F492636

General Info

Members Datasets Scaffolds Average Seq Length
1291 396 2582 200

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10001616|Ga0081539_100016169
Length 221
Sequence VGRPGARAPQGSRVGGGAARPEYPKRPLTVPVDDISERYLKKAIAEINELGREITQAAGQEAAPVLGSGHPLGDIFLLKYGPQDAEQHEGVAFFGRAGQAILKSLQRLHVDPTAIYGTNCLKFAGADEEQAHAWLARELHIVQPKLIVIMGQDALACLNALRFPLAAEVASEPGTLQRFTPTIDALVAPDLDASLDDSAAKRDFWDAFKAIGPWWSELPPY

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
226 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
227 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
230 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
233 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
234 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
235 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
241 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
242 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
243 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
244 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
245 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
278 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
321 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
362 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
363 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
364 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
365 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
368 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
369 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
370 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
373 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
377 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
396 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 8.6
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 20.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10001616 3300005985 Bacteria 36968
2 ARCol0yngRDRAFT_1002541 3300000652 Unclassified 1369
3 JGI24739J22299_10101662 3300001989 Bacteria 867
4 JGI24738J21930_10005089 3300002075 Bacteria 3177
5 JGI24738J21930_10025082 3300002075 Bacteria 1226
6 JGI24744J21845_10017313 3300002077 Bacteria 1432
7 JGI24751J29686_10022821 3300002459 Archaea 1297
8 JGI25406J46586_10006140 3300003203 Bacteria 5549
9 Ga0070658_10113960 3300005327 Bacteria 2242
10 Ga0070658_10487048 3300005327 Bacteria 1064
11 Ga0070676_10114811 3300005328 Unclassified 1682
12 Ga0070676_10323917 3300005328 Unclassified 1052
13 Ga0070676_10329435 3300005328 Bacteria 1044
14 Ga0070676_10535659 3300005328 Bacteria 836
15 Ga0070683_100018764 3300005329 Bacteria 6131
16 Ga0070683_100069514 3300005329 Bacteria 3283
17 Ga0070683_100082124 3300005329 Bacteria 3018
18 Ga0070683_100105664 3300005329 Unclassified 2654
19 Ga0070683_100335551 3300005329 Bacteria 1439
20 Ga0070683_100416469 3300005329 Bacteria 1281
21 Ga0070670_100004543 3300005331 Bacteria 11634
22 Ga0070670_100034091 3300005331 Bacteria 4382
23 Ga0070670_100490662 3300005331 Bacteria 1091
24 Ga0068869_100015969 3300005334 Bacteria 5053
25 Ga0068869_100238926 3300005334 Unclassified 1447
26 Ga0070680_100033643 3300005336 Bacteria 4133
27 Ga0070680_100443039 3300005336 Bacteria 1109
28 Ga0070682_100042952 3300005337 Bacteria 2793
29 Ga0070682_100119707 3300005337 Unclassified 1766
30 Ga0070682_100140523 3300005337 Unclassified 1645
31 Ga0070682_100149332 3300005337 Bacteria 1602
32 Ga0068868_100043680 3300005338 Bacteria 3501
33 Ga0068868_100132068 3300005338 Bacteria 2044
34 Ga0068868_100132198 3300005338 Unclassified 2043
35 Ga0070660_100034044 3300005339 Bacteria 3846
36 Ga0070660_100246580 3300005339 Bacteria 1456
37 Ga0070660_100281925 3300005339 Bacteria 1360
38 Ga0070689_100044907 3300005340 Bacteria 3400
39 Ga0070689_100048469 3300005340 Bacteria 3276
40 Ga0070689_100444022 3300005340 Bacteria 1103
41 Ga0070691_10019191 3300005341 Bacteria 3153
42 Ga0070687_100049733 3300005343 Bacteria 2162
43 Ga0070687_100178613 3300005343 Archaea 1270
44 Ga0070687_100178641 3300005343 Bacteria 1270
45 Ga0070661_100017470 3300005344 Bacteria 5090
46 Ga0070692_10037617 3300005345 Bacteria 2461
47 Ga0070668_100093189 3300005347 Unclassified 2377
48 Ga0070668_100173350 3300005347 Unclassified 1757
49 Ga0070668_100548700 3300005347 Bacteria 1006
50 Ga0070675_100010518 3300005354 Bacteria 7226
51 Ga0070675_100126852 3300005354 Unclassified 2171
52 Ga0070675_100497599 3300005354 Unclassified 1098
53 Ga0070671_100202581 3300005355 Bacteria 1683
54 Ga0070671_100462717 3300005355 Unclassified 1089
55 Ga0070674_100040412 3300005356 Unclassified 3155
56 Ga0070674_100057115 3300005356 Bacteria 2708
57 Ga0070674_100722205 3300005356 Unclassified 853
58 Ga0070673_100019420 3300005364 Bacteria 4877
59 Ga0070673_101371575 3300005364 Bacteria 665
60 Ga0070688_100001975 3300005365 Bacteria 10319
61 Ga0070688_100004454 3300005365 Bacteria 7293
62 Ga0070659_100017887 3300005366 Bacteria 5340
63 Ga0070659_100025870 3300005366 Unclassified 4513
64 Ga0070659_100077766 3300005366 Bacteria 2647
65 Ga0070659_100163147 3300005366 Bacteria 1823
66 Ga0070667_100495325 3300005367 Bacteria 1120
67 Ga0070703_10024265 3300005406 Unclassified 1791
68 Ga0070714_100027716 3300005435 Bacteria 4693
69 Ga0070714_100049463 3300005435 Bacteria 3578
70 Ga0070714_100295824 3300005435 Bacteria 1508
71 Ga0070714_100388107 3300005435 Bacteria 1317
72 Ga0070713_100012774 3300005436 Bacteria 6172
73 Ga0070713_100247191 3300005436 Bacteria 1626
74 Ga0070710_10003995 3300005437 Bacteria 6992
75 Ga0070701_10006783 3300005438 Bacteria 4841
76 Ga0070701_10009983 3300005438 Bacteria 4182
77 Ga0070701_10202233 3300005438 Bacteria 1175
78 Ga0070711_100014388 3300005439 Bacteria 4986
79 Ga0070705_100340421 3300005440 Bacteria 1090
80 Ga0070700_100018768 3300005441 Bacteria 3981
81 Ga0070694_100340796 3300005444 Bacteria 1159
82 Ga0070708_100107748 3300005445 Bacteria 2558
83 Ga0070708_100215676 3300005445 Bacteria 1799
84 Ga0070663_100138149 3300005455 Bacteria 1858
85 Ga0070663_100341091 3300005455 Bacteria 1211
86 Ga0070663_100403567 3300005455 Bacteria 1118
87 Ga0070678_100015299 3300005456 Bacteria 4872
88 Ga0070678_100341461 3300005456 Bacteria 1285
89 Ga0070678_100474542 3300005456 Unclassified 1100
90 Ga0070678_100817816 3300005456 Unclassified 847
91 Ga0070662_100017869 3300005457 Bacteria 4787
92 Ga0070681_10051804 3300005458 Bacteria 4093
93 Ga0070681_10064216 3300005458 Bacteria 3643
94 Ga0070681_10140840 3300005458 Unclassified 2341
95 Ga0070681_10636910 3300005458 Bacteria 981
96 Ga0068867_100073459 3300005459 Unclassified 2561
97 Ga0068867_100076136 3300005459 Bacteria 2519
98 Ga0068867_100094387 3300005459 Bacteria 2275
99 Ga0068867_100167137 3300005459 Unclassified 1739
100 Ga0070685_10006668 3300005466 Bacteria 5896
101 Ga0070685_10032533 3300005466 Bacteria 2921
102 Ga0070706_100072551 3300005467 Unclassified 3186
103 Ga0070706_100194571 3300005467 Unclassified 1894
104 Ga0070706_100420989 3300005467 Bacteria 1243
105 Ga0070707_100016491 3300005468 Bacteria 6932
106 Ga0070707_100118521 3300005468 Bacteria 2570
107 Ga0070707_100680356 3300005468 Unclassified 992
108 Ga0070698_100072056 3300005471 Unclassified 3463
109 Ga0070698_100287842 3300005471 Bacteria 1574
110 Ga0070699_100108632 3300005518 Bacteria 2435
111 Ga0070699_100109399 3300005518 Bacteria 2425
112 Ga0070679_100092712 3300005530 Unclassified 3007
113 Ga0070679_100172072 3300005530 Bacteria 2138
114 Ga0070679_100257999 3300005530 Bacteria 1698
115 Ga0070684_100038493 3300005535 Bacteria 4108
116 Ga0070684_100050708 3300005535 Bacteria 3605
117 Ga0070684_100159658 3300005535 Bacteria 2045
118 Ga0070684_100204611 3300005535 Bacteria 1798
119 Ga0070684_100596873 3300005535 Bacteria 1026
120 Ga0070697_100377873 3300005536 Bacteria 1227
121 Ga0068853_100054926 3300005539 Bacteria 3432
122 Ga0068853_100301265 3300005539 Unclassified 1482
123 Ga0070672_100061543 3300005543 Bacteria 2959
124 Ga0070672_100073107 3300005543 Unclassified 2732
125 Ga0070686_100007432 3300005544 Bacteria 6114
126 Ga0070686_100025506 3300005544 Bacteria 3558
127 Ga0070695_100708038 3300005545 Bacteria 800
128 Ga0070696_100196057 3300005546 Bacteria 1505
129 Ga0070693_100074406 3300005547 Bacteria 2009
130 Ga0070693_100083896 3300005547 Unclassified 1905
131 Ga0070665_100060819 3300005548 Unclassified 3786
132 Ga0070665_100261216 3300005548 Bacteria 1733
133 Ga0070704_100017249 3300005549 Unclassified 4586
134 Ga0070704_100025822 3300005549 Bacteria 3872
135 Ga0070704_100110292 3300005549 Bacteria 2092
136 Ga0068855_100065525 3300005563 Bacteria 4235
137 Ga0068855_100274562 3300005563 Bacteria 1873
138 Ga0070664_100085800 3300005564 Bacteria 2719
139 Ga0070664_100218013 3300005564 Bacteria 1707
140 Ga0070664_100319856 3300005564 Unclassified 1406
141 Ga0068857_100029085 3300005577 Bacteria 4876
142 Ga0068857_100037704 3300005577 Bacteria 4283
143 Ga0068857_100388186 3300005577 Bacteria 1297
144 Ga0068854_100380570 3300005578 Archaea 1163
145 Ga0068854_100656966 3300005578 Unclassified 901
146 Ga0068856_100045687 3300005614 Bacteria 4313
147 Ga0068856_100192200 3300005614 Bacteria 2055
148 Ga0068856_100266853 3300005614 Archaea 1728
149 Ga0068856_100286890 3300005614 Bacteria 1663
150 Ga0070702_100054829 3300005615 Bacteria 2296
151 Ga0070702_100082071 3300005615 Bacteria 1933
152 Ga0070702_100082889 3300005615 Bacteria 1925
153 Ga0070702_100472662 3300005615 Bacteria 914
154 Ga0070702_100912878 3300005615 Unclassified 688
155 Ga0070702_100912879 3300005615 Bacteria 688
156 Ga0068852_100139786 3300005616 Unclassified 2240
157 Ga0068852_100354367 3300005616 Bacteria 1434
158 Ga0068859_100052901 3300005617 Bacteria 4083
159 Ga0068859_100478502 3300005617 Archaea 1341
160 Ga0068859_100808742 3300005617 Unclassified 1025
161 Ga0068864_100005306 3300005618 Bacteria 10550
162 Ga0068864_100059765 3300005618 Bacteria 3298
163 Ga0068864_100615416 3300005618 Unclassified 1055
164 Ga0068861_100064128 3300005719 Bacteria 2826
165 Ga0068861_100077238 3300005719 Bacteria 2597
166 Ga0068861_100146734 3300005719 Unclassified 1931
167 Ga0068861_100319548 3300005719 Unclassified 1351
168 Ga0068851_10020397 3300005834 Unclassified 3210
169 Ga0068870_10014339 3300005840 Bacteria 3743
170 Ga0068870_10032260 3300005840 Bacteria 2661
171 Ga0068870_10075623 3300005840 Bacteria 1847
172 Ga0068870_10104220 3300005840 Bacteria 1609
173 Ga0068863_100286719 3300005841 Bacteria 1596
174 Ga0068863_100496427 3300005841 Bacteria 1202
175 Ga0068858_100015291 3300005842 Bacteria 7220
176 Ga0068860_100221639 3300005843 Bacteria 1837
177 Ga0068862_101129874 3300005844 Unclassified 780
178 Ga0081455_10014370 3300005937 Bacteria 7767
179 Ga0081455_10016183 3300005937 Bacteria 7210
180 Ga0081455_10064674 3300005937 Bacteria 3062
181 Ga0081455_10069014 3300005937 Bacteria 2941
182 Ga0081455_10077991 3300005937 Bacteria 2723
183 Ga0081455_10138500 3300005937 Unclassified 1893
184 Ga0081455_10180734 3300005937 Bacteria 1597
185 Ga0081455_10527148 3300005937 Bacteria 787
186 Ga0081538_10113182 3300005981 Bacteria 1326
187 Ga0081540_1000836 3300005983 Bacteria 28072
188 Ga0081540_1003929 3300005983 Bacteria 11561
189 Ga0081540_1004796 3300005983 Bacteria 10194
190 Ga0081539_10000384 3300005985 Bacteria 95594
191 Ga0081539_10000628 3300005985 Bacteria 71419
192 Ga0081539_10001582 3300005985 Bacteria 37628
193 Ga0081539_10016030 3300005985 Bacteria 5390
194 Ga0070717_10015446 3300006028 Bacteria 5899
195 Ga0070717_10017014 3300006028 Bacteria 5647
196 Ga0070717_10020582 3300006028 Bacteria 5191
197 Ga0070717_10591351 3300006028 Bacteria 1007
198 Ga0075365_10102482 3300006038 Bacteria 1961
199 Ga0075432_10000451 3300006058 Bacteria 12131
200 Ga0075432_10039012 3300006058 Bacteria 1655
201 Ga0070715_10118932 3300006163 Bacteria 1257
202 Ga0070716_100325404 3300006173 Bacteria 1079
203 Ga0070712_100017460 3300006175 Bacteria 4646
204 Ga0070712_100038637 3300006175 Bacteria 3263
205 Ga0070712_100129346 3300006175 Bacteria 1912
206 Ga0070712_100313037 3300006175 Bacteria 1274
207 Ga0075367_10082301 3300006178 Bacteria 1949
208 Ga0075367_10108217 3300006178 Bacteria 1704
