F492636
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1291 | 396 | 2582 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10001616|Ga0081539_100016169 |
| Length | 221 |
| Sequence | VGRPGARAPQGSRVGGGAARPEYPKRPLTVPVDDISERYLKKAIAEINELGREITQAAGQEAAPVLGSGHPLGDIFLLKYGPQDAEQHEGVAFFGRAGQAILKSLQRLHVDPTAIYGTNCLKFAGADEEQAHAWLARELHIVQPKLIVIMGQDALACLNALRFPLAAEVASEPGTLQRFTPTIDALVAPDLDASLDDSAAKRDFWDAFKAIGPWWSELPPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 233 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 234 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 235 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 236 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 237 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 240 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 241 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 242 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 243 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 244 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 245 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 251 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 255 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 396 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 8.6 |
| Rhizosphere | 90.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081539_10001616 | 3300005985 | Bacteria | 36968 |
| 2 | ARCol0yngRDRAFT_1002541 | 3300000652 | Unclassified | 1369 |
| 3 | JGI24739J22299_10101662 | 3300001989 | Bacteria | 867 |
| 4 | JGI24738J21930_10005089 | 3300002075 | Bacteria | 3177 |
| 5 | JGI24738J21930_10025082 | 3300002075 | Bacteria | 1226 |
| 6 | JGI24744J21845_10017313 | 3300002077 | Bacteria | 1432 |
| 7 | JGI24751J29686_10022821 | 3300002459 | Archaea | 1297 |
| 8 | JGI25406J46586_10006140 | 3300003203 | Bacteria | 5549 |
| 9 | Ga0070658_10113960 | 3300005327 | Bacteria | 2242 |
| 10 | Ga0070658_10487048 | 3300005327 | Bacteria | 1064 |
| 11 | Ga0070676_10114811 | 3300005328 | Unclassified | 1682 |
| 12 | Ga0070676_10323917 | 3300005328 | Unclassified | 1052 |
| 13 | Ga0070676_10329435 | 3300005328 | Bacteria | 1044 |
| 14 | Ga0070676_10535659 | 3300005328 | Bacteria | 836 |
| 15 | Ga0070683_100018764 | 3300005329 | Bacteria | 6131 |
| 16 | Ga0070683_100069514 | 3300005329 | Bacteria | 3283 |
| 17 | Ga0070683_100082124 | 3300005329 | Bacteria | 3018 |
| 18 | Ga0070683_100105664 | 3300005329 | Unclassified | 2654 |
| 19 | Ga0070683_100335551 | 3300005329 | Bacteria | 1439 |
| 20 | Ga0070683_100416469 | 3300005329 | Bacteria | 1281 |
| 21 | Ga0070670_100004543 | 3300005331 | Bacteria | 11634 |
| 22 | Ga0070670_100034091 | 3300005331 | Bacteria | 4382 |
| 23 | Ga0070670_100490662 | 3300005331 | Bacteria | 1091 |
| 24 | Ga0068869_100015969 | 3300005334 | Bacteria | 5053 |
| 25 | Ga0068869_100238926 | 3300005334 | Unclassified | 1447 |
| 26 | Ga0070680_100033643 | 3300005336 | Bacteria | 4133 |
| 27 | Ga0070680_100443039 | 3300005336 | Bacteria | 1109 |
| 28 | Ga0070682_100042952 | 3300005337 | Bacteria | 2793 |
| 29 | Ga0070682_100119707 | 3300005337 | Unclassified | 1766 |
| 30 | Ga0070682_100140523 | 3300005337 | Unclassified | 1645 |
| 31 | Ga0070682_100149332 | 3300005337 | Bacteria | 1602 |
| 32 | Ga0068868_100043680 | 3300005338 | Bacteria | 3501 |
| 33 | Ga0068868_100132068 | 3300005338 | Bacteria | 2044 |
| 34 | Ga0068868_100132198 | 3300005338 | Unclassified | 2043 |
| 35 | Ga0070660_100034044 | 3300005339 | Bacteria | 3846 |
| 36 | Ga0070660_100246580 | 3300005339 | Bacteria | 1456 |
| 37 | Ga0070660_100281925 | 3300005339 | Bacteria | 1360 |
| 38 | Ga0070689_100044907 | 3300005340 | Bacteria | 3400 |
| 39 | Ga0070689_100048469 | 3300005340 | Bacteria | 3276 |
| 40 | Ga0070689_100444022 | 3300005340 | Bacteria | 1103 |
| 41 | Ga0070691_10019191 | 3300005341 | Bacteria | 3153 |
| 42 | Ga0070687_100049733 | 3300005343 | Bacteria | 2162 |
| 43 | Ga0070687_100178613 | 3300005343 | Archaea | 1270 |
| 44 | Ga0070687_100178641 | 3300005343 | Bacteria | 1270 |
| 45 | Ga0070661_100017470 | 3300005344 | Bacteria | 5090 |
| 46 | Ga0070692_10037617 | 3300005345 | Bacteria | 2461 |
| 47 | Ga0070668_100093189 | 3300005347 | Unclassified | 2377 |
| 48 | Ga0070668_100173350 | 3300005347 | Unclassified | 1757 |
| 49 | Ga0070668_100548700 | 3300005347 | Bacteria | 1006 |
| 50 | Ga0070675_100010518 | 3300005354 | Bacteria | 7226 |
| 51 | Ga0070675_100126852 | 3300005354 | Unclassified | 2171 |
| 52 | Ga0070675_100497599 | 3300005354 | Unclassified | 1098 |
| 53 | Ga0070671_100202581 | 3300005355 | Bacteria | 1683 |
| 54 | Ga0070671_100462717 | 3300005355 | Unclassified | 1089 |
| 55 | Ga0070674_100040412 | 3300005356 | Unclassified | 3155 |
| 56 | Ga0070674_100057115 | 3300005356 | Bacteria | 2708 |
| 57 | Ga0070674_100722205 | 3300005356 | Unclassified | 853 |
| 58 | Ga0070673_100019420 | 3300005364 | Bacteria | 4877 |
| 59 | Ga0070673_101371575 | 3300005364 | Bacteria | 665 |
| 60 | Ga0070688_100001975 | 3300005365 | Bacteria | 10319 |
| 61 | Ga0070688_100004454 | 3300005365 | Bacteria | 7293 |
| 62 | Ga0070659_100017887 | 3300005366 | Bacteria | 5340 |
| 63 | Ga0070659_100025870 | 3300005366 | Unclassified | 4513 |
| 64 | Ga0070659_100077766 | 3300005366 | Bacteria | 2647 |
| 65 | Ga0070659_100163147 | 3300005366 | Bacteria | 1823 |
| 66 | Ga0070667_100495325 | 3300005367 | Bacteria | 1120 |
| 67 | Ga0070703_10024265 | 3300005406 | Unclassified | 1791 |
| 68 | Ga0070714_100027716 | 3300005435 | Bacteria | 4693 |
| 69 | Ga0070714_100049463 | 3300005435 | Bacteria | 3578 |
| 70 | Ga0070714_100295824 | 3300005435 | Bacteria | 1508 |
| 71 | Ga0070714_100388107 | 3300005435 | Bacteria | 1317 |
| 72 | Ga0070713_100012774 | 3300005436 | Bacteria | 6172 |
| 73 | Ga0070713_100247191 | 3300005436 | Bacteria | 1626 |
| 74 | Ga0070710_10003995 | 3300005437 | Bacteria | 6992 |
| 75 | Ga0070701_10006783 | 3300005438 | Bacteria | 4841 |
| 76 | Ga0070701_10009983 | 3300005438 | Bacteria | 4182 |
| 77 | Ga0070701_10202233 | 3300005438 | Bacteria | 1175 |
| 78 | Ga0070711_100014388 | 3300005439 | Bacteria | 4986 |
| 79 | Ga0070705_100340421 | 3300005440 | Bacteria | 1090 |
| 80 | Ga0070700_100018768 | 3300005441 | Bacteria | 3981 |
| 81 | Ga0070694_100340796 | 3300005444 | Bacteria | 1159 |
| 82 | Ga0070708_100107748 | 3300005445 | Bacteria | 2558 |
| 83 | Ga0070708_100215676 | 3300005445 | Bacteria | 1799 |
| 84 | Ga0070663_100138149 | 3300005455 | Bacteria | 1858 |
| 85 | Ga0070663_100341091 | 3300005455 | Bacteria | 1211 |
| 86 | Ga0070663_100403567 | 3300005455 | Bacteria | 1118 |
| 87 | Ga0070678_100015299 | 3300005456 | Bacteria | 4872 |
| 88 | Ga0070678_100341461 | 3300005456 | Bacteria | 1285 |
| 89 | Ga0070678_100474542 | 3300005456 | Unclassified | 1100 |
| 90 | Ga0070678_100817816 | 3300005456 | Unclassified | 847 |
| 91 | Ga0070662_100017869 | 3300005457 | Bacteria | 4787 |
| 92 | Ga0070681_10051804 | 3300005458 | Bacteria | 4093 |
| 93 | Ga0070681_10064216 | 3300005458 | Bacteria | 3643 |
| 94 | Ga0070681_10140840 | 3300005458 | Unclassified | 2341 |
| 95 | Ga0070681_10636910 | 3300005458 | Bacteria | 981 |
| 96 | Ga0068867_100073459 | 3300005459 | Unclassified | 2561 |
| 97 | Ga0068867_100076136 | 3300005459 | Bacteria | 2519 |
| 98 | Ga0068867_100094387 | 3300005459 | Bacteria | 2275 |
| 99 | Ga0068867_100167137 | 3300005459 | Unclassified | 1739 |
| 100 | Ga0070685_10006668 | 3300005466 | Bacteria | 5896 |
| 101 | Ga0070685_10032533 | 3300005466 | Bacteria | 2921 |
| 102 | Ga0070706_100072551 | 3300005467 | Unclassified | 3186 |
| 103 | Ga0070706_100194571 | 3300005467 | Unclassified | 1894 |
| 104 | Ga0070706_100420989 | 3300005467 | Bacteria | 1243 |
| 105 | Ga0070707_100016491 | 3300005468 | Bacteria | 6932 |
| 106 | Ga0070707_100118521 | 3300005468 | Bacteria | 2570 |
| 107 | Ga0070707_100680356 | 3300005468 | Unclassified | 992 |
| 108 | Ga0070698_100072056 | 3300005471 | Unclassified | 3463 |
| 109 | Ga0070698_100287842 | 3300005471 | Bacteria | 1574 |
| 110 | Ga0070699_100108632 | 3300005518 | Bacteria | 2435 |
| 111 | Ga0070699_100109399 | 3300005518 | Bacteria | 2425 |
| 112 | Ga0070679_100092712 | 3300005530 | Unclassified | 3007 |
| 113 | Ga0070679_100172072 | 3300005530 | Bacteria | 2138 |
| 114 | Ga0070679_100257999 | 3300005530 | Bacteria | 1698 |
| 115 | Ga0070684_100038493 | 3300005535 | Bacteria | 4108 |
| 116 | Ga0070684_100050708 | 3300005535 | Bacteria | 3605 |
| 117 | Ga0070684_100159658 | 3300005535 | Bacteria | 2045 |
| 118 | Ga0070684_100204611 | 3300005535 | Bacteria | 1798 |
| 119 | Ga0070684_100596873 | 3300005535 | Bacteria | 1026 |
| 120 | Ga0070697_100377873 | 3300005536 | Bacteria | 1227 |
| 121 | Ga0068853_100054926 | 3300005539 | Bacteria | 3432 |
| 122 | Ga0068853_100301265 | 3300005539 | Unclassified | 1482 |
| 123 | Ga0070672_100061543 | 3300005543 | Bacteria | 2959 |
| 124 | Ga0070672_100073107 | 3300005543 | Unclassified | 2732 |
| 125 | Ga0070686_100007432 | 3300005544 | Bacteria | 6114 |
| 126 | Ga0070686_100025506 | 3300005544 | Bacteria | 3558 |
| 127 | Ga0070695_100708038 | 3300005545 | Bacteria | 800 |
| 128 | Ga0070696_100196057 | 3300005546 | Bacteria | 1505 |
| 129 | Ga0070693_100074406 | 3300005547 | Bacteria | 2009 |
| 130 | Ga0070693_100083896 | 3300005547 | Unclassified | 1905 |
| 131 | Ga0070665_100060819 | 3300005548 | Unclassified | 3786 |
| 132 | Ga0070665_100261216 | 3300005548 | Bacteria | 1733 |
| 133 | Ga0070704_100017249 | 3300005549 | Unclassified | 4586 |
| 134 | Ga0070704_100025822 | 3300005549 | Bacteria | 3872 |
| 135 | Ga0070704_100110292 | 3300005549 | Bacteria | 2092 |
| 136 | Ga0068855_100065525 | 3300005563 | Bacteria | 4235 |
| 137 | Ga0068855_100274562 | 3300005563 | Bacteria | 1873 |
| 138 | Ga0070664_100085800 | 3300005564 | Bacteria | 2719 |
| 139 | Ga0070664_100218013 | 3300005564 | Bacteria | 1707 |
| 140 | Ga0070664_100319856 | 3300005564 | Unclassified | 1406 |
| 141 | Ga0068857_100029085 | 3300005577 | Bacteria | 4876 |
| 142 | Ga0068857_100037704 | 3300005577 | Bacteria | 4283 |
| 143 | Ga0068857_100388186 | 3300005577 | Bacteria | 1297 |
| 144 | Ga0068854_100380570 | 3300005578 | Archaea | 1163 |
| 145 | Ga0068854_100656966 | 3300005578 | Unclassified | 901 |
| 146 | Ga0068856_100045687 | 3300005614 | Bacteria | 4313 |
| 147 | Ga0068856_100192200 | 3300005614 | Bacteria | 2055 |
| 148 | Ga0068856_100266853 | 3300005614 | Archaea | 1728 |
| 149 | Ga0068856_100286890 | 3300005614 | Bacteria | 1663 |
| 150 | Ga0070702_100054829 | 3300005615 | Bacteria | 2296 |
| 151 | Ga0070702_100082071 | 3300005615 | Bacteria | 1933 |
| 152 | Ga0070702_100082889 | 3300005615 | Bacteria | 1925 |
| 153 | Ga0070702_100472662 | 3300005615 | Bacteria | 914 |
| 154 | Ga0070702_100912878 | 3300005615 | Unclassified | 688 |
| 155 | Ga0070702_100912879 | 3300005615 | Bacteria | 688 |
| 156 | Ga0068852_100139786 | 3300005616 | Unclassified | 2240 |
| 157 | Ga0068852_100354367 | 3300005616 | Bacteria | 1434 |
| 158 | Ga0068859_100052901 | 3300005617 | Bacteria | 4083 |
| 159 | Ga0068859_100478502 | 3300005617 | Archaea | 1341 |
| 160 | Ga0068859_100808742 | 3300005617 | Unclassified | 1025 |
| 161 | Ga0068864_100005306 | 3300005618 | Bacteria | 10550 |
| 162 | Ga0068864_100059765 | 3300005618 | Bacteria | 3298 |
| 163 | Ga0068864_100615416 | 3300005618 | Unclassified | 1055 |
| 164 | Ga0068861_100064128 | 3300005719 | Bacteria | 2826 |
| 165 | Ga0068861_100077238 | 3300005719 | Bacteria | 2597 |
| 166 | Ga0068861_100146734 | 3300005719 | Unclassified | 1931 |
| 167 | Ga0068861_100319548 | 3300005719 | Unclassified | 1351 |
| 168 | Ga0068851_10020397 | 3300005834 | Unclassified | 3210 |
| 169 | Ga0068870_10014339 | 3300005840 | Bacteria | 3743 |
| 170 | Ga0068870_10032260 | 3300005840 | Bacteria | 2661 |
| 171 | Ga0068870_10075623 | 3300005840 | Bacteria | 1847 |
| 172 | Ga0068870_10104220 | 3300005840 | Bacteria | 1609 |
| 173 | Ga0068863_100286719 | 3300005841 | Bacteria | 1596 |
| 174 | Ga0068863_100496427 | 3300005841 | Bacteria | 1202 |
| 175 | Ga0068858_100015291 | 3300005842 | Bacteria | 7220 |
| 176 | Ga0068860_100221639 | 3300005843 | Bacteria | 1837 |
| 177 | Ga0068862_101129874 | 3300005844 | Unclassified | 780 |
| 178 | Ga0081455_10014370 | 3300005937 | Bacteria | 7767 |
| 179 | Ga0081455_10016183 | 3300005937 | Bacteria | 7210 |
| 180 | Ga0081455_10064674 | 3300005937 | Bacteria | 3062 |
| 181 | Ga0081455_10069014 | 3300005937 | Bacteria | 2941 |
| 182 | Ga0081455_10077991 | 3300005937 | Bacteria | 2723 |
| 183 | Ga0081455_10138500 | 3300005937 | Unclassified | 1893 |
| 184 | Ga0081455_10180734 | 3300005937 | Bacteria | 1597 |
| 185 | Ga0081455_10527148 | 3300005937 | Bacteria | 787 |
| 186 | Ga0081538_10113182 | 3300005981 | Bacteria | 1326 |
| 187 | Ga0081540_1000836 | 3300005983 | Bacteria | 28072 |
| 188 | Ga0081540_1003929 | 3300005983 | Bacteria | 11561 |
| 189 | Ga0081540_1004796 | 3300005983 | Bacteria | 10194 |
| 190 | Ga0081539_10000384 | 3300005985 | Bacteria | 95594 |
