105244_10006932 Ga0105244_100069321 145
169 3300009036 Ga0105244_10007352 Ga0105244_100073527 145
170 3300009036 Ga0105244_10008094 Ga0105244_100080941 145
171 3300009036 Ga0105244_10017040 Ga0105244_100170402 145
172 3300009036 Ga0105244_10032241 Ga0105244_100322412 145
173 3300009036 Ga0105244_10032876 Ga0105244_100328761 145
174 3300009036 Ga0105244_10081298 Ga0105244_100812982 145
175 3300009036 Ga0105244_10108062 Ga0105244_101080622 145
176 3300009036 Ga0105244_10117698 Ga0105244_101176981 145
177 3300009036 Ga0105244_10146400 Ga0105244_101464001 145
178 3300009036 Ga0105244_10154859 Ga0105244_101548591 145
179 3300009036 Ga0105244_10159624 Ga0105244_101596242 145
180 3300009036 Ga0105244_10217218 Ga0105244_102172182 145
181 3300009036 Ga0105244_10222090 Ga0105244_102220902 145
182 3300009036 Ga0105244_10243957 Ga0105244_102439571 145
183 3300009092 Ga0105250_10000251 Ga0105250_1000025116 145
184 3300009092 Ga0105250_10000651 Ga0105250_100006511 145
185 3300009092 Ga0105250_10002675 Ga0105250_100026752 145
186 3300009092 Ga0105250_10008561 Ga0105250_100085615 145
187 3300009092 Ga0105250_10053522 Ga0105250_100535221 145
188 3300009092 Ga0105250_10053808 Ga0105250_100538082 145
189 3300009092 Ga0105250_10057061 Ga0105250_100570612 145
190 3300009092 Ga0105250_10132908 Ga0105250_101329081 145
191 3300009092 Ga0105250_10142351 Ga0105250_101423512 145
192 3300009092 Ga0105250_10299056 Ga0105250_102990561 145
193 3300009092 Ga0105250_10306330 Ga0105250_103063301 145
194 3300009148 Ga0105243_10000299 Ga0105243_1000029923 145
195 3300009148 Ga0105243_10001658 Ga0105243_100016588 145
196 3300009148 Ga0105243_10007582 Ga0105243_100075828 145
197 3300009148 Ga0105243_10007826 Ga0105243_100078263 145
198 3300009148 Ga0105243_10029031 Ga0105243_100290312 145
199 3300009148 Ga0105243_10191408 Ga0105243_101914082 145
200 3300009148 Ga0105243_10265075 Ga0105243_102650751 145
201 3300009148 Ga0105243_10426699 Ga0105243_104266992 145
202 3300009148 Ga0105243_11040697 Ga0105243_110406971 145
203 3300009176 Ga0105242_10002000 Ga0105242_100020003 145
204 3300009176 Ga0105242_10021110 Ga0105242_100211103 145
205 3300009176 Ga0105242_10819856 Ga0105242_108198562 145
206 3300009177 Ga0105248_10014147 Ga0105248_100141473 145
207 3300009545 Ga0105237_10001517 Ga0105237_1000151713 145
208 3300009545 Ga0105237_10186491 Ga0105237_101864911 145
209 3300009553 Ga0105249_10025181 Ga0105249_100251814 145
210 3300010375 Ga0105239_10572521 Ga0105239_105725212 145
211 3300011119 Ga0105246_10000445 Ga0105246_1000044519 145
212 3300011119 Ga0105246_10002318 Ga0105246_100023186 145
213 3300011119 Ga0105246_10005000 Ga0105246_100050006 145
214 3300011119 Ga0105246_10034243 Ga0105246_100342432 145
215 3300011119 Ga0105246_10105454 Ga0105246_101054542 145
216 3300012473 Ga0157340_1000406 Ga0157340_10004062 145
217 3300012477 Ga0157336_1004931 Ga0157336_10049312 145
218 3300012498 Ga0157345_1000173 Ga0157345_10001737 145
219 3300012498 Ga0157345_1001176 Ga0157345_10011763 145
220 3300012502 Ga0157347_1003443 Ga0157347_10034432 145
221 3300012502 Ga0157347_1009340 Ga0157347_10093402 145
222 3300013100 Ga0157373_10004675 Ga0157373_100046753 145
223 3300013100 Ga0157373_10012300 Ga0157373_100123003 145
224 3300013100 Ga0157373_10019102 Ga0157373_100191022 145
225 3300013100 Ga0157373_10030552 Ga0157373_100305522 145
226 3300013100 Ga0157373_10146868 Ga0157373_101468682 145
227 3300013100 Ga0157373_10169170 Ga0157373_101691702 145
228 3300013100 Ga0157373_10170281 Ga0157373_101702811 145
229 3300013100 Ga0157373_10245635 Ga0157373_102456351 145
230 3300013100 Ga0157373_10378711 Ga0157373_103787112 145
231 3300013100 Ga0157373_10434930 Ga0157373_104349302 145
232 3300013100 Ga0157373_10526504 Ga0157373_105265041 145
233 3300013100 Ga0157373_10619343 Ga0157373_106193431 145
234 3300013102 Ga0157371_10000238 Ga0157371_1000023811 145
235 3300013102 Ga0157371_10002603 Ga0157371_1000260312 145
236 3300013102 Ga0157371_10006450 Ga0157371_100064502 145
237 3300013102 Ga0157371_10019314 Ga0157371_100193143 145
238 3300013102 Ga0157371_10037713 Ga0157371_100377133 145
239 3300013102 Ga0157371_10489164 Ga0157371_104891643 145
240 3300013102 Ga0157371_10616652 Ga0157371_106166521 145
241 3300013102 Ga0157371_11352583 Ga0157371_113525831 145
242 3300013104 Ga0157370_10003628 Ga0157370_1000362811 145
243 3300013104 Ga0157370_10095789 Ga0157370_100957893 145
244 3300013104 Ga0157370_10135516 Ga0157370_101355163 145
245 3300013104 Ga0157370_10156160 Ga0157370_101561602 145
246 3300013104 Ga0157370_10197817 Ga0157370_101978171 145
247 3300013104 Ga0157370_10215088 Ga0157370_102150882 145
248 3300013104 Ga0157370_10237571 Ga0157370_102375711 145
249 3300013104 Ga0157370_10263433 Ga0157370_102634332 145
250 3300013104 Ga0157370_10369500 Ga0157370_103695002 145
251 3300013104 Ga0157370_10436396 Ga0157370_104363961 145
252 3300013104 Ga0157370_10457150 Ga0157370_104571502 145
253 3300013104 Ga0157370_10484168 Ga0157370_104841682 145
254 3300013104 Ga0157370_11952538 Ga0157370_119525381 145
255 3300013105 Ga0157369_10040455 Ga0157369_100404556 145
256 3300013105 Ga0157369_10115623 Ga0157369_101156234 145
257 3300013105 Ga0157369_10122183 Ga0157369_101221832 145
258 3300013105 Ga0157369_10323167 Ga0157369_103231672 145
259 3300013105 Ga0157369_10323580 Ga0157369_103235802 145
260 3300013105 Ga0157369_10496008 Ga0157369_104960082 145
261 3300013297 Ga0157378_10135724 Ga0157378_101357241 145
262 3300013306 Ga0163162_10008219 Ga0163162_100082192 145
263 3300013306 Ga0163162_10035391 Ga0163162_100353912 145
264 3300013306 Ga0163162_10088475 Ga0163162_100884752 145
265 3300013306 Ga0163162_10108847 Ga0163162_101088472 145
266 3300013306 Ga0163162_10188413 Ga0163162_101884133 145
267 3300013306 Ga0163162_10944443 Ga0163162_109444432 145
268 3300013306 Ga0163162_11799778 Ga0163162_117997781 145
269 3300013307 Ga0157372_10011625 Ga0157372_100116257 145
270 3300013308 Ga0157375_10008818 Ga0157375_100088181 145
271 3300013308 Ga0157375_10043933 Ga0157375_100439335 145
272 3300013308 Ga0157375_10326675 Ga0157375_103266752 145
273 3300013308 Ga0157375_10365496 Ga0157375_103654962 145
274 3300013308 Ga0157375_11224997 Ga0157375_112249971 145
275 3300013308 Ga0157375_11313747 Ga0157375_113137472 145
276 3300013308 Ga0157375_11374783 Ga0157375_113747832 145
277 3300013308 Ga0157375_11941674 Ga0157375_119416741 145
278 3300014326 Ga0157380_10423910 Ga0157380_104239102 145
279 3300014326 Ga0157380_12424941 Ga0157380_124249411 145
280 3300014497 Ga0182008_10005144 Ga0182008_100051441 145
281 3300014497 Ga0182008_10006051 Ga0182008_100060513 145
282 3300014497 Ga0182008_10006281 Ga0182008_100062815 145
283 3300014497 Ga0182008_10008204 Ga0182008_100082043 145
284 3300014497 Ga0182008_10024942 Ga0182008_100249424 145
285 3300014497 Ga0182008_10034886 Ga0182008_100348862 145
286 3300014497 Ga0182008_10073622 Ga0182008_100736222 145
287 3300014497 Ga0182008_10093758 Ga0182008_100937582 145
288 3300014497 Ga0182008_10105369 Ga0182008_101053691 145
289 3300014497 Ga0182008_10234898 Ga0182008_102348982 145
290 3300014497 Ga0182008_10296659 Ga0182008_102966591 145
291 3300014497 Ga0182008_10651189 Ga0182008_106511891 145
292 3300014969 Ga0157376_10639699 Ga0157376_106396992 145
293 3300014969 Ga0157376_11474043 Ga0157376_114740432 145
294 3300015261 Ga0182006_1001876 Ga0182006_10018768 145
295 3300015261 Ga0182006_1002366 Ga0182006_10023663 145
296 3300015261 Ga0182006_1004424 Ga0182006_10044246 145
297 3300015261 Ga0182006_1007210 Ga0182006_10072103 145
298 3300015261 Ga0182006_1022158 Ga0182006_10221582 145
299 3300015261 Ga0182006_1023709 Ga0182006_10237093 145
300 3300015261 Ga0182006_1035699 Ga0182006_10356992 145
301 3300015261 Ga0182006_1078988 Ga0182006_10789882 145
302 3300015261 Ga0182006_1111716 Ga0182006_11117162 145
303 3300015261 Ga0182006_1122520 Ga0182006_11225201 145
304 3300015261 Ga0182006_1216138 Ga0182006_12161381 145
305 3300015262 Ga0182007_10000427 Ga0182007_1000042715 145
306 3300015262 Ga0182007_10034013 Ga0182007_100340131 145
307 3300015262 Ga0182007_10045281 Ga0182007_100452812 145
308 3300015262 Ga0182007_10100388 Ga0182007_101003882 145
309 3300015265 Ga0182005_1001211 Ga0182005_10012113 145
310 3300015265 Ga0182005_1004330 Ga0182005_10043302 145
311 3300015265 Ga0182005_1018016 Ga0182005_10180161 145
312 3300015265 Ga0182005_1057604 Ga0182005_10576041 145
313 3300015265 Ga0182005_1073143 Ga0182005_10731431 145
314 3300015265 Ga0182005_1077814 Ga0182005_10778141 145
315 3300017792 Ga0163161_10005861 Ga0163161_100058618 145
316 3300017792 Ga0163161_10023992 Ga0163161_100239921 145
317 3300017792 Ga0163161_10049953 Ga0163161_100499532 145
318 3300017792 Ga0163161_10271320 Ga0163161_102713201 145
319 3300017792 Ga0163161_10638270 Ga0163161_106382702 145
320 3300017792 Ga0163161_11251544 Ga0163161_112515441 145
321 3300025206 Ga0209435_100571 Ga0209435_1005712 145