209 Ga0075367_10143138 3300006178 Bacteria 1482
210 Ga0097621_100100422 3300006237 Unclassified 2434
211 Ga0097621_100124713 3300006237 Bacteria 2187
212 Ga0097621_100857561 3300006237 Unclassified 844
213 Ga0068871_100074599 3300006358 Bacteria 2799
214 Ga0075428_100002662 3300006844 Bacteria 19398
215 Ga0075428_100045578 3300006844 Bacteria 4818
216 Ga0075428_100060163 3300006844 Bacteria 4159
217 Ga0075428_100105176 3300006844 Bacteria 3078
218 Ga0075428_100290714 3300006844 Unclassified 1758
219 Ga0075428_100458538 3300006844 Bacteria 1365
220 Ga0075430_100005830 3300006846 Bacteria 10392
221 Ga0075430_100481279 3300006846 Bacteria 1024
222 Ga0075431_100031224 3300006847 Bacteria 5487
223 Ga0075431_100066835 3300006847 Bacteria 3711
224 Ga0075431_100097238 3300006847 Bacteria 3040
225 Ga0075431_100587678 3300006847 Bacteria 1098
226 Ga0075431_100660683 3300006847 Bacteria 1025
227 Ga0075433_10011801 3300006852 Bacteria 7037
228 Ga0075433_10025219 3300006852 Bacteria 5025
229 Ga0075433_10055376 3300006852 Bacteria 3462
230 Ga0075433_10073112 3300006852 Unclassified 3015
231 Ga0075433_10133393 3300006852 Bacteria 2207
232 Ga0075433_10401009 3300006852 Bacteria 1210
233 Ga0075434_100007792 3300006871 Bacteria 9917
234 Ga0075434_100013062 3300006871 Bacteria 7886
235 Ga0075434_100073846 3300006871 Bacteria 3404
236 Ga0075434_100652988 3300006871 Bacteria 1070
237 Ga0075434_101048216 3300006871 Bacteria 829
238 Ga0075434_101346026 3300006871 Bacteria 724
239 Ga0075429_100020238 3300006880 Bacteria 5770
240 Ga0075429_100205184 3300006880 Bacteria 1727
241 Ga0075429_100536707 3300006880 Bacteria 1025
242 Ga0068865_100039721 3300006881 Bacteria 3193
243 Ga0068865_100078935 3300006881 Bacteria 2356
244 Ga0068865_100100359 3300006881 Unclassified 2118
245 Ga0068865_100107961 3300006881 Bacteria 2048
246 Ga0075436_100007890 3300006914 Bacteria 7284
247 Ga0075436_100100406 3300006914 Bacteria 2015
248 Ga0075436_100122837 3300006914 Unclassified 1818
249 Ga0075436_100540173 3300006914 Unclassified 855
250 Ga0097620_100052902 3300006931 Bacteria 4083
251 Ga0097620_100478538 3300006931 Archaea 1341
252 Ga0097620_100808641 3300006931 Unclassified 1025
253 Ga0075435_100002153 3300007076 Bacteria 12981
254 Ga0075435_100135562 3300007076 Bacteria 2062
255 Ga0075435_100190728 3300007076 Unclassified 1735
256 Ga0075435_100311182 3300007076 Bacteria 1348
257 Ga0075435_100609633 3300007076 Unclassified 947
258 Ga0075435_100629896 3300007076 Unclassified 931
259 Ga0099795_10082525 3300007788 Bacteria 1232
260 Ga0111539_10000648 3300009094 Bacteria 44951
261 Ga0111539_10006602 3300009094 Bacteria 14945
262 Ga0111539_10017044 3300009094 Bacteria 8993
263 Ga0111539_10017381 3300009094 Bacteria 8901
264 Ga0111539_10077795 3300009094 Unclassified 3904
265 Ga0111539_10137411 3300009094 Bacteria 2862
266 Ga0111539_10742524 3300009094 Bacteria 1142
267 Ga0111539_10835190 3300009094 Unclassified 1072
268 Ga0105245_10008337 3300009098 Bacteria 9056
269 Ga0105245_10014479 3300009098 Bacteria 6869
270 Ga0105245_10060451 3300009098 Unclassified 3412
271 Ga0105245_10064281 3300009098 Bacteria 3315
272 Ga0105245_10105422 3300009098 Bacteria 2615
273 Ga0105245_10137318 3300009098 Bacteria 2299
274 Ga0105245_10154023 3300009098 Unclassified 2176
275 Ga0105245_10159510 3300009098 Unclassified 2139
276 Ga0105245_10290145 3300009098 Bacteria 1602
277 Ga0105245_10883665 3300009098 Bacteria 935
278 Ga0105245_10948562 3300009098 Bacteria 903
279 Ga0105245_11086284 3300009098 Bacteria 846
280 Ga0105247_10009263 3300009101 Bacteria 5981
281 Ga0114129_10010920 3300009147 Bacteria 12939
282 Ga0114129_10015646 3300009147 Bacteria 10788
283 Ga0114129_10026913 3300009147 Bacteria 8141
284 Ga0114129_10112533 3300009147 Unclassified 3754
285 Ga0114129_10118846 3300009147 Bacteria 3641
286 Ga0114129_10193430 3300009147 Unclassified 2760
287 Ga0114129_10241288 3300009147 Bacteria 2429
288 Ga0114129_10242682 3300009147 Unclassified 2421
289 Ga0114129_10469874 3300009147 Bacteria 1647
290 Ga0114129_10598704 3300009147 Bacteria 1428
291 Ga0114129_10797319 3300009147 Bacteria 1205
292 Ga0114129_10966079 3300009147 Bacteria 1075
293 Ga0105243_10003486 3300009148 Bacteria 12706
294 Ga0105243_10013359 3300009148 Bacteria 6211
295 Ga0105243_10018939 3300009148 Bacteria 5220
296 Ga0105243_10130683 3300009148 Bacteria 2129
297 Ga0105243_10228454 3300009148 Bacteria 1649
298 Ga0105243_10327796 3300009148 Bacteria 1397
299 Ga0105243_11023780 3300009148 Bacteria 830
300 Ga0105243_11074723 3300009148 Bacteria 811
301 Ga0105241_10049960 3300009174 Unclassified 3187
302 Ga0105241_10490524 3300009174 Unclassified 1094
303 Ga0105241_10531351 3300009174 Bacteria 1053
304 Ga0105242_10033827 3300009176 Bacteria 4095
305 Ga0105242_10078913 3300009176 Bacteria 2749
306 Ga0105242_10108648 3300009176 Bacteria 2361
307 Ga0105242_10131291 3300009176 Bacteria 2163
308 Ga0105242_10249965 3300009176 Bacteria 1597
309 Ga0105242_10306689 3300009176 Bacteria 1451
310 Ga0105248_10034045 3300009177 Bacteria 5695
311 Ga0105248_10036506 3300009177 Bacteria 5497
312 Ga0105248_10099570 3300009177 Bacteria 3276
313 Ga0105248_10187053 3300009177 Bacteria 2334
314 Ga0105248_10618997 3300009177 Bacteria 1221
315 Ga0105237_10270674 3300009545 Unclassified 1702
316 Ga0105238_10029324 3300009551 Bacteria 5605
317 Ga0105238_10205477 3300009551 Bacteria 1945
318 Ga0105238_10308915 3300009551 Bacteria 1566
319 Ga0105249_10261795 3300009553 Unclassified 1719
320 Ga0105249_10312752 3300009553 Bacteria 1580
321 Ga0105239_10019732 3300010375 Bacteria 7439
322 Ga0105239_10044517 3300010375 Bacteria 4865
323 Ga0105239_10109230 3300010375 Bacteria 3065
324 Ga0105239_10347875 3300010375 Bacteria 1673
325 Ga0105239_10427004 3300010375 Bacteria 1502
326 Ga0105239_10478105 3300010375 Unclassified 1415
327 Ga0105246_10012363 3300011119 Bacteria 5323
328 Ga0105246_10070423 3300011119 Unclassified 2460
329 Ga0105246_10270833 3300011119 Bacteria 1357
330 Ga0157342_1000339 3300012507 Bacteria 2724
331 Ga0157371_10030079 3300013102 Bacteria 3919
332 Ga0157371_10044248 3300013102 Bacteria 3170
333 Ga0157371_10138456 3300013102 Unclassified 1734
334 Ga0157371_10205330 3300013102 Bacteria 1413
335 Ga0157370_10564332 3300013104 Bacteria 1043
336 Ga0157369_10061751 3300013105 Bacteria 4039
337 Ga0157374_10184573 3300013296 Bacteria 2039
338 Ga0157374_10404233 3300013296 Bacteria 1363
339 Ga0157374_10480512 3300013296 Bacteria 1246
340 Ga0157374_10589129 3300013296 Bacteria 1121
341 Ga0157374_10715830 3300013296 Unclassified 1015
342 Ga0157378_10190006 3300013297 Bacteria 1936
343 Ga0157378_10339353 3300013297 Bacteria 1465
344 Ga0157378_10588279 3300013297 Bacteria 1123
345 Ga0163162_10093794 3300013306 Bacteria 3087
346 Ga0163162_10114762 3300013306 Unclassified 2793
347 Ga0163162_10145207 3300013306 Bacteria 2488
348 Ga0163162_10475046 3300013306 Bacteria 1381
349 Ga0163162_10776463 3300013306 Bacteria 1076
350 Ga0157372_10025354 3300013307 Bacteria 6445
351 Ga0157372_10089070 3300013307 Bacteria 3505
352 Ga0157372_10349735 3300013307 Unclassified 1722
353 Ga0157372_10535828 3300013307 Bacteria 1365
354 Ga0157372_10652701 3300013307 Unclassified 1225
355 Ga0157375_10005826 3300013308 Bacteria 10721
356 Ga0157375_10016816 3300013308 Bacteria 6583
357 Ga0157375_10019447 3300013308 Bacteria 6176
358 Ga0157375_10019925 3300013308 Bacteria 6115
359 Ga0157375_10350653 3300013308 Bacteria 1642
360 Ga0157375_10363322 3300013308 Bacteria 1614
361 Ga0157375_10416024 3300013308 Bacteria 1510
362 Ga0163163_10006950 3300014325 Bacteria 9942
363 Ga0163163_10073365 3300014325 Bacteria 3413
364 Ga0157380_10019322 3300014326 Bacteria 5078
365 Ga0157380_10107118 3300014326 Bacteria 2340
366 Ga0157380_10228161 3300014326 Bacteria 1671
367 Ga0157380_10549838 3300014326 Bacteria 1132
368 Ga0157380_10909590 3300014326 Bacteria 907
369 Ga0182008_10178480 3300014497 Bacteria 1074
370 Ga0182008_10416042 3300014497 Archaea 725
371 Ga0157377_10098925 3300014745 Bacteria 1734
372 Ga0157377_10128337 3300014745 Unclassified 1545
373 Ga0157377_10130490 3300014745 Bacteria 1534
374 Ga0157377_10336204 3300014745 Unclassified 1008
375 Ga0157379_10019500 3300014968 Bacteria 5991
376 Ga0157379_10074880 3300014968 Bacteria 3030
377 Ga0157376_10019387 3300014969 Bacteria 5242
378 Ga0157376_10408794 3300014969 Unclassified 1314
379 Ga0157376_10463848 3300014969 Unclassified 1238
380 Ga0157376_11047185 3300014969 Unclassified 840
381 Ga0163161_10310170 3300017792 Bacteria 1245
382 Ga0207656_10101209 3300025321 Bacteria 1321
383 Ga0207653_10027253 3300025885 Bacteria 1834
384 Ga0207692_10006275 3300025898 Bacteria 4819
385 Ga0207642_10046227 3300025899 Unclassified 1938
386 Ga0207710_10059299 3300025900 Bacteria 1732
387 Ga0207688_10027230 3300025901 Bacteria 3144
388 Ga0207688_10118318 3300025901 Bacteria 1544
389 Ga0207685_10085510 3300025905 Unclassified 1316
390 Ga0207685_10201509 3300025905 Bacteria 935
391 Ga0207645_10035355 3300025907 Bacteria 3208
392 Ga0207645_10086393 3300025907 Bacteria 2015
393 Ga0207645_10223646 3300025907 Bacteria 1241
394 Ga0207645_10350339 3300025907 Unclassified 988
395 Ga0207643_10008192 3300025908 Bacteria 5610
396 Ga0207643_10015090 3300025908 Bacteria 4201
397 Ga0207643_10023159 3300025908 Bacteria 3425
398 Ga0207643_10050041 3300025908 Bacteria 2369
399 Ga0207705_10026955 3300025909 Bacteria 4095
400 Ga0207705_10039928 3300025909 Unclassified 3364
401 Ga0207684_10046071 3300025910 Bacteria 3699
402 Ga0207684_10081328 3300025910 Unclassified 2756
403 Ga0207684_10138737 3300025910 Unclassified 2089
404 Ga0207654_10216829 3300025911 Bacteria 1267
405 Ga0207654_10304306 3300025911 Unclassified 1085
406 Ga0207707_10029897 3300025912 Bacteria 4764
407 Ga0207707_10099707 3300025912 Unclassified 2538
408 Ga0207707_10231887 3300025912 Bacteria 1606
409 Ga0207707_10309941 3300025912 Bacteria 1364
410 Ga0207671_10072984 3300025914 Bacteria 2562
411 Ga0207693_10008061 3300025915 Bacteria 8642
412 Ga0207693_10197025 3300025915 Unclassified 1584
413 Ga0207693_10313509 3300025915 Bacteria 1228
414 Ga0207663_10044860 3300025916 Bacteria 2716
415 Ga0207663_10093589 3300025916 Bacteria 2000
416 Ga0207663_10319027 3300025916 Bacteria 1167
417 Ga0207660_10147728 3300025917 Unclassified 1803
418 Ga0207662_10073086 3300025918 Unclassified 2079
419 Ga0207662_10126843 3300025918 Bacteria 1605
420 Ga0207662_10136653 3300025918 Bacteria 1550
421 Ga0207657_10001701 3300025919 Bacteria 23714
422 Ga0207657_10006124 3300025919 Bacteria 12503
423 Ga0207657_10061045 3300025919 Bacteria 3234
424 Ga0207657_10166020 3300025919 Bacteria 1791
425 Ga0207657_10241264 3300025919 Bacteria 1443
426 Ga0207652_10066652 3300025921 Bacteria 3121
427 Ga0207652_10203811 3300025921 Bacteria 1780
428 Ga0207652_10311346 3300025921 Bacteria 1421
429 Ga0207652_10933616 3300025921 Bacteria 765
430 Ga0207646_10002167 3300025922 Bacteria 23455
431 Ga0207646_10003470 3300025922 Bacteria 17803
432 Ga0207646_10055886 3300025922 Bacteria 3529
433 Ga0207681_10157171 3300025923 Unclassified 1710
434 Ga0207694_10190517 3300025924 Bacteria 1666
435 Ga0207650_10008340 3300025925 Bacteria 7074
436 Ga0207650_10011261 3300025925 Bacteria 6153
437 Ga0207650_10068042 3300025925 Bacteria 2674
438 Ga0207650_10758832 3300025925 Bacteria 821
439 Ga0207659_10484627 3300025926 Unclassified 1045
440 Ga0207659_10503754 3300025926 Bacteria 1025
441 Ga0207659_10726370 3300025926 Unclassified 851
442 Ga0207687_10059611 3300025927 Unclassified 2690
443 Ga0207687_10064056 3300025927 Unclassified 2605
444 Ga0207687_10065731 3300025927 Bacteria 2576
445 Ga0207687_10065989 3300025927 Bacteria 2571
446 Ga0207687_10088142 3300025927 Bacteria 2257
447 Ga0207687_10186382 3300025927 Unclassified 1611
448 Ga0207687_10188254 3300025927 Unclassified 1604
449 Ga0207687_10255500 3300025927 Bacteria 1395
450 Ga0207687_10329168 3300025927 Unclassified 1239
451 Ga0207687_10379377 3300025927 Bacteria 1158
452 Ga0207687_10379477 3300025927 Unclassified 1158
453 Ga0207700_10038568 3300025928 Unclassified 3468
454 Ga0207700_10109917 3300025928 Bacteria 2216
455 Ga0207700_11019136 3300025928 Bacteria 741
456 Ga0207664_10002961 3300025929 Bacteria 11273