| 191 | Ga0081539_10000628 | 3300005985 | Bacteria | 71419 |
| 192 | Ga0081539_10001582 | 3300005985 | Bacteria | 37628 |
| 193 | Ga0081539_10016030 | 3300005985 | Bacteria | 5390 |
| 194 | Ga0070717_10015446 | 3300006028 | Bacteria | 5899 |
| 195 | Ga0070717_10017014 | 3300006028 | Bacteria | 5647 |
| 196 | Ga0070717_10020582 | 3300006028 | Bacteria | 5191 |
| 197 | Ga0070717_10591351 | 3300006028 | Bacteria | 1007 |
| 198 | Ga0075365_10102482 | 3300006038 | Bacteria | 1961 |
| 199 | Ga0075432_10000451 | 3300006058 | Bacteria | 12131 |
| 200 | Ga0075432_10039012 | 3300006058 | Bacteria | 1655 |
| 201 | Ga0070715_10118932 | 3300006163 | Bacteria | 1257 |
| 202 | Ga0070716_100325404 | 3300006173 | Bacteria | 1079 |
| 203 | Ga0070712_100017460 | 3300006175 | Bacteria | 4646 |
| 204 | Ga0070712_100038637 | 3300006175 | Bacteria | 3263 |
| 205 | Ga0070712_100129346 | 3300006175 | Bacteria | 1912 |
| 206 | Ga0070712_100313037 | 3300006175 | Bacteria | 1274 |
| 207 | Ga0075367_10082301 | 3300006178 | Bacteria | 1949 |
| 208 | Ga0075367_10108217 | 3300006178 | Bacteria | 1704 |
| 209 | Ga0075367_10143138 | 3300006178 | Bacteria | 1482 |
| 210 | Ga0097621_100100422 | 3300006237 | Unclassified | 2434 |
| 211 | Ga0097621_100124713 | 3300006237 | Bacteria | 2187 |
| 212 | Ga0097621_100857561 | 3300006237 | Unclassified | 844 |
| 213 | Ga0068871_100074599 | 3300006358 | Bacteria | 2799 |
| 214 | Ga0075428_100002662 | 3300006844 | Bacteria | 19398 |
| 215 | Ga0075428_100045578 | 3300006844 | Bacteria | 4818 |
| 216 | Ga0075428_100060163 | 3300006844 | Bacteria | 4159 |
| 217 | Ga0075428_100105176 | 3300006844 | Bacteria | 3078 |
| 218 | Ga0075428_100290714 | 3300006844 | Unclassified | 1758 |
| 219 | Ga0075428_100458538 | 3300006844 | Bacteria | 1365 |
| 220 | Ga0075430_100005830 | 3300006846 | Bacteria | 10392 |
| 221 | Ga0075430_100481279 | 3300006846 | Bacteria | 1024 |
| 222 | Ga0075431_100031224 | 3300006847 | Bacteria | 5487 |
| 223 | Ga0075431_100066835 | 3300006847 | Bacteria | 3711 |
| 224 | Ga0075431_100097238 | 3300006847 | Bacteria | 3040 |
| 225 | Ga0075431_100587678 | 3300006847 | Bacteria | 1098 |
| 226 | Ga0075431_100660683 | 3300006847 | Bacteria | 1025 |
| 227 | Ga0075433_10011801 | 3300006852 | Bacteria | 7037 |
| 228 | Ga0075433_10025219 | 3300006852 | Bacteria | 5025 |
| 229 | Ga0075433_10055376 | 3300006852 | Bacteria | 3462 |
| 230 | Ga0075433_10073112 | 3300006852 | Unclassified | 3015 |
| 231 | Ga0075433_10133393 | 3300006852 | Bacteria | 2207 |
| 232 | Ga0075433_10401009 | 3300006852 | Bacteria | 1210 |
| 233 | Ga0075434_100007792 | 3300006871 | Bacteria | 9917 |
| 234 | Ga0075434_100013062 | 3300006871 | Bacteria | 7886 |
| 235 | Ga0075434_100073846 | 3300006871 | Bacteria | 3404 |
| 236 | Ga0075434_100652988 | 3300006871 | Bacteria | 1070 |
| 237 | Ga0075434_101048216 | 3300006871 | Bacteria | 829 |
| 238 | Ga0075434_101346026 | 3300006871 | Bacteria | 724 |
| 239 | Ga0075429_100020238 | 3300006880 | Bacteria | 5770 |
| 240 | Ga0075429_100205184 | 3300006880 | Bacteria | 1727 |
| 241 | Ga0075429_100536707 | 3300006880 | Bacteria | 1025 |
| 242 | Ga0068865_100039721 | 3300006881 | Bacteria | 3193 |
| 243 | Ga0068865_100078935 | 3300006881 | Bacteria | 2356 |
| 244 | Ga0068865_100100359 | 3300006881 | Unclassified | 2118 |
| 245 | Ga0068865_100107961 | 3300006881 | Bacteria | 2048 |
| 246 | Ga0075436_100007890 | 3300006914 | Bacteria | 7284 |
| 247 | Ga0075436_100100406 | 3300006914 | Bacteria | 2015 |
| 248 | Ga0075436_100122837 | 3300006914 | Unclassified | 1818 |
| 249 | Ga0075436_100540173 | 3300006914 | Unclassified | 855 |
| 250 | Ga0097620_100052902 | 3300006931 | Bacteria | 4083 |
| 251 | Ga0097620_100478538 | 3300006931 | Archaea | 1341 |
| 252 | Ga0097620_100808641 | 3300006931 | Unclassified | 1025 |
| 253 | Ga0075435_100002153 | 3300007076 | Bacteria | 12981 |
| 254 | Ga0075435_100135562 | 3300007076 | Bacteria | 2062 |
| 255 | Ga0075435_100190728 | 3300007076 | Unclassified | 1735 |
| 256 | Ga0075435_100311182 | 3300007076 | Bacteria | 1348 |
| 257 | Ga0075435_100609633 | 3300007076 | Unclassified | 947 |
| 258 | Ga0075435_100629896 | 3300007076 | Unclassified | 931 |
| 259 | Ga0099795_10082525 | 3300007788 | Bacteria | 1232 |
| 260 | Ga0111539_10000648 | 3300009094 | Bacteria | 44951 |
| 261 | Ga0111539_10006602 | 3300009094 | Bacteria | 14945 |
| 262 | Ga0111539_10017044 | 3300009094 | Bacteria | 8993 |
| 263 | Ga0111539_10017381 | 3300009094 | Bacteria | 8901 |
| 264 | Ga0111539_10077795 | 3300009094 | Unclassified | 3904 |
| 265 | Ga0111539_10137411 | 3300009094 | Bacteria | 2862 |
| 266 | Ga0111539_10742524 | 3300009094 | Bacteria | 1142 |
| 267 | Ga0111539_10835190 | 3300009094 | Unclassified | 1072 |
| 268 | Ga0105245_10008337 | 3300009098 | Bacteria | 9056 |
| 269 | Ga0105245_10014479 | 3300009098 | Bacteria | 6869 |
| 270 | Ga0105245_10060451 | 3300009098 | Unclassified | 3412 |
| 271 | Ga0105245_10064281 | 3300009098 | Bacteria | 3315 |
| 272 | Ga0105245_10105422 | 3300009098 | Bacteria | 2615 |
| 273 | Ga0105245_10137318 | 3300009098 | Bacteria | 2299 |
| 274 | Ga0105245_10154023 | 3300009098 | Unclassified | 2176 |
| 275 | Ga0105245_10159510 | 3300009098 | Unclassified | 2139 |
| 276 | Ga0105245_10290145 | 3300009098 | Bacteria | 1602 |
| 277 | Ga0105245_10883665 | 3300009098 | Bacteria | 935 |
| 278 | Ga0105245_10948562 | 3300009098 | Bacteria | 903 |
| 279 | Ga0105245_11086284 | 3300009098 | Bacteria | 846 |
| 280 | Ga0105247_10009263 | 3300009101 | Bacteria | 5981 |
| 281 | Ga0114129_10010920 | 3300009147 | Bacteria | 12939 |
| 282 | Ga0114129_10015646 | 3300009147 | Bacteria | 10788 |
| 283 | Ga0114129_10026913 | 3300009147 | Bacteria | 8141 |
| 284 | Ga0114129_10112533 | 3300009147 | Unclassified | 3754 |
| 285 | Ga0114129_10118846 | 3300009147 | Bacteria | 3641 |
| 286 | Ga0114129_10193430 | 3300009147 | Unclassified | 2760 |
| 287 | Ga0114129_10241288 | 3300009147 | Bacteria | 2429 |
| 288 | Ga0114129_10242682 | 3300009147 | Unclassified | 2421 |
| 289 | Ga0114129_10469874 | 3300009147 | Bacteria | 1647 |
| 290 | Ga0114129_10598704 | 3300009147 | Bacteria | 1428 |
| 291 | Ga0114129_10797319 | 3300009147 | Bacteria | 1205 |
| 292 | Ga0114129_10966079 | 3300009147 | Bacteria | 1075 |
| 293 | Ga0105243_10003486 | 3300009148 | Bacteria | 12706 |
| 294 | Ga0105243_10013359 | 3300009148 | Bacteria | 6211 |
| 295 | Ga0105243_10018939 | 3300009148 | Bacteria | 5220 |
| 296 | Ga0105243_10130683 | 3300009148 | Bacteria | 2129 |
| 297 | Ga0105243_10228454 | 3300009148 | Bacteria | 1649 |
| 298 | Ga0105243_10327796 | 3300009148 | Bacteria | 1397 |
| 299 | Ga0105243_11023780 | 3300009148 | Bacteria | 830 |
| 300 | Ga0105243_11074723 | 3300009148 | Bacteria | 811 |
| 301 | Ga0105241_10049960 | 3300009174 | Unclassified | 3187 |
| 302 | Ga0105241_10490524 | 3300009174 | Unclassified | 1094 |
| 303 | Ga0105241_10531351 | 3300009174 | Bacteria | 1053 |
| 304 | Ga0105242_10033827 | 3300009176 | Bacteria | 4095 |
| 305 | Ga0105242_10078913 | 3300009176 | Bacteria | 2749 |
| 306 | Ga0105242_10108648 | 3300009176 | Bacteria | 2361 |
| 307 | Ga0105242_10131291 | 3300009176 | Bacteria | 2163 |
| 308 | Ga0105242_10249965 | 3300009176 | Bacteria | 1597 |
| 309 | Ga0105242_10306689 | 3300009176 | Bacteria | 1451 |
| 310 | Ga0105248_10034045 | 3300009177 | Bacteria | 5695 |
| 311 | Ga0105248_10036506 | 3300009177 | Bacteria | 5497 |
| 312 | Ga0105248_10099570 | 3300009177 | Bacteria | 3276 |
| 313 | Ga0105248_10187053 | 3300009177 | Bacteria | 2334 |
| 314 | Ga0105248_10618997 | 3300009177 | Bacteria | 1221 |
| 315 | Ga0105237_10270674 | 3300009545 | Unclassified | 1702 |
| 316 | Ga0105238_10029324 | 3300009551 | Bacteria | 5605 |
| 317 | Ga0105238_10205477 | 3300009551 | Bacteria | 1945 |
| 318 | Ga0105238_10308915 | 3300009551 | Bacteria | 1566 |
| 319 | Ga0105249_10261795 | 3300009553 | Unclassified | 1719 |
| 320 | Ga0105249_10312752 | 3300009553 | Bacteria | 1580 |
| 321 | Ga0105239_10019732 | 3300010375 | Bacteria | 7439 |
| 322 | Ga0105239_10044517 | 3300010375 | Bacteria | 4865 |
| 323 | Ga0105239_10109230 | 3300010375 | Bacteria | 3065 |
| 324 | Ga0105239_10347875 | 3300010375 | Bacteria | 1673 |
| 325 | Ga0105239_10427004 | 3300010375 | Bacteria | 1502 |
| 326 | Ga0105239_10478105 | 3300010375 | Unclassified | 1415 |
| 327 | Ga0105246_10012363 | 3300011119 | Bacteria | 5323 |
| 328 | Ga0105246_10070423 | 3300011119 | Unclassified | 2460 |
| 329 | Ga0105246_10270833 | 3300011119 | Bacteria | 1357 |
| 330 | Ga0157342_1000339 | 3300012507 | Bacteria | 2724 |
| 331 | Ga0157371_10030079 | 3300013102 | Bacteria | 3919 |
| 332 | Ga0157371_10044248 | 3300013102 | Bacteria | 3170 |
| 333 | Ga0157371_10138456 | 3300013102 | Unclassified | 1734 |
| 334 | Ga0157371_10205330 | 3300013102 | Bacteria | 1413 |
| 335 | Ga0157370_10564332 | 3300013104 | Bacteria | 1043 |
| 336 | Ga0157369_10061751 | 3300013105 | Bacteria | 4039 |
| 337 | Ga0157374_10184573 | 3300013296 | Bacteria | 2039 |
| 338 | Ga0157374_10404233 | 3300013296 | Bacteria | 1363 |
| 339 | Ga0157374_10480512 | 3300013296 | Bacteria | 1246 |
| 340 | Ga0157374_10589129 | 3300013296 | Bacteria | 1121 |
| 341 | Ga0157374_10715830 | 3300013296 | Unclassified | 1015 |
| 342 | Ga0157378_10190006 | 3300013297 | Bacteria | 1936 |
| 343 | Ga0157378_10339353 | 3300013297 | Bacteria | 1465 |
| 344 | Ga0157378_10588279 | 3300013297 | Bacteria | 1123 |
| 345 | Ga0163162_10093794 | 3300013306 | Bacteria | 3087 |
| 346 | Ga0163162_10114762 | 3300013306 | Unclassified | 2793 |
| 347 | Ga0163162_10145207 | 3300013306 | Bacteria | 2488 |
| 348 | Ga0163162_10475046 | 3300013306 | Bacteria | 1381 |
| 349 | Ga0163162_10776463 | 3300013306 | Bacteria | 1076 |
| 350 | Ga0157372_10025354 | 3300013307 | Bacteria | 6445 |
| 351 | Ga0157372_10089070 | 3300013307 | Bacteria | 3505 |
| 352 | Ga0157372_10349735 | 3300013307 | Unclassified | 1722 |
| 353 | Ga0157372_10535828 | 3300013307 | Bacteria | 1365 |
| 354 | Ga0157372_10652701 | 3300013307 | Unclassified | 1225 |
| 355 | Ga0157375_10005826 | 3300013308 | Bacteria | 10721 |
| 356 | Ga0157375_10016816 | 3300013308 | Bacteria | 6583 |
| 357 | Ga0157375_10019447 | 3300013308 | Bacteria | 6176 |
| 358 | Ga0157375_10019925 | 3300013308 | Bacteria | 6115 |
| 359 | Ga0157375_10350653 | 3300013308 | Bacteria | 1642 |
| 360 | Ga0157375_10363322 | 3300013308 | Bacteria | 1614 |
| 361 | Ga0157375_10416024 | 3300013308 | Bacteria | 1510 |
| 362 | Ga0163163_10006950 | 3300014325 | Bacteria | 9942 |
| 363 | Ga0163163_10073365 | 3300014325 | Bacteria | 3413 |
| 364 | Ga0157380_10019322 | 3300014326 | Bacteria | 5078 |
| 365 | Ga0157380_10107118 | 3300014326 | Bacteria | 2340 |
| 366 | Ga0157380_10228161 | 3300014326 | Bacteria | 1671 |
| 367 | Ga0157380_10549838 | 3300014326 | Bacteria | 1132 |
| 368 | Ga0157380_10909590 | 3300014326 | Bacteria | 907 |
| 369 | Ga0182008_10178480 | 3300014497 | Bacteria | 1074 |
| 370 | Ga0182008_10416042 | 3300014497 | Archaea | 725 |
| 371 | Ga0157377_10098925 | 3300014745 | Bacteria | 1734 |
| 372 | Ga0157377_10128337 | 3300014745 | Unclassified | 1545 |
| 373 | Ga0157377_10130490 | 3300014745 | Bacteria | 1534 |
| 374 | Ga0157377_10336204 | 3300014745 | Unclassified | 1008 |
| 375 | Ga0157379_10019500 | 3300014968 | Bacteria | 5991 |
| 376 | Ga0157379_10074880 | 3300014968 | Bacteria | 3030 |
| 377 | Ga0157376_10019387 | 3300014969 | Bacteria | 5242 |
| 378 | Ga0157376_10408794 | 3300014969 | Unclassified | 1314 |
| 379 | Ga0157376_10463848 | 3300014969 | Unclassified | 1238 |
| 380 | Ga0157376_11047185 | 3300014969 | Unclassified | 840 |
| 381 | Ga0163161_10310170 | 3300017792 | Bacteria | 1245 |
| 382 | Ga0207656_10101209 | 3300025321 | Bacteria | 1321 |
| 383 | Ga0207653_10027253 | 3300025885 | Bacteria | 1834 |
| 384 | Ga0207692_10006275 | 3300025898 | Bacteria | 4819 |
| 385 | Ga0207642_10046227 | 3300025899 | Unclassified | 1938 |
| 386 | Ga0207710_10059299 | 3300025900 | Bacteria | 1732 |
| 387 | Ga0207688_10027230 | 3300025901 | Bacteria | 3144 |
| 388 | Ga0207688_10118318 | 3300025901 | Bacteria | 1544 |
| 389 | Ga0207685_10085510 | 3300025905 | Unclassified | 1316 |
| 390 | Ga0207685_10201509 | 3300025905 | Bacteria | 935 |
| 391 | Ga0207645_10035355 | 3300025907 | Bacteria | 3208 |
| 392 | Ga0207645_10086393 | 3300025907 | Bacteria | 2015 |
| 393 | Ga0207645_10223646 | 3300025907 | Bacteria | 1241 |
| 394 | Ga0207645_10350339 | 3300025907 | Unclassified | 988 |
| 395 | Ga0207643_10008192 | 3300025908 | Bacteria | 5610 |
| 396 | Ga0207643_10015090 | 3300025908 | Bacteria | 4201 |
| 397 | Ga0207643_10023159 | 3300025908 | Bacteria | 3425 |
| 398 | Ga0207643_10050041 | 3300025908 | Bacteria | 2369 |
| 399 | Ga0207705_10026955 | 3300025909 | Bacteria | 4095 |
| 400 | Ga0207705_10039928 | 3300025909 | Unclassified | 3364 |
| 401 | Ga0207684_10046071 | 3300025910 | Bacteria | 3699 |
| 402 | Ga0207684_10081328 | 3300025910 | Unclassified | 2756 |