322 3300025207 Ga0209760_100080 Ga0209760_10008025 145
323 3300025207 Ga0209760_100159 Ga0209760_1001597 145
324 3300025224 Ga0209784_100028 Ga0209784_1000282 145
325 3300025225 Ga0209566_100028 Ga0209566_1000282 145
326 3300025226 Ga0209674_100047 Ga0209674_1000472 145
327 3300025229 Ga0209147_100031 Ga0209147_1000312 145
328 3300025230 Ga0209563_100050 Ga0209563_1000502 145
329 3300025230 Ga0209563_101807 Ga0209563_1018074 145
330 3300025231 Ga0207427_100014 Ga0207427_100014311 145
331 3300025231 Ga0207427_100016 Ga0207427_10001678 145
332 3300025233 Ga0209437_100011 Ga0209437_100011267 145
333 3300025233 Ga0209437_100016 Ga0209437_100016326 145
334 3300025233 Ga0209437_101954 Ga0209437_1019544 145
335 3300025242 Ga0209258_102000 Ga0209258_1020003 145
336 3300025245 Ga0207425_1000381 Ga0207425_100038130 145
337 3300025245 Ga0207425_1014827 Ga0207425_10148272 145
338 3300025246 Ga0209646_1001004 Ga0209646_10010046 145
339 3300025253 Ga0209677_100029 Ga0209677_1000292 145
340 3300025256 Ga0209759_1001687 Ga0209759_10016875 145
341 3300025256 Ga0209759_1014277 Ga0209759_10142772 145
342 3300025261 Ga0209233_1000019 Ga0209233_1000019267 145
343 3300025261 Ga0209233_1000036 Ga0209233_1000036311 145
344 3300025263 Ga0209565_1000020 Ga0209565_100002074 145
345 3300025273 Ga0209673_1000072 Ga0209673_1000072126 145
346 3300025273 Ga0209673_1001259 Ga0209673_10012594 145
347 3300025273 Ga0209673_1003690 Ga0209673_10036904 145
348 3300025291 Ga0209675_1000014 Ga0209675_100001462 145
349 3300025291 Ga0209675_1004181 Ga0209675_10041814 145
350 3300025292 Ga0209676_1000025 Ga0209676_1000025329 145
351 3300025292 Ga0209676_1000032 Ga0209676_1000032292 145
352 3300025292 Ga0209676_1000208 Ga0209676_100020817 145
353 3300025292 Ga0209676_1005146 Ga0209676_10051462 145
354 3300025292 Ga0209676_1027400 Ga0209676_10274002 145
355 3300025294 Ga0209025_1005088 Ga0209025_100508810 145
356 3300025294 Ga0209025_1020897 Ga0209025_10208972 145
357 3300025295 Ga0209564_1036277 Ga0209564_10362772 145
358 3300025297 Ga0209758_1000278 Ga0209758_10002784 145
359 3300025298 Ga0209050_1000025 Ga0209050_1000025293 145
360 3300025298 Ga0209050_1000028 Ga0209050_1000028193 145
361 3300025298 Ga0209050_1000381 Ga0209050_100038143 145
362 3300025298 Ga0209050_1001504 Ga0209050_10015046 145
363 3300025298 Ga0209050_1069416 Ga0209050_10694162 145
364 3300025299 Ga0209256_1026888 Ga0209256_10268883 145
365 3300025299 Ga0209256_1068908 Ga0209256_10689081 145
366 3300025303 Ga0209051_1000026 Ga0209051_1000026124 145
367 3300025303 Ga0209051_1000080 Ga0209051_100008026 145
368 3300025303 Ga0209051_1000299 Ga0209051_100029952 145
369 3300025303 Ga0209051_1005384 Ga0209051_10053844 145
370 3300025303 Ga0209051_1100734 Ga0209051_11007342 145
371 3300025304 Ga0209257_1000034 Ga0209257_1000034329 145
372 3300025304 Ga0209257_1009273 Ga0209257_10092732 145
373 3300025304 Ga0209257_1011454 Ga0209257_10114545 145
374 3300025321 Ga0207656_10000008 Ga0207656_10000008192 145
375 3300025321 Ga0207656_10104439 Ga0207656_101044392 145
376 3300025711 Ga0207696_1000020 Ga0207696_100002096 145
377 3300025711 Ga0207696_1000057 Ga0207696_1000057157 145
378 3300025711 Ga0207696_1000074 Ga0207696_100007425 145
379 3300025711 Ga0207696_1000084 Ga0207696_100008495 145
380 3300025711 Ga0207696_1002384 Ga0207696_10023842 145
381 3300025711 Ga0207696_1005097 Ga0207696_10050975 145
382 3300025711 Ga0207696_1005477 Ga0207696_10054773 145
383 3300025711 Ga0207696_1023916 Ga0207696_10239162 145
384 3300025711 Ga0207696_1035644 Ga0207696_10356442 145
385 3300025728 Ga0207655_1000014 Ga0207655_1000014295 145
386 3300025728 Ga0207655_1000556 Ga0207655_100055626 145
387 3300025728 Ga0207655_1000904 Ga0207655_10009041 145
388 3300025728 Ga0207655_1001007 Ga0207655_100100717 145
389 3300025728 Ga0207655_1001055 Ga0207655_100105522 145
390 3300025728 Ga0207655_1001386 Ga0207655_100138616 145
391 3300025728 Ga0207655_1004166 Ga0207655_10041664 145
392 3300025728 Ga0207655_1004170 Ga0207655_10041702 145
393 3300025728 Ga0207655_1005009 Ga0207655_10050095 145
394 3300025728 Ga0207655_1005255 Ga0207655_10052553 145
395 3300025728 Ga0207655_1009660 Ga0207655_10096601 145
396 3300025728 Ga0207655_1011028 Ga0207655_10110281 145
397 3300025728 Ga0207655_1016324 Ga0207655_10163245 145
398 3300025728 Ga0207655_1021554 Ga0207655_10215541 145
399 3300025728 Ga0207655_1035433 Ga0207655_10354333 145
400 3300025728 Ga0207655_1039663 Ga0207655_10396632 145
401 3300025728 Ga0207655_1053812 Ga0207655_10538121 145
402 3300025728 Ga0207655_1056176 Ga0207655_10561762 145
403 3300025728 Ga0207655_1128570 Ga0207655_11285701 145
404 3300025728 Ga0207655_1167372 Ga0207655_11673722 145
405 3300025735 Ga0207713_1000031 Ga0207713_100003135 145
406 3300025735 Ga0207713_1000114 Ga0207713_100011488 145
407 3300025735 Ga0207713_1000537 Ga0207713_100053722 145
408 3300025735 Ga0207713_1001614 Ga0207713_10016142 145
409 3300025735 Ga0207713_1002914 Ga0207713_10029145 145
410 3300025735 Ga0207713_1003925 Ga0207713_10039259 145
411 3300025735 Ga0207713_1004305 Ga0207713_10043052 145
412 3300025735 Ga0207713_1005389 Ga0207713_10053893 145
413 3300025735 Ga0207713_1005934 Ga0207713_10059343 145
414 3300025735 Ga0207713_1006025 Ga0207713_10060252 145
415 3300025735 Ga0207713_1009636 Ga0207713_10096366 145
416 3300025735 Ga0207713_1010800 Ga0207713_10108002 145
417 3300025735 Ga0207713_1024858 Ga0207713_10248581 145
418 3300025735 Ga0207713_1030350 Ga0207713_10303502 145
419 3300025735 Ga0207713_1044595 Ga0207713_10445951 145
420 3300025735 Ga0207713_1046577 Ga0207713_10465771 145
421 3300025735 Ga0207713_1157521 Ga0207713_11575211 145
422 3300025901 Ga0207688_10744947 Ga0207688_107449472 145
423 3300025907 Ga0207645_10036430 Ga0207645_100364304 145
424 3300025907 Ga0207645_10613575 Ga0207645_106135752 145
425 3300025914 Ga0207671_10000015 Ga0207671_10000015181 145
426 3300025914 Ga0207671_10166643 Ga0207671_101666432 145
427 3300025914 Ga0207671_10549803 Ga0207671_105498031 145
428 3300025920 Ga0207649_10000001 Ga0207649_10000001306 145
429 3300025920 Ga0207649_10326114 Ga0207649_103261142 145
430 3300025923 Ga0207681_10000379 Ga0207681_1000037918 145
431 3300025923 Ga0207681_10001521 Ga0207681_100015212 145
432 3300025923 Ga0207681_10002578 Ga0207681_100025785 145
433 3300025923 Ga0207681_11014209 Ga0207681_110142092 145
434 3300025925 Ga0207650_10000239 Ga0207650_1000023933 145
435 3300025925 Ga0207650_10000329 Ga0207650_1000032918 145
436 3300025925 Ga0207650_10053499 Ga0207650_100534993 145
437 3300025925 Ga0207650_11462323 Ga0207650_114623232 145
438 3300025926 Ga0207659_10239755 Ga0207659_102397552 145
439 3300025931 Ga0207644_10445748 Ga0207644_104457482 145
440 3300025931 Ga0207644_10518137 Ga0207644_105181372 145
441 3300025931 Ga0207644_11298967 Ga0207644_112989671 145
442 3300025932 Ga0207690_10141781 Ga0207690_101417811 145
443 3300025932 Ga0207690_10551870 Ga0207690_105518702 145
444 3300025933 Ga0207706_10000885 Ga0207706_100008851 145
445 3300025933 Ga0207706_10160774 Ga0207706_101607742 145
446 3300025933 Ga0207706_10491963 Ga0207706_104919631 145
447 3300025934 Ga0207686_10001443 Ga0207686_100014432 145
448 3300025934 Ga0207686_10014509 Ga0207686_100145092 145
449 3300025934 Ga0207686_10714036 Ga0207686_107140362 145
450 3300025935 Ga0207709_10000022 Ga0207709_10000022324 145
451 3300025935 Ga0207709_10000451 Ga0207709_1000045126 145
452 3300025935 Ga0207709_10001509 Ga0207709_100015098 145
453 3300025935 Ga0207709_10004140 Ga0207709_100041403 145
454 3300025935 Ga0207709_10008684 Ga0207709_100086843 145
455 3300025935 Ga0207709_10013550 Ga0207709_100135503 145
456 3300025935 Ga0207709_10021524 Ga0207709_100215244 145
457 3300025935 Ga0207709_10027989 Ga0207709_100279891 145
458 3300025937 Ga0207669_10240291 Ga0207669_102402912 145
459 3300025938 Ga0207704_10289805 Ga0207704_102898052 145
460 3300025938 Ga0207704_10618613 Ga0207704_106186132 145
461 3300025941 Ga0207711_10236287 Ga0207711_102362872 145
462 3300025942 Ga0207689_10282336 Ga0207689_102823362 145
463 3300025945 Ga0207679_10000009 Ga0207679_10000009316 145
464 3300025949 Ga0207667_11460403 Ga0207667_114604031 145
465 3300025961 Ga0207712_10063690 Ga0207712_100636902 145
466 3300025972 Ga0207668_12052355 Ga0207668_120523551 145
467 3300025981 Ga0207640_10004861 Ga0207640_100048614 145
468 3300025986 Ga0207658_10120938 Ga0207658_101209382 145
469 3300026041 Ga0207639_10000099 Ga0207639_1000009910 145
470 3300026067 Ga0207678_10007570 Ga0207678_100075701 145
471 3300026067 Ga0207678_11683684 Ga0207678_116836841 145
472 3300026089 Ga0207648_10010854 Ga0207648_100108546 145
473 3300026089 Ga0207648_10115196 Ga0207648_101151962 145
474 3300026121 Ga0207683_10385230 Ga0207683_103852302 145
475 3300026121 Ga0207683_10448574 Ga0207683_104485742 145
476 3300027111 Ga0209281_1000026 Ga0209281_1000026233 145
477 3300027111 Ga0209281_1000033 Ga0209281_1000033300 145