457 Ga0207664_10077315 3300025929 Unclassified 2696
458 Ga0207664_10082933 3300025929 Bacteria 2612
459 Ga0207664_10198515 3300025929 Unclassified 1730
460 Ga0207690_10035490 3300025932 Bacteria 3221
461 Ga0207690_10038048 3300025932 Bacteria 3128
462 Ga0207690_10050027 3300025932 Bacteria 2788
463 Ga0207690_10380855 3300025932 Unclassified 1121
464 Ga0207706_10022030 3300025933 Bacteria 5719
465 Ga0207706_10023062 3300025933 Bacteria 5590
466 Ga0207686_10047809 3300025934 Bacteria 2647
467 Ga0207686_10214585 3300025934 Bacteria 1386
468 Ga0207686_10253188 3300025934 Bacteria 1287
469 Ga0207709_10025774 3300025935 Bacteria 3369
470 Ga0207709_10031964 3300025935 Bacteria 3079
471 Ga0207709_10068072 3300025935 Bacteria 2249
472 Ga0207709_10327560 3300025935 Unclassified 1149
473 Ga0207709_10486392 3300025935 Bacteria 961
474 Ga0207670_10312958 3300025936 Bacteria 1233
475 Ga0207670_10983928 3300025936 Unclassified 709
476 Ga0207669_10038646 3300025937 Bacteria 2750
477 Ga0207669_10068295 3300025937 Bacteria 2219
478 Ga0207669_10292243 3300025937 Unclassified 1234
479 Ga0207669_10377648 3300025937 Bacteria 1103
480 Ga0207669_10553630 3300025937 Bacteria 928
481 Ga0207669_10781956 3300025937 Unclassified 790
482 Ga0207704_10031119 3300025938 Bacteria 3001
483 Ga0207704_10104254 3300025938 Unclassified 1899
484 Ga0207704_10158777 3300025938 Bacteria 1606
485 Ga0207704_10170843 3300025938 Bacteria 1559
486 Ga0207665_10096583 3300025939 Bacteria 2055
487 Ga0207665_10103896 3300025939 Bacteria 1988
488 Ga0207691_10017223 3300025940 Bacteria 6854
489 Ga0207691_10066629 3300025940 Bacteria 3258
490 Ga0207691_10071953 3300025940 Bacteria 3119
491 Ga0207691_10147365 3300025940 Unclassified 2071
492 Ga0207711_10074783 3300025941 Unclassified 2947
493 Ga0207711_10153267 3300025941 Unclassified 2081
494 Ga0207711_10347714 3300025941 Bacteria 1373
495 Ga0207689_10029379 3300025942 Bacteria 4591
496 Ga0207689_10077920 3300025942 Bacteria 2723
497 Ga0207689_10198773 3300025942 Unclassified 1655
498 Ga0207689_10209599 3300025942 Bacteria 1610
499 Ga0207689_10252971 3300025942 Unclassified 1457
500 Ga0207661_10009366 3300025944 Bacteria 7019
501 Ga0207661_10037723 3300025944 Bacteria 3782
502 Ga0207661_10047233 3300025944 Bacteria 3417
503 Ga0207661_10096678 3300025944 Bacteria 2471
504 Ga0207661_10426104 3300025944 Bacteria 1206
505 Ga0207679_10164832 3300025945 Bacteria 1818
506 Ga0207679_10406812 3300025945 Bacteria 1198
507 Ga0207679_10535692 3300025945 Unclassified 1049
508 Ga0207679_10661950 3300025945 Bacteria 945
509 Ga0207667_10163266 3300025949 Bacteria 2291
510 Ga0207667_10538042 3300025949 Bacteria 1182
511 Ga0207651_10071703 3300025960 Bacteria 2457
512 Ga0207651_10315326 3300025960 Bacteria 1305
513 Ga0207712_10044556 3300025961 Unclassified 3067
514 Ga0207712_10243644 3300025961 Bacteria 1449
515 Ga0207668_10089584 3300025972 Unclassified 2256
516 Ga0207640_10091516 3300025981 Unclassified 2107
517 Ga0207640_10558352 3300025981 Unclassified 963
518 Ga0207677_10118393 3300026023 Bacteria 1987
519 Ga0207677_10209929 3300026023 Bacteria 1554
520 Ga0207639_10537227 3300026041 Bacteria 1072
521 Ga0207678_10019076 3300026067 Bacteria 6021
522 Ga0207678_10443644 3300026067 Bacteria 1127
523 Ga0207678_10590033 3300026067 Bacteria 974
524 Ga0207708_10031024 3300026075 Bacteria 4057
525 Ga0207708_10045488 3300026075 Bacteria 3345
526 Ga0207708_10067625 3300026075 Bacteria 2733
527 Ga0207702_10184280 3300026078 Bacteria 1924
528 Ga0207702_10568565 3300026078 Unclassified 1110
529 Ga0207702_10667678 3300026078 Bacteria 1023
530 Ga0207702_10731524 3300026078 Unclassified 976
531 Ga0207702_10853763 3300026078 Bacteria 901
532 Ga0207648_10035716 3300026089 Bacteria 4379
533 Ga0207648_10047888 3300026089 Bacteria 3745
534 Ga0207648_10054938 3300026089 Bacteria 3477
535 Ga0207648_10114006 3300026089 Bacteria 2374
536 Ga0207648_10120230 3300026089 Bacteria 2309
537 Ga0207648_10145648 3300026089 Bacteria 2089
538 Ga0207676_10230746 3300026095 Unclassified 1654
539 Ga0207674_10002446 3300026116 Bacteria 23456
540 Ga0207674_10037403 3300026116 Bacteria 5049
541 Ga0207674_10041632 3300026116 Bacteria 4749
542 Ga0207674_10197456 3300026116 Archaea 1961
543 Ga0207674_10224959 3300026116 Unclassified 1825
544 Ga0207675_100016689 3300026118 Bacteria 6856
545 Ga0207675_100055972 3300026118 Bacteria 3680
546 Ga0207675_100074084 3300026118 Unclassified 3186
547 Ga0207675_100203231 3300026118 Bacteria 1903
548 Ga0207675_100531846 3300026118 Bacteria 1173
549 Ga0207683_10021406 3300026121 Bacteria 5536
550 Ga0207683_10022545 3300026121 Bacteria 5405
551 Ga0207683_10308139 3300026121 Bacteria 1449
552 Ga0207683_10355740 3300026121 Bacteria 1344
553 Ga0207683_10523372 3300026121 Bacteria 1096
554 Ga0207698_10076789 3300026142 Bacteria 2675
555 Ga0207698_10378332 3300026142 Unclassified 1346
556 Ga0207698_11579302 3300026142 Unclassified 671
557 Ga0209998_10009112 3300027717 Bacteria 2057
558 Ga0207428_10000437 3300027907 Bacteria 51045
559 Ga0207428_10003178 3300027907 Bacteria 16086
560 Ga0207428_10025873 3300027907 Bacteria 4905
561 Ga0207428_10026500 3300027907 Bacteria 4839
562 Ga0207428_10034437 3300027907 Bacteria 4150
563 Ga0207428_10044804 3300027907 Bacteria 3566
564 Ga0207428_10062885 3300027907 Unclassified 2933
565 Ga0207428_10093819 3300027907 Bacteria 2327
566 Ga0207428_10139511 3300027907 Unclassified 1851
567 Ga0268266_10240882 3300028379 Archaea 1669
568 Ga0268266_10352425 3300028379 Bacteria 1383
569 Ga0268266_10380024 3300028379 Bacteria 1332
570 Ga0268265_10238936 3300028380 Bacteria 1602
571 Ga0268265_10282590 3300028380 Bacteria 1486
572 Ga0268264_10026271 3300028381 Bacteria 4756
573 Ga0268264_10627874 3300028381 Bacteria 1061
574 Ga0307408_100028335 3300031548 Bacteria 3870
575 Ga0307408_100289507 3300031548 Bacteria 1367
576 Ga0307408_100768375 3300031548 Bacteria 872
577 Ga0307408_101201331 3300031548 Bacteria 707
578 Ga0307410_10327576 3300031852 Bacteria 1217
579 Ga0307412_10360909 3300031911 Bacteria 1170
580 Ga0307409_100066045 3300031995 Bacteria 2850
581 Ga0307414_10189948 3300032004 Bacteria 1661
582 Ga0307411_10288532 3300032005 Bacteria 1310
583 Ga0307415_100000192 3300032126 Bacteria 27217
584 Ga0373958_0017671 3300034819 Bacteria 1285
585 Ga0373959_0078585 3300034820 Unclassified 757
586 Ga0373938_0028856 3300034957 Bacteria 1176
587 Ga0373926_0000871 3300035083 Bacteria 8636
588 Ga0373940_0148419 3300035088 Bacteria 746
589 Ga0373936_0066249 3300035113 Bacteria 1483
590 Ga0373939_0097767 3300035114 Unclassified 1003
591 Ga0373941_0013589 3300035115 Unclassified 2156
592 Ga0373941_0070133 3300035115 Unclassified 1162
593 Ga0373945_0004395 3300035116 Bacteria 4477
594 Ga0373945_0149132 3300035116 Bacteria 947
595 Ga0373953_0051980 3300035117 Unclassified 1658
596 Ga0373960_0074930 3300035121 Unclassified 1054
597 Ga0373943_0000490 3300035170 Bacteria 16855
598 Ga0373943_0179529 3300035170 Bacteria 1163
599 Ga0373946_0047013 3300035171 Bacteria 1791
600 Ga0373961_0103035 3300035241 Unclassified 926
601 Ga0373931_0097005 3300035691 Unclassified 1652
602 Ga0373931_0104052 3300035691 Bacteria 1601
603 Ga0373931_0380522 3300035691 Unclassified 890
604 Ga0373935_0298313 3300035692 Bacteria 1138
605 Ga0373927_0300470 3300035695 Bacteria 1056
606 Ga0373933_0069826 3300035724 Bacteria 2136
607 Ga0373947_0001296 3300035725 Bacteria 15382
608 Ga0373937_0300479 3300036401 Bacteria 1517
609 Ga0373925_0000484 3300037068 Bacteria 39880
610 Ga0395899_0001105 3300037312 Bacteria 24169
611 Ga0395899_0004478 3300037312 Bacteria 10886
612 Ga0395899_0005269 3300037312 Bacteria 10044
613 Ga0395899_0006397 3300037312 Bacteria 9125
614 Ga0395899_0035335 3300037312 Unclassified 3752
615 Ga0395899_0050319 3300037312 Bacteria 3094
616 Ga0395899_0078678 3300037312 Bacteria 2403
617 Ga0395899_0117795 3300037312 Bacteria 1905
618 Ga0395899_0281312 3300037312 Bacteria 1131
619 Ga0395899_0307020 3300037312 Bacteria 1072
620 Ga0395900_0002321 3300037418 Bacteria 21097
621 Ga0395900_0003619 3300037418 Bacteria 16614
622 Ga0395900_0004663 3300037418 Bacteria 14463
623 Ga0395900_0005393 3300037418 Bacteria 13397
624 Ga0395900_0013553 3300037418 Bacteria 8327
625 Ga0395900_0050832 3300037418 Bacteria 4269
626 Ga0395900_0054267 3300037418 Unclassified 4126
627 Ga0395900_0074045 3300037418 Bacteria 3502
628 Ga0395900_0110527 3300037418 Bacteria 2823
629 Ga0395900_0133751 3300037418 Unclassified 2540
630 Ga0395900_0154080 3300037418 Bacteria 2348
631 Ga0395900_0249266 3300037418 Bacteria 1778
632 Ga0395900_0273448 3300037418 Unclassified 1683
633 Ga0395900_0536458 3300037418 Unclassified 1116
634 Ga0395900_0847249 3300037418 Unclassified 840
635 Ga0395898_0002298 3300037466 Bacteria 22946
636 Ga0395898_0004033 3300037466 Bacteria 16145
637 Ga0395898_0008472 3300037466 Bacteria 10865
638 Ga0395898_0015626 3300037466 Bacteria 7782
639 Ga0395898_0019466 3300037466 Bacteria 6906
640 Ga0395898_0030341 3300037466 Bacteria 5411
641 Ga0395898_0034998 3300037466 Bacteria 4998
642 Ga0395898_0045984 3300037466 Unclassified 4288
643 Ga0395898_0048170 3300037466 Bacteria 4180
644 Ga0395898_0192583 3300037466 Bacteria 1948
645 Ga0395898_0365177 3300037466 Unclassified 1376
646 Ga0395898_0411779 3300037466 Bacteria 1289
647 Ga0395898_0540203 3300037466 Bacteria 1107
648 Ga0395898_0704463 3300037466 Bacteria 951
649 Ga0395905_0001864 3300037471 Bacteria 24276
650 Ga0395905_0003370 3300037471 Bacteria 17128
651 Ga0395905_0006000 3300037471 Bacteria 12303
652 Ga0395905_0009840 3300037471 Bacteria 9319
653 Ga0395905_0012742 3300037471 Bacteria 8087
654 Ga0395905_0036025 3300037471 Bacteria 4647
655 Ga0395905_0037274 3300037471 Bacteria 4566
656 Ga0395905_0037990 3300037471 Bacteria 4517
657 Ga0395905_0039015 3300037471 Bacteria 4456
658 Ga0395905_0083333 3300037471 Unclassified 2995
659 Ga0395905_0109252 3300037471 Bacteria 2596
660 Ga0395905_0181914 3300037471 Bacteria 1974
661 Ga0395905_0190130 3300037471 Bacteria 1926
662 Ga0395905_0234575 3300037471 Bacteria 1715
663 Ga0395905_0449737 3300037471 Bacteria 1186
664 Ga0395901_0003202 3300038443 Bacteria 16473
665 Ga0395901_0004006 3300038443 Bacteria 14838
666 Ga0395901_0004120 3300038443 Bacteria 14646
667 Ga0395901_0004168 3300038443 Bacteria 14592
668 Ga0395901_0007607 3300038443 Bacteria 10937
669 Ga0395901_0012918 3300038443 Bacteria 8471
670 Ga0395901_0020657 3300038443 Bacteria 6739
671 Ga0395901_0022539 3300038443 Bacteria 6455
672 Ga0395901_0036824 3300038443 Bacteria 5058
673 Ga0395901_0049028 3300038443 Bacteria 4387
674 Ga0395901_0082775 3300038443 Unclassified 3353
675 Ga0395901_0119437 3300038443 Bacteria 2770
676 Ga0395901_0150776 3300038443 Bacteria 2443
677 Ga0395901_0215190 3300038443 Bacteria 2010
678 Ga0395901_0217515 3300038443 Unclassified 1997
679 Ga0395901_0435784 3300038443 Bacteria 1342
680 Ga0395901_0671741 3300038443 Bacteria 1037
681 Ga0395901_0756196 3300038443 Bacteria 964
682 Ga0395901_1117443 3300038443 Bacteria 758
683 Ga0395901_1164417 3300038443 Unclassified 738
684 Ga0395901_1275565 3300038443 Unclassified 697
685 Ga0395901_1315786 3300038443 Bacteria 684
686 Ga0439439_0000168 3300041406 Bacteria 9797
687 Ga0451789_0831867 3300041443 Bacteria 1924
688 Ga0451791_1920887 3300041451 Bacteria 1168
689 Ga0451798_0932997 3300041458 Bacteria 1268
690 Ga0451800_0381266 3300041459 Bacteria 2037
691 Ga0451802_1601654 3300041460 Bacteria 2777
692 Ga0451804_0674902 3300041463 Bacteria 2070
693 Ga0451807_0556744 3300041486 Bacteria 1774
694 Ga0451807_0677844 3300041486 Unclassified 1062
695 Ga0451835_0158106 3300041492 Bacteria 2784
696 Ga0451839_0329616 3300041496 Bacteria 3118
697 Ga0451845_0293247 3300041501 Bacteria 1267
698 Ga0451847_0784703 3300041503 Bacteria 2709
699 Ga0451849_0149384 3300041505 Bacteria 1665
700 Ga0451851_0781637 3300041507 Bacteria 2415
701 Ga0439431_0003319 3300041997 Bacteria 3545
702 Ga0439433_0006255 3300041999 Bacteria 2562
703 Ga0439445_0054465 3300042004 Bacteria 1085
704 Ga0439448_0002278 3300042005 Bacteria 5188
705 Ga0439448_0035334 3300042005 Bacteria 1600
706 Ga0439448_0052078 3300042005 Unclassified 1341
707 Ga0439462_0016445 3300042015 Bacteria 1910