| 403 | Ga0207684_10138737 | 3300025910 | Unclassified | 2089 |
| 404 | Ga0207654_10216829 | 3300025911 | Bacteria | 1267 |
| 405 | Ga0207654_10304306 | 3300025911 | Unclassified | 1085 |
| 406 | Ga0207707_10029897 | 3300025912 | Bacteria | 4764 |
| 407 | Ga0207707_10099707 | 3300025912 | Unclassified | 2538 |
| 408 | Ga0207707_10231887 | 3300025912 | Bacteria | 1606 |
| 409 | Ga0207707_10309941 | 3300025912 | Bacteria | 1364 |
| 410 | Ga0207671_10072984 | 3300025914 | Bacteria | 2562 |
| 411 | Ga0207693_10008061 | 3300025915 | Bacteria | 8642 |
| 412 | Ga0207693_10197025 | 3300025915 | Unclassified | 1584 |
| 413 | Ga0207693_10313509 | 3300025915 | Bacteria | 1228 |
| 414 | Ga0207663_10044860 | 3300025916 | Bacteria | 2716 |
| 415 | Ga0207663_10093589 | 3300025916 | Bacteria | 2000 |
| 416 | Ga0207663_10319027 | 3300025916 | Bacteria | 1167 |
| 417 | Ga0207660_10147728 | 3300025917 | Unclassified | 1803 |
| 418 | Ga0207662_10073086 | 3300025918 | Unclassified | 2079 |
| 419 | Ga0207662_10126843 | 3300025918 | Bacteria | 1605 |
| 420 | Ga0207662_10136653 | 3300025918 | Bacteria | 1550 |
| 421 | Ga0207657_10001701 | 3300025919 | Bacteria | 23714 |
| 422 | Ga0207657_10006124 | 3300025919 | Bacteria | 12503 |
| 423 | Ga0207657_10061045 | 3300025919 | Bacteria | 3234 |
| 424 | Ga0207657_10166020 | 3300025919 | Bacteria | 1791 |
| 425 | Ga0207657_10241264 | 3300025919 | Bacteria | 1443 |
| 426 | Ga0207652_10066652 | 3300025921 | Bacteria | 3121 |
| 427 | Ga0207652_10203811 | 3300025921 | Bacteria | 1780 |
| 428 | Ga0207652_10311346 | 3300025921 | Bacteria | 1421 |
| 429 | Ga0207652_10933616 | 3300025921 | Bacteria | 765 |
| 430 | Ga0207646_10002167 | 3300025922 | Bacteria | 23455 |
| 431 | Ga0207646_10003470 | 3300025922 | Bacteria | 17803 |
| 432 | Ga0207646_10055886 | 3300025922 | Bacteria | 3529 |
| 433 | Ga0207681_10157171 | 3300025923 | Unclassified | 1710 |
| 434 | Ga0207694_10190517 | 3300025924 | Bacteria | 1666 |
| 435 | Ga0207650_10008340 | 3300025925 | Bacteria | 7074 |
| 436 | Ga0207650_10011261 | 3300025925 | Bacteria | 6153 |
| 437 | Ga0207650_10068042 | 3300025925 | Bacteria | 2674 |
| 438 | Ga0207650_10758832 | 3300025925 | Bacteria | 821 |
| 439 | Ga0207659_10484627 | 3300025926 | Unclassified | 1045 |
| 440 | Ga0207659_10503754 | 3300025926 | Bacteria | 1025 |
| 441 | Ga0207659_10726370 | 3300025926 | Unclassified | 851 |
| 442 | Ga0207687_10059611 | 3300025927 | Unclassified | 2690 |
| 443 | Ga0207687_10064056 | 3300025927 | Unclassified | 2605 |
| 444 | Ga0207687_10065731 | 3300025927 | Bacteria | 2576 |
| 445 | Ga0207687_10065989 | 3300025927 | Bacteria | 2571 |
| 446 | Ga0207687_10088142 | 3300025927 | Bacteria | 2257 |
| 447 | Ga0207687_10186382 | 3300025927 | Unclassified | 1611 |
| 448 | Ga0207687_10188254 | 3300025927 | Unclassified | 1604 |
| 449 | Ga0207687_10255500 | 3300025927 | Bacteria | 1395 |
| 450 | Ga0207687_10329168 | 3300025927 | Unclassified | 1239 |
| 451 | Ga0207687_10379377 | 3300025927 | Bacteria | 1158 |
| 452 | Ga0207687_10379477 | 3300025927 | Unclassified | 1158 |
| 453 | Ga0207700_10038568 | 3300025928 | Unclassified | 3468 |
| 454 | Ga0207700_10109917 | 3300025928 | Bacteria | 2216 |
| 455 | Ga0207700_11019136 | 3300025928 | Bacteria | 741 |
| 456 | Ga0207664_10002961 | 3300025929 | Bacteria | 11273 |
| 457 | Ga0207664_10077315 | 3300025929 | Unclassified | 2696 |
| 458 | Ga0207664_10082933 | 3300025929 | Bacteria | 2612 |
| 459 | Ga0207664_10198515 | 3300025929 | Unclassified | 1730 |
| 460 | Ga0207690_10035490 | 3300025932 | Bacteria | 3221 |
| 461 | Ga0207690_10038048 | 3300025932 | Bacteria | 3128 |
| 462 | Ga0207690_10050027 | 3300025932 | Bacteria | 2788 |
| 463 | Ga0207690_10380855 | 3300025932 | Unclassified | 1121 |
| 464 | Ga0207706_10022030 | 3300025933 | Bacteria | 5719 |
| 465 | Ga0207706_10023062 | 3300025933 | Bacteria | 5590 |
| 466 | Ga0207686_10047809 | 3300025934 | Bacteria | 2647 |
| 467 | Ga0207686_10214585 | 3300025934 | Bacteria | 1386 |
| 468 | Ga0207686_10253188 | 3300025934 | Bacteria | 1287 |
| 469 | Ga0207709_10025774 | 3300025935 | Bacteria | 3369 |
| 470 | Ga0207709_10031964 | 3300025935 | Bacteria | 3079 |
| 471 | Ga0207709_10068072 | 3300025935 | Bacteria | 2249 |
| 472 | Ga0207709_10327560 | 3300025935 | Unclassified | 1149 |
| 473 | Ga0207709_10486392 | 3300025935 | Bacteria | 961 |
| 474 | Ga0207670_10312958 | 3300025936 | Bacteria | 1233 |
| 475 | Ga0207670_10983928 | 3300025936 | Unclassified | 709 |
| 476 | Ga0207669_10038646 | 3300025937 | Bacteria | 2750 |
| 477 | Ga0207669_10068295 | 3300025937 | Bacteria | 2219 |
| 478 | Ga0207669_10292243 | 3300025937 | Unclassified | 1234 |
| 479 | Ga0207669_10377648 | 3300025937 | Bacteria | 1103 |
| 480 | Ga0207669_10553630 | 3300025937 | Bacteria | 928 |
| 481 | Ga0207669_10781956 | 3300025937 | Unclassified | 790 |
| 482 | Ga0207704_10031119 | 3300025938 | Bacteria | 3001 |
| 483 | Ga0207704_10104254 | 3300025938 | Unclassified | 1899 |
| 484 | Ga0207704_10158777 | 3300025938 | Bacteria | 1606 |
| 485 | Ga0207704_10170843 | 3300025938 | Bacteria | 1559 |
| 486 | Ga0207665_10096583 | 3300025939 | Bacteria | 2055 |
| 487 | Ga0207665_10103896 | 3300025939 | Bacteria | 1988 |
| 488 | Ga0207691_10017223 | 3300025940 | Bacteria | 6854 |
| 489 | Ga0207691_10066629 | 3300025940 | Bacteria | 3258 |
| 490 | Ga0207691_10071953 | 3300025940 | Bacteria | 3119 |
| 491 | Ga0207691_10147365 | 3300025940 | Unclassified | 2071 |
| 492 | Ga0207711_10074783 | 3300025941 | Unclassified | 2947 |
| 493 | Ga0207711_10153267 | 3300025941 | Unclassified | 2081 |
| 494 | Ga0207711_10347714 | 3300025941 | Bacteria | 1373 |
| 495 | Ga0207689_10029379 | 3300025942 | Bacteria | 4591 |
| 496 | Ga0207689_10077920 | 3300025942 | Bacteria | 2723 |
| 497 | Ga0207689_10198773 | 3300025942 | Unclassified | 1655 |
| 498 | Ga0207689_10209599 | 3300025942 | Bacteria | 1610 |
| 499 | Ga0207689_10252971 | 3300025942 | Unclassified | 1457 |
| 500 | Ga0207661_10009366 | 3300025944 | Bacteria | 7019 |
| 501 | Ga0207661_10037723 | 3300025944 | Bacteria | 3782 |
| 502 | Ga0207661_10047233 | 3300025944 | Bacteria | 3417 |
| 503 | Ga0207661_10096678 | 3300025944 | Bacteria | 2471 |
| 504 | Ga0207661_10426104 | 3300025944 | Bacteria | 1206 |
| 505 | Ga0207679_10164832 | 3300025945 | Bacteria | 1818 |
| 506 | Ga0207679_10406812 | 3300025945 | Bacteria | 1198 |
| 507 | Ga0207679_10535692 | 3300025945 | Unclassified | 1049 |
| 508 | Ga0207679_10661950 | 3300025945 | Bacteria | 945 |
| 509 | Ga0207667_10163266 | 3300025949 | Bacteria | 2291 |
| 510 | Ga0207667_10538042 | 3300025949 | Bacteria | 1182 |
| 511 | Ga0207651_10071703 | 3300025960 | Bacteria | 2457 |
| 512 | Ga0207651_10315326 | 3300025960 | Bacteria | 1305 |
| 513 | Ga0207712_10044556 | 3300025961 | Unclassified | 3067 |
| 514 | Ga0207712_10243644 | 3300025961 | Bacteria | 1449 |
| 515 | Ga0207668_10089584 | 3300025972 | Unclassified | 2256 |
| 516 | Ga0207640_10091516 | 3300025981 | Unclassified | 2107 |
| 517 | Ga0207640_10558352 | 3300025981 | Unclassified | 963 |
| 518 | Ga0207677_10118393 | 3300026023 | Bacteria | 1987 |
| 519 | Ga0207677_10209929 | 3300026023 | Bacteria | 1554 |
| 520 | Ga0207639_10537227 | 3300026041 | Bacteria | 1072 |
| 521 | Ga0207678_10019076 | 3300026067 | Bacteria | 6021 |
| 522 | Ga0207678_10443644 | 3300026067 | Bacteria | 1127 |
| 523 | Ga0207678_10590033 | 3300026067 | Bacteria | 974 |
| 524 | Ga0207708_10031024 | 3300026075 | Bacteria | 4057 |
| 525 | Ga0207708_10045488 | 3300026075 | Bacteria | 3345 |
| 526 | Ga0207708_10067625 | 3300026075 | Bacteria | 2733 |
| 527 | Ga0207702_10184280 | 3300026078 | Bacteria | 1924 |
| 528 | Ga0207702_10568565 | 3300026078 | Unclassified | 1110 |
| 529 | Ga0207702_10667678 | 3300026078 | Bacteria | 1023 |
| 530 | Ga0207702_10731524 | 3300026078 | Unclassified | 976 |
| 531 | Ga0207702_10853763 | 3300026078 | Bacteria | 901 |
| 532 | Ga0207648_10035716 | 3300026089 | Bacteria | 4379 |
| 533 | Ga0207648_10047888 | 3300026089 | Bacteria | 3745 |
| 534 | Ga0207648_10054938 | 3300026089 | Bacteria | 3477 |
| 535 | Ga0207648_10114006 | 3300026089 | Bacteria | 2374 |
| 536 | Ga0207648_10120230 | 3300026089 | Bacteria | 2309 |
| 537 | Ga0207648_10145648 | 3300026089 | Bacteria | 2089 |
| 538 | Ga0207676_10230746 | 3300026095 | Unclassified | 1654 |
| 539 | Ga0207674_10002446 | 3300026116 | Bacteria | 23456 |
| 540 | Ga0207674_10037403 | 3300026116 | Bacteria | 5049 |
| 541 | Ga0207674_10041632 | 3300026116 | Bacteria | 4749 |
| 542 | Ga0207674_10197456 | 3300026116 | Archaea | 1961 |
| 543 | Ga0207674_10224959 | 3300026116 | Unclassified | 1825 |
| 544 | Ga0207675_100016689 | 3300026118 | Bacteria | 6856 |
| 545 | Ga0207675_100055972 | 3300026118 | Bacteria | 3680 |
| 546 | Ga0207675_100074084 | 3300026118 | Unclassified | 3186 |
| 547 | Ga0207675_100203231 | 3300026118 | Bacteria | 1903 |
| 548 | Ga0207675_100531846 | 3300026118 | Bacteria | 1173 |
| 549 | Ga0207683_10021406 | 3300026121 | Bacteria | 5536 |
| 550 | Ga0207683_10022545 | 3300026121 | Bacteria | 5405 |
| 551 | Ga0207683_10308139 | 3300026121 | Bacteria | 1449 |
| 552 | Ga0207683_10355740 | 3300026121 | Bacteria | 1344 |
| 553 | Ga0207683_10523372 | 3300026121 | Bacteria | 1096 |
| 554 | Ga0207698_10076789 | 3300026142 | Bacteria | 2675 |
| 555 | Ga0207698_10378332 | 3300026142 | Unclassified | 1346 |
| 556 | Ga0207698_11579302 | 3300026142 | Unclassified | 671 |
| 557 | Ga0209998_10009112 | 3300027717 | Bacteria | 2057 |
| 558 | Ga0207428_10000437 | 3300027907 | Bacteria | 51045 |
| 559 | Ga0207428_10003178 | 3300027907 | Bacteria | 16086 |
| 560 | Ga0207428_10025873 | 3300027907 | Bacteria | 4905 |
| 561 | Ga0207428_10026500 | 3300027907 | Bacteria | 4839 |
| 562 | Ga0207428_10034437 | 3300027907 | Bacteria | 4150 |
| 563 | Ga0207428_10044804 | 3300027907 | Bacteria | 3566 |
| 564 | Ga0207428_10062885 | 3300027907 | Unclassified | 2933 |
| 565 | Ga0207428_10093819 | 3300027907 | Bacteria | 2327 |
| 566 | Ga0207428_10139511 | 3300027907 | Unclassified | 1851 |
| 567 | Ga0268266_10240882 | 3300028379 | Archaea | 1669 |
| 568 | Ga0268266_10352425 | 3300028379 | Bacteria | 1383 |
| 569 | Ga0268266_10380024 | 3300028379 | Bacteria | 1332 |
| 570 | Ga0268265_10238936 | 3300028380 | Bacteria | 1602 |
| 571 | Ga0268265_10282590 | 3300028380 | Bacteria | 1486 |
| 572 | Ga0268264_10026271 | 3300028381 | Bacteria | 4756 |
| 573 | Ga0268264_10627874 | 3300028381 | Bacteria | 1061 |
| 574 | Ga0307408_100028335 | 3300031548 | Bacteria | 3870 |
| 575 | Ga0307408_100289507 | 3300031548 | Bacteria | 1367 |
| 576 | Ga0307408_100768375 | 3300031548 | Bacteria | 872 |
| 577 | Ga0307408_101201331 | 3300031548 | Bacteria | 707 |
| 578 | Ga0307410_10327576 | 3300031852 | Bacteria | 1217 |
| 579 | Ga0307412_10360909 | 3300031911 | Bacteria | 1170 |
| 580 | Ga0307409_100066045 | 3300031995 | Bacteria | 2850 |
| 581 | Ga0307414_10189948 | 3300032004 | Bacteria | 1661 |
| 582 | Ga0307411_10288532 | 3300032005 | Bacteria | 1310 |
| 583 | Ga0307415_100000192 | 3300032126 | Bacteria | 27217 |
| 584 | Ga0373958_0017671 | 3300034819 | Bacteria | 1285 |
| 585 | Ga0373959_0078585 | 3300034820 | Unclassified | 757 |
| 586 | Ga0373938_0028856 | 3300034957 | Bacteria | 1176 |
| 587 | Ga0373926_0000871 | 3300035083 | Bacteria | 8636 |
| 588 | Ga0373940_0148419 | 3300035088 | Bacteria | 746 |
| 589 | Ga0373936_0066249 | 3300035113 | Bacteria | 1483 |
| 590 | Ga0373939_0097767 | 3300035114 | Unclassified | 1003 |
| 591 | Ga0373941_0013589 | 3300035115 | Unclassified | 2156 |
| 592 | Ga0373941_0070133 | 3300035115 | Unclassified | 1162 |
| 593 | Ga0373945_0004395 | 3300035116 | Bacteria | 4477 |
| 594 | Ga0373945_0149132 | 3300035116 | Bacteria | 947 |
| 595 | Ga0373953_0051980 | 3300035117 | Unclassified | 1658 |
| 596 | Ga0373960_0074930 | 3300035121 | Unclassified | 1054 |
| 597 | Ga0373943_0000490 | 3300035170 | Bacteria | 16855 |
| 598 | Ga0373943_0179529 | 3300035170 | Bacteria | 1163 |
| 599 | Ga0373946_0047013 | 3300035171 | Bacteria | 1791 |
| 600 | Ga0373961_0103035 | 3300035241 | Unclassified | 926 |
| 601 | Ga0373931_0097005 | 3300035691 | Unclassified | 1652 |
| 602 | Ga0373931_0104052 | 3300035691 | Bacteria | 1601 |
| 603 | Ga0373931_0380522 | 3300035691 | Unclassified | 890 |
| 604 | Ga0373935_0298313 | 3300035692 | Bacteria | 1138 |
| 605 | Ga0373927_0300470 | 3300035695 | Bacteria | 1056 |
| 606 | Ga0373933_0069826 | 3300035724 | Bacteria | 2136 |
| 607 | Ga0373947_0001296 | 3300035725 | Bacteria | 15382 |
| 608 | Ga0373937_0300479 | 3300036401 | Bacteria | 1517 |
| 609 | Ga0373925_0000484 | 3300037068 | Bacteria | 39880 |
| 610 | Ga0395899_0001105 | 3300037312 | Bacteria | 24169 |
| 611 | Ga0395899_0004478 | 3300037312 | Bacteria | 10886 |
| 612 | Ga0395899_0005269 | 3300037312 | Bacteria | 10044 |
| 613 | Ga0395899_0006397 | 3300037312 | Bacteria | 9125 |
| 614 | Ga0395899_0035335 | 3300037312 | Unclassified | 3752 |
| 615 | Ga0395899_0050319 | 3300037312 | Bacteria | 3094 |