478 3300027111 Ga0209281_1012387 Ga0209281_10123872 145
479 3300027296 Ga0209389_1000099 Ga0209389_100009962 145
480 3300027296 Ga0209389_1010492 Ga0209389_10104924 145
481 3300027312 Ga0209371_1000078 Ga0209371_100007830 145
482 3300027312 Ga0209371_1000630 Ga0209371_10006302 145
483 3300027360 Ga0209969_1000907 Ga0209969_10009073 145
484 3300027378 Ga0209981_1000751 Ga0209981_10007515 145
485 3300027424 Ga0209984_1006030 Ga0209984_10060302 145
486 3300027543 Ga0209999_1033803 Ga0209999_10338032 145
487 3300027543 Ga0209999_1046123 Ga0209999_10461232 145
488 3300027617 Ga0210002_1045935 Ga0210002_10459352 145
489 3300027665 Ga0209983_1002302 Ga0209983_10023022 145
490 3300027666 Ga0209282_1000360 Ga0209282_10003604 145
491 3300027682 Ga0209971_1001257 Ga0209971_10012577 145
492 3300027876 Ga0209974_10006221 Ga0209974_100062215 145
493 3300027876 Ga0209974_10245320 Ga0209974_102453202 145
494 3300027907 Ga0207428_10057273 Ga0207428_100572734 145
495 3300027907 Ga0207428_10742045 Ga0207428_107420452 145
496 3300028379 Ga0268266_10047572 Ga0268266_100475722 145
497 3300028379 Ga0268266_10132598 Ga0268266_101325982 145
498 3300028379 Ga0268266_10228166 Ga0268266_102281662 145
499 3300028379 Ga0268266_10570751 Ga0268266_105707511 145
500 3300028786 Ga0307517_10072123 Ga0307517_100721232 145
501 3300028786 Ga0307517_10317691 Ga0307517_103176912 145
502 3300028786 Ga0307517_10447645 Ga0307517_104476451 145
503 3300028794 Ga0307515_10005480 Ga0307515_1000548021 145
504 3300028794 Ga0307515_10282386 Ga0307515_102823862 145
505 3300028794 Ga0307515_10302575 Ga0307515_103025751 145
506 3300030500 Ga0268256_1000237 Ga0268256_100023754 145
507 3300030500 Ga0268256_1000273 Ga0268256_100027344 145
508 3300030521 Ga0307511_10040776 Ga0307511_100407764 145
509 3300030521 Ga0307511_10239710 Ga0307511_102397102 145
510 3300030521 Ga0307511_10269721 Ga0307511_102697212 145
511 3300030731 Ga0316177_1100029 Ga0316177_11000292 145
512 3300030734 Ga0316179_1054624 Ga0316179_10546244 145
513 3300030735 Ga0316178_1083481 Ga0316178_10834815 145
514 3300030742 Ga0316183_1034892 Ga0316183_10348922 145
515 3300030742 Ga0316183_1095561 Ga0316183_10955614 145
516 3300030742 Ga0316183_1155856 Ga0316183_11558562 145
517 3300030744 Ga0316181_1014722 Ga0316181_10147223 145
518 3300031250 Ga0265331_10018148 Ga0265331_100181483 145
519 3300031251 Ga0265327_10000151 Ga0265327_10000151107 145
520 3300031344 Ga0265316_10390077 Ga0265316_103900772 145
521 3300031507 Ga0307509_10486258 Ga0307509_104862581 145
522 3300031548 Ga0307408_100000002 Ga0307408_100000002255 145
523 3300031548 Ga0307408_100020467 Ga0307408_1000204671 145
524 3300031548 Ga0307408_100024898 Ga0307408_1000248983 145
525 3300031548 Ga0307408_100038505 Ga0307408_1000385054 145
526 3300031548 Ga0307408_100042854 Ga0307408_1000428544 145
527 3300031548 Ga0307408_100046887 Ga0307408_1000468874 145
528 3300031548 Ga0307408_100162595 Ga0307408_1001625952 145
529 3300031548 Ga0307408_100303862 Ga0307408_1003038621 145
530 3300031548 Ga0307408_100330940 Ga0307408_1003309402 145
531 3300031548 Ga0307408_100377080 Ga0307408_1003770802 145
532 3300031649 Ga0307514_10200906 Ga0307514_102009063 145
533 3300031727 Ga0316576_10039418 Ga0316576_100394182 145
534 3300031728 Ga0316578_10016599 Ga0316578_100165994 145
535 3300031730 Ga0307516_10001808 Ga0307516_100018081 145
536 3300031730 Ga0307516_10057531 Ga0307516_100575312 145
537 3300031730 Ga0307516_10154865 Ga0307516_101548652 145
538 3300031730 Ga0307516_10163587 Ga0307516_101635872 145
539 3300031730 Ga0307516_10731604 Ga0307516_107316042 145
540 3300031731 Ga0307405_10001968 Ga0307405_100019681 145
541 3300031731 Ga0307405_10003360 Ga0307405_100033607 145
542 3300031731 Ga0307405_10048674 Ga0307405_100486744 145
543 3300031731 Ga0307405_10057775 Ga0307405_100577753 145
544 3300031731 Ga0307405_10182107 Ga0307405_101821071 145
545 3300031731 Ga0307405_10242227 Ga0307405_102422272 145
546 3300031731 Ga0307405_10372136 Ga0307405_103721362 145
547 3300031733 Ga0316577_10417509 Ga0316577_104175092 145
548 3300031824 Ga0307413_10013326 Ga0307413_100133261 145
549 3300031824 Ga0307413_10892142 Ga0307413_108921421 145
550 3300031852 Ga0307410_10216569 Ga0307410_102165693 145
551 3300031901 Ga0307406_10071304 Ga0307406_100713043 145
552 3300031901 Ga0307406_10106741 Ga0307406_101067412 145
553 3300031901 Ga0307406_10185739 Ga0307406_101857391 145
554 3300031901 Ga0307406_10230547 Ga0307406_102305471 145
555 3300031903 Ga0307407_10192852 Ga0307407_101928522 145
556 3300031903 Ga0307407_10536380 Ga0307407_105363801 145
557 3300031903 Ga0307407_10951397 Ga0307407_109513971 145
558 3300031903 Ga0307407_11022846 Ga0307407_110228462 145
559 3300031911 Ga0307412_10002218 Ga0307412_100022183 145
560 3300031911 Ga0307412_10006543 Ga0307412_100065437 145
561 3300031911 Ga0307412_10010756 Ga0307412_100107561 145
562 3300031911 Ga0307412_10015248 Ga0307412_100152483 145
563 3300031911 Ga0307412_10074975 Ga0307412_100749752 145
564 3300031911 Ga0307412_10170795 Ga0307412_101707952 145
565 3300031911 Ga0307412_10232432 Ga0307412_102324322 145
566 3300031911 Ga0307412_10348252 Ga0307412_103482522 145
567 3300031911 Ga0307412_10450331 Ga0307412_104503312 145
568 3300031911 Ga0307412_10530109 Ga0307412_105301091 145
569 3300031911 Ga0307412_10761998 Ga0307412_107619982 145
570 3300031911 Ga0307412_10851231 Ga0307412_108512312 145
571 3300031995 Ga0307409_100036890 Ga0307409_1000368902 145
572 3300031995 Ga0307409_100107313 Ga0307409_1001073133 145
573 3300031995 Ga0307409_100224347 Ga0307409_1002243472 145
574 3300032002 Ga0307416_100003898 Ga0307416_1000038983 145
575 3300032002 Ga0307416_100109894 Ga0307416_1001098942 145
576 3300032002 Ga0307416_100140485 Ga0307416_1001404853 145
577 3300032002 Ga0307416_100259050 Ga0307416_1002590503 145
578 3300032002 Ga0307416_100378632 Ga0307416_1003786321 145
579 3300032002 Ga0307416_100674660 Ga0307416_1006746601 145
580 3300032004 Ga0307414_10031621 Ga0307414_100316211 145
581 3300032004 Ga0307414_10065210 Ga0307414_100652102 145
582 3300032004 Ga0307414_10207544 Ga0307414_102075442 145
583 3300032004 Ga0307414_10277539 Ga0307414_102775392 145
584 3300032004 Ga0307414_10317622 Ga0307414_103176222 145
585 3300032004 Ga0307414_10389349 Ga0307414_103893491 145
586 3300032004 Ga0307414_10509363 Ga0307414_105093632 145
587 3300032004 Ga0307414_10808499 Ga0307414_108084992 145
588 3300032004 Ga0307414_11706282 Ga0307414_117062821 145
589 3300032005 Ga0307411_10006610 Ga0307411_100066101 145
590 3300032005 Ga0307411_10056875 Ga0307411_100568753 145
591 3300032005 Ga0307411_10200087 Ga0307411_102000872 145
592 3300032005 Ga0307411_10489429 Ga0307411_104894292 145
593 3300032005 Ga0307411_10712281 Ga0307411_107122811 145
594 3300032005 Ga0307411_11032619 Ga0307411_110326191 145
595 3300033180 Ga0307510_10012023 Ga0307510_100120232 145
596 3300035112 Ga0373932_0154473 Ga0373932_0154473_225_668 145
597 3300035691 Ga0373931_0002682 Ga0373931_0002682_7238_7678 145
598 3300036401 Ga0373937_0592754 Ga0373937_0592754_579_1028 145
599 3300036712 Ga0316584_0243295 Ga0316584_0243295_544_981 145
600 3300037471 Ga0395905_0013719 Ga0395905_0013719_6737_7177 145
601 3300038705 Ga0237819_02166 Ga0237819_02166_643_1080 145
602 3300039110 Ga0400487_22015 Ga0400487_22015_4889_5338 145
603 3300039447 Ga0436361_1042483 Ga0436361_1042483_3682_4125 145
604 3300041404 Ga0439436_0019491 Ga0439436_0019491_1502_1939 145
605 3300041405 Ga0439438_001375 Ga0439438_001375_3607_4044 145
606 3300041405 Ga0439438_002509 Ga0439438_002509_6685_7122 145
607 3300041405 Ga0439438_003719 Ga0439438_003719_5527_5964 145
608 3300041405 Ga0439438_005311 Ga0439438_005311_4151_4588 145
609 3300041405 Ga0439438_007105 Ga0439438_007105_3203_3640 145
610 3300041405 Ga0439438_010216 Ga0439438_010216_2485_2922 145
611 3300041405 Ga0439438_014706 Ga0439438_014706_1106_1546 145
612 3300041405 Ga0439438_021105 Ga0439438_021105_48_485 145
613 3300041405 Ga0439438_034280 Ga0439438_034280_108_545 145
614 3300041405 Ga0439438_054011 Ga0439438_054011_435_872 145
615 3300041405 Ga0439438_081881 Ga0439438_081881_144_581 145
616 3300041407 Ga0439447_001178 Ga0439447_001178_6830_7267 145
617 3300041407 Ga0439447_001953 Ga0439447_001953_3700_4137 145
618 3300041407 Ga0439447_003505 Ga0439447_003505_5030_5467 145
619 3300041407 Ga0439447_003645 Ga0439447_003645_3958_4395 145
620 3300041407 Ga0439447_018428 Ga0439447_018428_617_1054 145
621 3300041407 Ga0439447_018549 Ga0439447_018549_1155_1595 145
622 3300041407 Ga0439447_045455 Ga0439447_045455_334_771 145
623 3300041407 Ga0439447_096890 Ga0439447_096890_98_535 145
624 3300041407 Ga0439447_111532 Ga0439447_111532_100_537 145
625 3300041411 Ga0439466_0005580 Ga0439466_0005580_3328_3765 145
626 3300041411 Ga0439466_0008951 Ga0439466_0008951_2147_2584 145
627 3300041411 Ga0439466_0009184 Ga0439466_0009184_2438_2875 145