708 Ga0450920_031964 3300042122 Bacteria 1038
709 Ga0450923_003845 3300042125 Bacteria 2308
710 Ga0450907_005134 3300042146 Unclassified 2221
711 Ga0439446_0001028 3300042156 Bacteria 6127
712 Ga0439458_0004345 3300042157 Bacteria 3260
713 Ga0439434_0037562 3300042435 Bacteria 1483
714 Ga0466969_0020004 3300044656 Bacteria 3469
715 Ga0453683_0117574 3300044673 Bacteria 1673
716 Ga0466961_0077330 3300044693 Bacteria 2108
717 Ga0466961_0307584 3300044693 Bacteria 967
718 Ga0466963_0000045 3300044694 Bacteria 40813
719 Ga0466963_0041098 3300044694 Unclassified 3031
720 Ga0466963_0064643 3300044694 Bacteria 2451
721 Ga0466963_0260097 3300044694 Bacteria 1218
722 Ga0466964_0000074 3300044706 Bacteria 22392
723 Ga0466964_0013974 3300044706 Bacteria 3049
724 Ga0466971_0011789 3300044719 Bacteria 3829
725 Ga0466971_0064302 3300044719 Bacteria 1661
726 Ga0466968_0008417 3300044735 Bacteria 3949
727 Ga0466968_0015989 3300044735 Bacteria 2982
728 Ga0466968_0105412 3300044735 Bacteria 1263
729 Ga0466957_0003753 3300044842 Bacteria 8394
730 Ga0466957_0088960 3300044842 Bacteria 1932
731 Ga0466959_0006407 3300045049 Bacteria 8147
732 Ga0451576_0752536 3300045051 Unclassified 1023
733 Ga0466958_0004688 3300045836 Bacteria 7257
734 Ga0466967_0000085 3300045976 Bacteria 34226
735 Ga0466967_0005337 3300045976 Bacteria 8879
736 Ga0466967_0014500 3300045976 Bacteria 6142
737 Ga0466967_0042350 3300045976 Bacteria 3934
738 Ga0466967_0254195 3300045976 Bacteria 1679
739 Ga0495592_0006827 3300046454 Bacteria 8521
740 Ga0495592_0093479 3300046454 Bacteria 2153
741 Ga0495603_0037612 3300046455 Unclassified 2904
742 Ga0495603_0270279 3300046455 Unclassified 978
743 Ga0495629_0058848 3300046459 Bacteria 2687
744 Ga0495629_0069671 3300046459 Unclassified 2454
745 Ga0495629_0180481 3300046459 Bacteria 1463
746 Ga0495641_0002472 3300046461 Bacteria 14578
747 Ga0495641_0013150 3300046461 Bacteria 4571
748 Ga0495641_0030758 3300046461 Bacteria 2570
749 Ga0495641_0038579 3300046461 Bacteria 2231
750 Ga0495651_0034677 3300046462 Bacteria 3933
751 Ga0495651_0176707 3300046462 Bacteria 1515
752 Ga0495653_0017708 3300046463 Bacteria 5792
753 Ga0495653_0047653 3300046463 Bacteria 3314
754 Ga0495580_0012758 3300046472 Bacteria 6441
755 Ga0495582_0009080 3300046473 Bacteria 5485
756 Ga0495582_0053759 3300046473 Bacteria 2221
757 Ga0495582_0229057 3300046473 Bacteria 1064
758 Ga0495605_0014353 3300046474 Bacteria 4343
759 Ga0495639_0001471 3300046475 Bacteria 10533
760 Ga0495639_0262626 3300046475 Bacteria 855
761 Ga0495662_0001052 3300046476 Bacteria 13534
762 Ga0495662_0241215 3300046476 Unclassified 891
763 Ga0495664_0244778 3300046477 Unclassified 1084
764 Ga0495664_0292031 3300046477 Bacteria 984
765 Ga0495584_0027488 3300046491 Bacteria 2883
766 Ga0495584_0428770 3300046491 Unclassified 672
767 Ga0495585_0021155 3300046492 Bacteria 3737
768 Ga0495585_0097169 3300046492 Bacteria 1580
769 Ga0495594_0111326 3300046499 Bacteria 1544
770 Ga0495594_0237455 3300046499 Unclassified 1039
771 Ga0495594_0336162 3300046499 Unclassified 860
772 Ga0495596_0023254 3300046500 Bacteria 2516
773 Ga0495596_0078477 3300046500 Unclassified 1282
774 Ga0495596_0080272 3300046500 Unclassified 1267
775 Ga0495596_0151932 3300046500 Bacteria 899
776 Ga0495596_0173247 3300046500 Bacteria 839
777 Ga0495607_0046332 3300046501 Bacteria 2554
778 Ga0495583_0246092 3300046506 Unclassified 718
779 Ga0495608_0008332 3300046511 Bacteria 7272
780 Ga0495608_0011305 3300046511 Bacteria 6214
781 Ga0495608_0108761 3300046511 Bacteria 1783
782 Ga0495608_0337715 3300046511 Bacteria 929
783 Ga0495618_0159990 3300046514 Bacteria 1436
784 Ga0495618_0382355 3300046514 Bacteria 863
785 Ga0495628_0074619 3300046516 Bacteria 2641
786 Ga0495630_0063343 3300046517 Bacteria 2777
787 Ga0495630_0064450 3300046517 Bacteria 2753
788 Ga0495631_0024285 3300046518 Bacteria 2799
789 Ga0495637_0158376 3300046520 Unclassified 851
790 Ga0495644_0023053 3300046523 Bacteria 2370
791 Ga0495644_0036891 3300046523 Bacteria 1844
792 Ga0495644_0123394 3300046523 Bacteria 986
793 Ga0495663_0013836 3300046525 Bacteria 2256
794 Ga0495663_0063257 3300046525 Unclassified 1166
795 Ga0495666_0000168 3300046526 Bacteria 27728
796 Ga0495642_0015846 3300046528 Bacteria 2934
797 Ga0495652_0027449 3300046529 Bacteria 5016
798 Ga0495652_0117747 3300046529 Bacteria 2124
799 Ga0495665_0000038 3300046531 Bacteria 51967
800 Ga0495640_0061516 3300046533 Bacteria 2550
801 Ga0495640_0109551 3300046533 Bacteria 1805
802 Ga0495640_0170889 3300046533 Unclassified 1389
803 Ga0495586_0044768 3300046535 Unclassified 2384
804 Ga0495586_0087123 3300046535 Bacteria 1721
805 Ga0495587_0051345 3300046536 Bacteria 2438
806 Ga0495587_0136115 3300046536 Bacteria 1403
807 Ga0495609_0034973 3300046538 Unclassified 2276
808 Ga0495609_0056328 3300046538 Bacteria 1742
809 Ga0495609_0081141 3300046538 Unclassified 1418
810 Ga0495645_0020312 3300046543 Bacteria 4789
811 Ga0495645_0134585 3300046543 Bacteria 1729
812 Ga0495633_0075557 3300046558 Bacteria 1569
813 Ga0495656_0004926 3300046615 Bacteria 4596
814 Ga0495656_0020371 3300046615 Unclassified 2572
815 Ga0495656_0073680 3300046615 Bacteria 1523
816 Ga0495656_0082347 3300046615 Unclassified 1455
817 Ga0495668_0159375 3300046616 Bacteria 1236
818 Ga0495634_0032310 3300046642 Bacteria 3599
819 Ga0495634_0046482 3300046642 Bacteria 2929
820 Ga0495634_0125069 3300046642 Bacteria 1644
821 Ga0495611_0009038 3300046648 Bacteria 4215
822 Ga0495611_0087260 3300046648 Bacteria 1440
823 Ga0495635_0016870 3300046663 Bacteria 5099
824 Ga0495635_0045671 3300046663 Bacteria 3022
825 Ga0495659_0002908 3300046664 Bacteria 5499
826 Ga0495659_0009308 3300046664 Unclassified 3134
827 Ga0495659_0076923 3300046664 Unclassified 1260
828 Ga0495659_0091623 3300046664 Unclassified 1168
829 Ga0495588_0155332 3300046674 Unclassified 1210
830 Ga0495588_0162951 3300046674 Unclassified 1179
831 Ga0495657_0114026 3300046675 Unclassified 1709
832 Ga0495599_0005941 3300046678 Bacteria 7340
833 Ga0495599_0035792 3300046678 Bacteria 3116
834 Ga0495646_0016254 3300046680 Bacteria 4724
835 Ga0495646_0040322 3300046680 Bacteria 2877
836 Ga0495646_0084300 3300046680 Bacteria 1845
837 Ga0495647_0014147 3300046681 Bacteria 2776
838 Ga0495647_0194017 3300046681 Bacteria 888
839 Ga0495647_0245049 3300046681 Bacteria 796
840 Ga0495658_0120967 3300046683 Bacteria 1583
841 Ga0495658_0128567 3300046683 Bacteria 1540
842 Ga0495669_0018351 3300046684 Bacteria 3008
843 Ga0495613_0012499 3300046689 Bacteria 6309
844 Ga0495613_0305541 3300046689 Unclassified 1100
845 Ga0495624_0022102 3300046690 Bacteria 4210
846 Ga0495624_0044304 3300046690 Bacteria 2836
847 Ga0495624_0105896 3300046690 Bacteria 1730
848 Ga0495624_0134073 3300046690 Bacteria 1518
849 Ga0495589_0011190 3300046794 Bacteria 4656
850 Ga0495600_0096760 3300046809 Bacteria 1924
851 Ga0495660_0065583 3300046810 Bacteria 1938
852 Ga0495581_0002990 3300047315 Bacteria 9687
853 Ga0495581_0006726 3300047315 Bacteria 6667
854 Ga0495604_0175959 3300047317 Unclassified 1500
855 Ga0495674_0050204 3300047319 Bacteria 3682
856 Ga0495676_0012944 3300047321 Bacteria 7504
857 Ga0495676_0125215 3300047321 Bacteria 1863
858 Ga0495680_0041623 3300047322 Bacteria 3652
859 Ga0495680_0065347 3300047322 Bacteria 2786
860 Ga0495680_0262927 3300047322 Bacteria 1220
861 Ga0495677_0005967 3300047445 Bacteria 4611
862 Ga0495677_0020441 3300047445 Bacteria 2400
863 Ga0495677_0039234 3300047445 Bacteria 1731
864 Ga0495679_077974 3300047446 Unclassified 945
865 Ga0495679_151229 3300047446 Unclassified 623
866 Ga0495673_0132476 3300047469 Bacteria 979
867 Ga0495684_0001595 3300047471 Bacteria 18196
868 Ga0495684_0475614 3300047471 Bacteria 863
869 Ga0495593_0001683 3300047673 Bacteria 13111
870 Ga0495602_0033921 3300048088 Bacteria 4781
871 Ga0495602_0062381 3300048088 Bacteria 3234
872 Ga0495602_0357648 3300048088 Unclassified 1052
873 Ga0495614_0000113 3300048089 Bacteria 27871
874 Ga0495626_0117746 3300048091 Bacteria 1145
875 Ga0496100_0040354 3300048903 Unclassified 2969
876 Ga0496100_0048695 3300048903 Bacteria 2737
877 Ga0496100_0137668 3300048903 Bacteria 1727
878 Ga0496100_0242380 3300048903 Unclassified 1331
879 Ga0496100_0392288 3300048903 Bacteria 1056
880 Ga0496100_0495068 3300048903 Unclassified 941
881 Ga0496101_0166317 3300048904 Bacteria 1693
882 Ga0496101_0186014 3300048904 Bacteria 1601
883 Ga0496101_0348536 3300048904 Unclassified 1163
884 Ga0496102_0011804 3300048905 Bacteria 7540
885 Ga0496102_0108999 3300048905 Bacteria 2580
886 Ga0496102_0244267 3300048905 Bacteria 1693
887 Ga0496102_0476335 3300048905 Unclassified 1169
888 Ga0496102_0881774 3300048905 Bacteria 817
889 Ga0496103_0155600 3300048906 Bacteria 1465
890 Ga0496103_0187989 3300048906 Bacteria 1328
891 Ga0496103_0546816 3300048906 Unclassified 739
892 Ga0496104_0000796 3300048907 Bacteria 27065
893 Ga0496104_0015518 3300048907 Bacteria 6900
894 Ga0496104_0055323 3300048907 Bacteria 3752
895 Ga0496104_0105853 3300048907 Bacteria 2695
896 Ga0496104_0237597 3300048907 Bacteria 1734
897 Ga0496105_0002479 3300048908 Bacteria 13363
898 Ga0496105_0004890 3300048908 Bacteria 10128
899 Ga0496105_0014167 3300048908 Bacteria 6345
900 Ga0496105_0072063 3300048908 Bacteria 2855
901 Ga0496105_0143570 3300048908 Bacteria 1964
902 Ga0496105_0973287 3300048908 Unclassified 636
903 Ga0496106_0054377 3300048909 Bacteria 3025
904 Ga0496106_0302959 3300048909 Bacteria 1282
905 Ga0496107_0085794 3300048910 Bacteria 2297
906 Ga0496107_0108861 3300048910 Unclassified 2035
907 Ga0496107_0242849 3300048910 Bacteria 1340
908 Ga0496107_0276050 3300048910 Bacteria 1251
909 Ga0496107_0457240 3300048910 Unclassified 948
910 Ga0496107_0537404 3300048910 Bacteria 866
911 Ga0496107_0620776 3300048910 Unclassified 798
912 Ga0496108_0013267 3300048911 Bacteria 6716
913 Ga0496108_0017218 3300048911 Bacteria 5911
914 Ga0496108_0023902 3300048911 Bacteria 5031
915 Ga0496108_0037517 3300048911 Bacteria 4037
916 Ga0496108_0516857 3300048911 Bacteria 1042
917 Ga0496109_0002279 3300048912 Bacteria 15952
918 Ga0496109_0003664 3300048912 Bacteria 12839
919 Ga0496109_0017231 3300048912 Bacteria 6329
920 Ga0496109_0025028 3300048912 Bacteria 5314
921 Ga0496109_0073603 3300048912 Bacteria 3139
922 Ga0496109_0189427 3300048912 Bacteria 1933
923 Ga0496109_0256808 3300048912 Bacteria 1646
924 Ga0496109_0296581 3300048912 Bacteria 1524
925 Ga0496109_0340359 3300048912 Bacteria 1416
926 Ga0496109_0351964 3300048912 Bacteria 1391
927 Ga0496109_0681225 3300048912 Bacteria 965
928 Ga0496110_0003721 3300048913 Bacteria 11747
929 Ga0496110_0011450 3300048913 Bacteria 7260
930 Ga0496110_0025824 3300048913 Bacteria 5022
931 Ga0496110_0026248 3300048913 Bacteria 4982
932 Ga0496110_0055798 3300048913 Bacteria 3476
933 Ga0496110_0061868 3300048913 Bacteria 3305
934 Ga0496110_0166595 3300048913 Bacteria 1998
935 Ga0496110_0182613 3300048913 Bacteria 1905
936 Ga0496110_0356964 3300048913 Bacteria 1332
937 Ga0496110_0469651 3300048913 Unclassified 1146
938 Ga0496111_0005145 3300048914 Bacteria 8338
939 Ga0496111_0012987 3300048914 Bacteria 5653
940 Ga0496111_0024923 3300048914 Bacteria 4219
941 Ga0496111_0036864 3300048914 Bacteria 3497
942 Ga0496111_0050839 3300048914 Bacteria 2991
943 Ga0496111_0058734 3300048914 Bacteria 2785
944 Ga0496111_0061451 3300048914 Bacteria 2723
945 Ga0496111_0108228 3300048914 Bacteria 2047
946 Ga0496111_0257099 3300048914 Bacteria 1296
947 Ga0496111_0887150 3300048914 Bacteria 643
948 Ga0496112_0009544 3300048915 Bacteria 8751
949 Ga0496112_0028258 3300048915 Bacteria 5413
950 Ga0496112_0055404 3300048915 Bacteria 3899
951 Ga0496112_0101343 3300048915 Bacteria 2849
952 Ga0496112_0127573 3300048915 Unclassified 2515
953 Ga0496112_0183213 3300048915 Unclassified 2058
954 Ga0496112_0312290 3300048915 Bacteria 1517
955 Ga0496112_0328738 3300048915 Bacteria 1473
956 Ga0496112_0375135 3300048915 Bacteria 1364
957 Ga0496112_0532175 3300048915 Bacteria 1109
958 Ga0496112_0996578 3300048915 Bacteria 758
959 Ga0496113_0027915 3300048916 Bacteria 4052
960 Ga0496113_0028180 3300048916 Bacteria 4037
961 Ga0496113_0050677 3300048916 Bacteria 3096
962 Ga0496113_0096668 3300048916 Bacteria 2284