| 616 | Ga0395899_0078678 | 3300037312 | Bacteria | 2403 |
| 617 | Ga0395899_0117795 | 3300037312 | Bacteria | 1905 |
| 618 | Ga0395899_0281312 | 3300037312 | Bacteria | 1131 |
| 619 | Ga0395899_0307020 | 3300037312 | Bacteria | 1072 |
| 620 | Ga0395900_0002321 | 3300037418 | Bacteria | 21097 |
| 621 | Ga0395900_0003619 | 3300037418 | Bacteria | 16614 |
| 622 | Ga0395900_0004663 | 3300037418 | Bacteria | 14463 |
| 623 | Ga0395900_0005393 | 3300037418 | Bacteria | 13397 |
| 624 | Ga0395900_0013553 | 3300037418 | Bacteria | 8327 |
| 625 | Ga0395900_0050832 | 3300037418 | Bacteria | 4269 |
| 626 | Ga0395900_0054267 | 3300037418 | Unclassified | 4126 |
| 627 | Ga0395900_0074045 | 3300037418 | Bacteria | 3502 |
| 628 | Ga0395900_0110527 | 3300037418 | Bacteria | 2823 |
| 629 | Ga0395900_0133751 | 3300037418 | Unclassified | 2540 |
| 630 | Ga0395900_0154080 | 3300037418 | Bacteria | 2348 |
| 631 | Ga0395900_0249266 | 3300037418 | Bacteria | 1778 |
| 632 | Ga0395900_0273448 | 3300037418 | Unclassified | 1683 |
| 633 | Ga0395900_0536458 | 3300037418 | Unclassified | 1116 |
| 634 | Ga0395900_0847249 | 3300037418 | Unclassified | 840 |
| 635 | Ga0395898_0002298 | 3300037466 | Bacteria | 22946 |
| 636 | Ga0395898_0004033 | 3300037466 | Bacteria | 16145 |
| 637 | Ga0395898_0008472 | 3300037466 | Bacteria | 10865 |
| 638 | Ga0395898_0015626 | 3300037466 | Bacteria | 7782 |
| 639 | Ga0395898_0019466 | 3300037466 | Bacteria | 6906 |
| 640 | Ga0395898_0030341 | 3300037466 | Bacteria | 5411 |
| 641 | Ga0395898_0034998 | 3300037466 | Bacteria | 4998 |
| 642 | Ga0395898_0045984 | 3300037466 | Unclassified | 4288 |
| 643 | Ga0395898_0048170 | 3300037466 | Bacteria | 4180 |
| 644 | Ga0395898_0192583 | 3300037466 | Bacteria | 1948 |
| 645 | Ga0395898_0365177 | 3300037466 | Unclassified | 1376 |
| 646 | Ga0395898_0411779 | 3300037466 | Bacteria | 1289 |
| 647 | Ga0395898_0540203 | 3300037466 | Bacteria | 1107 |
| 648 | Ga0395898_0704463 | 3300037466 | Bacteria | 951 |
| 649 | Ga0395905_0001864 | 3300037471 | Bacteria | 24276 |
| 650 | Ga0395905_0003370 | 3300037471 | Bacteria | 17128 |
| 651 | Ga0395905_0006000 | 3300037471 | Bacteria | 12303 |
| 652 | Ga0395905_0009840 | 3300037471 | Bacteria | 9319 |
| 653 | Ga0395905_0012742 | 3300037471 | Bacteria | 8087 |
| 654 | Ga0395905_0036025 | 3300037471 | Bacteria | 4647 |
| 655 | Ga0395905_0037274 | 3300037471 | Bacteria | 4566 |
| 656 | Ga0395905_0037990 | 3300037471 | Bacteria | 4517 |
| 657 | Ga0395905_0039015 | 3300037471 | Bacteria | 4456 |
| 658 | Ga0395905_0083333 | 3300037471 | Unclassified | 2995 |
| 659 | Ga0395905_0109252 | 3300037471 | Bacteria | 2596 |
| 660 | Ga0395905_0181914 | 3300037471 | Bacteria | 1974 |
| 661 | Ga0395905_0190130 | 3300037471 | Bacteria | 1926 |
| 662 | Ga0395905_0234575 | 3300037471 | Bacteria | 1715 |
| 663 | Ga0395905_0449737 | 3300037471 | Bacteria | 1186 |
| 664 | Ga0395901_0003202 | 3300038443 | Bacteria | 16473 |
| 665 | Ga0395901_0004006 | 3300038443 | Bacteria | 14838 |
| 666 | Ga0395901_0004120 | 3300038443 | Bacteria | 14646 |
| 667 | Ga0395901_0004168 | 3300038443 | Bacteria | 14592 |
| 668 | Ga0395901_0007607 | 3300038443 | Bacteria | 10937 |
| 669 | Ga0395901_0012918 | 3300038443 | Bacteria | 8471 |
| 670 | Ga0395901_0020657 | 3300038443 | Bacteria | 6739 |
| 671 | Ga0395901_0022539 | 3300038443 | Bacteria | 6455 |
| 672 | Ga0395901_0036824 | 3300038443 | Bacteria | 5058 |
| 673 | Ga0395901_0049028 | 3300038443 | Bacteria | 4387 |
| 674 | Ga0395901_0082775 | 3300038443 | Unclassified | 3353 |
| 675 | Ga0395901_0119437 | 3300038443 | Bacteria | 2770 |
| 676 | Ga0395901_0150776 | 3300038443 | Bacteria | 2443 |
| 677 | Ga0395901_0215190 | 3300038443 | Bacteria | 2010 |
| 678 | Ga0395901_0217515 | 3300038443 | Unclassified | 1997 |
| 679 | Ga0395901_0435784 | 3300038443 | Bacteria | 1342 |
| 680 | Ga0395901_0671741 | 3300038443 | Bacteria | 1037 |
| 681 | Ga0395901_0756196 | 3300038443 | Bacteria | 964 |
| 682 | Ga0395901_1117443 | 3300038443 | Bacteria | 758 |
| 683 | Ga0395901_1164417 | 3300038443 | Unclassified | 738 |
| 684 | Ga0395901_1275565 | 3300038443 | Unclassified | 697 |
| 685 | Ga0395901_1315786 | 3300038443 | Bacteria | 684 |
| 686 | Ga0439439_0000168 | 3300041406 | Bacteria | 9797 |
| 687 | Ga0451789_0831867 | 3300041443 | Bacteria | 1924 |
| 688 | Ga0451791_1920887 | 3300041451 | Bacteria | 1168 |
| 689 | Ga0451798_0932997 | 3300041458 | Bacteria | 1268 |
| 690 | Ga0451800_0381266 | 3300041459 | Bacteria | 2037 |
| 691 | Ga0451802_1601654 | 3300041460 | Bacteria | 2777 |
| 692 | Ga0451804_0674902 | 3300041463 | Bacteria | 2070 |
| 693 | Ga0451807_0556744 | 3300041486 | Bacteria | 1774 |
| 694 | Ga0451807_0677844 | 3300041486 | Unclassified | 1062 |
| 695 | Ga0451835_0158106 | 3300041492 | Bacteria | 2784 |
| 696 | Ga0451839_0329616 | 3300041496 | Bacteria | 3118 |
| 697 | Ga0451845_0293247 | 3300041501 | Bacteria | 1267 |
| 698 | Ga0451847_0784703 | 3300041503 | Bacteria | 2709 |
| 699 | Ga0451849_0149384 | 3300041505 | Bacteria | 1665 |
| 700 | Ga0451851_0781637 | 3300041507 | Bacteria | 2415 |
| 701 | Ga0439431_0003319 | 3300041997 | Bacteria | 3545 |
| 702 | Ga0439433_0006255 | 3300041999 | Bacteria | 2562 |
| 703 | Ga0439445_0054465 | 3300042004 | Bacteria | 1085 |
| 704 | Ga0439448_0002278 | 3300042005 | Bacteria | 5188 |
| 705 | Ga0439448_0035334 | 3300042005 | Bacteria | 1600 |
| 706 | Ga0439448_0052078 | 3300042005 | Unclassified | 1341 |
| 707 | Ga0439462_0016445 | 3300042015 | Bacteria | 1910 |
| 708 | Ga0450920_031964 | 3300042122 | Bacteria | 1038 |
| 709 | Ga0450923_003845 | 3300042125 | Bacteria | 2308 |
| 710 | Ga0450907_005134 | 3300042146 | Unclassified | 2221 |
| 711 | Ga0439446_0001028 | 3300042156 | Bacteria | 6127 |
| 712 | Ga0439458_0004345 | 3300042157 | Bacteria | 3260 |
| 713 | Ga0439434_0037562 | 3300042435 | Bacteria | 1483 |
| 714 | Ga0466969_0020004 | 3300044656 | Bacteria | 3469 |
| 715 | Ga0453683_0117574 | 3300044673 | Bacteria | 1673 |
| 716 | Ga0466961_0077330 | 3300044693 | Bacteria | 2108 |
| 717 | Ga0466961_0307584 | 3300044693 | Bacteria | 967 |
| 718 | Ga0466963_0000045 | 3300044694 | Bacteria | 40813 |
| 719 | Ga0466963_0041098 | 3300044694 | Unclassified | 3031 |
| 720 | Ga0466963_0064643 | 3300044694 | Bacteria | 2451 |
| 721 | Ga0466963_0260097 | 3300044694 | Bacteria | 1218 |
| 722 | Ga0466964_0000074 | 3300044706 | Bacteria | 22392 |
| 723 | Ga0466964_0013974 | 3300044706 | Bacteria | 3049 |
| 724 | Ga0466971_0011789 | 3300044719 | Bacteria | 3829 |
| 725 | Ga0466971_0064302 | 3300044719 | Bacteria | 1661 |
| 726 | Ga0466968_0008417 | 3300044735 | Bacteria | 3949 |
| 727 | Ga0466968_0015989 | 3300044735 | Bacteria | 2982 |
| 728 | Ga0466968_0105412 | 3300044735 | Bacteria | 1263 |
| 729 | Ga0466957_0003753 | 3300044842 | Bacteria | 8394 |
| 730 | Ga0466957_0088960 | 3300044842 | Bacteria | 1932 |
| 731 | Ga0466959_0006407 | 3300045049 | Bacteria | 8147 |
| 732 | Ga0451576_0752536 | 3300045051 | Unclassified | 1023 |
| 733 | Ga0466958_0004688 | 3300045836 | Bacteria | 7257 |
| 734 | Ga0466967_0000085 | 3300045976 | Bacteria | 34226 |
| 735 | Ga0466967_0005337 | 3300045976 | Bacteria | 8879 |
| 736 | Ga0466967_0014500 | 3300045976 | Bacteria | 6142 |
| 737 | Ga0466967_0042350 | 3300045976 | Bacteria | 3934 |
| 738 | Ga0466967_0254195 | 3300045976 | Bacteria | 1679 |
| 739 | Ga0495592_0006827 | 3300046454 | Bacteria | 8521 |
| 740 | Ga0495592_0093479 | 3300046454 | Bacteria | 2153 |
| 741 | Ga0495603_0037612 | 3300046455 | Unclassified | 2904 |
| 742 | Ga0495603_0270279 | 3300046455 | Unclassified | 978 |
| 743 | Ga0495629_0058848 | 3300046459 | Bacteria | 2687 |
| 744 | Ga0495629_0069671 | 3300046459 | Unclassified | 2454 |
| 745 | Ga0495629_0180481 | 3300046459 | Bacteria | 1463 |
| 746 | Ga0495641_0002472 | 3300046461 | Bacteria | 14578 |
| 747 | Ga0495641_0013150 | 3300046461 | Bacteria | 4571 |
| 748 | Ga0495641_0030758 | 3300046461 | Bacteria | 2570 |
| 749 | Ga0495641_0038579 | 3300046461 | Bacteria | 2231 |
| 750 | Ga0495651_0034677 | 3300046462 | Bacteria | 3933 |
| 751 | Ga0495651_0176707 | 3300046462 | Bacteria | 1515 |
| 752 | Ga0495653_0017708 | 3300046463 | Bacteria | 5792 |
| 753 | Ga0495653_0047653 | 3300046463 | Bacteria | 3314 |
| 754 | Ga0495580_0012758 | 3300046472 | Bacteria | 6441 |
| 755 | Ga0495582_0009080 | 3300046473 | Bacteria | 5485 |
| 756 | Ga0495582_0053759 | 3300046473 | Bacteria | 2221 |
| 757 | Ga0495582_0229057 | 3300046473 | Bacteria | 1064 |
| 758 | Ga0495605_0014353 | 3300046474 | Bacteria | 4343 |
| 759 | Ga0495639_0001471 | 3300046475 | Bacteria | 10533 |
| 760 | Ga0495639_0262626 | 3300046475 | Bacteria | 855 |
| 761 | Ga0495662_0001052 | 3300046476 | Bacteria | 13534 |
| 762 | Ga0495662_0241215 | 3300046476 | Unclassified | 891 |
| 763 | Ga0495664_0244778 | 3300046477 | Unclassified | 1084 |
| 764 | Ga0495664_0292031 | 3300046477 | Bacteria | 984 |
| 765 | Ga0495584_0027488 | 3300046491 | Bacteria | 2883 |
| 766 | Ga0495584_0428770 | 3300046491 | Unclassified | 672 |
| 767 | Ga0495585_0021155 | 3300046492 | Bacteria | 3737 |
| 768 | Ga0495585_0097169 | 3300046492 | Bacteria | 1580 |
| 769 | Ga0495594_0111326 | 3300046499 | Bacteria | 1544 |
| 770 | Ga0495594_0237455 | 3300046499 | Unclassified | 1039 |
| 771 | Ga0495594_0336162 | 3300046499 | Unclassified | 860 |
| 772 | Ga0495596_0023254 | 3300046500 | Bacteria | 2516 |
| 773 | Ga0495596_0078477 | 3300046500 | Unclassified | 1282 |
| 774 | Ga0495596_0080272 | 3300046500 | Unclassified | 1267 |
| 775 | Ga0495596_0151932 | 3300046500 | Bacteria | 899 |
| 776 | Ga0495596_0173247 | 3300046500 | Bacteria | 839 |
| 777 | Ga0495607_0046332 | 3300046501 | Bacteria | 2554 |
| 778 | Ga0495583_0246092 | 3300046506 | Unclassified | 718 |
| 779 | Ga0495608_0008332 | 3300046511 | Bacteria | 7272 |
| 780 | Ga0495608_0011305 | 3300046511 | Bacteria | 6214 |
| 781 | Ga0495608_0108761 | 3300046511 | Bacteria | 1783 |
| 782 | Ga0495608_0337715 | 3300046511 | Bacteria | 929 |
| 783 | Ga0495618_0159990 | 3300046514 | Bacteria | 1436 |
| 784 | Ga0495618_0382355 | 3300046514 | Bacteria | 863 |
| 785 | Ga0495628_0074619 | 3300046516 | Bacteria | 2641 |
| 786 | Ga0495630_0063343 | 3300046517 | Bacteria | 2777 |
| 787 | Ga0495630_0064450 | 3300046517 | Bacteria | 2753 |
| 788 | Ga0495631_0024285 | 3300046518 | Bacteria | 2799 |
| 789 | Ga0495637_0158376 | 3300046520 | Unclassified | 851 |
| 790 | Ga0495644_0023053 | 3300046523 | Bacteria | 2370 |
| 791 | Ga0495644_0036891 | 3300046523 | Bacteria | 1844 |
| 792 | Ga0495644_0123394 | 3300046523 | Bacteria | 986 |
| 793 | Ga0495663_0013836 | 3300046525 | Bacteria | 2256 |
| 794 | Ga0495663_0063257 | 3300046525 | Unclassified | 1166 |
| 795 | Ga0495666_0000168 | 3300046526 | Bacteria | 27728 |
| 796 | Ga0495642_0015846 | 3300046528 | Bacteria | 2934 |
| 797 | Ga0495652_0027449 | 3300046529 | Bacteria | 5016 |
| 798 | Ga0495652_0117747 | 3300046529 | Bacteria | 2124 |
| 799 | Ga0495665_0000038 | 3300046531 | Bacteria | 51967 |
| 800 | Ga0495640_0061516 | 3300046533 | Bacteria | 2550 |
| 801 | Ga0495640_0109551 | 3300046533 | Bacteria | 1805 |
| 802 | Ga0495640_0170889 | 3300046533 | Unclassified | 1389 |
| 803 | Ga0495586_0044768 | 3300046535 | Unclassified | 2384 |
| 804 | Ga0495586_0087123 | 3300046535 | Bacteria | 1721 |
| 805 | Ga0495587_0051345 | 3300046536 | Bacteria | 2438 |
| 806 | Ga0495587_0136115 | 3300046536 | Bacteria | 1403 |
| 807 | Ga0495609_0034973 | 3300046538 | Unclassified | 2276 |
| 808 | Ga0495609_0056328 | 3300046538 | Bacteria | 1742 |
| 809 | Ga0495609_0081141 | 3300046538 | Unclassified | 1418 |
| 810 | Ga0495645_0020312 | 3300046543 | Bacteria | 4789 |
| 811 | Ga0495645_0134585 | 3300046543 | Bacteria | 1729 |
| 812 | Ga0495633_0075557 | 3300046558 | Bacteria | 1569 |
| 813 | Ga0495656_0004926 | 3300046615 | Bacteria | 4596 |
| 814 | Ga0495656_0020371 | 3300046615 | Unclassified | 2572 |
| 815 | Ga0495656_0073680 | 3300046615 | Bacteria | 1523 |
| 816 | Ga0495656_0082347 | 3300046615 | Unclassified | 1455 |
| 817 | Ga0495668_0159375 | 3300046616 | Bacteria | 1236 |
| 818 | Ga0495634_0032310 | 3300046642 | Bacteria | 3599 |
| 819 | Ga0495634_0046482 | 3300046642 | Bacteria | 2929 |
| 820 | Ga0495634_0125069 | 3300046642 | Bacteria | 1644 |
| 821 | Ga0495611_0009038 | 3300046648 | Bacteria | 4215 |
| 822 | Ga0495611_0087260 | 3300046648 | Bacteria | 1440 |
| 823 | Ga0495635_0016870 | 3300046663 | Bacteria | 5099 |
| 824 | Ga0495635_0045671 | 3300046663 | Bacteria | 3022 |
| 825 | Ga0495659_0002908 | 3300046664 | Bacteria | 5499 |
| 826 | Ga0495659_0009308 | 3300046664 | Unclassified | 3134 |
| 827 | Ga0495659_0076923 | 3300046664 | Unclassified | 1260 |
| 828 | Ga0495659_0091623 | 3300046664 | Unclassified | 1168 |
| 829 | Ga0495588_0155332 | 3300046674 | Unclassified | 1210 |
| 830 | Ga0495588_0162951 | 3300046674 | Unclassified | 1179 |
| 831 | Ga0495657_0114026 | 3300046675 | Unclassified | 1709 |
| 832 | Ga0495599_0005941 | 3300046678 | Bacteria | 7340 |