628 3300041411 Ga0439466_0012072 Ga0439466_0012072_1685_2122 145
629 3300041411 Ga0439466_0022705 Ga0439466_0022705_983_1420 145
630 3300041411 Ga0439466_0023951 Ga0439466_0023951_180_617 145
631 3300041411 Ga0439466_0025331 Ga0439466_0025331_696_1133 145
632 3300041411 Ga0439466_0030715 Ga0439466_0030715_174_614 145
633 3300041411 Ga0439466_0038361 Ga0439466_0038361_542_979 145
634 3300041411 Ga0439466_0061762 Ga0439466_0061762_120_557 145
635 3300041411 Ga0439466_0233480 Ga0439466_0233480_79_516 145
636 3300041413 Ga0439465_0021955 Ga0439465_0021955_333_773 145
637 3300041443 Ga0451789_0877898 Ga0451789_0877898_49_486 145
638 3300041453 Ga0451797_1030840 Ga0451797_1030840_95_538 145
639 3300041456 Ga0451795_1013380 Ga0451795_1013380_80_523 145
640 3300041460 Ga0451802_0419198 Ga0451802_0419198_213_656 145
641 3300041460 Ga0451802_0441061 Ga0451802_0441061_656_1096 145
642 3300041491 Ga0451833_1324399 Ga0451833_1324399_66_509 145
643 3300041494 Ga0451837_0138631 Ga0451837_0138631_80_517 145
644 3300041997 Ga0439431_0005299 Ga0439431_0005299_1560_1997 145
645 3300041997 Ga0439431_0060161 Ga0439431_0060161_241_681 145
646 3300041997 Ga0439431_0225305 Ga0439431_0225305_94_531 145
647 3300041999 Ga0439433_0004071 Ga0439433_0004071_218_658 145
648 3300042000 Ga0439437_000593 Ga0439437_000593_1438_1875 145
649 3300042000 Ga0439437_003374 Ga0439437_003374_85_525 145
650 3300042002 Ga0439442_021019 Ga0439442_021019_885_1325 145
651 3300042004 Ga0439445_0063186 Ga0439445_0063186_430_870 145
652 3300042006 Ga0439432_013208 Ga0439432_013208_1010_1447 145
653 3300042006 Ga0439432_013408 Ga0439432_013408_133_570 145
654 3300042006 Ga0439432_023066 Ga0439432_023066_812_1249 145
655 3300042006 Ga0439432_067789 Ga0439432_067789_379_816 145
656 3300042006 Ga0439432_081504 Ga0439432_081504_87_524 145
657 3300042006 Ga0439432_084569 Ga0439432_084569_364_801 145
658 3300042006 Ga0439432_097255 Ga0439432_097255_427_864 145
659 3300042006 Ga0439432_114696 Ga0439432_114696_217_654 145
660 3300042007 Ga0439449_0004040 Ga0439449_0004040_2443_2883 145
661 3300042009 Ga0439451_015790 Ga0439451_015790_713_1150 145
662 3300042009 Ga0439451_034881 Ga0439451_034881_374_811 145
663 3300042010 Ga0439452_000639 Ga0439452_000639_4713_5150 145
664 3300042010 Ga0439452_000699 Ga0439452_000699_1460_1897 145
665 3300042010 Ga0439452_000714 Ga0439452_000714_533_970 145
666 3300042010 Ga0439452_001159 Ga0439452_001159_3912_4349 145
667 3300042010 Ga0439452_002829 Ga0439452_002829_5755_6192 145
668 3300042010 Ga0439452_003967 Ga0439452_003967_3723_4160 145
669 3300042010 Ga0439452_005162 Ga0439452_005162_161_598 145
670 3300042010 Ga0439452_008268 Ga0439452_008268_920_1357 145
671 3300042010 Ga0439452_045739 Ga0439452_045739_109_546 145
672 3300042010 Ga0439452_078563 Ga0439452_078563_102_539 145
673 3300042012 Ga0439455_0001801 Ga0439455_0001801_2674_3111 145
674 3300042013 Ga0439456_000319 Ga0439456_000319_3851_4288 145
675 3300042013 Ga0439456_001966 Ga0439456_001966_2815_3252 145
676 3300042013 Ga0439456_002979 Ga0439456_002979_1509_1946 145
677 3300042013 Ga0439456_003292 Ga0439456_003292_1453_1890 145
678 3300042013 Ga0439456_013995 Ga0439456_013995_1222_1659 145
679 3300042013 Ga0439456_040285 Ga0439456_040285_192_629 145
680 3300042013 Ga0439456_044318 Ga0439456_044318_347_784 145
681 3300042015 Ga0439462_0003781 Ga0439462_0003781_572_1012 145
682 3300042016 Ga0439463_001078 Ga0439463_001078_4372_4809 145
683 3300042016 Ga0439463_004105 Ga0439463_004105_11_448 145
684 3300042016 Ga0439463_019064 Ga0439463_019064_85_522 145
685 3300042115 Ga0450911_000018 Ga0450911_000018_79789_80226 145
686 3300042115 Ga0450911_004958 Ga0450911_004958_477_914 145
687 3300042115 Ga0450911_014610 Ga0450911_014610_438_875 145
688 3300042117 Ga0450913_001277 Ga0450913_001277_214_654 145
689 3300042120 Ga0450917_000905 Ga0450917_000905_264_704 145
690 3300042121 Ga0450919_003620 Ga0450919_003620_949_1386 145
691 3300042124 Ga0450922_003663 Ga0450922_003663_427_864 145
692 3300042124 Ga0450922_010403 Ga0450922_010403_365_805 145
693 3300042125 Ga0450923_012516 Ga0450923_012516_468_905 145
694 3300042126 Ga0450888_005682 Ga0450888_005682_640_1080 145
695 3300042127 Ga0450890_003656 Ga0450890_003656_343_783 145
696 3300042129 Ga0450891_002048 Ga0450891_002048_237_677 145
697 3300042130 Ga0450892_000203 Ga0450892_000203_5835_6275 145
698 3300042131 Ga0450894_012435 Ga0450894_012435_234_674 145
699 3300042133 Ga0450896_025919 Ga0450896_025919_233_673 145
700 3300042136 Ga0450900_000189 Ga0450900_000189_1998_2435 145
701 3300042137 Ga0450902_005404 Ga0450902_005404_1469_1906 145
702 3300042138 Ga0450903_009291 Ga0450903_009291_484_921 145
703 3300042138 Ga0450903_011572 Ga0450903_011572_537_977 145
704 3300042138 Ga0450903_021148 Ga0450903_021148_336_773 145
705 3300042138 Ga0450903_056177 Ga0450903_056177_78_515 145
706 3300042139 Ga0450904_000142 Ga0450904_000142_4112_4549 145
707 3300042139 Ga0450904_010499 Ga0450904_010499_377_814 145
708 3300042142 Ga0450905_000352 Ga0450905_000352_1106_1543 145
709 3300042142 Ga0450905_003902 Ga0450905_003902_564_1001 145
710 3300042142 Ga0450905_024187 Ga0450905_024187_426_863 145
711 3300042142 Ga0450905_033854 Ga0450905_033854_280_717 145
712 3300042145 Ga0450906_002984 Ga0450906_002984_2835_3272 145
713 3300042145 Ga0450906_008733 Ga0450906_008733_1215_1655 145
714 3300042145 Ga0450906_045074 Ga0450906_045074_282_719 145
715 3300042146 Ga0450907_001203 Ga0450907_001203_4374_4811 145
716 3300042146 Ga0450907_008179 Ga0450907_008179_1164_1601 145
717 3300042147 Ga0450910_000909 Ga0450910_000909_229_666 145
718 3300042156 Ga0439446_0001855 Ga0439446_0001855_3543_3980 145
719 3300042156 Ga0439446_0019117 Ga0439446_0019117_470_910 145
720 3300042184 Ga0450908_071982 Ga0450908_071982_116_553 145
721 3300042185 Ga0450909_000684 Ga0450909_000684_2089_2526 145
722 3300042185 Ga0450909_005673 Ga0450909_005673_1102_1539 145
723 3300042435 Ga0439434_0001331 Ga0439434_0001331_106_543 145
724 3300042435 Ga0439434_0001998 Ga0439434_0001998_2848_3285 145
725 3300042435 Ga0439434_0010673 Ga0439434_0010673_368_808 145
726 3300042438 Ga0439459_0002455 Ga0439459_0002455_30_467 145
727 3300042438 Ga0439459_0006238 Ga0439459_0006238_967_1404 145
728 3300042439 Ga0439464_0000180 Ga0439464_0000180_2015_2452 145
729 3300042439 Ga0439464_0000893 Ga0439464_0000893_2558_2995 145
730 3300042439 Ga0439464_0019935 Ga0439464_0019935_1129_1566 145
731 3300042439 Ga0439464_0104738 Ga0439464_0104738_311_748 145
732 3300042439 Ga0439464_0207108 Ga0439464_0207108_78_515 145
733 3300042461 Ga0439460_0008788 Ga0439460_0008788_1039_1476 145
734 3300042530 Ga0450916_000918 Ga0450916_000918_2128_2565 145
735 3300042530 Ga0450916_004880 Ga0450916_004880_1058_1498 145
736 3300042531 Ga0450918_013018 Ga0450918_013018_211_648 145
737 3300042532 Ga0450893_0010337 Ga0450893_0010337_1007_1447 145
738 3300042532 Ga0450893_0037258 Ga0450893_0037258_357_794 145
739 3300042533 Ga0450901_001352 Ga0450901_001352_592_1029 145
740 3300042876 Ga0451577_0023501 Ga0451577_0023501_1771_2208 145
741 3300042876 Ga0451577_0039819 Ga0451577_0039819_1728_2168 145
742 3300042876 Ga0451577_0106334 Ga0451577_0106334_1334_1774 145
743 3300042876 Ga0451577_0269550 Ga0451577_0269550_426_872 145
744 3300042876 Ga0451577_0591277 Ga0451577_0591277_494_934 145
745 3300042993 Ga0439440_0023405 Ga0439440_0023405_53_490 145
746 3300042993 Ga0439440_0081977 Ga0439440_0081977_12_449 145
747 3300044712 Ga0453684_0010847 Ga0453684_0010847_11691_12137 145
748 3300044712 Ga0453684_0058784 Ga0453684_0058784_4483_4923 145
749 3300044712 Ga0453684_0457325 Ga0453684_0457325_152_592 145
750 3300044842 Ga0466957_0164187 Ga0466957_0164187_950_1390 145
751 3300044901 Ga0466960_0017751 Ga0466960_0017751_1510_1953 145
752 3300046452 Ga0495617_001025 Ga0495617_001025_965_1402 145
753 3300046452 Ga0495617_020886 Ga0495617_020886_667_1104 145
754 3300046452 Ga0495617_037177 Ga0495617_037177_712_1149 145
755 3300046452 Ga0495617_106919 Ga0495617_106919_415_852 145
756 3300046453 Ga0495627_000023 Ga0495627_000023_215688_216125 145
757 3300046453 Ga0495627_000774 Ga0495627_000774_3346_3783 145
758 3300046453 Ga0495627_002622 Ga0495627_002622_359_796 145
759 3300046453 Ga0495627_003290 Ga0495627_003290_3683_4120 145
760 3300046453 Ga0495627_003818 Ga0495627_003818_255_692 145
761 3300046453 Ga0495627_015834 Ga0495627_015834_141_578 145
762 3300046453 Ga0495627_062201 Ga0495627_062201_291_728 145
763 3300046453 Ga0495627_128990 Ga0495627_128990_235_672 145
764 3300046455 Ga0495603_0092340 Ga0495603_0092340_720_1157 145
765 3300046455 Ga0495603_0234268 Ga0495603_0234268_592_1029 145
766 3300046455 Ga0495603_0287234 Ga0495603_0287234_66_503 145
767 3300046457 Ga0495590_0037123 Ga0495590_0037123_879_1316 145
768 3300046457 Ga0495590_0108306 Ga0495590_0108306_278_715 145
769 3300046457 Ga0495590_0173348 Ga0495590_0173348_333_770 145