963 Ga0496113_0250008 3300048916 Bacteria 1415
964 Ga0496113_0262144 3300048916 Unclassified 1381
965 Ga0496114_0005323 3300048917 Bacteria 10055
966 Ga0496114_0014999 3300048917 Bacteria 6230
967 Ga0496114_0029594 3300048917 Bacteria 4504
968 Ga0496114_0075226 3300048917 Bacteria 2844
969 Ga0496114_0137754 3300048917 Bacteria 2111
970 Ga0496114_0224911 3300048917 Bacteria 1648
971 Ga0496114_0400247 3300048917 Bacteria 1216
972 Ga0496114_0861432 3300048917 Bacteria 786
973 Ga0496115_0019305 3300048918 Bacteria 5245
974 Ga0496115_0029074 3300048918 Bacteria 4338
975 Ga0496115_0100380 3300048918 Bacteria 2372
976 Ga0496115_0648755 3300048918 Unclassified 834
977 Ga0496115_0738063 3300048918 Unclassified 771
978 Ga0501031_0018283 3300049568 Bacteria 4561
979 Ga0501031_0035031 3300049568 Bacteria 3274
980 Ga0501031_0042296 3300049568 Bacteria 2974
981 Ga0501031_0187148 3300049568 Bacteria 1352
982 Ga0501031_0357122 3300049568 Bacteria 946
983 Ga0501031_0379115 3300049568 Bacteria 915
984 Ga0501032_0017415 3300049569 Bacteria 5046
985 Ga0501032_0057394 3300049569 Bacteria 2616
986 Ga0501032_0059129 3300049569 Unclassified 2573
987 Ga0501032_0696749 3300049569 Bacteria 644
988 Ga0501033_0033324 3300049570 Bacteria 3867
989 Ga0501033_0063914 3300049570 Unclassified 2708
990 Ga0501033_0128523 3300049570 Bacteria 1836
991 Ga0501033_0160272 3300049570 Unclassified 1620
992 Ga0501034_0241020 3300049571 Bacteria 1754
993 Ga0501034_0426389 3300049571 Bacteria 1247
994 Ga0501036_0007462 3300049572 Bacteria 8913
995 Ga0501036_0012198 3300049572 Bacteria 7120
996 Ga0501036_0018707 3300049572 Bacteria 5808
997 Ga0501036_0040352 3300049572 Bacteria 3947
998 Ga0501036_0095912 3300049572 Bacteria 2507
999 Ga0501036_0141522 3300049572 Unclassified 2030
1000 Ga0501036_0178641 3300049572 Bacteria 1787
1001 Ga0501036_0627690 3300049572 Bacteria 890
1002 Ga0501037_0007291 3300049573 Bacteria 8083
1003 Ga0501037_0175286 3300049573 Bacteria 1523
1004 Ga0501037_0289727 3300049573 Unclassified 1139
1005 Ga0501037_0299508 3300049573 Unclassified 1117
1006 Ga0501037_0342775 3300049573 Unclassified 1032
1007 Ga0501037_0455887 3300049573 Bacteria 872
1008 Ga0501038_0034894 3300049574 Bacteria 4420
1009 Ga0501038_0039536 3300049574 Bacteria 4125
1010 Ga0501038_0039616 3300049574 Bacteria 4121
1011 Ga0501038_0159160 3300049574 Bacteria 1836
1012 Ga0501038_0402683 3300049574 Bacteria 1058
1013 Ga0501038_0475108 3300049574 Unclassified 959
1014 Ga0501038_0713714 3300049574 Bacteria 750
1015 Ga0501039_0009095 3300049575 Bacteria 7572
1016 Ga0501039_0009928 3300049575 Bacteria 7259
1017 Ga0501039_0016770 3300049575 Bacteria 5613
1018 Ga0501039_0021738 3300049575 Bacteria 4922
1019 Ga0501039_0343500 3300049575 Unclassified 1173
1020 Ga0501039_0387720 3300049575 Bacteria 1097
1021 Ga0501039_0485459 3300049575 Bacteria 970
1022 Ga0501039_0576329 3300049575 Unclassified 883
1023 Ga0501040_0002593 3300049576 Bacteria 11649
1024 Ga0501040_0018564 3300049576 Bacteria 4618
1025 Ga0501040_0028374 3300049576 Bacteria 3772
1026 Ga0501040_0041491 3300049576 Bacteria 3134
1027 Ga0501040_0045154 3300049576 Unclassified 3004
1028 Ga0501040_0152107 3300049576 Bacteria 1633
1029 Ga0501040_0269586 3300049576 Bacteria 1215
1030 Ga0501040_0315898 3300049576 Unclassified 1117
1031 Ga0501040_0358307 3300049576 Bacteria 1045
1032 Ga0501041_0007274 3300049577 Bacteria 6499
1033 Ga0501041_0012870 3300049577 Bacteria 4956
1034 Ga0501041_0028611 3300049577 Bacteria 3362
1035 Ga0501041_0046929 3300049577 Bacteria 2628
1036 Ga0501041_0072387 3300049577 Unclassified 2117
1037 Ga0501041_0118236 3300049577 Unclassified 1646
1038 Ga0501041_0119709 3300049577 Bacteria 1636
1039 Ga0501041_0273289 3300049577 Bacteria 1063
1040 Ga0501041_0476377 3300049577 Bacteria 793
1041 Ga0501042_0004401 3300049578 Bacteria 8987
1042 Ga0501042_0061438 3300049578 Bacteria 2684
1043 Ga0501042_0076005 3300049578 Bacteria 2403
1044 Ga0501042_0084004 3300049578 Unclassified 2282
1045 Ga0501042_0095116 3300049578 Unclassified 2140
1046 Ga0501042_0199933 3300049578 Unclassified 1441
1047 Ga0501042_0800539 3300049578 Unclassified 686
1048 Ga0501043_0017112 3300049579 Bacteria 5684
1049 Ga0501043_0111447 3300049579 Bacteria 2148
1050 Ga0501043_0127343 3300049579 Unclassified 1997
1051 Ga0501043_0222958 3300049579 Unclassified 1458
1052 Ga0501046_0002178 3300049580 Bacteria 18497
1053 Ga0501046_0012656 3300049580 Bacteria 7174
1054 Ga0501046_0027500 3300049580 Bacteria 4638
1055 Ga0501046_0073092 3300049580 Bacteria 2661
1056 Ga0501046_0080985 3300049580 Bacteria 2508
1057 Ga0501047_0046233 3300049581 Bacteria 4207
1058 Ga0501048_0028695 3300049582 Bacteria 4040
1059 Ga0501048_0030829 3300049582 Bacteria 3880
1060 Ga0501048_0056720 3300049582 Bacteria 2778
1061 Ga0501048_0063481 3300049582 Bacteria 2612
1062 Ga0501048_0165342 3300049582 Bacteria 1566
1063 Ga0501048_0833981 3300049582 Bacteria 663
1064 Ga0501067_0007990 3300049583 Bacteria 5875
1065 Ga0501067_0028914 3300049583 Bacteria 3072
1066 Ga0501067_0118208 3300049583 Bacteria 1474
1067 Ga0501067_0118402 3300049583 Bacteria 1473
1068 Ga0501067_0140764 3300049583 Bacteria 1343
1069 Ga0501068_0003747 3300049584 Bacteria 8226
1070 Ga0501068_0007558 3300049584 Bacteria 6015
1071 Ga0501068_0008746 3300049584 Bacteria 5648
1072 Ga0501068_0035139 3300049584 Bacteria 2991
1073 Ga0501068_0041057 3300049584 Bacteria 2779
1074 Ga0501068_0255294 3300049584 Bacteria 1118
1075 Ga0501068_0508359 3300049584 Bacteria 782
1076 Ga0501069_0000968 3300049585 Bacteria 13668
1077 Ga0501069_0015555 3300049585 Bacteria 4080
1078 Ga0501069_0016217 3300049585 Bacteria 3997
1079 Ga0501069_0028350 3300049585 Bacteria 3069
1080 Ga0501069_0053876 3300049585 Bacteria 2240
1081 Ga0501069_0069932 3300049585 Bacteria 1966
1082 Ga0501070_0002450 3300049586 Bacteria 16255
1083 Ga0501070_0074032 3300049586 Bacteria 2819
1084 Ga0501070_0080974 3300049586 Bacteria 2686
1085 Ga0501070_0089238 3300049586 Bacteria 2551
1086 Ga0501070_0175751 3300049586 Bacteria 1763
1087 Ga0501070_0742260 3300049586 Bacteria 774
1088 Ga0501071_0001822 3300049587 Bacteria 12626
1089 Ga0501071_0003354 3300049587 Bacteria 10006
1090 Ga0501071_0006541 3300049587 Bacteria 7567
1091 Ga0501071_0011840 3300049587 Bacteria 5887
1092 Ga0501071_0048676 3300049587 Unclassified 3050
1093 Ga0501071_0073754 3300049587 Unclassified 2490
1094 Ga0501071_0172275 3300049587 Bacteria 1620
1095 Ga0501071_0227235 3300049587 Bacteria 1405
1096 Ga0501071_0275830 3300049587 Unclassified 1272
1097 Ga0501071_0281216 3300049587 Unclassified 1259
1098 Ga0501071_0304897 3300049587 Unclassified 1208
1099 Ga0501071_0427304 3300049587 Bacteria 1013
1100 Ga0501071_0924042 3300049587 Bacteria 673
1101 Ga0501072_0008618 3300049588 Bacteria 7741
1102 Ga0501072_0013405 3300049588 Bacteria 6273
1103 Ga0501072_0022455 3300049588 Bacteria 4895
1104 Ga0501072_0029064 3300049588 Bacteria 4315
1105 Ga0501072_0054949 3300049588 Unclassified 3139
1106 Ga0501072_0073731 3300049588 Bacteria 2698
1107 Ga0501072_0075660 3300049588 Bacteria 2663
1108 Ga0501072_0153749 3300049588 Unclassified 1834
1109 Ga0501072_0213739 3300049588 Bacteria 1537
1110 Ga0501072_0259620 3300049588 Unclassified 1383
1111 Ga0501073_0003805 3300049589 Bacteria 11333
1112 Ga0501073_0043484 3300049589 Bacteria 3168
1113 Ga0501074_0001334 3300049590 Bacteria 16397
1114 Ga0501074_0023942 3300049590 Bacteria 4437
1115 Ga0501074_0032573 3300049590 Bacteria 3775
1116 Ga0501074_0050916 3300049590 Bacteria 2989
1117 Ga0501074_0127027 3300049590 Unclassified 1824
1118 Ga0501074_0213677 3300049590 Unclassified 1374
1119 Ga0501074_0274828 3300049590 Unclassified 1198
1120 Ga0501075_0014061 3300049591 Bacteria 5730
1121 Ga0501075_0030416 3300049591 Bacteria 4000
1122 Ga0501075_0031563 3300049591 Bacteria 3933
1123 Ga0501075_0031655 3300049591 Bacteria 3927
1124 Ga0501075_0106004 3300049591 Unclassified 2136
1125 Ga0501075_0168536 3300049591 Bacteria 1671
1126 Ga0501075_0169271 3300049591 Bacteria 1667
1127 Ga0501075_0303363 3300049591 Bacteria 1217
1128 Ga0501075_0314927 3300049591 Bacteria 1192
1129 Ga0501076_0001883 3300049592 Bacteria 14295
1130 Ga0501076_0004930 3300049592 Bacteria 9551
1131 Ga0501076_0014766 3300049592 Bacteria 5888
1132 Ga0501076_0024867 3300049592 Bacteria 4632
1133 Ga0501076_0030603 3300049592 Bacteria 4193
1134 Ga0501076_0031075 3300049592 Bacteria 4162
1135 Ga0501076_0049285 3300049592 Bacteria 3331
1136 Ga0501076_0330005 3300049592 Unclassified 1251
1137 Ga0501076_0360689 3300049592 Bacteria 1194
1138 Ga0501076_0591820 3300049592 Unclassified 915
1139 Ga0501077_0011665 3300049593 Bacteria 5492
1140 Ga0501077_0019049 3300049593 Bacteria 4339
1141 Ga0501077_0020984 3300049593 Unclassified 4133
1142 Ga0501077_0022898 3300049593 Bacteria 3959
1143 Ga0501077_0033852 3300049593 Bacteria 3252
1144 Ga0501077_0049117 3300049593 Unclassified 2681
1145 Ga0501077_0212765 3300049593 Bacteria 1228
1146 Ga0501077_0218055 3300049593 Bacteria 1213
1147 Ga0501077_0636810 3300049593 Unclassified 685
1148 Ga0501079_0004568 3300049741 Bacteria 10264
1149 Ga0501079_0007431 3300049741 Bacteria 8292
1150 Ga0501079_0011783 3300049741 Bacteria 6676
1151 Ga0501079_0031637 3300049741 Bacteria 4067
1152 Ga0501079_0089736 3300049741 Bacteria 2380
1153 Ga0501079_0102494 3300049741 Bacteria 2219
1154 Ga0501079_0166093 3300049741 Bacteria 1721
1155 Ga0501079_0178441 3300049741 Bacteria 1657
1156 Ga0501079_0186151 3300049741 Bacteria 1621
1157 Ga0501079_0256442 3300049741 Bacteria 1367
1158 Ga0501079_0607452 3300049741 Bacteria 861
1159 Ga0501080_0003932 3300049742 Bacteria 13156
1160 Ga0501080_0026594 3300049742 Bacteria 5376
1161 Ga0501080_0035680 3300049742 Bacteria 4641
1162 Ga0501080_0138230 3300049742 Bacteria 2253
1163 Ga0501080_0205385 3300049742 Bacteria 1807
1164 Ga0501080_0215163 3300049742 Unclassified 1760
1165 Ga0501080_0237799 3300049742 Bacteria 1663
1166 Ga0501080_0609863 3300049742 Bacteria 968
1167 Ga0501081_0004593 3300049743 Bacteria 8865
1168 Ga0501081_0012409 3300049743 Bacteria 5599
1169 Ga0501081_0013193 3300049743 Bacteria 5434
1170 Ga0501081_0030588 3300049743 Bacteria 3645
1171 Ga0501081_0129607 3300049743 Unclassified 1802
1172 Ga0501081_0133495 3300049743 Bacteria 1775
1173 Ga0501081_0171740 3300049743 Unclassified 1565
1174 Ga0501081_0199485 3300049743 Bacteria 1451
1175 Ga0501081_0491569 3300049743 Bacteria 914
1176 Ga0501081_0519755 3300049743 Bacteria 888
1177 Ga0501083_0031235 3300049744 Bacteria 3656
1178 Ga0501083_0091182 3300049744 Bacteria 2012
1179 Ga0501083_0196210 3300049744 Unclassified 1317
1180 Ga0501083_0368241 3300049744 Bacteria 934
1181 Ga0501083_0601399 3300049744 Bacteria 715
1182 Ga0501035_0004561 3300049822 Bacteria 13144
1183 Ga0501035_0040200 3300049822 Bacteria 4228
1184 Ga0501035_0064632 3300049822 Bacteria 3251
1185 Ga0501035_0251491 3300049822 Unclassified 1501
1186 Ga0501035_0289560 3300049822 Bacteria 1382
1187 Ga0501035_1063158 3300049822 Bacteria 634
1188 Ga0501044_0029988 3300049823 Bacteria 5735
1189 Ga0501044_0098704 3300049823 Bacteria 2940
1190 Ga0501044_0224412 3300049823 Bacteria 1829
1191 Ga0501044_0246877 3300049823 Bacteria 1728
1192 Ga0501044_0520460 3300049823 Bacteria 1089
1193 Ga0501045_0017589 3300049824 Bacteria 5076
1194 Ga0501045_0021351 3300049824 Bacteria 4631
1195 Ga0501045_0031191 3300049824 Unclassified 3860
1196 Ga0501045_0038060 3300049824 Bacteria 3498
1197 Ga0501045_0047388 3300049824 Unclassified 3130
1198 Ga0501045_0070913 3300049824 Bacteria 2564
1199 Ga0501045_0081791 3300049824 Bacteria 2381
1200 Ga0501045_0535239 3300049824 Unclassified 869
1201 nmdc:mga0yw44_241822_c1 3300050492 Bacteria 1200
1202 nmdc:mga06z11_68021_c1 3300050494 Bacteria 1876
1203 nmdc:mga05p37_10748_c1 3300050507 Bacteria 10866
1204 nmdc:mga05p37_1190645_c1 3300050507 Bacteria 788
1205 nmdc:mga05p37_144056_c1 3300050507 Unclassified 2918
1206 nmdc:mga05p37_15198_c1 3300050507 Bacteria 9244
1207 nmdc:mga05p37_204218_c1 3300050507 Unclassified 2391
1208 nmdc:mga05p37_328080_c1 3300050507 Unclassified 1809
1209 nmdc:mga05p37_51818_c1 3300050507 Bacteria 5047
1210 nmdc:mga05p37_556335_c1 3300050507 Unclassified 1305