| 833 | Ga0495599_0035792 | 3300046678 | Bacteria | 3116 |
| 834 | Ga0495646_0016254 | 3300046680 | Bacteria | 4724 |
| 835 | Ga0495646_0040322 | 3300046680 | Bacteria | 2877 |
| 836 | Ga0495646_0084300 | 3300046680 | Bacteria | 1845 |
| 837 | Ga0495647_0014147 | 3300046681 | Bacteria | 2776 |
| 838 | Ga0495647_0194017 | 3300046681 | Bacteria | 888 |
| 839 | Ga0495647_0245049 | 3300046681 | Bacteria | 796 |
| 840 | Ga0495658_0120967 | 3300046683 | Bacteria | 1583 |
| 841 | Ga0495658_0128567 | 3300046683 | Bacteria | 1540 |
| 842 | Ga0495669_0018351 | 3300046684 | Bacteria | 3008 |
| 843 | Ga0495613_0012499 | 3300046689 | Bacteria | 6309 |
| 844 | Ga0495613_0305541 | 3300046689 | Unclassified | 1100 |
| 845 | Ga0495624_0022102 | 3300046690 | Bacteria | 4210 |
| 846 | Ga0495624_0044304 | 3300046690 | Bacteria | 2836 |
| 847 | Ga0495624_0105896 | 3300046690 | Bacteria | 1730 |
| 848 | Ga0495624_0134073 | 3300046690 | Bacteria | 1518 |
| 849 | Ga0495589_0011190 | 3300046794 | Bacteria | 4656 |
| 850 | Ga0495600_0096760 | 3300046809 | Bacteria | 1924 |
| 851 | Ga0495660_0065583 | 3300046810 | Bacteria | 1938 |
| 852 | Ga0495581_0002990 | 3300047315 | Bacteria | 9687 |
| 853 | Ga0495581_0006726 | 3300047315 | Bacteria | 6667 |
| 854 | Ga0495604_0175959 | 3300047317 | Unclassified | 1500 |
| 855 | Ga0495674_0050204 | 3300047319 | Bacteria | 3682 |
| 856 | Ga0495676_0012944 | 3300047321 | Bacteria | 7504 |
| 857 | Ga0495676_0125215 | 3300047321 | Bacteria | 1863 |
| 858 | Ga0495680_0041623 | 3300047322 | Bacteria | 3652 |
| 859 | Ga0495680_0065347 | 3300047322 | Bacteria | 2786 |
| 860 | Ga0495680_0262927 | 3300047322 | Bacteria | 1220 |
| 861 | Ga0495677_0005967 | 3300047445 | Bacteria | 4611 |
| 862 | Ga0495677_0020441 | 3300047445 | Bacteria | 2400 |
| 863 | Ga0495677_0039234 | 3300047445 | Bacteria | 1731 |
| 864 | Ga0495679_077974 | 3300047446 | Unclassified | 945 |
| 865 | Ga0495679_151229 | 3300047446 | Unclassified | 623 |
| 866 | Ga0495673_0132476 | 3300047469 | Bacteria | 979 |
| 867 | Ga0495684_0001595 | 3300047471 | Bacteria | 18196 |
| 868 | Ga0495684_0475614 | 3300047471 | Bacteria | 863 |
| 869 | Ga0495593_0001683 | 3300047673 | Bacteria | 13111 |
| 870 | Ga0495602_0033921 | 3300048088 | Bacteria | 4781 |
| 871 | Ga0495602_0062381 | 3300048088 | Bacteria | 3234 |
| 872 | Ga0495602_0357648 | 3300048088 | Unclassified | 1052 |
| 873 | Ga0495614_0000113 | 3300048089 | Bacteria | 27871 |
| 874 | Ga0495626_0117746 | 3300048091 | Bacteria | 1145 |
| 875 | Ga0496100_0040354 | 3300048903 | Unclassified | 2969 |
| 876 | Ga0496100_0048695 | 3300048903 | Bacteria | 2737 |
| 877 | Ga0496100_0137668 | 3300048903 | Bacteria | 1727 |
| 878 | Ga0496100_0242380 | 3300048903 | Unclassified | 1331 |
| 879 | Ga0496100_0392288 | 3300048903 | Bacteria | 1056 |
| 880 | Ga0496100_0495068 | 3300048903 | Unclassified | 941 |
| 881 | Ga0496101_0166317 | 3300048904 | Bacteria | 1693 |
| 882 | Ga0496101_0186014 | 3300048904 | Bacteria | 1601 |
| 883 | Ga0496101_0348536 | 3300048904 | Unclassified | 1163 |
| 884 | Ga0496102_0011804 | 3300048905 | Bacteria | 7540 |
| 885 | Ga0496102_0108999 | 3300048905 | Bacteria | 2580 |
| 886 | Ga0496102_0244267 | 3300048905 | Bacteria | 1693 |
| 887 | Ga0496102_0476335 | 3300048905 | Unclassified | 1169 |
| 888 | Ga0496102_0881774 | 3300048905 | Bacteria | 817 |
| 889 | Ga0496103_0155600 | 3300048906 | Bacteria | 1465 |
| 890 | Ga0496103_0187989 | 3300048906 | Bacteria | 1328 |
| 891 | Ga0496103_0546816 | 3300048906 | Unclassified | 739 |
| 892 | Ga0496104_0000796 | 3300048907 | Bacteria | 27065 |
| 893 | Ga0496104_0015518 | 3300048907 | Bacteria | 6900 |
| 894 | Ga0496104_0055323 | 3300048907 | Bacteria | 3752 |
| 895 | Ga0496104_0105853 | 3300048907 | Bacteria | 2695 |
| 896 | Ga0496104_0237597 | 3300048907 | Bacteria | 1734 |
| 897 | Ga0496105_0002479 | 3300048908 | Bacteria | 13363 |
| 898 | Ga0496105_0004890 | 3300048908 | Bacteria | 10128 |
| 899 | Ga0496105_0014167 | 3300048908 | Bacteria | 6345 |
| 900 | Ga0496105_0072063 | 3300048908 | Bacteria | 2855 |
| 901 | Ga0496105_0143570 | 3300048908 | Bacteria | 1964 |
| 902 | Ga0496105_0973287 | 3300048908 | Unclassified | 636 |
| 903 | Ga0496106_0054377 | 3300048909 | Bacteria | 3025 |
| 904 | Ga0496106_0302959 | 3300048909 | Bacteria | 1282 |
| 905 | Ga0496107_0085794 | 3300048910 | Bacteria | 2297 |
| 906 | Ga0496107_0108861 | 3300048910 | Unclassified | 2035 |
| 907 | Ga0496107_0242849 | 3300048910 | Bacteria | 1340 |
| 908 | Ga0496107_0276050 | 3300048910 | Bacteria | 1251 |
| 909 | Ga0496107_0457240 | 3300048910 | Unclassified | 948 |
| 910 | Ga0496107_0537404 | 3300048910 | Bacteria | 866 |
| 911 | Ga0496107_0620776 | 3300048910 | Unclassified | 798 |
| 912 | Ga0496108_0013267 | 3300048911 | Bacteria | 6716 |
| 913 | Ga0496108_0017218 | 3300048911 | Bacteria | 5911 |
| 914 | Ga0496108_0023902 | 3300048911 | Bacteria | 5031 |
| 915 | Ga0496108_0037517 | 3300048911 | Bacteria | 4037 |
| 916 | Ga0496108_0516857 | 3300048911 | Bacteria | 1042 |
| 917 | Ga0496109_0002279 | 3300048912 | Bacteria | 15952 |
| 918 | Ga0496109_0003664 | 3300048912 | Bacteria | 12839 |
| 919 | Ga0496109_0017231 | 3300048912 | Bacteria | 6329 |
| 920 | Ga0496109_0025028 | 3300048912 | Bacteria | 5314 |
| 921 | Ga0496109_0073603 | 3300048912 | Bacteria | 3139 |
| 922 | Ga0496109_0189427 | 3300048912 | Bacteria | 1933 |
| 923 | Ga0496109_0256808 | 3300048912 | Bacteria | 1646 |
| 924 | Ga0496109_0296581 | 3300048912 | Bacteria | 1524 |
| 925 | Ga0496109_0340359 | 3300048912 | Bacteria | 1416 |
| 926 | Ga0496109_0351964 | 3300048912 | Bacteria | 1391 |
| 927 | Ga0496109_0681225 | 3300048912 | Bacteria | 965 |
| 928 | Ga0496110_0003721 | 3300048913 | Bacteria | 11747 |
| 929 | Ga0496110_0011450 | 3300048913 | Bacteria | 7260 |
| 930 | Ga0496110_0025824 | 3300048913 | Bacteria | 5022 |
| 931 | Ga0496110_0026248 | 3300048913 | Bacteria | 4982 |
| 932 | Ga0496110_0055798 | 3300048913 | Bacteria | 3476 |
| 933 | Ga0496110_0061868 | 3300048913 | Bacteria | 3305 |
| 934 | Ga0496110_0166595 | 3300048913 | Bacteria | 1998 |
| 935 | Ga0496110_0182613 | 3300048913 | Bacteria | 1905 |
| 936 | Ga0496110_0356964 | 3300048913 | Bacteria | 1332 |
| 937 | Ga0496110_0469651 | 3300048913 | Unclassified | 1146 |
| 938 | Ga0496111_0005145 | 3300048914 | Bacteria | 8338 |
| 939 | Ga0496111_0012987 | 3300048914 | Bacteria | 5653 |
| 940 | Ga0496111_0024923 | 3300048914 | Bacteria | 4219 |
| 941 | Ga0496111_0036864 | 3300048914 | Bacteria | 3497 |
| 942 | Ga0496111_0050839 | 3300048914 | Bacteria | 2991 |
| 943 | Ga0496111_0058734 | 3300048914 | Bacteria | 2785 |
| 944 | Ga0496111_0061451 | 3300048914 | Bacteria | 2723 |
| 945 | Ga0496111_0108228 | 3300048914 | Bacteria | 2047 |
| 946 | Ga0496111_0257099 | 3300048914 | Bacteria | 1296 |
| 947 | Ga0496111_0887150 | 3300048914 | Bacteria | 643 |
| 948 | Ga0496112_0009544 | 3300048915 | Bacteria | 8751 |
| 949 | Ga0496112_0028258 | 3300048915 | Bacteria | 5413 |
| 950 | Ga0496112_0055404 | 3300048915 | Bacteria | 3899 |
| 951 | Ga0496112_0101343 | 3300048915 | Bacteria | 2849 |
| 952 | Ga0496112_0127573 | 3300048915 | Unclassified | 2515 |
| 953 | Ga0496112_0183213 | 3300048915 | Unclassified | 2058 |
| 954 | Ga0496112_0312290 | 3300048915 | Bacteria | 1517 |
| 955 | Ga0496112_0328738 | 3300048915 | Bacteria | 1473 |
| 956 | Ga0496112_0375135 | 3300048915 | Bacteria | 1364 |
| 957 | Ga0496112_0532175 | 3300048915 | Bacteria | 1109 |
| 958 | Ga0496112_0996578 | 3300048915 | Bacteria | 758 |
| 959 | Ga0496113_0027915 | 3300048916 | Bacteria | 4052 |
| 960 | Ga0496113_0028180 | 3300048916 | Bacteria | 4037 |
| 961 | Ga0496113_0050677 | 3300048916 | Bacteria | 3096 |
| 962 | Ga0496113_0096668 | 3300048916 | Bacteria | 2284 |
| 963 | Ga0496113_0250008 | 3300048916 | Bacteria | 1415 |
| 964 | Ga0496113_0262144 | 3300048916 | Unclassified | 1381 |
| 965 | Ga0496114_0005323 | 3300048917 | Bacteria | 10055 |
| 966 | Ga0496114_0014999 | 3300048917 | Bacteria | 6230 |
| 967 | Ga0496114_0029594 | 3300048917 | Bacteria | 4504 |
| 968 | Ga0496114_0075226 | 3300048917 | Bacteria | 2844 |
| 969 | Ga0496114_0137754 | 3300048917 | Bacteria | 2111 |
| 970 | Ga0496114_0224911 | 3300048917 | Bacteria | 1648 |
| 971 | Ga0496114_0400247 | 3300048917 | Bacteria | 1216 |
| 972 | Ga0496114_0861432 | 3300048917 | Bacteria | 786 |
| 973 | Ga0496115_0019305 | 3300048918 | Bacteria | 5245 |
| 974 | Ga0496115_0029074 | 3300048918 | Bacteria | 4338 |
| 975 | Ga0496115_0100380 | 3300048918 | Bacteria | 2372 |
| 976 | Ga0496115_0648755 | 3300048918 | Unclassified | 834 |
| 977 | Ga0496115_0738063 | 3300048918 | Unclassified | 771 |
| 978 | Ga0501031_0018283 | 3300049568 | Bacteria | 4561 |
| 979 | Ga0501031_0035031 | 3300049568 | Bacteria | 3274 |
| 980 | Ga0501031_0042296 | 3300049568 | Bacteria | 2974 |
| 981 | Ga0501031_0187148 | 3300049568 | Bacteria | 1352 |
| 982 | Ga0501031_0357122 | 3300049568 | Bacteria | 946 |
| 983 | Ga0501031_0379115 | 3300049568 | Bacteria | 915 |
| 984 | Ga0501032_0017415 | 3300049569 | Bacteria | 5046 |
| 985 | Ga0501032_0057394 | 3300049569 | Bacteria | 2616 |
| 986 | Ga0501032_0059129 | 3300049569 | Unclassified | 2573 |
| 987 | Ga0501032_0696749 | 3300049569 | Bacteria | 644 |
| 988 | Ga0501033_0033324 | 3300049570 | Bacteria | 3867 |
| 989 | Ga0501033_0063914 | 3300049570 | Unclassified | 2708 |
| 990 | Ga0501033_0128523 | 3300049570 | Bacteria | 1836 |
| 991 | Ga0501033_0160272 | 3300049570 | Unclassified | 1620 |
| 992 | Ga0501034_0241020 | 3300049571 | Bacteria | 1754 |
| 993 | Ga0501034_0426389 | 3300049571 | Bacteria | 1247 |
| 994 | Ga0501036_0007462 | 3300049572 | Bacteria | 8913 |
| 995 | Ga0501036_0012198 | 3300049572 | Bacteria | 7120 |
| 996 | Ga0501036_0018707 | 3300049572 | Bacteria | 5808 |
| 997 | Ga0501036_0040352 | 3300049572 | Bacteria | 3947 |
| 998 | Ga0501036_0095912 | 3300049572 | Bacteria | 2507 |
| 999 | Ga0501036_0141522 | 3300049572 | Unclassified | 2030 |
| 1000 | Ga0501036_0178641 | 3300049572 | Bacteria | 1787 |
| 1001 | Ga0501036_0627690 | 3300049572 | Bacteria | 890 |
| 1002 | Ga0501037_0007291 | 3300049573 | Bacteria | 8083 |
| 1003 | Ga0501037_0175286 | 3300049573 | Bacteria | 1523 |
| 1004 | Ga0501037_0289727 | 3300049573 | Unclassified | 1139 |
| 1005 | Ga0501037_0299508 | 3300049573 | Unclassified | 1117 |
| 1006 | Ga0501037_0342775 | 3300049573 | Unclassified | 1032 |
| 1007 | Ga0501037_0455887 | 3300049573 | Bacteria | 872 |
| 1008 | Ga0501038_0034894 | 3300049574 | Bacteria | 4420 |
| 1009 | Ga0501038_0039536 | 3300049574 | Bacteria | 4125 |
| 1010 | Ga0501038_0039616 | 3300049574 | Bacteria | 4121 |
| 1011 | Ga0501038_0159160 | 3300049574 | Bacteria | 1836 |
| 1012 | Ga0501038_0402683 | 3300049574 | Bacteria | 1058 |
| 1013 | Ga0501038_0475108 | 3300049574 | Unclassified | 959 |
| 1014 | Ga0501038_0713714 | 3300049574 | Bacteria | 750 |
| 1015 | Ga0501039_0009095 | 3300049575 | Bacteria | 7572 |
| 1016 | Ga0501039_0009928 | 3300049575 | Bacteria | 7259 |
| 1017 | Ga0501039_0016770 | 3300049575 | Bacteria | 5613 |
| 1018 | Ga0501039_0021738 | 3300049575 | Bacteria | 4922 |
| 1019 | Ga0501039_0343500 | 3300049575 | Unclassified | 1173 |
| 1020 | Ga0501039_0387720 | 3300049575 | Bacteria | 1097 |
| 1021 | Ga0501039_0485459 | 3300049575 | Bacteria | 970 |
| 1022 | Ga0501039_0576329 | 3300049575 | Unclassified | 883 |
| 1023 | Ga0501040_0002593 | 3300049576 | Bacteria | 11649 |
| 1024 | Ga0501040_0018564 | 3300049576 | Bacteria | 4618 |
| 1025 | Ga0501040_0028374 | 3300049576 | Bacteria | 3772 |
| 1026 | Ga0501040_0041491 | 3300049576 | Bacteria | 3134 |
| 1027 | Ga0501040_0045154 | 3300049576 | Unclassified | 3004 |
| 1028 | Ga0501040_0152107 | 3300049576 | Bacteria | 1633 |
| 1029 | Ga0501040_0269586 | 3300049576 | Bacteria | 1215 |
| 1030 | Ga0501040_0315898 | 3300049576 | Unclassified | 1117 |
| 1031 | Ga0501040_0358307 | 3300049576 | Bacteria | 1045 |
| 1032 | Ga0501041_0007274 | 3300049577 | Bacteria | 6499 |
| 1033 | Ga0501041_0012870 | 3300049577 | Bacteria | 4956 |
| 1034 | Ga0501041_0028611 | 3300049577 | Bacteria | 3362 |
| 1035 | Ga0501041_0046929 | 3300049577 | Bacteria | 2628 |
| 1036 | Ga0501041_0072387 | 3300049577 | Unclassified | 2117 |
| 1037 | Ga0501041_0118236 | 3300049577 | Unclassified | 1646 |
| 1038 | Ga0501041_0119709 | 3300049577 | Bacteria | 1636 |
| 1039 | Ga0501041_0273289 | 3300049577 | Bacteria | 1063 |
| 1040 | Ga0501041_0476377 | 3300049577 | Bacteria | 793 |
| 1041 | Ga0501042_0004401 | 3300049578 | Bacteria | 8987 |
| 1042 | Ga0501042_0061438 | 3300049578 | Bacteria | 2684 |
| 1043 | Ga0501042_0076005 | 3300049578 | Bacteria | 2403 |
| 1044 | Ga0501042_0084004 | 3300049578 | Unclassified | 2282 |
| 1045 | Ga0501042_0095116 | 3300049578 | Unclassified | 2140 |
| 1046 | Ga0501042_0199933 | 3300049578 | Unclassified | 1441 |
| 1047 | Ga0501042_0800539 | 3300049578 | Unclassified | 686 |
| 1048 | Ga0501043_0017112 | 3300049579 | Bacteria | 5684 |