770 3300046458 Ga0495591_000668 Ga0495591_000668_24554_24991 145
771 3300046458 Ga0495591_001374 Ga0495591_001374_11306_11743 145
772 3300046458 Ga0495591_003232 Ga0495591_003232_938_1375 145
773 3300046458 Ga0495591_004755 Ga0495591_004755_164_601 145
774 3300046458 Ga0495591_019120 Ga0495591_019120_243_680 145
775 3300046458 Ga0495591_019246 Ga0495591_019246_285_722 145
776 3300046458 Ga0495591_033170 Ga0495591_033170_1023_1460 145
777 3300046458 Ga0495591_095703 Ga0495591_095703_44_481 145
778 3300046458 Ga0495591_099851 Ga0495591_099851_26_463 145
779 3300046458 Ga0495591_130241 Ga0495591_130241_138_575 145
780 3300046459 Ga0495629_0083167 Ga0495629_0083167_875_1312 145
781 3300046460 Ga0495638_0019354 Ga0495638_0019354_2635_3072 145
782 3300046460 Ga0495638_0029635 Ga0495638_0029635_86_523 145
783 3300046460 Ga0495638_0077768 Ga0495638_0077768_860_1297 145
784 3300046460 Ga0495638_0155658 Ga0495638_0155658_792_1229 145
785 3300046460 Ga0495638_0196197 Ga0495638_0196197_692_1129 145
786 3300046463 Ga0495653_0023066 Ga0495653_0023066_1610_2047 145
787 3300046463 Ga0495653_0030976 Ga0495653_0030976_3401_3838 145
788 3300046463 Ga0495653_0698521 Ga0495653_0698521_41_484 145
789 3300046471 Ga0495650_0001958 Ga0495650_0001958_4368_4805 145
790 3300046471 Ga0495650_0011367 Ga0495650_0011367_4287_4724 145
791 3300046471 Ga0495650_0012088 Ga0495650_0012088_3979_4416 145
792 3300046471 Ga0495650_0013501 Ga0495650_0013501_3369_3806 145
793 3300046471 Ga0495650_0034643 Ga0495650_0034643_363_800 145
794 3300046471 Ga0495650_0085247 Ga0495650_0085247_255_692 145
795 3300046471 Ga0495650_0173353 Ga0495650_0173353_167_604 145
796 3300046473 Ga0495582_0126835 Ga0495582_0126835_441_878 145
797 3300046474 Ga0495605_0000095 Ga0495605_0000095_78663_79100 145
798 3300046474 Ga0495605_0000210 Ga0495605_0000210_31504_31941 145
799 3300046474 Ga0495605_0000677 Ga0495605_0000677_21765_22202 145
800 3300046474 Ga0495605_0000927 Ga0495605_0000927_8809_9246 145
801 3300046474 Ga0495605_0001281 Ga0495605_0001281_14447_14884 145
802 3300046474 Ga0495605_0002745 Ga0495605_0002745_251_688 145
803 3300046474 Ga0495605_0014191 Ga0495605_0014191_1640_2077 145
804 3300046474 Ga0495605_0015180 Ga0495605_0015180_92_529 145
805 3300046474 Ga0495605_0022969 Ga0495605_0022969_339_776 145
806 3300046474 Ga0495605_0075881 Ga0495605_0075881_838_1275 145
807 3300046474 Ga0495605_0412072 Ga0495605_0412072_41_478 145
808 3300046475 Ga0495639_0000523 Ga0495639_0000523_13670_14107 145
809 3300046475 Ga0495639_0275608 Ga0495639_0275608_231_668 145
810 3300046491 Ga0495584_0010069 Ga0495584_0010069_3575_4012 145
811 3300046491 Ga0495584_0032560 Ga0495584_0032560_2157_2594 145
812 3300046491 Ga0495584_0098102 Ga0495584_0098102_876_1313 145
813 3300046491 Ga0495584_0152129 Ga0495584_0152129_708_1145 145
814 3300046491 Ga0495584_0184021 Ga0495584_0184021_96_533 145
815 3300046491 Ga0495584_0265004 Ga0495584_0265004_45_482 145
816 3300046492 Ga0495585_0006945 Ga0495585_0006945_3467_3904 145
817 3300046492 Ga0495585_0009033 Ga0495585_0009033_4946_5383 145
818 3300046492 Ga0495585_0128524 Ga0495585_0128524_668_1105 145
819 3300046492 Ga0495585_0246729 Ga0495585_0246729_74_511 145
820 3300046499 Ga0495594_0004380 Ga0495594_0004380_3142_3579 145
821 3300046499 Ga0495594_0036018 Ga0495594_0036018_1123_1560 145
822 3300046500 Ga0495596_0002377 Ga0495596_0002377_2905_3342 145
823 3300046500 Ga0495596_0003170 Ga0495596_0003170_7144_7581 145
824 3300046500 Ga0495596_0110684 Ga0495596_0110684_415_852 145
825 3300046500 Ga0495596_0217226 Ga0495596_0217226_222_659 145
826 3300046501 Ga0495607_0000069 Ga0495607_0000069_20301_20738 145
827 3300046501 Ga0495607_0000673 Ga0495607_0000673_6940_7377 145
828 3300046501 Ga0495607_0001262 Ga0495607_0001262_12455_12892 145
829 3300046501 Ga0495607_0003099 Ga0495607_0003099_3918_4355 145
830 3300046501 Ga0495607_0006625 Ga0495607_0006625_6912_7349 145
831 3300046501 Ga0495607_0007271 Ga0495607_0007271_4235_4672 145
832 3300046501 Ga0495607_0010660 Ga0495607_0010660_4223_4660 145
833 3300046501 Ga0495607_0013982 Ga0495607_0013982_3253_3690 145
834 3300046501 Ga0495607_0023745 Ga0495607_0023745_3346_3783 145
835 3300046501 Ga0495607_0054353 Ga0495607_0054353_276_713 145
836 3300046501 Ga0495607_0064002 Ga0495607_0064002_582_1019 145
837 3300046501 Ga0495607_0074193 Ga0495607_0074193_1381_1818 145
838 3300046501 Ga0495607_0089093 Ga0495607_0089093_691_1128 145
839 3300046501 Ga0495607_0096700 Ga0495607_0096700_456_893 145
840 3300046501 Ga0495607_0126446 Ga0495607_0126446_442_879 145
841 3300046501 Ga0495607_0167130 Ga0495607_0167130_314_751 145
842 3300046501 Ga0495607_0171672 Ga0495607_0171672_68_505 145
843 3300046501 Ga0495607_0175986 Ga0495607_0175986_148_585 145
844 3300046501 Ga0495607_0191138 Ga0495607_0191138_246_683 145
845 3300046501 Ga0495607_0196097 Ga0495607_0196097_18_455 145
846 3300046501 Ga0495607_0197701 Ga0495607_0197701_81_518 145
847 3300046501 Ga0495607_0261437 Ga0495607_0261437_283_720 145
848 3300046501 Ga0495607_0284074 Ga0495607_0284074_79_516 145
849 3300046501 Ga0495607_0289098 Ga0495607_0289098_317_754 145
850 3300046501 Ga0495607_0402426 Ga0495607_0402426_126_563 145
851 3300046501 Ga0495607_0403523 Ga0495607_0403523_46_483 145
852 3300046506 Ga0495583_0000015 Ga0495583_0000015_95426_95863 145
853 3300046506 Ga0495583_0000779 Ga0495583_0000779_30558_30995 145
854 3300046506 Ga0495583_0005179 Ga0495583_0005179_8239_8676 145
855 3300046506 Ga0495583_0008908 Ga0495583_0008908_4558_4995 145
856 3300046506 Ga0495583_0009541 Ga0495583_0009541_1206_1643 145
857 3300046506 Ga0495583_0009795 Ga0495583_0009795_3733_4170 145
858 3300046506 Ga0495583_0013746 Ga0495583_0013746_267_704 145
859 3300046506 Ga0495583_0019806 Ga0495583_0019806_2199_2636 145
860 3300046506 Ga0495583_0084235 Ga0495583_0084235_28_465 145
861 3300046507 Ga0495606_0000271 Ga0495606_0000271_77704_78141 145
862 3300046507 Ga0495606_0000447 Ga0495606_0000447_25455_25892 145
863 3300046507 Ga0495606_0008834 Ga0495606_0008834_3544_3981 145
864 3300046507 Ga0495606_0009017 Ga0495606_0009017_3724_4161 145
865 3300046507 Ga0495606_0063552 Ga0495606_0063552_966_1403 145
866 3300046507 Ga0495606_0064160 Ga0495606_0064160_1185_1622 145
867 3300046507 Ga0495606_0102474 Ga0495606_0102474_886_1323 145
868 3300046507 Ga0495606_0116497 Ga0495606_0116497_743_1180 145
869 3300046507 Ga0495606_0287283 Ga0495606_0287283_45_482 145
870 3300046512 Ga0495610_0006170 Ga0495610_0006170_264_701 145
871 3300046512 Ga0495610_0014582 Ga0495610_0014582_3950_4387 145
872 3300046512 Ga0495610_0032387 Ga0495610_0032387_1470_1907 145
873 3300046512 Ga0495610_0076686 Ga0495610_0076686_179_616 145
874 3300046512 Ga0495610_0120181 Ga0495610_0120181_702_1139 145
875 3300046512 Ga0495610_0167234 Ga0495610_0167234_438_875 145
876 3300046512 Ga0495610_0176040 Ga0495610_0176040_424_861 145
877 3300046512 Ga0495610_0177490 Ga0495610_0177490_435_872 145
878 3300046512 Ga0495610_0187323 Ga0495610_0187323_134_571 145
879 3300046513 Ga0495616_0004341 Ga0495616_0004341_8444_8881 145
880 3300046513 Ga0495616_0012091 Ga0495616_0012091_3963_4400 145
881 3300046513 Ga0495616_0024482 Ga0495616_0024482_1279_1716 145
882 3300046513 Ga0495616_0028520 Ga0495616_0028520_2485_2922 145
883 3300046513 Ga0495616_0035911 Ga0495616_0035911_183_620 145
884 3300046513 Ga0495616_0037035 Ga0495616_0037035_658_1095 145
885 3300046513 Ga0495616_0055030 Ga0495616_0055030_1068_1505 145
886 3300046513 Ga0495616_0056858 Ga0495616_0056858_62_499 145
887 3300046513 Ga0495616_0173134 Ga0495616_0173134_361_798 145
888 3300046513 Ga0495616_0254362 Ga0495616_0254362_69_506 145
889 3300046513 Ga0495616_0358908 Ga0495616_0358908_147_584 145
890 3300046515 Ga0495620_0000042 Ga0495620_0000042_8972_9409 145
891 3300046515 Ga0495620_0001720 Ga0495620_0001720_12378_12815 145
892 3300046515 Ga0495620_0003398 Ga0495620_0003398_1223_1660 145
893 3300046515 Ga0495620_0005739 Ga0495620_0005739_3422_3859 145
894 3300046515 Ga0495620_0006827 Ga0495620_0006827_5733_6170 145
895 3300046517 Ga0495630_0124752 Ga0495630_0124752_229_666 145
896 3300046518 Ga0495631_0001164 Ga0495631_0001164_10901_11338 145
897 3300046518 Ga0495631_0001281 Ga0495631_0001281_9820_10257 145
898 3300046518 Ga0495631_0026137 Ga0495631_0026137_753_1190 145
899 3300046518 Ga0495631_0027791 Ga0495631_0027791_809_1246 145
900 3300046518 Ga0495631_0072952 Ga0495631_0072952_650_1087 145
901 3300046518 Ga0495631_0076617 Ga0495631_0076617_730_1167 145
902 3300046519 Ga0495632_0002195 Ga0495632_0002195_10970_11407 145
903 3300046519 Ga0495632_0002608 Ga0495632_0002608_30_467 145
904 3300046519 Ga0495632_0004428 Ga0495632_0004428_253_690 145
905 3300046519 Ga0495632_0023464 Ga0495632_0023464_2573_3010 145
906 3300046519 Ga0495632_0033961 Ga0495632_0033961_1432_1869 145
907 3300046519 Ga0495632_0035524 Ga0495632_0035524_62_499 145