1211 nmdc:mga05p37_79479_c1 3300050507 Bacteria 4038
1212 nmdc:mga05p37_96370_c1 3300050507 Bacteria 3645
1213 nmdc:mga05p37_96568_c1 3300050507 Bacteria 3641
1214 nmdc:mga09592_129799_c1 3300050508 Unclassified 2168
1215 nmdc:mga09592_146226_c1 3300050508 Bacteria 2038
1216 nmdc:mga09592_61944_c1 3300050508 Unclassified 3165
1217 nmdc:mga09592_648919_c1 3300050508 Bacteria 901
1218 nmdc:mga0qj67_190955_c1 3300050509 Bacteria 1665
1219 nmdc:mga06r32_108753_c1 3300050510 Bacteria 2726
1220 nmdc:mga06r32_56625_c1 3300050510 Bacteria 3764
1221 nmdc:mga06r32_663616_c1 3300050510 Bacteria 1010
1222 nmdc:mga08y16_1224188_c1 3300050511 Bacteria 721
1223 nmdc:mga08y16_23953_c1 3300050511 Bacteria 6447
1224 nmdc:mga08y16_314437_c1 3300050511 Bacteria 1613
1225 nmdc:mga08y16_402098_c1 3300050511 Bacteria 1401
1226 nmdc:mga08y16_406548_c1 3300050511 Unclassified 1393
1227 nmdc:mga08y16_51762_c1 3300050511 Bacteria 4297
1228 nmdc:mga08y16_55749_c1 3300050511 Bacteria 4130
1229 nmdc:mga08y16_948234_c1 3300050511 Bacteria 844
1230 nmdc:mga08y16_9589_c1 3300050511 Bacteria 10165
1231 nmdc:mga08y16_9855_c1 3300050511 Bacteria 10031
1232 nmdc:mga0n895_1343907_c1 3300050512 Bacteria 684
1233 nmdc:mga0n895_198815_c1 3300050512 Bacteria 2036
1234 nmdc:mga0n895_227061_c1 3300050512 Bacteria 1895
1235 nmdc:mga0n895_2841_c1 3300050512 Bacteria 13716
1236 nmdc:mga0n895_380147_c1 3300050512 Archaea 1429
1237 nmdc:mga0n895_624106_c1 3300050512 Bacteria 1079
1238 nmdc:mga0n895_820070_c1 3300050512 Unclassified 920
1239 nmdc:mga0rr50_1093779_c1 3300050513 Unclassified 678
1240 nmdc:mga0rr50_114286_c1 3300050513 Bacteria 2140
1241 nmdc:mga0rr50_153156_c1 3300050513 Unclassified 1865
1242 nmdc:mga0rr50_425948_c1 3300050513 Unclassified 1123
1243 nmdc:mga0rr50_64909_c1 3300050513 Unclassified 2764
1244 nmdc:mga0rr50_9123_c1 3300050513 Bacteria 6213
1245 nmdc:mga08x19_101458_c1 3300050514 Unclassified 1910
1246 nmdc:mga08x19_337176_c1 3300050514 Unclassified 1051
1247 nmdc:mga08x19_41493_c1 3300050514 Unclassified 2931
1248 nmdc:mga08x19_509024_c1 3300050514 Bacteria 850
1249 nmdc:mga08x19_7105_c1 3300050514 Bacteria 6647
1250 nmdc:mga0a205_108212_c1 3300050515 Bacteria 2678
1251 nmdc:mga0a205_145716_c2 3300050515 Unclassified 1558
1252 nmdc:mga0a205_16200_c2 3300050515 Bacteria 3495
1253 nmdc:mga0a205_34944_c1 3300050515 Bacteria 4826
1254 nmdc:mga0a205_388828_c1 3300050515 Bacteria 1259
1255 Ga0495601_0250938 3300053077 Bacteria 1155
1256 Ga0495612_0014657 3300053078 Bacteria 3149
1257 Ga0495612_0030486 3300053078 Unclassified 2172
1258 Ga0495612_0225927 3300053078 Bacteria 829
1259 Ga0495612_0359188 3300053078 Unclassified 658
1260 Ga0495595_0030251 3300053084 Bacteria 2427
1261 Ga0495595_0073577 3300053084 Unclassified 1618
1262 Ga0495619_0105815 3300053085 Bacteria 1918
1263 Ga0495619_0419371 3300053085 Unclassified 923
1264 Ga0500566_0060298 3300053094 Bacteria 2149
1265 Ga0501084_0000702 3300054114 Bacteria 25637
1266 Ga0501084_0004889 3300054114 Bacteria 10948
1267 Ga0501084_0015097 3300054114 Bacteria 6406
1268 Ga0501084_0053524 3300054114 Unclassified 3376
1269 Ga0501084_0058015 3300054114 Bacteria 3239
1270 Ga0501084_0099065 3300054114 Bacteria 2447
1271 Ga0501084_0122327 3300054114 Bacteria 2188
1272 Ga0501084_0207121 3300054114 Bacteria 1655
1273 Ga0501084_0688380 3300054114 Unclassified 862
1274 Ga0501082_0008395 3300060353 Bacteria 8909
1275 Ga0501082_0028610 3300060353 Bacteria 4800
1276 Ga0501082_0046862 3300060353 Bacteria 3725
1277 Ga0501082_0097199 3300060353 Bacteria 2545
1278 Ga0501082_0524538 3300060353 Bacteria 1035
1279 Ga0466962_0007956 3300061719 Bacteria 5085
1280 Ga0466962_0069637 3300061719 Bacteria 1680
1281 Ga0466962_0130698 3300061719 Unclassified 1213
1282 Ga0530510_0013522 3300061734 Bacteria 5740
1283 Ga0530510_0022536 3300061734 Bacteria 4487
1284 Ga0530510_0029037 3300061734 Bacteria 3968
1285 Ga0530510_0029848 3300061734 Bacteria 3914
1286 Ga0530510_0038507 3300061734 Bacteria 3452
1287 Ga0530510_0052654 3300061734 Bacteria 2941
1288 Ga0530510_0069822 3300061734 Bacteria 2549
1289 Ga0530510_0187655 3300061734 Bacteria 1534
1290 Ga0530510_0548071 3300061734 Unclassified 878
1291 Ga0530510_0628636 3300061734 Unclassified 817
1292 Ga0081539_10001616
1293 ARCol0yngRDRAFT_1002541
1294 JGI24739J22299_10101662
1295 JGI24738J21930_10005089
1296 JGI24738J21930_10025082
1297 JGI24744J21845_10017313
1298 JGI24751J29686_10022821
1299 JGI25406J46586_10006140
1300 Ga0070658_10113960
1301 Ga0070658_10487048
1302 Ga0070676_10114811
1303 Ga0070676_10323917
1304 Ga0070676_10329435
1305 Ga0070676_10535659
1306 Ga0070683_100018764
1307 Ga0070683_100069514
1308 Ga0070683_100082124
1309 Ga0070683_100105664
1310 Ga0070683_100335551
1311 Ga0070683_100416469
1312 Ga0070670_100004543
1313 Ga0070670_100034091
1314 Ga0070670_100490662
1315 Ga0068869_100015969
1316 Ga0068869_100238926
1317 Ga0070680_100033643
1318 Ga0070680_100443039
1319 Ga0070682_100042952
1320 Ga0070682_100119707
1321 Ga0070682_100140523
1322 Ga0070682_100149332
1323 Ga0068868_100043680
1324 Ga0068868_100132068
1325 Ga0068868_100132198
1326 Ga0070660_100034044
1327 Ga0070660_100246580
1328 Ga0070660_100281925
1329 Ga0070689_100044907
1330 Ga0070689_100048469
1331 Ga0070689_100444022
1332 Ga0070691_10019191
1333 Ga0070687_100049733
1334 Ga0070687_100178613
1335 Ga0070687_100178641
1336 Ga0070661_100017470
1337 Ga0070692_10037617
1338 Ga0070668_100093189
1339 Ga0070668_100173350
1340 Ga0070668_100548700
1341 Ga0070675_100010518
1342 Ga0070675_100126852
1343 Ga0070675_100497599
1344 Ga0070671_100202581
1345 Ga0070671_100462717
1346 Ga0070674_100040412
1347 Ga0070674_100057115
1348 Ga0070674_100722205
1349 Ga0070673_100019420
1350 Ga0070673_101371575
1351 Ga0070688_100001975
1352 Ga0070688_100004454
1353 Ga0070659_100017887
1354 Ga0070659_100025870
1355 Ga0070659_100077766
1356 Ga0070659_100163147
1357 Ga0070667_100495325
1358 Ga0070703_10024265
1359 Ga0070714_100027716
1360 Ga0070714_100049463
1361 Ga0070714_100295824
1362 Ga0070714_100388107
1363 Ga0070713_100012774
1364 Ga0070713_100247191
1365 Ga0070710_10003995
1366 Ga0070701_10006783
1367 Ga0070701_10009983
1368 Ga0070701_10202233
1369 Ga0070711_100014388
1370 Ga0070705_100340421
1371 Ga0070700_100018768
1372 Ga0070694_100340796
1373 Ga0070708_100107748
1374 Ga0070708_100215676
1375 Ga0070663_100138149
1376 Ga0070663_100341091
1377 Ga0070663_100403567
1378 Ga0070678_100015299
1379 Ga0070678_100341461
1380 Ga0070678_100474542
1381 Ga0070678_100817816
1382 Ga0070662_100017869
1383 Ga0070681_10051804
1384 Ga0070681_10064216
1385 Ga0070681_10140840
1386 Ga0070681_10636910
1387 Ga0068867_100073459
1388 Ga0068867_100076136
1389 Ga0068867_100094387
1390 Ga0068867_100167137
1391 Ga0070685_10006668
1392 Ga0070685_10032533
1393 Ga0070706_100072551
1394 Ga0070706_100194571
1395 Ga0070706_100420989
1396 Ga0070707_100016491
1397 Ga0070707_100118521
1398 Ga0070707_100680356
1399 Ga0070698_100072056
1400 Ga0070698_100287842
1401 Ga0070699_100108632
1402 Ga0070699_100109399
1403 Ga0070679_100092712
1404 Ga0070679_100172072
1405 Ga0070679_100257999
1406 Ga0070684_100038493
1407 Ga0070684_100050708
1408 Ga0070684_100159658
1409 Ga0070684_100204611
1410 Ga0070684_100596873
1411 Ga0070697_100377873
1412 Ga0068853_100054926
1413 Ga0068853_100301265
1414 Ga0070672_100061543
1415 Ga0070672_100073107
1416 Ga0070686_100007432
1417 Ga0070686_100025506
1418 Ga0070695_100708038
1419 Ga0070696_100196057
1420 Ga0070693_100074406
1421 Ga0070693_100083896
1422 Ga0070665_100060819
1423 Ga0070665_100261216
1424 Ga0070704_100017249
1425 Ga0070704_100025822
1426 Ga0070704_100110292
1427 Ga0068855_100065525
1428 Ga0068855_100274562
1429 Ga0070664_100085800
1430 Ga0070664_100218013
1431 Ga0070664_100319856
1432 Ga0068857_100029085
1433 Ga0068857_100037704
1434 Ga0068857_100388186
1435 Ga0068854_100380570
1436 Ga0068854_100656966
1437 Ga0068856_100045687
1438 Ga0068856_100192200
1439 Ga0068856_100266853
1440 Ga0068856_100286890
1441 Ga0070702_100054829
1442 Ga0070702_100082071
1443 Ga0070702_100082889
1444 Ga0070702_100472662
1445 Ga0070702_100912878
1446 Ga0070702_100912879
1447 Ga0068852_100139786
1448 Ga0068852_100354367
1449 Ga0068859_100052901
1450 Ga0068859_100478502
1451 Ga0068859_100808742
1452 Ga0068864_100005306
1453 Ga0068864_100059765
1454 Ga0068864_100615416
1455 Ga0068861_100064128
1456 Ga0068861_100077238
1457 Ga0068861_100146734
1458 Ga0068861_100319548
1459 Ga0068851_10020397
1460 Ga0068870_10014339
1461 Ga0068870_10032260
1462 Ga0068870_10075623
1463 Ga0068870_10104220
1464 Ga0068863_100286719
1465 Ga0068863_100496427
1466 Ga0068858_100015291
1467 Ga0068860_100221639
1468 Ga0068862_101129874
1469 Ga0081455_10014370
1470 Ga0081455_10016183
1471 Ga0081455_10064674
1472 Ga0081455_10069014
1473 Ga0081455_10077991
1474 Ga0081455_10138500
1475 Ga0081455_10180734
1476 Ga0081455_10527148
1477 Ga0081538_10113182
1478 Ga0081540_1000836
1479 Ga0081540_1003929
1480 Ga0081540_1004796
1481 Ga0081539_10000384
1482 Ga0081539_10000628
1483 Ga0081539_10001582
1484 Ga0081539_10016030
1485 Ga0070717_10015446
1486 Ga0070717_10017014
1487 Ga0070717_10020582
1488 Ga0070717_10591351
1489 Ga0075365_10102482
1490 Ga0075432_10000451
1491 Ga0075432_10039012
1492 Ga0070715_10118932
1493 Ga0070716_100325404
1494 Ga0070712_100017460
1495 Ga0070712_100038637
1496 Ga0070712_100129346
1497 Ga0070712_100313037
1498 Ga0075367_10082301
1499 Ga0075367_10108217
1500 Ga0075367_10143138
1501 Ga0097621_100100422
1502 Ga0097621_100124713
1503 Ga0097621_100857561
1504 Ga0068871_100074599
1505 Ga0075428_100002662
1506 Ga0075428_100045578
1507 Ga0075428_100060163
1508 Ga0075428_100105176
1509 Ga0075428_100290714
1510 Ga0075428_100458538
1511 Ga0075430_100005830
1512 Ga0075430_100481279
1513 Ga0075431_100031224
1514 Ga0075431_100066835
1515 Ga0075431_100097238
1516 Ga0075431_100587678
1517 Ga0075431_100660683
1518 Ga0075433_10011801
1519 Ga0075433_10025219
1520 Ga0075433_10055376
1521 Ga0075433_10073112
1522 Ga0075433_10133393
1523 Ga0075433_10401009
1524 Ga0075434_100007792
1525 Ga0075434_100013062
1526 Ga0075434_100073846
1527 Ga0075434_100652988
1528 Ga0075434_101048216
1529 Ga0075434_101346026
1530 Ga0075429_100020238
1531 Ga0075429_100205184
1532 Ga0075429_100536707
1533 Ga0068865_100039721
1534 Ga0068865_100078935
1535 Ga0068865_100100359
1536 Ga0068865_100107961
1537 Ga0075436_100007890
1538 Ga0075436_100100406
1539 Ga0075436_100122837
1540 Ga0075436_100540173
1541 Ga0097620_100052902
1542 Ga0097620_100478538
1543 Ga0097620_100808641
1544 Ga0075435_100002153
1545 Ga0075435_100135562
1546 Ga0075435_100190728
1547 Ga0075435_100311182
1548 Ga0075435_100609633
1549 Ga0075435_100629896
1550 Ga0099795_10082525
1551 Ga0111539_10000648
1552 Ga0111539_10006602
1553 Ga0111539_10017044
1554 Ga0111539_10017381
1555 Ga0111539_10077795
1556 Ga0111539_10137411
1557 Ga0111539_10742524
1558 Ga0111539_10835190
1559 Ga0105245_10008337
1560 Ga0105245_10014479
1561 Ga0105245_10060451
1562 Ga0105245_10064281
1563 Ga0105245_10105422
1564 Ga0105245_10137318
1565 Ga0105245_10154023
1566 Ga0105245_10159510
1567 Ga0105245_10290145
1568 Ga0105245_10883665
1569 Ga0105245_10948562
1570 Ga0105245_11086284
1571 Ga0105247_10009263
1572 Ga0114129_10010920
1573 Ga0114129_10015646
1574 Ga0114129_10026913
1575 Ga0114129_10112533
1576 Ga0114129_10118846
1577 Ga0114129_10193430
1578 Ga0114129_10241288
1579 Ga0114129_10242682
1580 Ga0114129_10469874
1581 Ga0114129_10598704
1582 Ga0114129_10797319
1583 Ga0114129_10966079
1584 Ga0105243_10003486
1585 Ga0105243_10013359
1586 Ga0105243_10018939
1587 Ga0105243_10130683
1588 Ga0105243_10228454
1589 Ga0105243_10327796
1590 Ga0105243_11023780
1591 Ga0105243_11074723
1592 Ga0105241_10049960
1593 Ga0105241_10490524
1594 Ga0105241_10531351
1595 Ga0105242_10033827
1596 Ga0105242_10078913
1597 Ga0105242_10108648
1598 Ga0105242_10131291
1599 Ga0105242_10249965
1600 Ga0105242_10306689
1601 Ga0105248_10034045
1602 Ga0105248_10036506
1603 Ga0105248_10099570
1604 Ga0105248_10187053
1605 Ga0105248_10618997
1606 Ga0105237_10270674
1607 Ga0105238_10029324
1608 Ga0105238_10205477
1609 Ga0105238_10308915
1610 Ga0105249_10261795
1611 Ga0105249_10312752
1612 Ga0105239_10019732
1613 Ga0105239_10044517