| 1049 | Ga0501043_0111447 | 3300049579 | Bacteria | 2148 |
| 1050 | Ga0501043_0127343 | 3300049579 | Unclassified | 1997 |
| 1051 | Ga0501043_0222958 | 3300049579 | Unclassified | 1458 |
| 1052 | Ga0501046_0002178 | 3300049580 | Bacteria | 18497 |
| 1053 | Ga0501046_0012656 | 3300049580 | Bacteria | 7174 |
| 1054 | Ga0501046_0027500 | 3300049580 | Bacteria | 4638 |
| 1055 | Ga0501046_0073092 | 3300049580 | Bacteria | 2661 |
| 1056 | Ga0501046_0080985 | 3300049580 | Bacteria | 2508 |
| 1057 | Ga0501047_0046233 | 3300049581 | Bacteria | 4207 |
| 1058 | Ga0501048_0028695 | 3300049582 | Bacteria | 4040 |
| 1059 | Ga0501048_0030829 | 3300049582 | Bacteria | 3880 |
| 1060 | Ga0501048_0056720 | 3300049582 | Bacteria | 2778 |
| 1061 | Ga0501048_0063481 | 3300049582 | Bacteria | 2612 |
| 1062 | Ga0501048_0165342 | 3300049582 | Bacteria | 1566 |
| 1063 | Ga0501048_0833981 | 3300049582 | Bacteria | 663 |
| 1064 | Ga0501067_0007990 | 3300049583 | Bacteria | 5875 |
| 1065 | Ga0501067_0028914 | 3300049583 | Bacteria | 3072 |
| 1066 | Ga0501067_0118208 | 3300049583 | Bacteria | 1474 |
| 1067 | Ga0501067_0118402 | 3300049583 | Bacteria | 1473 |
| 1068 | Ga0501067_0140764 | 3300049583 | Bacteria | 1343 |
| 1069 | Ga0501068_0003747 | 3300049584 | Bacteria | 8226 |
| 1070 | Ga0501068_0007558 | 3300049584 | Bacteria | 6015 |
| 1071 | Ga0501068_0008746 | 3300049584 | Bacteria | 5648 |
| 1072 | Ga0501068_0035139 | 3300049584 | Bacteria | 2991 |
| 1073 | Ga0501068_0041057 | 3300049584 | Bacteria | 2779 |
| 1074 | Ga0501068_0255294 | 3300049584 | Bacteria | 1118 |
| 1075 | Ga0501068_0508359 | 3300049584 | Bacteria | 782 |
| 1076 | Ga0501069_0000968 | 3300049585 | Bacteria | 13668 |
| 1077 | Ga0501069_0015555 | 3300049585 | Bacteria | 4080 |
| 1078 | Ga0501069_0016217 | 3300049585 | Bacteria | 3997 |
| 1079 | Ga0501069_0028350 | 3300049585 | Bacteria | 3069 |
| 1080 | Ga0501069_0053876 | 3300049585 | Bacteria | 2240 |
| 1081 | Ga0501069_0069932 | 3300049585 | Bacteria | 1966 |
| 1082 | Ga0501070_0002450 | 3300049586 | Bacteria | 16255 |
| 1083 | Ga0501070_0074032 | 3300049586 | Bacteria | 2819 |
| 1084 | Ga0501070_0080974 | 3300049586 | Bacteria | 2686 |
| 1085 | Ga0501070_0089238 | 3300049586 | Bacteria | 2551 |
| 1086 | Ga0501070_0175751 | 3300049586 | Bacteria | 1763 |
| 1087 | Ga0501070_0742260 | 3300049586 | Bacteria | 774 |
| 1088 | Ga0501071_0001822 | 3300049587 | Bacteria | 12626 |
| 1089 | Ga0501071_0003354 | 3300049587 | Bacteria | 10006 |
| 1090 | Ga0501071_0006541 | 3300049587 | Bacteria | 7567 |
| 1091 | Ga0501071_0011840 | 3300049587 | Bacteria | 5887 |
| 1092 | Ga0501071_0048676 | 3300049587 | Unclassified | 3050 |
| 1093 | Ga0501071_0073754 | 3300049587 | Unclassified | 2490 |
| 1094 | Ga0501071_0172275 | 3300049587 | Bacteria | 1620 |
| 1095 | Ga0501071_0227235 | 3300049587 | Bacteria | 1405 |
| 1096 | Ga0501071_0275830 | 3300049587 | Unclassified | 1272 |
| 1097 | Ga0501071_0281216 | 3300049587 | Unclassified | 1259 |
| 1098 | Ga0501071_0304897 | 3300049587 | Unclassified | 1208 |
| 1099 | Ga0501071_0427304 | 3300049587 | Bacteria | 1013 |
| 1100 | Ga0501071_0924042 | 3300049587 | Bacteria | 673 |
| 1101 | Ga0501072_0008618 | 3300049588 | Bacteria | 7741 |
| 1102 | Ga0501072_0013405 | 3300049588 | Bacteria | 6273 |
| 1103 | Ga0501072_0022455 | 3300049588 | Bacteria | 4895 |
| 1104 | Ga0501072_0029064 | 3300049588 | Bacteria | 4315 |
| 1105 | Ga0501072_0054949 | 3300049588 | Unclassified | 3139 |
| 1106 | Ga0501072_0073731 | 3300049588 | Bacteria | 2698 |
| 1107 | Ga0501072_0075660 | 3300049588 | Bacteria | 2663 |
| 1108 | Ga0501072_0153749 | 3300049588 | Unclassified | 1834 |
| 1109 | Ga0501072_0213739 | 3300049588 | Bacteria | 1537 |
| 1110 | Ga0501072_0259620 | 3300049588 | Unclassified | 1383 |
| 1111 | Ga0501073_0003805 | 3300049589 | Bacteria | 11333 |
| 1112 | Ga0501073_0043484 | 3300049589 | Bacteria | 3168 |
| 1113 | Ga0501074_0001334 | 3300049590 | Bacteria | 16397 |
| 1114 | Ga0501074_0023942 | 3300049590 | Bacteria | 4437 |
| 1115 | Ga0501074_0032573 | 3300049590 | Bacteria | 3775 |
| 1116 | Ga0501074_0050916 | 3300049590 | Bacteria | 2989 |
| 1117 | Ga0501074_0127027 | 3300049590 | Unclassified | 1824 |
| 1118 | Ga0501074_0213677 | 3300049590 | Unclassified | 1374 |
| 1119 | Ga0501074_0274828 | 3300049590 | Unclassified | 1198 |
| 1120 | Ga0501075_0014061 | 3300049591 | Bacteria | 5730 |
| 1121 | Ga0501075_0030416 | 3300049591 | Bacteria | 4000 |
| 1122 | Ga0501075_0031563 | 3300049591 | Bacteria | 3933 |
| 1123 | Ga0501075_0031655 | 3300049591 | Bacteria | 3927 |
| 1124 | Ga0501075_0106004 | 3300049591 | Unclassified | 2136 |
| 1125 | Ga0501075_0168536 | 3300049591 | Bacteria | 1671 |
| 1126 | Ga0501075_0169271 | 3300049591 | Bacteria | 1667 |
| 1127 | Ga0501075_0303363 | 3300049591 | Bacteria | 1217 |
| 1128 | Ga0501075_0314927 | 3300049591 | Bacteria | 1192 |
| 1129 | Ga0501076_0001883 | 3300049592 | Bacteria | 14295 |
| 1130 | Ga0501076_0004930 | 3300049592 | Bacteria | 9551 |
| 1131 | Ga0501076_0014766 | 3300049592 | Bacteria | 5888 |
| 1132 | Ga0501076_0024867 | 3300049592 | Bacteria | 4632 |
| 1133 | Ga0501076_0030603 | 3300049592 | Bacteria | 4193 |
| 1134 | Ga0501076_0031075 | 3300049592 | Bacteria | 4162 |
| 1135 | Ga0501076_0049285 | 3300049592 | Bacteria | 3331 |
| 1136 | Ga0501076_0330005 | 3300049592 | Unclassified | 1251 |
| 1137 | Ga0501076_0360689 | 3300049592 | Bacteria | 1194 |
| 1138 | Ga0501076_0591820 | 3300049592 | Unclassified | 915 |
| 1139 | Ga0501077_0011665 | 3300049593 | Bacteria | 5492 |
| 1140 | Ga0501077_0019049 | 3300049593 | Bacteria | 4339 |
| 1141 | Ga0501077_0020984 | 3300049593 | Unclassified | 4133 |
| 1142 | Ga0501077_0022898 | 3300049593 | Bacteria | 3959 |
| 1143 | Ga0501077_0033852 | 3300049593 | Bacteria | 3252 |
| 1144 | Ga0501077_0049117 | 3300049593 | Unclassified | 2681 |
| 1145 | Ga0501077_0212765 | 3300049593 | Bacteria | 1228 |
| 1146 | Ga0501077_0218055 | 3300049593 | Bacteria | 1213 |
| 1147 | Ga0501077_0636810 | 3300049593 | Unclassified | 685 |
| 1148 | Ga0501079_0004568 | 3300049741 | Bacteria | 10264 |
| 1149 | Ga0501079_0007431 | 3300049741 | Bacteria | 8292 |
| 1150 | Ga0501079_0011783 | 3300049741 | Bacteria | 6676 |
| 1151 | Ga0501079_0031637 | 3300049741 | Bacteria | 4067 |
| 1152 | Ga0501079_0089736 | 3300049741 | Bacteria | 2380 |
| 1153 | Ga0501079_0102494 | 3300049741 | Bacteria | 2219 |
| 1154 | Ga0501079_0166093 | 3300049741 | Bacteria | 1721 |
| 1155 | Ga0501079_0178441 | 3300049741 | Bacteria | 1657 |
| 1156 | Ga0501079_0186151 | 3300049741 | Bacteria | 1621 |
| 1157 | Ga0501079_0256442 | 3300049741 | Bacteria | 1367 |
| 1158 | Ga0501079_0607452 | 3300049741 | Bacteria | 861 |
| 1159 | Ga0501080_0003932 | 3300049742 | Bacteria | 13156 |
| 1160 | Ga0501080_0026594 | 3300049742 | Bacteria | 5376 |
| 1161 | Ga0501080_0035680 | 3300049742 | Bacteria | 4641 |
| 1162 | Ga0501080_0138230 | 3300049742 | Bacteria | 2253 |
| 1163 | Ga0501080_0205385 | 3300049742 | Bacteria | 1807 |
| 1164 | Ga0501080_0215163 | 3300049742 | Unclassified | 1760 |
| 1165 | Ga0501080_0237799 | 3300049742 | Bacteria | 1663 |
| 1166 | Ga0501080_0609863 | 3300049742 | Bacteria | 968 |
| 1167 | Ga0501081_0004593 | 3300049743 | Bacteria | 8865 |
| 1168 | Ga0501081_0012409 | 3300049743 | Bacteria | 5599 |
| 1169 | Ga0501081_0013193 | 3300049743 | Bacteria | 5434 |
| 1170 | Ga0501081_0030588 | 3300049743 | Bacteria | 3645 |
| 1171 | Ga0501081_0129607 | 3300049743 | Unclassified | 1802 |
| 1172 | Ga0501081_0133495 | 3300049743 | Bacteria | 1775 |
| 1173 | Ga0501081_0171740 | 3300049743 | Unclassified | 1565 |
| 1174 | Ga0501081_0199485 | 3300049743 | Bacteria | 1451 |
| 1175 | Ga0501081_0491569 | 3300049743 | Bacteria | 914 |
| 1176 | Ga0501081_0519755 | 3300049743 | Bacteria | 888 |
| 1177 | Ga0501083_0031235 | 3300049744 | Bacteria | 3656 |
| 1178 | Ga0501083_0091182 | 3300049744 | Bacteria | 2012 |
| 1179 | Ga0501083_0196210 | 3300049744 | Unclassified | 1317 |
| 1180 | Ga0501083_0368241 | 3300049744 | Bacteria | 934 |
| 1181 | Ga0501083_0601399 | 3300049744 | Bacteria | 715 |
| 1182 | Ga0501035_0004561 | 3300049822 | Bacteria | 13144 |
| 1183 | Ga0501035_0040200 | 3300049822 | Bacteria | 4228 |
| 1184 | Ga0501035_0064632 | 3300049822 | Bacteria | 3251 |
| 1185 | Ga0501035_0251491 | 3300049822 | Unclassified | 1501 |
| 1186 | Ga0501035_0289560 | 3300049822 | Bacteria | 1382 |
| 1187 | Ga0501035_1063158 | 3300049822 | Bacteria | 634 |
| 1188 | Ga0501044_0029988 | 3300049823 | Bacteria | 5735 |
| 1189 | Ga0501044_0098704 | 3300049823 | Bacteria | 2940 |
| 1190 | Ga0501044_0224412 | 3300049823 | Bacteria | 1829 |
| 1191 | Ga0501044_0246877 | 3300049823 | Bacteria | 1728 |
| 1192 | Ga0501044_0520460 | 3300049823 | Bacteria | 1089 |
| 1193 | Ga0501045_0017589 | 3300049824 | Bacteria | 5076 |
| 1194 | Ga0501045_0021351 | 3300049824 | Bacteria | 4631 |
| 1195 | Ga0501045_0031191 | 3300049824 | Unclassified | 3860 |
| 1196 | Ga0501045_0038060 | 3300049824 | Bacteria | 3498 |
| 1197 | Ga0501045_0047388 | 3300049824 | Unclassified | 3130 |
| 1198 | Ga0501045_0070913 | 3300049824 | Bacteria | 2564 |
| 1199 | Ga0501045_0081791 | 3300049824 | Bacteria | 2381 |
| 1200 | Ga0501045_0535239 | 3300049824 | Unclassified | 869 |
| 1201 | nmdc:mga0yw44_241822_c1 | 3300050492 | Bacteria | 1200 |
| 1202 | nmdc:mga06z11_68021_c1 | 3300050494 | Bacteria | 1876 |
| 1203 | nmdc:mga05p37_10748_c1 | 3300050507 | Bacteria | 10866 |
| 1204 | nmdc:mga05p37_1190645_c1 | 3300050507 | Bacteria | 788 |
| 1205 | nmdc:mga05p37_144056_c1 | 3300050507 | Unclassified | 2918 |
| 1206 | nmdc:mga05p37_15198_c1 | 3300050507 | Bacteria | 9244 |
| 1207 | nmdc:mga05p37_204218_c1 | 3300050507 | Unclassified | 2391 |
| 1208 | nmdc:mga05p37_328080_c1 | 3300050507 | Unclassified | 1809 |
| 1209 | nmdc:mga05p37_51818_c1 | 3300050507 | Bacteria | 5047 |
| 1210 | nmdc:mga05p37_556335_c1 | 3300050507 | Unclassified | 1305 |
| 1211 | nmdc:mga05p37_79479_c1 | 3300050507 | Bacteria | 4038 |
| 1212 | nmdc:mga05p37_96370_c1 | 3300050507 | Bacteria | 3645 |
| 1213 | nmdc:mga05p37_96568_c1 | 3300050507 | Bacteria | 3641 |
| 1214 | nmdc:mga09592_129799_c1 | 3300050508 | Unclassified | 2168 |
| 1215 | nmdc:mga09592_146226_c1 | 3300050508 | Bacteria | 2038 |
| 1216 | nmdc:mga09592_61944_c1 | 3300050508 | Unclassified | 3165 |
| 1217 | nmdc:mga09592_648919_c1 | 3300050508 | Bacteria | 901 |
| 1218 | nmdc:mga0qj67_190955_c1 | 3300050509 | Bacteria | 1665 |
| 1219 | nmdc:mga06r32_108753_c1 | 3300050510 | Bacteria | 2726 |
| 1220 | nmdc:mga06r32_56625_c1 | 3300050510 | Bacteria | 3764 |
| 1221 | nmdc:mga06r32_663616_c1 | 3300050510 | Bacteria | 1010 |
| 1222 | nmdc:mga08y16_1224188_c1 | 3300050511 | Bacteria | 721 |
| 1223 | nmdc:mga08y16_23953_c1 | 3300050511 | Bacteria | 6447 |
| 1224 | nmdc:mga08y16_314437_c1 | 3300050511 | Bacteria | 1613 |
| 1225 | nmdc:mga08y16_402098_c1 | 3300050511 | Bacteria | 1401 |
| 1226 | nmdc:mga08y16_406548_c1 | 3300050511 | Unclassified | 1393 |
| 1227 | nmdc:mga08y16_51762_c1 | 3300050511 | Bacteria | 4297 |
| 1228 | nmdc:mga08y16_55749_c1 | 3300050511 | Bacteria | 4130 |
| 1229 | nmdc:mga08y16_948234_c1 | 3300050511 | Bacteria | 844 |
| 1230 | nmdc:mga08y16_9589_c1 | 3300050511 | Bacteria | 10165 |
| 1231 | nmdc:mga08y16_9855_c1 | 3300050511 | Bacteria | 10031 |
| 1232 | nmdc:mga0n895_1343907_c1 | 3300050512 | Bacteria | 684 |
| 1233 | nmdc:mga0n895_198815_c1 | 3300050512 | Bacteria | 2036 |
| 1234 | nmdc:mga0n895_227061_c1 | 3300050512 | Bacteria | 1895 |
| 1235 | nmdc:mga0n895_2841_c1 | 3300050512 | Bacteria | 13716 |
| 1236 | nmdc:mga0n895_380147_c1 | 3300050512 | Archaea | 1429 |
| 1237 | nmdc:mga0n895_624106_c1 | 3300050512 | Bacteria | 1079 |
| 1238 | nmdc:mga0n895_820070_c1 | 3300050512 | Unclassified | 920 |
| 1239 | nmdc:mga0rr50_1093779_c1 | 3300050513 | Unclassified | 678 |
| 1240 | nmdc:mga0rr50_114286_c1 | 3300050513 | Bacteria | 2140 |
| 1241 | nmdc:mga0rr50_153156_c1 | 3300050513 | Unclassified | 1865 |
| 1242 | nmdc:mga0rr50_425948_c1 | 3300050513 | Unclassified | 1123 |
| 1243 | nmdc:mga0rr50_64909_c1 | 3300050513 | Unclassified | 2764 |
| 1244 | nmdc:mga0rr50_9123_c1 | 3300050513 | Bacteria | 6213 |
| 1245 | nmdc:mga08x19_101458_c1 | 3300050514 | Unclassified | 1910 |
| 1246 | nmdc:mga08x19_337176_c1 | 3300050514 | Unclassified | 1051 |
| 1247 | nmdc:mga08x19_41493_c1 | 3300050514 | Unclassified | 2931 |
| 1248 | nmdc:mga08x19_509024_c1 | 3300050514 | Bacteria | 850 |
| 1249 | nmdc:mga08x19_7105_c1 | 3300050514 | Bacteria | 6647 |
| 1250 | nmdc:mga0a205_108212_c1 | 3300050515 | Bacteria | 2678 |
| 1251 | nmdc:mga0a205_145716_c2 | 3300050515 | Unclassified | 1558 |
| 1252 | nmdc:mga0a205_16200_c2 | 3300050515 | Bacteria | 3495 |
| 1253 | nmdc:mga0a205_34944_c1 | 3300050515 | Bacteria | 4826 |
| 1254 | nmdc:mga0a205_388828_c1 | 3300050515 | Bacteria | 1259 |
| 1255 | Ga0495601_0250938 | 3300053077 | Bacteria | 1155 |
| 1256 | Ga0495612_0014657 | 3300053078 | Bacteria | 3149 |