908 3300046519 Ga0495632_0079736 Ga0495632_0079736_251_688 145
909 3300046519 Ga0495632_0094453 Ga0495632_0094453_834_1271 145
910 3300046519 Ga0495632_0096296 Ga0495632_0096296_689_1126 145
911 3300046520 Ga0495637_0000682 Ga0495637_0000682_22805_23242 145
912 3300046520 Ga0495637_0002317 Ga0495637_0002317_9780_10217 145
913 3300046520 Ga0495637_0003151 Ga0495637_0003151_8246_8683 145
914 3300046520 Ga0495637_0007709 Ga0495637_0007709_939_1376 145
915 3300046520 Ga0495637_0013570 Ga0495637_0013570_491_928 145
916 3300046520 Ga0495637_0027357 Ga0495637_0027357_51_488 145
917 3300046520 Ga0495637_0031226 Ga0495637_0031226_971_1408 145
918 3300046520 Ga0495637_0034277 Ga0495637_0034277_1615_2052 145
919 3300046520 Ga0495637_0050663 Ga0495637_0050663_389_826 145
920 3300046520 Ga0495637_0054941 Ga0495637_0054941_110_547 145
921 3300046520 Ga0495637_0063336 Ga0495637_0063336_1038_1475 145
922 3300046520 Ga0495637_0073301 Ga0495637_0073301_246_683 145
923 3300046520 Ga0495637_0085280 Ga0495637_0085280_586_1023 145
924 3300046520 Ga0495637_0099992 Ga0495637_0099992_608_1045 145
925 3300046520 Ga0495637_0103776 Ga0495637_0103776_292_729 145
926 3300046522 Ga0495643_0000930 Ga0495643_0000930_29385_29822 145
927 3300046522 Ga0495643_0001783 Ga0495643_0001783_4633_5070 145
928 3300046522 Ga0495643_0016964 Ga0495643_0016964_113_550 145
929 3300046522 Ga0495643_0017839 Ga0495643_0017839_3604_4041 145
930 3300046522 Ga0495643_0048420 Ga0495643_0048420_285_722 145
931 3300046522 Ga0495643_0119828 Ga0495643_0119828_46_483 145
932 3300046522 Ga0495643_0140215 Ga0495643_0140215_393_836 145
933 3300046522 Ga0495643_0145605 Ga0495643_0145605_710_1147 145
934 3300046523 Ga0495644_0002729 Ga0495644_0002729_2967_3404 145
935 3300046523 Ga0495644_0022504 Ga0495644_0022504_1031_1468 145
936 3300046523 Ga0495644_0085821 Ga0495644_0085821_375_812 145
937 3300046524 Ga0495648_0002138 Ga0495648_0002138_17635_18072 145
938 3300046524 Ga0495648_0006246 Ga0495648_0006246_9026_9463 145
939 3300046524 Ga0495648_0008856 Ga0495648_0008856_7347_7784 145
940 3300046524 Ga0495648_0019260 Ga0495648_0019260_3844_4281 145
941 3300046524 Ga0495648_0048792 Ga0495648_0048792_734_1171 145
942 3300046524 Ga0495648_0135211 Ga0495648_0135211_567_1004 145
943 3300046524 Ga0495648_0223402 Ga0495648_0223402_382_819 145
944 3300046524 Ga0495648_0251585 Ga0495648_0251585_327_764 145
945 3300046526 Ga0495666_0004890 Ga0495666_0004890_1047_1484 145
946 3300046526 Ga0495666_0011100 Ga0495666_0011100_2645_3082 145
947 3300046528 Ga0495642_0000803 Ga0495642_0000803_3982_4419 145
948 3300046528 Ga0495642_0005130 Ga0495642_0005130_2369_2806 145
949 3300046530 Ga0495654_0000906 Ga0495654_0000906_17530_17967 145
950 3300046530 Ga0495654_0002648 Ga0495654_0002648_254_691 145
951 3300046530 Ga0495654_0002748 Ga0495654_0002748_10570_11007 145
952 3300046530 Ga0495654_0003945 Ga0495654_0003945_8209_8646 145
953 3300046530 Ga0495654_0011396 Ga0495654_0011396_2472_2909 145
954 3300046530 Ga0495654_0013437 Ga0495654_0013437_362_799 145
955 3300046530 Ga0495654_0013804 Ga0495654_0013804_68_505 145
956 3300046530 Ga0495654_0031245 Ga0495654_0031245_974_1411 145
957 3300046530 Ga0495654_0039525 Ga0495654_0039525_185_622 145
958 3300046530 Ga0495654_0051840 Ga0495654_0051840_1229_1666 145
959 3300046530 Ga0495654_0064157 Ga0495654_0064157_338_775 145
960 3300046530 Ga0495654_0064705 Ga0495654_0064705_1054_1491 145
961 3300046530 Ga0495654_0073516 Ga0495654_0073516_1031_1468 145
962 3300046530 Ga0495654_0112512 Ga0495654_0112512_763_1200 145
963 3300046530 Ga0495654_0149179 Ga0495654_0149179_22_459 145
964 3300046530 Ga0495654_0168753 Ga0495654_0168753_440_877 145
965 3300046530 Ga0495654_0201054 Ga0495654_0201054_89_526 145
966 3300046530 Ga0495654_0323057 Ga0495654_0323057_163_600 145
967 3300046535 Ga0495586_0010327 Ga0495586_0010327_4206_4643 145
968 3300046536 Ga0495587_0122589 Ga0495587_0122589_213_650 145
969 3300046536 Ga0495587_0285103 Ga0495587_0285103_137_574 145
970 3300046538 Ga0495609_0000053 Ga0495609_0000053_4350_4787 145
971 3300046538 Ga0495609_0000133 Ga0495609_0000133_51969_52406 145
972 3300046538 Ga0495609_0000283 Ga0495609_0000283_3702_4139 145
973 3300046538 Ga0495609_0132139 Ga0495609_0132139_581_1018 145
974 3300046542 Ga0495597_0000229 Ga0495597_0000229_35298_35735 145
975 3300046542 Ga0495597_0002956 Ga0495597_0002956_9161_9598 145
976 3300046542 Ga0495597_0011470 Ga0495597_0011470_1389_1826 145
977 3300046542 Ga0495597_0012655 Ga0495597_0012655_3233_3670 145
978 3300046542 Ga0495597_0014282 Ga0495597_0014282_27_464 145
979 3300046542 Ga0495597_0054769 Ga0495597_0054769_355_792 145
980 3300046542 Ga0495597_0072240 Ga0495597_0072240_1007_1444 145
981 3300046542 Ga0495597_0100077 Ga0495597_0100077_599_1036 145
982 3300046542 Ga0495597_0125133 Ga0495597_0125133_431_868 145
983 3300046542 Ga0495597_0259725 Ga0495597_0259725_166_603 145
984 3300046543 Ga0495645_0058898 Ga0495645_0058898_812_1255 145
985 3300046557 Ga0495622_0002110 Ga0495622_0002110_5680_6117 145
986 3300046557 Ga0495622_0004661 Ga0495622_0004661_3788_4225 145
987 3300046557 Ga0495622_0023030 Ga0495622_0023030_145_582 145
988 3300046557 Ga0495622_0093725 Ga0495622_0093725_915_1352 145
989 3300046558 Ga0495633_0000115 Ga0495633_0000115_47733_48170 145
990 3300046558 Ga0495633_0133937 Ga0495633_0133937_611_1048 145
991 3300046615 Ga0495656_0001548 Ga0495656_0001548_1494_1931 145
992 3300046616 Ga0495668_0004409 Ga0495668_0004409_7996_8433 145
993 3300046616 Ga0495668_0025993 Ga0495668_0025993_194_631 145
994 3300046616 Ga0495668_0205537 Ga0495668_0205537_254_691 145
995 3300046648 Ga0495611_0001157 Ga0495611_0001157_2611_3048 145
996 3300046648 Ga0495611_0002460 Ga0495611_0002460_7781_8218 145
997 3300046648 Ga0495611_0023835 Ga0495611_0023835_2047_2484 145
998 3300046660 Ga0495625_0000086 Ga0495625_0000086_47414_47851 145
999 3300046660 Ga0495625_0002399 Ga0495625_0002399_12525_12968 145
1000 3300046660 Ga0495625_0009857 Ga0495625_0009857_940_1383 145
1001 3300046660 Ga0495625_0010864 Ga0495625_0010864_7011_7448 145
1002 3300046660 Ga0495625_0028763 Ga0495625_0028763_19_456 145
1003 3300046660 Ga0495625_0051276 Ga0495625_0051276_2021_2458 145
1004 3300046663 Ga0495635_0002602 Ga0495635_0002602_9119_9556 145
1005 3300046664 Ga0495659_0001331 Ga0495659_0001331_2638_3075 145
1006 3300046664 Ga0495659_0002109 Ga0495659_0002109_1103_1540 145
1007 3300046665 Ga0495661_0000212 Ga0495661_0000212_45263_45700 145
1008 3300046665 Ga0495661_0000346 Ga0495661_0000346_30449_30886 145
1009 3300046665 Ga0495661_0001033 Ga0495661_0001033_14689_15126 145
1010 3300046665 Ga0495661_0001808 Ga0495661_0001808_7736_8173 145
1011 3300046665 Ga0495661_0009872 Ga0495661_0009872_5878_6315 145
1012 3300046665 Ga0495661_0028404 Ga0495661_0028404_971_1408 145
1013 3300046665 Ga0495661_0124442 Ga0495661_0124442_918_1355 145
1014 3300046674 Ga0495588_0005542 Ga0495588_0005542_1670_2107 145
1015 3300046674 Ga0495588_0027452 Ga0495588_0027452_2354_2791 145
1016 3300046675 Ga0495657_0374115 Ga0495657_0374115_235_672 145
1017 3300046680 Ga0495646_0075649 Ga0495646_0075649_1127_1564 145
1018 3300046680 Ga0495646_0181899 Ga0495646_0181899_206_643 145
1019 3300046684 Ga0495669_0007452 Ga0495669_0007452_1595_2032 145
1020 3300046689 Ga0495613_0036114 Ga0495613_0036114_1810_2247 145
1021 3300046690 Ga0495624_0079940 Ga0495624_0079940_1177_1614 145
1022 3300046691 Ga0495670_0004647 Ga0495670_0004647_3679_4116 145
1023 3300046691 Ga0495670_0010384 Ga0495670_0010384_1704_2141 145
1024 3300046691 Ga0495670_0083661 Ga0495670_0083661_1177_1614 145
1025 3300046691 Ga0495670_0102838 Ga0495670_0102838_578_1015 145
1026 3300046691 Ga0495670_0241339 Ga0495670_0241339_106_543 145
1027 3300046692 Ga0495671_0000692 Ga0495671_0000692_12563_13000 145
1028 3300046692 Ga0495671_0001074 Ga0495671_0001074_11123_11560 145
1029 3300046692 Ga0495671_0001427 Ga0495671_0001427_12075_12512 145
1030 3300046692 Ga0495671_0001729 Ga0495671_0001729_8468_8905 145
1031 3300046692 Ga0495671_0013687 Ga0495671_0013687_3721_4158 145
1032 3300046692 Ga0495671_0027637 Ga0495671_0027637_1624_2061 145
1033 3300046692 Ga0495671_0046793 Ga0495671_0046793_1549_1986 145
1034 3300046692 Ga0495671_0094416 Ga0495671_0094416_24_461 145
1035 3300046692 Ga0495671_0212592 Ga0495671_0212592_176_613 145
1036 3300046692 Ga0495671_0239052 Ga0495671_0239052_87_524 145
1037 3300046692 Ga0495671_0424618 Ga0495671_0424618_114_551 145
1038 3300046694 Ga0495649_0000186 Ga0495649_0000186_16234_16671 145
1039 3300046694 Ga0495649_0000839 Ga0495649_0000839_18649_19086 145
1040 3300046694 Ga0495649_0009899 Ga0495649_0009899_4507_4944 145
1041 3300046694 Ga0495649_0017116 Ga0495649_0017116_2434_2871 145
1042 3300046694 Ga0495649_0024221 Ga0495649_0024221_2025_2462 145
1043 3300046694 Ga0495649_0057577 Ga0495649_0057577_929_1366 145
1044 3300046694 Ga0495649_0091270 Ga0495649_0091270_1030_1467 145