1614 Ga0105239_10109230
1615 Ga0105239_10347875
1616 Ga0105239_10427004
1617 Ga0105239_10478105
1618 Ga0105246_10012363
1619 Ga0105246_10070423
1620 Ga0105246_10270833
1621 Ga0157342_1000339
1622 Ga0157371_10030079
1623 Ga0157371_10044248
1624 Ga0157371_10138456
1625 Ga0157371_10205330
1626 Ga0157370_10564332
1627 Ga0157369_10061751
1628 Ga0157374_10184573
1629 Ga0157374_10404233
1630 Ga0157374_10480512
1631 Ga0157374_10589129
1632 Ga0157374_10715830
1633 Ga0157378_10190006
1634 Ga0157378_10339353
1635 Ga0157378_10588279
1636 Ga0163162_10093794
1637 Ga0163162_10114762
1638 Ga0163162_10145207
1639 Ga0163162_10475046
1640 Ga0163162_10776463
1641 Ga0157372_10025354
1642 Ga0157372_10089070
1643 Ga0157372_10349735
1644 Ga0157372_10535828
1645 Ga0157372_10652701
1646 Ga0157375_10005826
1647 Ga0157375_10016816
1648 Ga0157375_10019447
1649 Ga0157375_10019925
1650 Ga0157375_10350653
1651 Ga0157375_10363322
1652 Ga0157375_10416024
1653 Ga0163163_10006950
1654 Ga0163163_10073365
1655 Ga0157380_10019322
1656 Ga0157380_10107118
1657 Ga0157380_10228161
1658 Ga0157380_10549838
1659 Ga0157380_10909590
1660 Ga0182008_10178480
1661 Ga0182008_10416042
1662 Ga0157377_10098925
1663 Ga0157377_10128337
1664 Ga0157377_10130490
1665 Ga0157377_10336204
1666 Ga0157379_10019500
1667 Ga0157379_10074880
1668 Ga0157376_10019387
1669 Ga0157376_10408794
1670 Ga0157376_10463848
1671 Ga0157376_11047185
1672 Ga0163161_10310170
1673 Ga0207656_10101209
1674 Ga0207653_10027253
1675 Ga0207692_10006275
1676 Ga0207642_10046227
1677 Ga0207710_10059299
1678 Ga0207688_10027230
1679 Ga0207688_10118318
1680 Ga0207685_10085510
1681 Ga0207685_10201509
1682 Ga0207645_10035355
1683 Ga0207645_10086393
1684 Ga0207645_10223646
1685 Ga0207645_10350339
1686 Ga0207643_10008192
1687 Ga0207643_10015090
1688 Ga0207643_10023159
1689 Ga0207643_10050041
1690 Ga0207705_10026955
1691 Ga0207705_10039928
1692 Ga0207684_10046071
1693 Ga0207684_10081328
1694 Ga0207684_10138737
1695 Ga0207654_10216829
1696 Ga0207654_10304306
1697 Ga0207707_10029897
1698 Ga0207707_10099707
1699 Ga0207707_10231887
1700 Ga0207707_10309941
1701 Ga0207671_10072984
1702 Ga0207693_10008061
1703 Ga0207693_10197025
1704 Ga0207693_10313509
1705 Ga0207663_10044860
1706 Ga0207663_10093589
1707 Ga0207663_10319027
1708 Ga0207660_10147728
1709 Ga0207662_10073086
1710 Ga0207662_10126843
1711 Ga0207662_10136653
1712 Ga0207657_10001701
1713 Ga0207657_10006124
1714 Ga0207657_10061045
1715 Ga0207657_10166020
1716 Ga0207657_10241264
1717 Ga0207652_10066652
1718 Ga0207652_10203811
1719 Ga0207652_10311346
1720 Ga0207652_10933616
1721 Ga0207646_10002167
1722 Ga0207646_10003470
1723 Ga0207646_10055886
1724 Ga0207681_10157171
1725 Ga0207694_10190517
1726 Ga0207650_10008340
1727 Ga0207650_10011261
1728 Ga0207650_10068042
1729 Ga0207650_10758832
1730 Ga0207659_10484627
1731 Ga0207659_10503754
1732 Ga0207659_10726370
1733 Ga0207687_10059611
1734 Ga0207687_10064056
1735 Ga0207687_10065731
1736 Ga0207687_10065989
1737 Ga0207687_10088142
1738 Ga0207687_10186382
1739 Ga0207687_10188254
1740 Ga0207687_10255500
1741 Ga0207687_10329168
1742 Ga0207687_10379377
1743 Ga0207687_10379477
1744 Ga0207700_10038568
1745 Ga0207700_10109917
1746 Ga0207700_11019136
1747 Ga0207664_10002961
1748 Ga0207664_10077315
1749 Ga0207664_10082933
1750 Ga0207664_10198515
1751 Ga0207690_10035490
1752 Ga0207690_10038048
1753 Ga0207690_10050027
1754 Ga0207690_10380855
1755 Ga0207706_10022030
1756 Ga0207706_10023062
1757 Ga0207686_10047809
1758 Ga0207686_10214585
1759 Ga0207686_10253188
1760 Ga0207709_10025774
1761 Ga0207709_10031964
1762 Ga0207709_10068072
1763 Ga0207709_10327560
1764 Ga0207709_10486392
1765 Ga0207670_10312958
1766 Ga0207670_10983928
1767 Ga0207669_10038646
1768 Ga0207669_10068295
1769 Ga0207669_10292243
1770 Ga0207669_10377648
1771 Ga0207669_10553630
1772 Ga0207669_10781956
1773 Ga0207704_10031119
1774 Ga0207704_10104254
1775 Ga0207704_10158777
1776 Ga0207704_10170843
1777 Ga0207665_10096583
1778 Ga0207665_10103896
1779 Ga0207691_10017223
1780 Ga0207691_10066629
1781 Ga0207691_10071953
1782 Ga0207691_10147365
1783 Ga0207711_10074783
1784 Ga0207711_10153267
1785 Ga0207711_10347714
1786 Ga0207689_10029379
1787 Ga0207689_10077920
1788 Ga0207689_10198773
1789 Ga0207689_10209599
1790 Ga0207689_10252971
1791 Ga0207661_10009366
1792 Ga0207661_10037723
1793 Ga0207661_10047233
1794 Ga0207661_10096678
1795 Ga0207661_10426104
1796 Ga0207679_10164832
1797 Ga0207679_10406812
1798 Ga0207679_10535692
1799 Ga0207679_10661950
1800 Ga0207667_10163266
1801 Ga0207667_10538042
1802 Ga0207651_10071703
1803 Ga0207651_10315326
1804 Ga0207712_10044556
1805 Ga0207712_10243644
1806 Ga0207668_10089584
1807 Ga0207640_10091516
1808 Ga0207640_10558352
1809 Ga0207677_10118393
1810 Ga0207677_10209929
1811 Ga0207639_10537227
1812 Ga0207678_10019076
1813 Ga0207678_10443644
1814 Ga0207678_10590033
1815 Ga0207708_10031024
1816 Ga0207708_10045488
1817 Ga0207708_10067625
1818 Ga0207702_10184280
1819 Ga0207702_10568565
1820 Ga0207702_10667678
1821 Ga0207702_10731524
1822 Ga0207702_10853763
1823 Ga0207648_10035716
1824 Ga0207648_10047888
1825 Ga0207648_10054938
1826 Ga0207648_10114006
1827 Ga0207648_10120230
1828 Ga0207648_10145648
1829 Ga0207676_10230746
1830 Ga0207674_10002446
1831 Ga0207674_10037403
1832 Ga0207674_10041632
1833 Ga0207674_10197456
1834 Ga0207674_10224959
1835 Ga0207675_100016689
1836 Ga0207675_100055972
1837 Ga0207675_100074084
1838 Ga0207675_100203231
1839 Ga0207675_100531846
1840 Ga0207683_10021406
1841 Ga0207683_10022545
1842 Ga0207683_10308139
1843 Ga0207683_10355740
1844 Ga0207683_10523372
1845 Ga0207698_10076789
1846 Ga0207698_10378332
1847 Ga0207698_11579302
1848 Ga0209998_10009112
1849 Ga0207428_10000437
1850 Ga0207428_10003178
1851 Ga0207428_10025873
1852 Ga0207428_10026500
1853 Ga0207428_10034437
1854 Ga0207428_10044804
1855 Ga0207428_10062885
1856 Ga0207428_10093819
1857 Ga0207428_10139511
1858 Ga0268266_10240882
1859 Ga0268266_10352425
1860 Ga0268266_10380024
1861 Ga0268265_10238936
1862 Ga0268265_10282590
1863 Ga0268264_10026271
1864 Ga0268264_10627874
1865 Ga0307408_100028335
1866 Ga0307408_100289507
1867 Ga0307408_100768375
1868 Ga0307408_101201331
1869 Ga0307410_10327576
1870 Ga0307412_10360909
1871 Ga0307409_100066045
1872 Ga0307414_10189948
1873 Ga0307411_10288532
1874 Ga0307415_100000192
1875 Ga0373958_0017671
1876 Ga0373959_0078585
1877 Ga0373938_0028856
1878 Ga0373926_0000871
1879 Ga0373940_0148419
1880 Ga0373936_0066249
1881 Ga0373939_0097767
1882 Ga0373941_0013589
1883 Ga0373941_0070133
1884 Ga0373945_0004395
1885 Ga0373945_0149132
1886 Ga0373953_0051980
1887 Ga0373960_0074930
1888 Ga0373943_0000490
1889 Ga0373943_0179529
1890 Ga0373946_0047013
1891 Ga0373961_0103035
1892 Ga0373931_0097005
1893 Ga0373931_0104052
1894 Ga0373931_0380522
1895 Ga0373935_0298313
1896 Ga0373927_0300470
1897 Ga0373933_0069826
1898 Ga0373947_0001296
1899 Ga0373937_0300479
1900 Ga0373925_0000484
1901 Ga0395899_0001105
1902 Ga0395899_0004478
1903 Ga0395899_0005269
1904 Ga0395899_0006397
1905 Ga0395899_0035335
1906 Ga0395899_0050319
1907 Ga0395899_0078678
1908 Ga0395899_0117795
1909 Ga0395899_0281312
1910 Ga0395899_0307020
1911 Ga0395900_0002321
1912 Ga0395900_0003619
1913 Ga0395900_0004663
1914 Ga0395900_0005393
1915 Ga0395900_0013553
1916 Ga0395900_0050832
1917 Ga0395900_0054267
1918 Ga0395900_0074045
1919 Ga0395900_0110527
1920 Ga0395900_0133751
1921 Ga0395900_0154080
1922 Ga0395900_0249266
1923 Ga0395900_0273448
1924 Ga0395900_0536458
1925 Ga0395900_0847249
1926 Ga0395898_0002298
1927 Ga0395898_0004033
1928 Ga0395898_0008472
1929 Ga0395898_0015626
1930 Ga0395898_0019466
1931 Ga0395898_0030341
1932 Ga0395898_0034998
1933 Ga0395898_0045984
1934 Ga0395898_0048170
1935 Ga0395898_0192583
1936 Ga0395898_0365177
1937 Ga0395898_0411779
1938 Ga0395898_0540203
1939 Ga0395898_0704463
1940 Ga0395905_0001864
1941 Ga0395905_0003370
1942 Ga0395905_0006000
1943 Ga0395905_0009840
1944 Ga0395905_0012742
1945 Ga0395905_0036025
1946 Ga0395905_0037274
1947 Ga0395905_0037990
1948 Ga0395905_0039015
1949 Ga0395905_0083333
1950 Ga0395905_0109252
1951 Ga0395905_0181914
1952 Ga0395905_0190130
1953 Ga0395905_0234575
1954 Ga0395905_0449737
1955 Ga0395901_0003202
1956 Ga0395901_0004006
1957 Ga0395901_0004120
1958 Ga0395901_0004168
1959 Ga0395901_0007607
1960 Ga0395901_0012918
1961 Ga0395901_0020657
1962 Ga0395901_0022539
1963 Ga0395901_0036824
1964 Ga0395901_0049028
1965 Ga0395901_0082775
1966 Ga0395901_0119437
1967 Ga0395901_0150776
1968 Ga0395901_0215190
1969 Ga0395901_0217515
1970 Ga0395901_0435784
1971 Ga0395901_0671741
1972 Ga0395901_0756196
1973 Ga0395901_1117443
1974 Ga0395901_1164417
1975 Ga0395901_1275565
1976 Ga0395901_1315786
1977 Ga0439439_0000168
1978 Ga0451789_0831867
1979 Ga0451791_1920887
1980 Ga0451798_0932997
1981 Ga0451800_0381266
1982 Ga0451802_1601654
1983 Ga0451804_0674902
1984 Ga0451807_0556744
1985 Ga0451807_0677844
1986 Ga0451835_0158106
1987 Ga0451839_0329616
1988 Ga0451845_0293247
1989 Ga0451847_0784703
1990 Ga0451849_0149384
1991 Ga0451851_0781637
1992 Ga0439431_0003319
1993 Ga0439433_0006255
1994 Ga0439445_0054465
1995 Ga0439448_0002278
1996 Ga0439448_0035334
1997 Ga0439448_0052078
1998 Ga0439462_0016445
1999 Ga0450920_031964
2000 Ga0450923_003845
2001 Ga0450907_005134
2002 Ga0439446_0001028
2003 Ga0439458_0004345
2004 Ga0439434_0037562
2005 Ga0466969_0020004
2006 Ga0453683_0117574
2007 Ga0466961_0077330
2008 Ga0466961_0307584
2009 Ga0466963_0000045
2010 Ga0466963_0041098
2011 Ga0466963_0064643
2012 Ga0466963_0260097
2013 Ga0466964_0000074
2014 Ga0466964_0013974
2015 Ga0466971_0011789
2016 Ga0466971_0064302
2017 Ga0466968_0008417
2018 Ga0466968_0015989
2019 Ga0466968_0105412
2020 Ga0466957_0003753
2021 Ga0466957_0088960
2022 Ga0466959_0006407
2023 Ga0451576_0752536
2024 Ga0466958_0004688
2025 Ga0466967_0000085
2026 Ga0466967_0005337
2027 Ga0466967_0014500
2028 Ga0466967_0042350
2029 Ga0466967_0254195
2030 Ga0495592_0006827
2031 Ga0495592_0093479
2032 Ga0495603_0037612
2033 Ga0495603_0270279
2034 Ga0495629_0058848
2035 Ga0495629_0069671
2036 Ga0495629_0180481
2037 Ga0495641_0002472
2038 Ga0495641_0013150
2039 Ga0495641_0030758
2040 Ga0495641_0038579
2041 Ga0495651_0034677
2042 Ga0495651_0176707
2043 Ga0495653_0017708
2044 Ga0495653_0047653
2045 Ga0495580_0012758
2046 Ga0495582_0009080
2047 Ga0495582_0053759
2048 Ga0495582_0229057
2049 Ga0495605_0014353
2050 Ga0495639_0001471
2051 Ga0495639_0262626
2052 Ga0495662_0001052
2053 Ga0495662_0241215
2054 Ga0495664_0244778
2055 Ga0495664_0292031
2056 Ga0495584_0027488
2057 Ga0495584_0428770
2058 Ga0495585_0021155
2059 Ga0495585_0097169
2060 Ga0495594_0111326
2061 Ga0495594_0237455
2062 Ga0495594_0336162
2063 Ga0495596_0023254
2064 Ga0495596_0078477
2065 Ga0495596_0080272
2066 Ga0495596_0151932
2067 Ga0495596_0173247
2068 Ga0495607_0046332
2069 Ga0495583_0246092
2070 Ga0495608_0008332
2071 Ga0495608_0011305
2072 Ga0495608_0108761
2073 Ga0495608_0337715
2074 Ga0495618_0159990
2075 Ga0495618_0382355
2076 Ga0495628_0074619
2077 Ga0495630_0063343
2078 Ga0495630_0064450
2079 Ga0495631_0024285
2080 Ga0495637_0158376
2081 Ga0495644_0023053
2082 Ga0495644_0036891
2083 Ga0495644_0123394
2084 Ga0495663_0013836
2085 Ga0495663_0063257
2086 Ga0495666_0000168
2087 Ga0495642_0015846
2088 Ga0495652_0027449
2089 Ga0495652_0117747
2090 Ga0495665_0000038
2091 Ga0495640_0061516
2092 Ga0495640_0109551
2093 Ga0495640_0170889
2094 Ga0495586_0044768
2095 Ga0495586_0087123
2096 Ga0495587_0051345
2097 Ga0495587_0136115
2098 Ga0495609_0034973
2099 Ga0495609_0056328
2100 Ga0495609_0081141
2101 Ga0495645_0020312
2102 Ga0495645_0134585
2103 Ga0495633_0075557
2104 Ga0495656_0004926
2105 Ga0495656_0020371
2106 Ga0495656_0073680
2107 Ga0495656_0082347
2108 Ga0495668_0159375
2109 Ga0495634_0032310
2110 Ga0495634_0046482
2111 Ga0495634_0125069
2112 Ga0495611_0009038
2113 Ga0495611_0087260
2114 Ga0495635_0016870
2115 Ga0495635_0045671
2116 Ga0495659_0002908
2117 Ga0495659_0009308
2118 Ga0495659_0076923
2119 Ga0495659_0091623
2120 Ga0495588_0155332
2121 Ga0495588_0162951
2122 Ga0495657_0114026
2123 Ga0495599_0005941
2124 Ga0495599_0035792
2125 Ga0495646_0016254
2126 Ga0495646_0040322
2127 Ga0495646_0084300
2128 Ga0495647_0014147
2129 Ga0495647_0194017