| 1257 | Ga0495612_0030486 | 3300053078 | Unclassified | 2172 |
| 1258 | Ga0495612_0225927 | 3300053078 | Bacteria | 829 |
| 1259 | Ga0495612_0359188 | 3300053078 | Unclassified | 658 |
| 1260 | Ga0495595_0030251 | 3300053084 | Bacteria | 2427 |
| 1261 | Ga0495595_0073577 | 3300053084 | Unclassified | 1618 |
| 1262 | Ga0495619_0105815 | 3300053085 | Bacteria | 1918 |
| 1263 | Ga0495619_0419371 | 3300053085 | Unclassified | 923 |
| 1264 | Ga0500566_0060298 | 3300053094 | Bacteria | 2149 |
| 1265 | Ga0501084_0000702 | 3300054114 | Bacteria | 25637 |
| 1266 | Ga0501084_0004889 | 3300054114 | Bacteria | 10948 |
| 1267 | Ga0501084_0015097 | 3300054114 | Bacteria | 6406 |
| 1268 | Ga0501084_0053524 | 3300054114 | Unclassified | 3376 |
| 1269 | Ga0501084_0058015 | 3300054114 | Bacteria | 3239 |
| 1270 | Ga0501084_0099065 | 3300054114 | Bacteria | 2447 |
| 1271 | Ga0501084_0122327 | 3300054114 | Bacteria | 2188 |
| 1272 | Ga0501084_0207121 | 3300054114 | Bacteria | 1655 |
| 1273 | Ga0501084_0688380 | 3300054114 | Unclassified | 862 |
| 1274 | Ga0501082_0008395 | 3300060353 | Bacteria | 8909 |
| 1275 | Ga0501082_0028610 | 3300060353 | Bacteria | 4800 |
| 1276 | Ga0501082_0046862 | 3300060353 | Bacteria | 3725 |
| 1277 | Ga0501082_0097199 | 3300060353 | Bacteria | 2545 |
| 1278 | Ga0501082_0524538 | 3300060353 | Bacteria | 1035 |
| 1279 | Ga0466962_0007956 | 3300061719 | Bacteria | 5085 |
| 1280 | Ga0466962_0069637 | 3300061719 | Bacteria | 1680 |
| 1281 | Ga0466962_0130698 | 3300061719 | Unclassified | 1213 |
| 1282 | Ga0530510_0013522 | 3300061734 | Bacteria | 5740 |
| 1283 | Ga0530510_0022536 | 3300061734 | Bacteria | 4487 |
| 1284 | Ga0530510_0029037 | 3300061734 | Bacteria | 3968 |
| 1285 | Ga0530510_0029848 | 3300061734 | Bacteria | 3914 |
| 1286 | Ga0530510_0038507 | 3300061734 | Bacteria | 3452 |
| 1287 | Ga0530510_0052654 | 3300061734 | Bacteria | 2941 |
| 1288 | Ga0530510_0069822 | 3300061734 | Bacteria | 2549 |
| 1289 | Ga0530510_0187655 | 3300061734 | Bacteria | 1534 |
| 1290 | Ga0530510_0548071 | 3300061734 | Unclassified | 878 |
| 1291 | Ga0530510_0628636 | 3300061734 | Unclassified | 817 |
| 1292 | Ga0081539_10001616 | |||
| 1293 | ARCol0yngRDRAFT_1002541 | |||
| 1294 | JGI24739J22299_10101662 | |||
| 1295 | JGI24738J21930_10005089 | |||
| 1296 | JGI24738J21930_10025082 | |||
| 1297 | JGI24744J21845_10017313 | |||
| 1298 | JGI24751J29686_10022821 | |||
| 1299 | JGI25406J46586_10006140 | |||
| 1300 | Ga0070658_10113960 | |||
| 1301 | Ga0070658_10487048 | |||
| 1302 | Ga0070676_10114811 | |||
| 1303 | Ga0070676_10323917 | |||
| 1304 | Ga0070676_10329435 | |||
| 1305 | Ga0070676_10535659 | |||
| 1306 | Ga0070683_100018764 | |||
| 1307 | Ga0070683_100069514 | |||
| 1308 | Ga0070683_100082124 | |||
| 1309 | Ga0070683_100105664 | |||
| 1310 | Ga0070683_100335551 | |||
| 1311 | Ga0070683_100416469 | |||
| 1312 | Ga0070670_100004543 | |||
| 1313 | Ga0070670_100034091 | |||
| 1314 | Ga0070670_100490662 | |||
| 1315 | Ga0068869_100015969 | |||
| 1316 | Ga0068869_100238926 | |||
| 1317 | Ga0070680_100033643 | |||
| 1318 | Ga0070680_100443039 | |||
| 1319 | Ga0070682_100042952 | |||
| 1320 | Ga0070682_100119707 | |||
| 1321 | Ga0070682_100140523 | |||
| 1322 | Ga0070682_100149332 | |||
| 1323 | Ga0068868_100043680 | |||
| 1324 | Ga0068868_100132068 | |||
| 1325 | Ga0068868_100132198 | |||
| 1326 | Ga0070660_100034044 | |||
| 1327 | Ga0070660_100246580 | |||
| 1328 | Ga0070660_100281925 | |||
| 1329 | Ga0070689_100044907 | |||
| 1330 | Ga0070689_100048469 | |||
| 1331 | Ga0070689_100444022 | |||
| 1332 | Ga0070691_10019191 | |||
| 1333 | Ga0070687_100049733 | |||
| 1334 | Ga0070687_100178613 | |||
| 1335 | Ga0070687_100178641 | |||
| 1336 | Ga0070661_100017470 | |||
| 1337 | Ga0070692_10037617 | |||
| 1338 | Ga0070668_100093189 | |||
| 1339 | Ga0070668_100173350 | |||
| 1340 | Ga0070668_100548700 | |||
| 1341 | Ga0070675_100010518 | |||
| 1342 | Ga0070675_100126852 | |||
| 1343 | Ga0070675_100497599 | |||
| 1344 | Ga0070671_100202581 | |||
| 1345 | Ga0070671_100462717 | |||
| 1346 | Ga0070674_100040412 | |||
| 1347 | Ga0070674_100057115 | |||
| 1348 | Ga0070674_100722205 | |||
| 1349 | Ga0070673_100019420 | |||
| 1350 | Ga0070673_101371575 | |||
| 1351 | Ga0070688_100001975 | |||
| 1352 | Ga0070688_100004454 | |||
| 1353 | Ga0070659_100017887 | |||
| 1354 | Ga0070659_100025870 | |||
| 1355 | Ga0070659_100077766 | |||
| 1356 | Ga0070659_100163147 | |||
| 1357 | Ga0070667_100495325 | |||
| 1358 | Ga0070703_10024265 | |||
| 1359 | Ga0070714_100027716 | |||
| 1360 | Ga0070714_100049463 | |||
| 1361 | Ga0070714_100295824 | |||
| 1362 | Ga0070714_100388107 | |||
| 1363 | Ga0070713_100012774 | |||
| 1364 | Ga0070713_100247191 | |||
| 1365 | Ga0070710_10003995 | |||
| 1366 | Ga0070701_10006783 | |||
| 1367 | Ga0070701_10009983 | |||
| 1368 | Ga0070701_10202233 | |||
| 1369 | Ga0070711_100014388 | |||
| 1370 | Ga0070705_100340421 | |||
| 1371 | Ga0070700_100018768 | |||
| 1372 | Ga0070694_100340796 | |||
| 1373 | Ga0070708_100107748 | |||
| 1374 | Ga0070708_100215676 | |||
| 1375 | Ga0070663_100138149 | |||
| 1376 | Ga0070663_100341091 | |||
| 1377 | Ga0070663_100403567 | |||
| 1378 | Ga0070678_100015299 | |||
| 1379 | Ga0070678_100341461 | |||
| 1380 | Ga0070678_100474542 | |||
| 1381 | Ga0070678_100817816 | |||
| 1382 | Ga0070662_100017869 | |||
| 1383 | Ga0070681_10051804 | |||
| 1384 | Ga0070681_10064216 | |||
| 1385 | Ga0070681_10140840 | |||
| 1386 | Ga0070681_10636910 | |||
| 1387 | Ga0068867_100073459 | |||
| 1388 | Ga0068867_100076136 | |||
| 1389 | Ga0068867_100094387 | |||
| 1390 | Ga0068867_100167137 | |||
| 1391 | Ga0070685_10006668 | |||
| 1392 | Ga0070685_10032533 | |||
| 1393 | Ga0070706_100072551 | |||
| 1394 | Ga0070706_100194571 | |||
| 1395 | Ga0070706_100420989 | |||
| 1396 | Ga0070707_100016491 | |||
| 1397 | Ga0070707_100118521 | |||
| 1398 | Ga0070707_100680356 | |||
| 1399 | Ga0070698_100072056 | |||
| 1400 | Ga0070698_100287842 | |||
| 1401 | Ga0070699_100108632 | |||
| 1402 | Ga0070699_100109399 | |||
| 1403 | Ga0070679_100092712 | |||
| 1404 | Ga0070679_100172072 | |||
| 1405 | Ga0070679_100257999 | |||
| 1406 | Ga0070684_100038493 | |||
| 1407 | Ga0070684_100050708 | |||
| 1408 | Ga0070684_100159658 | |||
| 1409 | Ga0070684_100204611 | |||
| 1410 | Ga0070684_100596873 | |||
| 1411 | Ga0070697_100377873 | |||
| 1412 | Ga0068853_100054926 | |||
| 1413 | Ga0068853_100301265 | |||
| 1414 | Ga0070672_100061543 | |||
| 1415 | Ga0070672_100073107 | |||
| 1416 | Ga0070686_100007432 | |||
| 1417 | Ga0070686_100025506 | |||
| 1418 | Ga0070695_100708038 | |||
| 1419 | Ga0070696_100196057 | |||
| 1420 | Ga0070693_100074406 | |||
| 1421 | Ga0070693_100083896 | |||
| 1422 | Ga0070665_100060819 | |||
| 1423 | Ga0070665_100261216 | |||
| 1424 | Ga0070704_100017249 | |||
| 1425 | Ga0070704_100025822 | |||
| 1426 | Ga0070704_100110292 | |||
| 1427 | Ga0068855_100065525 | |||
| 1428 | Ga0068855_100274562 | |||
| 1429 | Ga0070664_100085800 | |||
| 1430 | Ga0070664_100218013 | |||
| 1431 | Ga0070664_100319856 | |||
| 1432 | Ga0068857_100029085 | |||
| 1433 | Ga0068857_100037704 | |||
| 1434 | Ga0068857_100388186 | |||
| 1435 | Ga0068854_100380570 | |||
| 1436 | Ga0068854_100656966 | |||
| 1437 | Ga0068856_100045687 | |||
| 1438 | Ga0068856_100192200 | |||
| 1439 | Ga0068856_100266853 | |||
| 1440 | Ga0068856_100286890 | |||
| 1441 | Ga0070702_100054829 | |||
| 1442 | Ga0070702_100082071 | |||
| 1443 | Ga0070702_100082889 | |||
| 1444 | Ga0070702_100472662 | |||
| 1445 | Ga0070702_100912878 | |||
| 1446 | Ga0070702_100912879 | |||
| 1447 | Ga0068852_100139786 | |||
| 1448 | Ga0068852_100354367 | |||
| 1449 | Ga0068859_100052901 | |||
| 1450 | Ga0068859_100478502 | |||
| 1451 | Ga0068859_100808742 | |||
| 1452 | Ga0068864_100005306 | |||
| 1453 | Ga0068864_100059765 | |||
| 1454 | Ga0068864_100615416 | |||
| 1455 | Ga0068861_100064128 | |||
| 1456 | Ga0068861_100077238 | |||
| 1457 | Ga0068861_100146734 | |||
| 1458 | Ga0068861_100319548 | |||
| 1459 | Ga0068851_10020397 | |||
| 1460 | Ga0068870_10014339 | |||
| 1461 | Ga0068870_10032260 | |||
| 1462 | Ga0068870_10075623 | |||
| 1463 | Ga0068870_10104220 | |||
| 1464 | Ga0068863_100286719 | |||
| 1465 | Ga0068863_100496427 | |||
| 1466 | Ga0068858_100015291 | |||
| 1467 | Ga0068860_100221639 | |||
| 1468 | Ga0068862_101129874 | |||
| 1469 | Ga0081455_10014370 | |||
| 1470 | Ga0081455_10016183 | |||
| 1471 | Ga0081455_10064674 | |||
| 1472 | Ga0081455_10069014 | |||
| 1473 | Ga0081455_10077991 | |||
| 1474 | Ga0081455_10138500 | |||
| 1475 | Ga0081455_10180734 | |||
| 1476 | Ga0081455_10527148 | |||
| 1477 | Ga0081538_10113182 | |||
| 1478 | Ga0081540_1000836 | |||
| 1479 | Ga0081540_1003929 | |||
| 1480 | Ga0081540_1004796 | |||
| 1481 | Ga0081539_10000384 | |||
| 1482 | Ga0081539_10000628 | |||
| 1483 | Ga0081539_10001582 | |||
| 1484 | Ga0081539_10016030 | |||
| 1485 | Ga0070717_10015446 | |||
| 1486 | Ga0070717_10017014 | |||
| 1487 | Ga0070717_10020582 | |||
| 1488 | Ga0070717_10591351 | |||
| 1489 | Ga0075365_10102482 | |||
| 1490 | Ga0075432_10000451 | |||
| 1491 | Ga0075432_10039012 | |||
| 1492 | Ga0070715_10118932 | |||
| 1493 | Ga0070716_100325404 | |||
| 1494 | Ga0070712_100017460 | |||
| 1495 | Ga0070712_100038637 | |||
| 1496 | Ga0070712_100129346 | |||
| 1497 | Ga0070712_100313037 | |||
| 1498 | Ga0075367_10082301 | |||
| 1499 | Ga0075367_10108217 | |||
| 1500 | Ga0075367_10143138 | |||
| 1501 | Ga0097621_100100422 | |||
| 1502 | Ga0097621_100124713 | |||
| 1503 | Ga0097621_100857561 | |||
| 1504 | Ga0068871_100074599 | |||
| 1505 | Ga0075428_100002662 | |||
| 1506 | Ga0075428_100045578 | |||
| 1507 | Ga0075428_100060163 | |||
| 1508 | Ga0075428_100105176 | |||
| 1509 | Ga0075428_100290714 | |||
| 1510 | Ga0075428_100458538 | |||
| 1511 | Ga0075430_100005830 | |||
| 1512 | Ga0075430_100481279 | |||
| 1513 | Ga0075431_100031224 | |||
| 1514 | Ga0075431_100066835 | |||
| 1515 | Ga0075431_100097238 | |||
| 1516 | Ga0075431_100587678 | |||
| 1517 | Ga0075431_100660683 | |||
| 1518 | Ga0075433_10011801 | |||
| 1519 | Ga0075433_10025219 | |||
| 1520 | Ga0075433_10055376 | |||
| 1521 | Ga0075433_10073112 | |||
| 1522 | Ga0075433_10133393 | |||
| 1523 | Ga0075433_10401009 | |||
| 1524 | Ga0075434_100007792 | |||
| 1525 | Ga0075434_100013062 | |||
| 1526 | Ga0075434_100073846 | |||
| 1527 | Ga0075434_100652988 | |||
| 1528 | Ga0075434_101048216 | |||
| 1529 | Ga0075434_101346026 | |||
| 1530 | Ga0075429_100020238 | |||
| 1531 | Ga0075429_100205184 | |||
| 1532 | Ga0075429_100536707 | |||
| 1533 | Ga0068865_100039721 | |||
| 1534 | Ga0068865_100078935 | |||
| 1535 | Ga0068865_100100359 | |||
| 1536 | Ga0068865_100107961 | |||
| 1537 | Ga0075436_100007890 | |||
| 1538 | Ga0075436_100100406 | |||
| 1539 | Ga0075436_100122837 | |||
| 1540 | Ga0075436_100540173 | |||
| 1541 | Ga0097620_100052902 | |||
| 1542 | Ga0097620_100478538 | |||
| 1543 | Ga0097620_100808641 | |||
| 1544 | Ga0075435_100002153 | |||
| 1545 | Ga0075435_100135562 | |||
| 1546 | Ga0075435_100190728 | |||
| 1547 | Ga0075435_100311182 | |||
| 1548 | Ga0075435_100609633 | |||
| 1549 | Ga0075435_100629896 | |||
| 1550 | Ga0099795_10082525 | |||
| 1551 | Ga0111539_10000648 | |||
| 1552 | Ga0111539_10006602 | |||
| 1553 | Ga0111539_10017044 | |||
| 1554 | Ga0111539_10017381 | |||
| 1555 | Ga0111539_10077795 | |||
| 1556 | Ga0111539_10137411 | |||
| 1557 | Ga0111539_10742524 | |||
| 1558 | Ga0111539_10835190 | |||
| 1559 | Ga0105245_10008337 | |||
| 1560 | Ga0105245_10014479 | |||
| 1561 | Ga0105245_10060451 | |||
| 1562 | Ga0105245_10064281 | |||
| 1563 | Ga0105245_10105422 | |||
| 1564 | Ga0105245_10137318 | |||
| 1565 | Ga0105245_10154023 | |||
| 1566 | Ga0105245_10159510 | |||
| 1567 | Ga0105245_10290145 | |||
| 1568 | Ga0105245_10883665 | |||
| 1569 | Ga0105245_10948562 | |||
| 1570 | Ga0105245_11086284 | |||
| 1571 | Ga0105247_10009263 | |||
| 1572 | Ga0114129_10010920 | |||
| 1573 | Ga0114129_10015646 | |||
| 1574 | Ga0114129_10026913 | |||
| 1575 | Ga0114129_10112533 | |||
| 1576 | Ga0114129_10118846 | |||
| 1577 | Ga0114129_10193430 | |||
| 1578 | Ga0114129_10241288 | |||
| 1579 | Ga0114129_10242682 | |||
| 1580 | Ga0114129_10469874 | |||
| 1581 | Ga0114129_10598704 | |||
| 1582 | Ga0114129_10797319 | |||
| 1583 | Ga0114129_10966079 | |||
| 1584 | Ga0105243_10003486 | |||
| 1585 | Ga0105243_10013359 | |||
| 1586 | Ga0105243_10018939 | |||
| 1587 | Ga0105243_10130683 | |||
| 1588 | Ga0105243_10228454 | |||
| 1589 | Ga0105243_10327796 | |||
| 1590 | Ga0105243_11023780 | |||
| 1591 | Ga0105243_11074723 | |||
| 1592 | Ga0105241_10049960 | |||
| 1593 | Ga0105241_10490524 | |||
| 1594 | Ga0105241_10531351 | |||
| 1595 | Ga0105242_10033827 | |||
| 1596 | Ga0105242_10078913 | |||
| 1597 | Ga0105242_10108648 | |||
| 1598 | Ga0105242_10131291 | |||
| 1599 | Ga0105242_10249965 | |||
| 1600 | Ga0105242_10306689 | |||
| 1601 | Ga0105248_10034045 | |||
| 1602 | Ga0105248_10036506 | |||
| 1603 | Ga0105248_10099570 | |||
| 1604 | Ga0105248_10187053 | |||