1045 3300046694 Ga0495649_0105430 Ga0495649_0105430_14_451 145
1046 3300046694 Ga0495649_0131841 Ga0495649_0131841_152_589 145
1047 3300046794 Ga0495589_0003163 Ga0495589_0003163_8542_8979 145
1048 3300046794 Ga0495589_0006094 Ga0495589_0006094_5775_6212 145
1049 3300046794 Ga0495589_0037907 Ga0495589_0037907_13_450 145
1050 3300046794 Ga0495589_0042577 Ga0495589_0042577_231_668 145
1051 3300046794 Ga0495589_0069038 Ga0495589_0069038_890_1327 145
1052 3300046794 Ga0495589_0076295 Ga0495589_0076295_936_1373 145
1053 3300046809 Ga0495600_0045251 Ga0495600_0045251_2169_2606 145
1054 3300046809 Ga0495600_0214212 Ga0495600_0214212_142_585 145
1055 3300046810 Ga0495660_0005301 Ga0495660_0005301_3226_3663 145
1056 3300046810 Ga0495660_0007051 Ga0495660_0007051_2148_2585 145
1057 3300046810 Ga0495660_0021391 Ga0495660_0021391_2642_3079 145
1058 3300046810 Ga0495660_0038615 Ga0495660_0038615_13_450 145
1059 3300046810 Ga0495660_0057984 Ga0495660_0057984_383_820 145
1060 3300046810 Ga0495660_0059936 Ga0495660_0059936_762_1199 145
1061 3300046810 Ga0495660_0137788 Ga0495660_0137788_392_829 145
1062 3300046810 Ga0495660_0183748 Ga0495660_0183748_507_944 145
1063 3300046810 Ga0495660_0229542 Ga0495660_0229542_215_652 145
1064 3300047315 Ga0495581_0320974 Ga0495581_0320974_363_800 145
1065 3300047317 Ga0495604_0053920 Ga0495604_0053920_526_963 145
1066 3300047317 Ga0495604_0151147 Ga0495604_0151147_1019_1456 145
1067 3300047318 Ga0495636_0001216 Ga0495636_0001216_5695_6132 145
1068 3300047318 Ga0495636_0034267 Ga0495636_0034267_110_547 145
1069 3300047319 Ga0495674_0034015 Ga0495674_0034015_10_447 145
1070 3300047320 Ga0495672_0002773 Ga0495672_0002773_580_1017 145
1071 3300047320 Ga0495672_0004098 Ga0495672_0004098_3239_3676 145
1072 3300047320 Ga0495672_0011278 Ga0495672_0011278_5865_6302 145
1073 3300047320 Ga0495672_0013420 Ga0495672_0013420_1034_1471 145
1074 3300047320 Ga0495672_0014647 Ga0495672_0014647_1753_2190 145
1075 3300047320 Ga0495672_0014701 Ga0495672_0014701_2183_2620 145
1076 3300047320 Ga0495672_0016544 Ga0495672_0016544_3808_4245 145
1077 3300047320 Ga0495672_0019996 Ga0495672_0019996_3686_4123 145
1078 3300047320 Ga0495672_0027106 Ga0495672_0027106_3018_3455 145
1079 3300047320 Ga0495672_0043503 Ga0495672_0043503_791_1228 145
1080 3300047320 Ga0495672_0045525 Ga0495672_0045525_1583_2020 145
1081 3300047320 Ga0495672_0089456 Ga0495672_0089456_618_1055 145
1082 3300047320 Ga0495672_0185702 Ga0495672_0185702_41_478 145
1083 3300047320 Ga0495672_0373772 Ga0495672_0373772_145_582 145
1084 3300047321 Ga0495676_0000022 Ga0495676_0000022_47919_48356 145
1085 3300047321 Ga0495676_0056463 Ga0495676_0056463_2262_2699 145
1086 3300047321 Ga0495676_0084788 Ga0495676_0084788_1117_1575 145
1087 3300047321 Ga0495676_0104996 Ga0495676_0104996_1350_1787 145
1088 3300047322 Ga0495680_0006510 Ga0495680_0006510_3458_3895 145
1089 3300047323 Ga0495683_0000030 Ga0495683_0000030_140781_141218 145
1090 3300047323 Ga0495683_0000586 Ga0495683_0000586_26877_27314 145
1091 3300047323 Ga0495683_0001528 Ga0495683_0001528_5237_5674 145
1092 3300047323 Ga0495683_0011767 Ga0495683_0011767_1025_1462 145
1093 3300047323 Ga0495683_0033363 Ga0495683_0033363_1737_2174 145
1094 3300047323 Ga0495683_0041276 Ga0495683_0041276_157_594 145
1095 3300047323 Ga0495683_0076591 Ga0495683_0076591_212_649 145
1096 3300047323 Ga0495683_0086986 Ga0495683_0086986_329_766 145
1097 3300047323 Ga0495683_0225538 Ga0495683_0225538_166_603 145
1098 3300047443 Ga0495687_003299 Ga0495687_003299_149_586 145
1099 3300047444 Ga0495675_0027219 Ga0495675_0027219_399_836 145
1100 3300047444 Ga0495675_0470786 Ga0495675_0470786_258_695 145
1101 3300047445 Ga0495677_0003984 Ga0495677_0003984_4288_4725 145
1102 3300047446 Ga0495679_000212 Ga0495679_000212_17794_18231 145
1103 3300047446 Ga0495679_007212 Ga0495679_007212_3704_4141 145
1104 3300047446 Ga0495679_016264 Ga0495679_016264_2125_2562 145
1105 3300047446 Ga0495679_051109 Ga0495679_051109_692_1129 145
1106 3300047447 Ga0495685_158914 Ga0495685_158914_271_708 145
1107 3300047469 Ga0495673_0001151 Ga0495673_0001151_18881_19318 145
1108 3300047469 Ga0495673_0001766 Ga0495673_0001766_2570_3007 145
1109 3300047469 Ga0495673_0010284 Ga0495673_0010284_896_1333 145
1110 3300047469 Ga0495673_0010674 Ga0495673_0010674_3367_3900 145
1111 3300047469 Ga0495673_0023704 Ga0495673_0023704_1722_2159 145
1112 3300047469 Ga0495673_0026787 Ga0495673_0026787_588_1025 145
1113 3300047469 Ga0495673_0034223 Ga0495673_0034223_1865_2302 145
1114 3300047469 Ga0495673_0040284 Ga0495673_0040284_1515_1952 145
1115 3300047469 Ga0495673_0044639 Ga0495673_0044639_48_485 145
1116 3300047469 Ga0495673_0095168 Ga0495673_0095168_538_975 145
1117 3300047469 Ga0495673_0168962 Ga0495673_0168962_43_480 145
1118 3300047469 Ga0495673_0257558 Ga0495673_0257558_76_513 145
1119 3300047470 Ga0495681_0004261 Ga0495681_0004261_9255_9692 145
1120 3300047470 Ga0495681_0010344 Ga0495681_0010344_1007_1444 145
1121 3300047470 Ga0495681_0015920 Ga0495681_0015920_1735_2172 145
1122 3300047470 Ga0495681_0017912 Ga0495681_0017912_158_595 145
1123 3300047470 Ga0495681_0020316 Ga0495681_0020316_572_1009 145
1124 3300047470 Ga0495681_0022387 Ga0495681_0022387_84_521 145
1125 3300047470 Ga0495681_0026912 Ga0495681_0026912_2165_2602 145
1126 3300047470 Ga0495681_0032028 Ga0495681_0032028_1866_2303 145
1127 3300047470 Ga0495681_0138606 Ga0495681_0138606_534_971 145
1128 3300047470 Ga0495681_0279286 Ga0495681_0279286_31_468 145
1129 3300047472 Ga0495686_0017632 Ga0495686_0017632_633_1070 145
1130 3300047472 Ga0495686_0028152 Ga0495686_0028152_1732_2169 145
1131 3300047472 Ga0495686_0091385 Ga0495686_0091385_1062_1505 145
1132 3300047472 Ga0495686_0107825 Ga0495686_0107825_30_473 145
1133 3300047472 Ga0495686_0138327 Ga0495686_0138327_37_474 145
1134 3300047472 Ga0495686_0454969 Ga0495686_0454969_45_482 145
1135 3300047673 Ga0495593_0056871 Ga0495593_0056871_1535_1972 145
1136 3300048089 Ga0495614_0198804 Ga0495614_0198804_401_838 145
1137 3300048091 Ga0495626_0000039 Ga0495626_0000039_115391_115828 145
1138 3300048091 Ga0495626_0002269 Ga0495626_0002269_11158_11595 145
1139 3300048091 Ga0495626_0003103 Ga0495626_0003103_1066_1503 145
1140 3300048091 Ga0495626_0005248 Ga0495626_0005248_14_451 145
1141 3300048091 Ga0495626_0035553 Ga0495626_0035553_783_1220 145
1142 3300048091 Ga0495626_0065605 Ga0495626_0065605_168_605 145
1143 3300048091 Ga0495626_0088922 Ga0495626_0088922_910_1347 145
1144 3300048091 Ga0495626_0111022 Ga0495626_0111022_733_1170 145
1145 3300048903 Ga0496100_0279619 Ga0496100_0279619_347_784 145
1146 3300048903 Ga0496100_0801451 Ga0496100_0801451_57_512 145
1147 3300048904 Ga0496101_0394760 Ga0496101_0394760_108_545 145
1148 3300048905 Ga0496102_0057328 Ga0496102_0057328_28_465 145
1149 3300048905 Ga0496102_0339044 Ga0496102_0339044_52_489 145
1150 3300048906 Ga0496103_0281042 Ga0496103_0281042_556_993 145
1151 3300048908 Ga0496105_0987647 Ga0496105_0987647_141_578 145
1152 3300048912 Ga0496109_0679147 Ga0496109_0679147_160_600 145
1153 3300048913 Ga0496110_0023964 Ga0496110_0023964_3622_4059 145
1154 3300048913 Ga0496110_0081619 Ga0496110_0081619_2062_2499 145
1155 3300048913 Ga0496110_0206097 Ga0496110_0206097_881_1318 145
1156 3300048913 Ga0496110_0226667 Ga0496110_0226667_507_944 145
1157 3300048913 Ga0496110_1046155 Ga0496110_1046155_53_490 145
1158 3300048914 Ga0496111_0312538 Ga0496111_0312538_15_452 145
1159 3300048915 Ga0496112_0575237 Ga0496112_0575237_115_552 145
1160 3300048916 Ga0496113_0564694 Ga0496113_0564694_442_879 145
1161 3300048917 Ga0496114_0043752 Ga0496114_0043752_559_996 145
1162 3300048917 Ga0496114_0418561 Ga0496114_0418561_557_997 145
1163 3300048917 Ga0496114_0607051 Ga0496114_0607051_187_624 145
1164 3300048919 Ga0496116_0000881 Ga0496116_0000881_32350_32787 145
1165 3300048919 Ga0496116_0004366 Ga0496116_0004366_3149_3586 145
1166 3300048919 Ga0496116_0031571 Ga0496116_0031571_2432_2869 145
1167 3300048920 Ga0496117_0004157 Ga0496117_0004157_276_713 145
1168 3300048920 Ga0496117_0004852 Ga0496117_0004852_12941_13378 145
1169 3300048920 Ga0496117_0006702 Ga0496117_0006702_168_605 145
1170 3300048920 Ga0496117_0009650 Ga0496117_0009650_311_748 145
1171 3300048920 Ga0496117_0137437 Ga0496117_0137437_115_552 145
1172 3300048920 Ga0496117_0196097 Ga0496117_0196097_63_500 145
1173 3300048920 Ga0496117_0255292 Ga0496117_0255292_301_738 145
1174 3300048921 Ga0496118_0002846 Ga0496118_0002846_18836_19273 145
1175 3300048921 Ga0496118_0008191 Ga0496118_0008191_186_623 145
1176 3300048921 Ga0496118_0067581 Ga0496118_0067581_1689_2126 145
1177 3300048921 Ga0496118_0083677 Ga0496118_0083677_256_693 145
1178 3300048921 Ga0496118_0167611 Ga0496118_0167611_834_1271 145
1179 3300048921 Ga0496118_0190198 Ga0496118_0190198_10_447 145
1180 3300048921 Ga0496118_0249160 Ga0496118_0249160_487_924 145