2130 Ga0495647_0245049
2131 Ga0495658_0120967
2132 Ga0495658_0128567
2133 Ga0495669_0018351
2134 Ga0495613_0012499
2135 Ga0495613_0305541
2136 Ga0495624_0022102
2137 Ga0495624_0044304
2138 Ga0495624_0105896
2139 Ga0495624_0134073
2140 Ga0495589_0011190
2141 Ga0495600_0096760
2142 Ga0495660_0065583
2143 Ga0495581_0002990
2144 Ga0495581_0006726
2145 Ga0495604_0175959
2146 Ga0495674_0050204
2147 Ga0495676_0012944
2148 Ga0495676_0125215
2149 Ga0495680_0041623
2150 Ga0495680_0065347
2151 Ga0495680_0262927
2152 Ga0495677_0005967
2153 Ga0495677_0020441
2154 Ga0495677_0039234
2155 Ga0495679_077974
2156 Ga0495679_151229
2157 Ga0495673_0132476
2158 Ga0495684_0001595
2159 Ga0495684_0475614
2160 Ga0495593_0001683
2161 Ga0495602_0033921
2162 Ga0495602_0062381
2163 Ga0495602_0357648
2164 Ga0495614_0000113
2165 Ga0495626_0117746
2166 Ga0496100_0040354
2167 Ga0496100_0048695
2168 Ga0496100_0137668
2169 Ga0496100_0242380
2170 Ga0496100_0392288
2171 Ga0496100_0495068
2172 Ga0496101_0166317
2173 Ga0496101_0186014
2174 Ga0496101_0348536
2175 Ga0496102_0011804
2176 Ga0496102_0108999
2177 Ga0496102_0244267
2178 Ga0496102_0476335
2179 Ga0496102_0881774
2180 Ga0496103_0155600
2181 Ga0496103_0187989
2182 Ga0496103_0546816
2183 Ga0496104_0000796
2184 Ga0496104_0015518
2185 Ga0496104_0055323
2186 Ga0496104_0105853
2187 Ga0496104_0237597
2188 Ga0496105_0002479
2189 Ga0496105_0004890
2190 Ga0496105_0014167
2191 Ga0496105_0072063
2192 Ga0496105_0143570
2193 Ga0496105_0973287
2194 Ga0496106_0054377
2195 Ga0496106_0302959
2196 Ga0496107_0085794
2197 Ga0496107_0108861
2198 Ga0496107_0242849
2199 Ga0496107_0276050
2200 Ga0496107_0457240
2201 Ga0496107_0537404
2202 Ga0496107_0620776
2203 Ga0496108_0013267
2204 Ga0496108_0017218
2205 Ga0496108_0023902
2206 Ga0496108_0037517
2207 Ga0496108_0516857
2208 Ga0496109_0002279
2209 Ga0496109_0003664
2210 Ga0496109_0017231
2211 Ga0496109_0025028
2212 Ga0496109_0073603
2213 Ga0496109_0189427
2214 Ga0496109_0256808
2215 Ga0496109_0296581
2216 Ga0496109_0340359
2217 Ga0496109_0351964
2218 Ga0496109_0681225
2219 Ga0496110_0003721
2220 Ga0496110_0011450
2221 Ga0496110_0025824
2222 Ga0496110_0026248
2223 Ga0496110_0055798
2224 Ga0496110_0061868
2225 Ga0496110_0166595
2226 Ga0496110_0182613
2227 Ga0496110_0356964
2228 Ga0496110_0469651
2229 Ga0496111_0005145
2230 Ga0496111_0012987
2231 Ga0496111_0024923
2232 Ga0496111_0036864
2233 Ga0496111_0050839
2234 Ga0496111_0058734
2235 Ga0496111_0061451
2236 Ga0496111_0108228
2237 Ga0496111_0257099
2238 Ga0496111_0887150
2239 Ga0496112_0009544
2240 Ga0496112_0028258
2241 Ga0496112_0055404
2242 Ga0496112_0101343
2243 Ga0496112_0127573
2244 Ga0496112_0183213
2245 Ga0496112_0312290
2246 Ga0496112_0328738
2247 Ga0496112_0375135
2248 Ga0496112_0532175
2249 Ga0496112_0996578
2250 Ga0496113_0027915
2251 Ga0496113_0028180
2252 Ga0496113_0050677
2253 Ga0496113_0096668
2254 Ga0496113_0250008
2255 Ga0496113_0262144
2256 Ga0496114_0005323
2257 Ga0496114_0014999
2258 Ga0496114_0029594
2259 Ga0496114_0075226
2260 Ga0496114_0137754
2261 Ga0496114_0224911
2262 Ga0496114_0400247
2263 Ga0496114_0861432
2264 Ga0496115_0019305
2265 Ga0496115_0029074
2266 Ga0496115_0100380
2267 Ga0496115_0648755
2268 Ga0496115_0738063
2269 Ga0501031_0018283
2270 Ga0501031_0035031
2271 Ga0501031_0042296
2272 Ga0501031_0187148
2273 Ga0501031_0357122
2274 Ga0501031_0379115
2275 Ga0501032_0017415
2276 Ga0501032_0057394
2277 Ga0501032_0059129
2278 Ga0501032_0696749
2279 Ga0501033_0033324
2280 Ga0501033_0063914
2281 Ga0501033_0128523
2282 Ga0501033_0160272
2283 Ga0501034_0241020
2284 Ga0501034_0426389
2285 Ga0501036_0007462
2286 Ga0501036_0012198
2287 Ga0501036_0018707
2288 Ga0501036_0040352
2289 Ga0501036_0095912
2290 Ga0501036_0141522
2291 Ga0501036_0178641
2292 Ga0501036_0627690
2293 Ga0501037_0007291
2294 Ga0501037_0175286
2295 Ga0501037_0289727
2296 Ga0501037_0299508
2297 Ga0501037_0342775
2298 Ga0501037_0455887
2299 Ga0501038_0034894
2300 Ga0501038_0039536
2301 Ga0501038_0039616
2302 Ga0501038_0159160
2303 Ga0501038_0402683
2304 Ga0501038_0475108
2305 Ga0501038_0713714
2306 Ga0501039_0009095
2307 Ga0501039_0009928
2308 Ga0501039_0016770
2309 Ga0501039_0021738
2310 Ga0501039_0343500
2311 Ga0501039_0387720
2312 Ga0501039_0485459
2313 Ga0501039_0576329
2314 Ga0501040_0002593
2315 Ga0501040_0018564
2316 Ga0501040_0028374
2317 Ga0501040_0041491
2318 Ga0501040_0045154
2319 Ga0501040_0152107
2320 Ga0501040_0269586
2321 Ga0501040_0315898
2322 Ga0501040_0358307
2323 Ga0501041_0007274
2324 Ga0501041_0012870
2325 Ga0501041_0028611
2326 Ga0501041_0046929
2327 Ga0501041_0072387
2328 Ga0501041_0118236
2329 Ga0501041_0119709
2330 Ga0501041_0273289
2331 Ga0501041_0476377
2332 Ga0501042_0004401
2333 Ga0501042_0061438
2334 Ga0501042_0076005
2335 Ga0501042_0084004
2336 Ga0501042_0095116
2337 Ga0501042_0199933
2338 Ga0501042_0800539
2339 Ga0501043_0017112
2340 Ga0501043_0111447
2341 Ga0501043_0127343
2342 Ga0501043_0222958
2343 Ga0501046_0002178
2344 Ga0501046_0012656
2345 Ga0501046_0027500
2346 Ga0501046_0073092
2347 Ga0501046_0080985
2348 Ga0501047_0046233
2349 Ga0501048_0028695
2350 Ga0501048_0030829
2351 Ga0501048_0056720
2352 Ga0501048_0063481
2353 Ga0501048_0165342
2354 Ga0501048_0833981
2355 Ga0501067_0007990
2356 Ga0501067_0028914
2357 Ga0501067_0118208
2358 Ga0501067_0118402
2359 Ga0501067_0140764
2360 Ga0501068_0003747
2361 Ga0501068_0007558
2362 Ga0501068_0008746
2363 Ga0501068_0035139
2364 Ga0501068_0041057
2365 Ga0501068_0255294
2366 Ga0501068_0508359
2367 Ga0501069_0000968
2368 Ga0501069_0015555
2369 Ga0501069_0016217
2370 Ga0501069_0028350
2371 Ga0501069_0053876
2372 Ga0501069_0069932
2373 Ga0501070_0002450
2374 Ga0501070_0074032
2375 Ga0501070_0080974
2376 Ga0501070_0089238
2377 Ga0501070_0175751
2378 Ga0501070_0742260
2379 Ga0501071_0001822
2380 Ga0501071_0003354
2381 Ga0501071_0006541
2382 Ga0501071_0011840
2383 Ga0501071_0048676
2384 Ga0501071_0073754
2385 Ga0501071_0172275
2386 Ga0501071_0227235
2387 Ga0501071_0275830
2388 Ga0501071_0281216
2389 Ga0501071_0304897
2390 Ga0501071_0427304
2391 Ga0501071_0924042
2392 Ga0501072_0008618
2393 Ga0501072_0013405
2394 Ga0501072_0022455
2395 Ga0501072_0029064
2396 Ga0501072_0054949
2397 Ga0501072_0073731
2398 Ga0501072_0075660
2399 Ga0501072_0153749
2400 Ga0501072_0213739
2401 Ga0501072_0259620
2402 Ga0501073_0003805
2403 Ga0501073_0043484
2404 Ga0501074_0001334
2405 Ga0501074_0023942
2406 Ga0501074_0032573
2407 Ga0501074_0050916
2408 Ga0501074_0127027
2409 Ga0501074_0213677
2410 Ga0501074_0274828
2411 Ga0501075_0014061
2412 Ga0501075_0030416
2413 Ga0501075_0031563
2414 Ga0501075_0031655
2415 Ga0501075_0106004
2416 Ga0501075_0168536
2417 Ga0501075_0169271
2418 Ga0501075_0303363
2419 Ga0501075_0314927
2420 Ga0501076_0001883
2421 Ga0501076_0004930
2422 Ga0501076_0014766
2423 Ga0501076_0024867
2424 Ga0501076_0030603
2425 Ga0501076_0031075
2426 Ga0501076_0049285
2427 Ga0501076_0330005
2428 Ga0501076_0360689
2429 Ga0501076_0591820
2430 Ga0501077_0011665
2431 Ga0501077_0019049
2432 Ga0501077_0020984
2433 Ga0501077_0022898
2434 Ga0501077_0033852
2435 Ga0501077_0049117
2436 Ga0501077_0212765
2437 Ga0501077_0218055
2438 Ga0501077_0636810
2439 Ga0501079_0004568
2440 Ga0501079_0007431
2441 Ga0501079_0011783
2442 Ga0501079_0031637
2443 Ga0501079_0089736
2444 Ga0501079_0102494
2445 Ga0501079_0166093
2446 Ga0501079_0178441
2447 Ga0501079_0186151
2448 Ga0501079_0256442
2449 Ga0501079_0607452
2450 Ga0501080_0003932
2451 Ga0501080_0026594
2452 Ga0501080_0035680
2453 Ga0501080_0138230
2454 Ga0501080_0205385
2455 Ga0501080_0215163
2456 Ga0501080_0237799
2457 Ga0501080_0609863
2458 Ga0501081_0004593
2459 Ga0501081_0012409
2460 Ga0501081_0013193
2461 Ga0501081_0030588
2462 Ga0501081_0129607
2463 Ga0501081_0133495
2464 Ga0501081_0171740
2465 Ga0501081_0199485
2466 Ga0501081_0491569
2467 Ga0501081_0519755
2468 Ga0501083_0031235
2469 Ga0501083_0091182
2470 Ga0501083_0196210
2471 Ga0501083_0368241
2472 Ga0501083_0601399
2473 Ga0501035_0004561
2474 Ga0501035_0040200
2475 Ga0501035_0064632
2476 Ga0501035_0251491
2477 Ga0501035_0289560
2478 Ga0501035_1063158
2479 Ga0501044_0029988
2480 Ga0501044_0098704
2481 Ga0501044_0224412
2482 Ga0501044_0246877
2483 Ga0501044_0520460
2484 Ga0501045_0017589
2485 Ga0501045_0021351
2486 Ga0501045_0031191
2487 Ga0501045_0038060
2488 Ga0501045_0047388
2489 Ga0501045_0070913
2490 Ga0501045_0081791
2491 Ga0501045_0535239
2492 nmdc:mga0yw44_241822_c1
2493 nmdc:mga06z11_68021_c1
2494 nmdc:mga05p37_10748_c1
2495 nmdc:mga05p37_1190645_c1
2496 nmdc:mga05p37_144056_c1
2497 nmdc:mga05p37_15198_c1
2498 nmdc:mga05p37_204218_c1
2499 nmdc:mga05p37_328080_c1
2500 nmdc:mga05p37_51818_c1
2501 nmdc:mga05p37_556335_c1
2502 nmdc:mga05p37_79479_c1
2503 nmdc:mga05p37_96370_c1
2504 nmdc:mga05p37_96568_c1
2505 nmdc:mga09592_129799_c1
2506 nmdc:mga09592_146226_c1
2507 nmdc:mga09592_61944_c1
2508 nmdc:mga09592_648919_c1
2509 nmdc:mga0qj67_190955_c1
2510 nmdc:mga06r32_108753_c1
2511 nmdc:mga06r32_56625_c1
2512 nmdc:mga06r32_663616_c1
2513 nmdc:mga08y16_1224188_c1
2514 nmdc:mga08y16_23953_c1
2515 nmdc:mga08y16_314437_c1
2516 nmdc:mga08y16_402098_c1
2517 nmdc:mga08y16_406548_c1
2518 nmdc:mga08y16_51762_c1
2519 nmdc:mga08y16_55749_c1
2520 nmdc:mga08y16_948234_c1
2521 nmdc:mga08y16_9589_c1
2522 nmdc:mga08y16_9855_c1
2523 nmdc:mga0n895_1343907_c1
2524 nmdc:mga0n895_198815_c1
2525 nmdc:mga0n895_227061_c1
2526 nmdc:mga0n895_2841_c1
2527 nmdc:mga0n895_380147_c1
2528 nmdc:mga0n895_624106_c1
2529 nmdc:mga0n895_820070_c1
2530 nmdc:mga0rr50_1093779_c1
2531 nmdc:mga0rr50_114286_c1
2532 nmdc:mga0rr50_153156_c1
2533 nmdc:mga0rr50_425948_c1
2534 nmdc:mga0rr50_64909_c1
2535 nmdc:mga0rr50_9123_c1
2536 nmdc:mga08x19_101458_c1
2537 nmdc:mga08x19_337176_c1
2538 nmdc:mga08x19_41493_c1
2539 nmdc:mga08x19_509024_c1
2540 nmdc:mga08x19_7105_c1
2541 nmdc:mga0a205_108212_c1
2542 nmdc:mga0a205_145716_c2
2543 nmdc:mga0a205_16200_c2
2544 nmdc:mga0a205_34944_c1
2545 nmdc:mga0a205_388828_c1
2546 Ga0495601_0250938
2547 Ga0495612_0014657
2548 Ga0495612_0030486
2549 Ga0495612_0225927
2550 Ga0495612_0359188
2551 Ga0495595_0030251
2552 Ga0495595_0073577
2553 Ga0495619_0105815
2554 Ga0495619_0419371
2555 Ga0500566_0060298
2556 Ga0501084_0000702
2557 Ga0501084_0004889
2558 Ga0501084_0015097
2559 Ga0501084_0053524
2560 Ga0501084_0058015
2561 Ga0501084_0099065
2562 Ga0501084_0122327
2563 Ga0501084_0207121
2564 Ga0501084_0688380
2565 Ga0501082_0008395
2566 Ga0501082_0028610
2567 Ga0501082_0046862
2568 Ga0501082_0097199
2569 Ga0501082_0524538
2570 Ga0466962_0007956
2571 Ga0466962_0069637
2572 Ga0466962_0130698
2573 Ga0530510_0013522
2574 Ga0530510_0022536
2575 Ga0530510_0029037
2576 Ga0530510_0029848
2577 Ga0530510_0038507
2578 Ga0530510_0052654
2579 Ga0530510_0069822
2580 Ga0530510_0187655
2581 Ga0530510_0548071
2582 Ga0530510_0628636

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

66

209

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.8478 41 214
8iig-assembly1.cif.gz_A complex form of msmudgx h109a mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by udgx h109a 0.8134 58 213
8iiq-assembly1.cif.gz_A msmudgx h109s/e52n double mutant 0.8129 56 214
8iij-assembly1.cif.gz_A h109g mutant of uracil dna glycosylase x 0.812 54 214
8iir-assembly1.cif.gz_A msmudgx h109s/q53a double mutant 0.8119 56 213
ID Description Score Start End Superfamily
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8477 41 214 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8025 41 216 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7701 41 214 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7372 41 216 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7037 36 213 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7V8XIA1-F1-model_v4 Uracil-DNA glycosylase 0.9918 76 216 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7V8XIA1-F1-model_v4 Uracil-DNA glycosylase 0.9848 76 216 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7W0PTT7-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9821 130 216
AF-A0A7W0Z0J1-F1-model_v4 Uracil-DNA glycosylase 0.9778 25 216 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7W0Z0J1-F1-model_v4 Uracil-DNA glycosylase 0.9678 25 216 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map