1181 3300048922 Ga0496119_0000060 Ga0496119_0000060_98575_99012 145
1182 3300048922 Ga0496119_0158002 Ga0496119_0158002_260_697 145
1183 3300048922 Ga0496119_0359940 Ga0496119_0359940_45_482 145
1184 3300048923 Ga0496120_0002408 Ga0496120_0002408_6134_6571 145
1185 3300048923 Ga0496120_0141567 Ga0496120_0141567_140_577 145
1186 3300048924 Ga0496121_0001650 Ga0496121_0001650_32477_32914 145
1187 3300048924 Ga0496121_0012757 Ga0496121_0012757_7612_8049 145
1188 3300048924 Ga0496121_0014564 Ga0496121_0014564_4224_4661 145
1189 3300048924 Ga0496121_0024304 Ga0496121_0024304_3812_4249 145
1190 3300048924 Ga0496121_0179415 Ga0496121_0179415_748_1194 145
1191 3300048924 Ga0496121_0329554 Ga0496121_0329554_284_721 145
1192 3300048924 Ga0496121_0381586 Ga0496121_0381586_227_664 145
1193 3300048925 Ga0496122_0001366 Ga0496122_0001366_14904_15341 145
1194 3300048925 Ga0496122_0003210 Ga0496122_0003210_16637_17074 145
1195 3300048925 Ga0496122_0004537 Ga0496122_0004537_15912_16355 145
1196 3300048925 Ga0496122_0012547 Ga0496122_0012547_412_849 145
1197 3300048925 Ga0496122_0141210 Ga0496122_0141210_362_799 145
1198 3300048925 Ga0496122_0256966 Ga0496122_0256966_408_845 145
1199 3300048925 Ga0496122_0266592 Ga0496122_0266592_478_915 145
1200 3300048925 Ga0496122_0457455 Ga0496122_0457455_24_461 145
1201 3300048926 Ga0496123_0000160 Ga0496123_0000160_13451_13894 145
1202 3300048926 Ga0496123_0000717 Ga0496123_0000717_20265_20702 145
1203 3300048926 Ga0496123_0001033 Ga0496123_0001033_24080_24517 145
1204 3300048926 Ga0496123_0030074 Ga0496123_0030074_3395_3832 145
1205 3300048926 Ga0496123_0193402 Ga0496123_0193402_568_1005 145
1206 3300048926 Ga0496123_0194578 Ga0496123_0194578_119_556 145
1207 3300048927 Ga0496124_0000120 Ga0496124_0000120_32411_32848 145
1208 3300048927 Ga0496124_0002576 Ga0496124_0002576_18419_18856 145
1209 3300048927 Ga0496124_0007600 Ga0496124_0007600_10869_11306 145
1210 3300048927 Ga0496124_0008310 Ga0496124_0008310_234_671 145
1211 3300048927 Ga0496124_0011914 Ga0496124_0011914_4058_4495 145
1212 3300048927 Ga0496124_0030903 Ga0496124_0030903_1874_2311 145
1213 3300048927 Ga0496124_0032645 Ga0496124_0032645_615_1052 145
1214 3300048927 Ga0496124_0035732 Ga0496124_0035732_3486_3923 145
1215 3300048927 Ga0496124_0050346 Ga0496124_0050346_956_1393 145
1216 3300048927 Ga0496124_0076629 Ga0496124_0076629_1330_1767 145
1217 3300048927 Ga0496124_0162154 Ga0496124_0162154_538_975 145
1218 3300048927 Ga0496124_0172764 Ga0496124_0172764_1052_1489 145
1219 3300048927 Ga0496124_0244160 Ga0496124_0244160_660_1097 145
1220 3300048927 Ga0496124_0281677 Ga0496124_0281677_181_618 145
1221 3300048927 Ga0496124_0362635 Ga0496124_0362635_162_599 145
1222 3300048927 Ga0496124_0379314 Ga0496124_0379314_326_763 145
1223 3300048927 Ga0496124_0447029 Ga0496124_0447029_187_630 145
1224 3300048927 Ga0496124_0464317 Ga0496124_0464317_281_718 145
1225 3300048927 Ga0496124_0838278 Ga0496124_0838278_78_515 145
1226 3300048928 Ga0496125_0002642 Ga0496125_0002642_19204_19641 145
1227 3300048928 Ga0496125_0008348 Ga0496125_0008348_10138_10575 145
1228 3300048928 Ga0496125_0010672 Ga0496125_0010672_189_626 145
1229 3300048928 Ga0496125_0012181 Ga0496125_0012181_3492_3929 145
1230 3300048928 Ga0496125_0103184 Ga0496125_0103184_525_962 145
1231 3300048928 Ga0496125_0309860 Ga0496125_0309860_305_742 145
1232 3300048928 Ga0496125_0404684 Ga0496125_0404684_273_710 145
1233 3300048929 Ga0496126_0051668 Ga0496126_0051668_135_572 145
1234 3300048929 Ga0496126_0260175 Ga0496126_0260175_32_469 145
1235 3300048929 Ga0496126_0293236 Ga0496126_0293236_312_749 145
1236 3300049459 Ga0495678_000017 Ga0495678_000017_60646_61083 145
1237 3300049459 Ga0495678_000238 Ga0495678_000238_38487_38924 145
1238 3300049459 Ga0495678_004233 Ga0495678_004233_7968_8405 145
1239 3300049459 Ga0495678_010495 Ga0495678_010495_87_524 145
1240 3300049459 Ga0495678_027174 Ga0495678_027174_1093_1530 145
1241 3300049459 Ga0495678_043306 Ga0495678_043306_320_757 145
1242 3300049459 Ga0495678_047688 Ga0495678_047688_913_1350 145
1243 3300049459 Ga0495678_060213 Ga0495678_060213_925_1362 145
1244 3300049459 Ga0495678_111054 Ga0495678_111054_408_845 145
1245 3300049459 Ga0495678_113107 Ga0495678_113107_87_524 145
1246 3300049459 Ga0495678_129310 Ga0495678_129310_31_468 145
1247 3300049460 Ga0495682_0000264 Ga0495682_0000264_11604_12041 145
1248 3300049460 Ga0495682_0002650 Ga0495682_0002650_3827_4264 145
1249 3300049460 Ga0495682_0022422 Ga0495682_0022422_1049_1486 145
1250 3300049513 Ga0501290_099620 Ga0501290_099620_13_450 145
1251 3300049568 Ga0501031_0043555 Ga0501031_0043555_1826_2263 145
1252 3300049569 Ga0501032_0041571 Ga0501032_0041571_2201_2638 145
1253 3300049571 Ga0501034_0001845 Ga0501034_0001845_22936_23373 145
1254 3300049571 Ga0501034_0012884 Ga0501034_0012884_3090_3527 145
1255 3300049571 Ga0501034_0136036 Ga0501034_0136036_1738_2175 145
1256 3300049571 Ga0501034_0448445 Ga0501034_0448445_651_1097 145
1257 3300049573 Ga0501037_0047131 Ga0501037_0047131_1842_2279 145
1258 3300049573 Ga0501037_0421947 Ga0501037_0421947_261_698 145
1259 3300049574 Ga0501038_0162137 Ga0501038_0162137_351_788 145
1260 3300049575 Ga0501039_0814693 Ga0501039_0814693_270_707 145
1261 3300049649 Ga0501198_000007 Ga0501198_000007_105759_106223 145
1262 3300049662 Ga0501222_000005 Ga0501222_000005_23521_23985 145
1263 3300049662 Ga0501222_021760 Ga0501222_021760_290_727 145
1264 3300049759 Ga0501262_000596 Ga0501262_000596_2263_2706 145
1265 3300049822 Ga0501035_0009715 Ga0501035_0009715_3340_3786 145
1266 3300049853 Ga0501226_000001 Ga0501226_000001_5214_5651 145
1267 3300050489 nmdc:mga03683_176275_c1 nmdc:mga03683_176275_c1_170_607 145
1268 3300050489 nmdc:mga03683_2893_c1 nmdc:mga03683_2893_c1_227_667 145
1269 3300050490 nmdc:mga03n38_188067_c1 nmdc:mga03n38_188067_c1_419_862 145
1270 3300050490 nmdc:mga03n38_56007_c1 nmdc:mga03n38_56007_c1_614_1054 145
1271 3300050490 nmdc:mga03n38_57353_c1 nmdc:mga03n38_57353_c1_863_1300 145
1272 3300050493 nmdc:mga0k408_12452_c1 nmdc:mga0k408_12452_c1_861_1298 145
1273 3300050493 nmdc:mga0k408_141606_c1 nmdc:mga0k408_141606_c1_602_1045 145
1274 3300050493 nmdc:mga0k408_171509_c1 nmdc:mga0k408_171509_c1_502_945 145
1275 3300050493 nmdc:mga0k408_365840_c1 nmdc:mga0k408_365840_c1_346_789 145
1276 3300050493 nmdc:mga0k408_427431_c1 nmdc:mga0k408_427431_c1_47_484 145
1277 3300050493 nmdc:mga0k408_57431_c1 nmdc:mga0k408_57431_c1_666_1106 145
1278 3300050496 nmdc:mga07m45_28923_c1 nmdc:mga07m45_28923_c1_482_925 145
1279 3300050496 nmdc:mga07m45_5171_c1 nmdc:mga07m45_5171_c1_5667_6104 145
1280 3300050514 nmdc:mga08x19_505988_c1 nmdc:mga08x19_505988_c1_266_703 145
1281 3300050514 nmdc:mga08x19_787656_c1 nmdc:mga08x19_787656_c1_203_640 145
1282 3300053098 Ga0500650_0220620 Ga0500650_0220620_329_766 145
1283 3300053117 Ga0500593_011538 Ga0500593_011538_1543_1986 145
1284 3300053122 Ga0500608_185401 Ga0500608_185401_175_618 145
1285 3300053125 Ga0500618_005276 Ga0500618_005276_223_660 145
1286 3300053125 Ga0500618_066406 Ga0500618_066406_362_799 145
1287 3300053134 Ga0500658_0078798 Ga0500658_0078798_142_585 145
1288 3300053135 Ga0500659_0008444 Ga0500659_0008444_531_968 145
1289 3300053136 Ga0500559_0093430 Ga0500559_0093430_206_649 145
1290 3300053140 Ga0500573_0054738 Ga0500573_0054738_1074_1511 145
1291 3300053142 Ga0500577_0063217 Ga0500577_0063217_273_710 145
1292 3300053145 Ga0500586_183056 Ga0500586_183056_169_606 145
1293 3300053154 Ga0500619_000014 Ga0500619_000014_6391_6834 145
1294 3300053177 Ga0500636_0337501 Ga0500636_0337501_89_526 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

34

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9285 1 145
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9268 1 145
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9206 1 145
3lmv-assembly3.cif.gz_E d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9204 1 144
3ko7-assembly3.cif.gz_F dtd from plasmodium falciparum in complex with d-lysine 0.9155 1 144
ID Description Score Start End Superfamily
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9268 1 145 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9206 1 145 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9089 1 144 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9063 1 145 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9053 1 145 3.50.80.10
ID Description Score Start End GO Terms
AF-W0HR39-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9652 1 145 GO:0005737
GO:0051500
AF-W0HR39-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9578 1 145 GO:0005737
GO:0051500
AF-A0A485HEP7-F1-model_v4 deleted 0.9354 2 145
AF-A0A3M5D1E4-F1-model_v4 deleted 0.933 1 145
AF-A0A1F6TM15-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9318 1 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Feature Viewer

pLDDT pTM Quality
95.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map