| 1605 | Ga0105248_10618997 | |||
| 1606 | Ga0105237_10270674 | |||
| 1607 | Ga0105238_10029324 | |||
| 1608 | Ga0105238_10205477 | |||
| 1609 | Ga0105238_10308915 | |||
| 1610 | Ga0105249_10261795 | |||
| 1611 | Ga0105249_10312752 | |||
| 1612 | Ga0105239_10019732 | |||
| 1613 | Ga0105239_10044517 | |||
| 1614 | Ga0105239_10109230 | |||
| 1615 | Ga0105239_10347875 | |||
| 1616 | Ga0105239_10427004 | |||
| 1617 | Ga0105239_10478105 | |||
| 1618 | Ga0105246_10012363 | |||
| 1619 | Ga0105246_10070423 | |||
| 1620 | Ga0105246_10270833 | |||
| 1621 | Ga0157342_1000339 | |||
| 1622 | Ga0157371_10030079 | |||
| 1623 | Ga0157371_10044248 | |||
| 1624 | Ga0157371_10138456 | |||
| 1625 | Ga0157371_10205330 | |||
| 1626 | Ga0157370_10564332 | |||
| 1627 | Ga0157369_10061751 | |||
| 1628 | Ga0157374_10184573 | |||
| 1629 | Ga0157374_10404233 | |||
| 1630 | Ga0157374_10480512 | |||
| 1631 | Ga0157374_10589129 | |||
| 1632 | Ga0157374_10715830 | |||
| 1633 | Ga0157378_10190006 | |||
| 1634 | Ga0157378_10339353 | |||
| 1635 | Ga0157378_10588279 | |||
| 1636 | Ga0163162_10093794 | |||
| 1637 | Ga0163162_10114762 | |||
| 1638 | Ga0163162_10145207 | |||
| 1639 | Ga0163162_10475046 | |||
| 1640 | Ga0163162_10776463 | |||
| 1641 | Ga0157372_10025354 | |||
| 1642 | Ga0157372_10089070 | |||
| 1643 | Ga0157372_10349735 | |||
| 1644 | Ga0157372_10535828 | |||
| 1645 | Ga0157372_10652701 | |||
| 1646 | Ga0157375_10005826 | |||
| 1647 | Ga0157375_10016816 | |||
| 1648 | Ga0157375_10019447 | |||
| 1649 | Ga0157375_10019925 | |||
| 1650 | Ga0157375_10350653 | |||
| 1651 | Ga0157375_10363322 | |||
| 1652 | Ga0157375_10416024 | |||
| 1653 | Ga0163163_10006950 | |||
| 1654 | Ga0163163_10073365 | |||
| 1655 | Ga0157380_10019322 | |||
| 1656 | Ga0157380_10107118 | |||
| 1657 | Ga0157380_10228161 | |||
| 1658 | Ga0157380_10549838 | |||
| 1659 | Ga0157380_10909590 | |||
| 1660 | Ga0182008_10178480 | |||
| 1661 | Ga0182008_10416042 | |||
| 1662 | Ga0157377_10098925 | |||
| 1663 | Ga0157377_10128337 | |||
| 1664 | Ga0157377_10130490 | |||
| 1665 | Ga0157377_10336204 | |||
| 1666 | Ga0157379_10019500 | |||
| 1667 | Ga0157379_10074880 | |||
| 1668 | Ga0157376_10019387 | |||
| 1669 | Ga0157376_10408794 | |||
| 1670 | Ga0157376_10463848 | |||
| 1671 | Ga0157376_11047185 | |||
| 1672 | Ga0163161_10310170 | |||
| 1673 | Ga0207656_10101209 | |||
| 1674 | Ga0207653_10027253 | |||
| 1675 | Ga0207692_10006275 | |||
| 1676 | Ga0207642_10046227 | |||
| 1677 | Ga0207710_10059299 | |||
| 1678 | Ga0207688_10027230 | |||
| 1679 | Ga0207688_10118318 | |||
| 1680 | Ga0207685_10085510 | |||
| 1681 | Ga0207685_10201509 | |||
| 1682 | Ga0207645_10035355 | |||
| 1683 | Ga0207645_10086393 | |||
| 1684 | Ga0207645_10223646 | |||
| 1685 | Ga0207645_10350339 | |||
| 1686 | Ga0207643_10008192 | |||
| 1687 | Ga0207643_10015090 | |||
| 1688 | Ga0207643_10023159 | |||
| 1689 | Ga0207643_10050041 | |||
| 1690 | Ga0207705_10026955 | |||
| 1691 | Ga0207705_10039928 | |||
| 1692 | Ga0207684_10046071 | |||
| 1693 | Ga0207684_10081328 | |||
| 1694 | Ga0207684_10138737 | |||
| 1695 | Ga0207654_10216829 | |||
| 1696 | Ga0207654_10304306 | |||
| 1697 | Ga0207707_10029897 | |||
| 1698 | Ga0207707_10099707 | |||
| 1699 | Ga0207707_10231887 | |||
| 1700 | Ga0207707_10309941 | |||
| 1701 | Ga0207671_10072984 | |||
| 1702 | Ga0207693_10008061 | |||
| 1703 | Ga0207693_10197025 | |||
| 1704 | Ga0207693_10313509 | |||
| 1705 | Ga0207663_10044860 | |||
| 1706 | Ga0207663_10093589 | |||
| 1707 | Ga0207663_10319027 | |||
| 1708 | Ga0207660_10147728 | |||
| 1709 | Ga0207662_10073086 | |||
| 1710 | Ga0207662_10126843 | |||
| 1711 | Ga0207662_10136653 | |||
| 1712 | Ga0207657_10001701 | |||
| 1713 | Ga0207657_10006124 | |||
| 1714 | Ga0207657_10061045 | |||
| 1715 | Ga0207657_10166020 | |||
| 1716 | Ga0207657_10241264 | |||
| 1717 | Ga0207652_10066652 | |||
| 1718 | Ga0207652_10203811 | |||
| 1719 | Ga0207652_10311346 | |||
| 1720 | Ga0207652_10933616 | |||
| 1721 | Ga0207646_10002167 | |||
| 1722 | Ga0207646_10003470 | |||
| 1723 | Ga0207646_10055886 | |||
| 1724 | Ga0207681_10157171 | |||
| 1725 | Ga0207694_10190517 | |||
| 1726 | Ga0207650_10008340 | |||
| 1727 | Ga0207650_10011261 | |||
| 1728 | Ga0207650_10068042 | |||
| 1729 | Ga0207650_10758832 | |||
| 1730 | Ga0207659_10484627 | |||
| 1731 | Ga0207659_10503754 | |||
| 1732 | Ga0207659_10726370 | |||
| 1733 | Ga0207687_10059611 | |||
| 1734 | Ga0207687_10064056 | |||
| 1735 | Ga0207687_10065731 | |||
| 1736 | Ga0207687_10065989 | |||
| 1737 | Ga0207687_10088142 | |||
| 1738 | Ga0207687_10186382 | |||
| 1739 | Ga0207687_10188254 | |||
| 1740 | Ga0207687_10255500 | |||
| 1741 | Ga0207687_10329168 | |||
| 1742 | Ga0207687_10379377 | |||
| 1743 | Ga0207687_10379477 | |||
| 1744 | Ga0207700_10038568 | |||
| 1745 | Ga0207700_10109917 | |||
| 1746 | Ga0207700_11019136 | |||
| 1747 | Ga0207664_10002961 | |||
| 1748 | Ga0207664_10077315 | |||
| 1749 | Ga0207664_10082933 | |||
| 1750 | Ga0207664_10198515 | |||
| 1751 | Ga0207690_10035490 | |||
| 1752 | Ga0207690_10038048 | |||
| 1753 | Ga0207690_10050027 | |||
| 1754 | Ga0207690_10380855 | |||
| 1755 | Ga0207706_10022030 | |||
| 1756 | Ga0207706_10023062 | |||
| 1757 | Ga0207686_10047809 | |||
| 1758 | Ga0207686_10214585 | |||
| 1759 | Ga0207686_10253188 | |||
| 1760 | Ga0207709_10025774 | |||
| 1761 | Ga0207709_10031964 | |||
| 1762 | Ga0207709_10068072 | |||
| 1763 | Ga0207709_10327560 | |||
| 1764 | Ga0207709_10486392 | |||
| 1765 | Ga0207670_10312958 | |||
| 1766 | Ga0207670_10983928 | |||
| 1767 | Ga0207669_10038646 | |||
| 1768 | Ga0207669_10068295 | |||
| 1769 | Ga0207669_10292243 | |||
| 1770 | Ga0207669_10377648 | |||
| 1771 | Ga0207669_10553630 | |||
| 1772 | Ga0207669_10781956 | |||
| 1773 | Ga0207704_10031119 | |||
| 1774 | Ga0207704_10104254 | |||
| 1775 | Ga0207704_10158777 | |||
| 1776 | Ga0207704_10170843 | |||
| 1777 | Ga0207665_10096583 | |||
| 1778 | Ga0207665_10103896 | |||
| 1779 | Ga0207691_10017223 | |||
| 1780 | Ga0207691_10066629 | |||
| 1781 | Ga0207691_10071953 | |||
| 1782 | Ga0207691_10147365 | |||
| 1783 | Ga0207711_10074783 | |||
| 1784 | Ga0207711_10153267 | |||
| 1785 | Ga0207711_10347714 | |||
| 1786 | Ga0207689_10029379 | |||
| 1787 | Ga0207689_10077920 | |||
| 1788 | Ga0207689_10198773 | |||
| 1789 | Ga0207689_10209599 | |||
| 1790 | Ga0207689_10252971 | |||
| 1791 | Ga0207661_10009366 | |||
| 1792 | Ga0207661_10037723 | |||
| 1793 | Ga0207661_10047233 | |||
| 1794 | Ga0207661_10096678 | |||
| 1795 | Ga0207661_10426104 | |||
| 1796 | Ga0207679_10164832 | |||
| 1797 | Ga0207679_10406812 | |||
| 1798 | Ga0207679_10535692 | |||
| 1799 | Ga0207679_10661950 | |||
| 1800 | Ga0207667_10163266 | |||
| 1801 | Ga0207667_10538042 | |||
| 1802 | Ga0207651_10071703 | |||
| 1803 | Ga0207651_10315326 | |||
| 1804 | Ga0207712_10044556 | |||
| 1805 | Ga0207712_10243644 | |||
| 1806 | Ga0207668_10089584 | |||
| 1807 | Ga0207640_10091516 | |||
| 1808 | Ga0207640_10558352 | |||
| 1809 | Ga0207677_10118393 | |||
| 1810 | Ga0207677_10209929 | |||
| 1811 | Ga0207639_10537227 | |||
| 1812 | Ga0207678_10019076 | |||
| 1813 | Ga0207678_10443644 | |||
| 1814 | Ga0207678_10590033 | |||
| 1815 | Ga0207708_10031024 | |||
| 1816 | Ga0207708_10045488 | |||
| 1817 | Ga0207708_10067625 | |||
| 1818 | Ga0207702_10184280 | |||
| 1819 | Ga0207702_10568565 | |||
| 1820 | Ga0207702_10667678 | |||
| 1821 | Ga0207702_10731524 | |||
| 1822 | Ga0207702_10853763 | |||
| 1823 | Ga0207648_10035716 | |||
| 1824 | Ga0207648_10047888 | |||
| 1825 | Ga0207648_10054938 | |||
| 1826 | Ga0207648_10114006 | |||
| 1827 | Ga0207648_10120230 | |||
| 1828 | Ga0207648_10145648 | |||
| 1829 | Ga0207676_10230746 | |||
| 1830 | Ga0207674_10002446 | |||
| 1831 | Ga0207674_10037403 | |||
| 1832 | Ga0207674_10041632 | |||
| 1833 | Ga0207674_10197456 | |||
| 1834 | Ga0207674_10224959 | |||
| 1835 | Ga0207675_100016689 | |||
| 1836 | Ga0207675_100055972 | |||
| 1837 | Ga0207675_100074084 | |||
| 1838 | Ga0207675_100203231 | |||
| 1839 | Ga0207675_100531846 | |||
| 1840 | Ga0207683_10021406 | |||
| 1841 | Ga0207683_10022545 | |||
| 1842 | Ga0207683_10308139 | |||
| 1843 | Ga0207683_10355740 | |||
| 1844 | Ga0207683_10523372 | |||
| 1845 | Ga0207698_10076789 | |||
| 1846 | Ga0207698_10378332 | |||
| 1847 | Ga0207698_11579302 | |||
| 1848 | Ga0209998_10009112 | |||
| 1849 | Ga0207428_10000437 | |||
| 1850 | Ga0207428_10003178 | |||
| 1851 | Ga0207428_10025873 | |||
| 1852 | Ga0207428_10026500 | |||
| 1853 | Ga0207428_10034437 | |||
| 1854 | Ga0207428_10044804 | |||
| 1855 | Ga0207428_10062885 | |||
| 1856 | Ga0207428_10093819 | |||
| 1857 | Ga0207428_10139511 | |||
| 1858 | Ga0268266_10240882 | |||
| 1859 | Ga0268266_10352425 | |||
| 1860 | Ga0268266_10380024 | |||
| 1861 | Ga0268265_10238936 | |||
| 1862 | Ga0268265_10282590 | |||
| 1863 | Ga0268264_10026271 | |||
| 1864 | Ga0268264_10627874 | |||
| 1865 | Ga0307408_100028335 | |||
| 1866 | Ga0307408_100289507 | |||
| 1867 | Ga0307408_100768375 | |||
| 1868 | Ga0307408_101201331 | |||
| 1869 | Ga0307410_10327576 | |||
| 1870 | Ga0307412_10360909 | |||
| 1871 | Ga0307409_100066045 | |||
| 1872 | Ga0307414_10189948 | |||
| 1873 | Ga0307411_10288532 | |||
| 1874 | Ga0307415_100000192 | |||
| 1875 | Ga0373958_0017671 | |||
| 1876 | Ga0373959_0078585 | |||
| 1877 | Ga0373938_0028856 | |||
| 1878 | Ga0373926_0000871 | |||
| 1879 | Ga0373940_0148419 | |||
| 1880 | Ga0373936_0066249 | |||
| 1881 | Ga0373939_0097767 | |||
| 1882 | Ga0373941_0013589 | |||
| 1883 | Ga0373941_0070133 | |||
| 1884 | Ga0373945_0004395 | |||
| 1885 | Ga0373945_0149132 | |||
| 1886 | Ga0373953_0051980 | |||
| 1887 | Ga0373960_0074930 | |||
| 1888 | Ga0373943_0000490 | |||
| 1889 | Ga0373943_0179529 | |||
| 1890 | Ga0373946_0047013 | |||
| 1891 | Ga0373961_0103035 | |||
| 1892 | Ga0373931_0097005 | |||
| 1893 | Ga0373931_0104052 | |||
| 1894 | Ga0373931_0380522 | |||
| 1895 | Ga0373935_0298313 | |||
| 1896 | Ga0373927_0300470 | |||
| 1897 | Ga0373933_0069826 | |||
| 1898 | Ga0373947_0001296 | |||
| 1899 | Ga0373937_0300479 | |||
| 1900 | Ga0373925_0000484 | |||
| 1901 | Ga0395899_0001105 | |||
| 1902 | Ga0395899_0004478 | |||
| 1903 | Ga0395899_0005269 | |||
| 1904 | Ga0395899_0006397 | |||
| 1905 | Ga0395899_0035335 | |||
| 1906 | Ga0395899_0050319 | |||
| 1907 | Ga0395899_0078678 | |||
| 1908 | Ga0395899_0117795 | |||
| 1909 | Ga0395899_0281312 | |||
| 1910 | Ga0395899_0307020 | |||
| 1911 | Ga0395900_0002321 | |||
| 1912 | Ga0395900_0003619 | |||
| 1913 | Ga0395900_0004663 | |||
| 1914 | Ga0395900_0005393 | |||
| 1915 | Ga0395900_0013553 | |||
| 1916 | Ga0395900_0050832 | |||
| 1917 | Ga0395900_0054267 | |||
| 1918 | Ga0395900_0074045 | |||
| 1919 | Ga0395900_0110527 | |||
| 1920 | Ga0395900_0133751 | |||
| 1921 | Ga0395900_0154080 | |||
| 1922 | Ga0395900_0249266 | |||
| 1923 | Ga0395900_0273448 | |||
| 1924 | Ga0395900_0536458 | |||
| 1925 | Ga0395900_0847249 | |||
| 1926 | Ga0395898_0002298 | |||
| 1927 | Ga0395898_0004033 | |||
| 1928 | Ga0395898_0008472 | |||
| 1929 | Ga0395898_0015626 | |||
| 1930 | Ga0395898_0019466 | |||
| 1931 | Ga0395898_0030341 | |||
| 1932 | Ga0395898_0034998 | |||
| 1933 | Ga0395898_0045984 | |||
| 1934 | Ga0395898_0048170 | |||
| 1935 | Ga0395898_0192583 | |||
| 1936 | Ga0395898_0365177 | |||
| 1937 | Ga0395898_0411779 | |||
| 1938 | Ga0395898_0540203 | |||
| 1939 | Ga0395898_0704463 | |||
| 1940 | Ga0395905_0001864 | |||
| 1941 | Ga0395905_0003370 | |||
| 1942 | Ga0395905_0006000 | |||
| 1943 | Ga0395905_0009840 | |||
| 1944 | Ga0395905_0012742 | |||
| 1945 | Ga0395905_0036025 | |||
| 1946 | Ga0395905_0037274 | |||
| 1947 | Ga0395905_0037990 | |||
| 1948 | Ga0395905_0039015 | |||
| 1949 | Ga0395905_0083333 | |||
| 1950 | Ga0395905_0109252 | |||
| 1951 | Ga0395905_0181914 | |||
| 1952 | Ga0395905_0190130 | |||
| 1953 | Ga0395905_0234575 | |||
| 1954 | Ga0395905_0449737 | |||
| 1955 | Ga0395901_0003202 | |||
| 1956 | Ga0395901_0004006 | |||
| 1957 | Ga0395901_0004120 | |||
| 1958 | Ga0395901_0004168 | |||
| 1959 | Ga0395901_0007607 | |||
| 1960 | Ga0395901_0012918 | |||
| 1961 | Ga0395901_0020657 | |||
| 1962 | Ga0395901_0022539 | |||
| 1963 | Ga0395901_0036824 | |||
| 1964 | Ga0395901_0049028 | |||
| 1965 | Ga0395901_0082775 | |||
| 1966 | Ga0395901_0119437 | |||
| 1967 | Ga0395901_0150776 | |||
| 1968 | Ga0395901_0215190 | |||
| 1969 | Ga0395901_0217515 | |||
| 1970 | Ga0395901_0435784 | |||
| 1971 | Ga0395901_0671741 | |||
| 1972 | Ga0395901_0756196 | |||
| 1973 | Ga0395901_1117443 | |||
| 1974 | Ga0395901_1164417 | |||
| 1975 | Ga0395901_1275565 | |||
| 1976 | Ga0395901_1315786 | |||
| 1977 | Ga0439439_0000168 | |||
| 1978 | Ga0451789_0831867 | |||
| 1979 | Ga0451791_1920887 | |||
| 1980 | Ga0451798_0932997 | |||
| 1981 | Ga0451800_0381266 | |||
| 1982 | Ga0451802_1601654 | |||
| 1983 | Ga0451804_0674902 | |||
| 1984 | Ga0451807_0556744 | |||
| 1985 | Ga0451807_0677844 | |||
| 1986 | Ga0451835_0158106 | |||
| 1987 | Ga0451839_0329616 | |||
| 1988 | Ga0451845_0293247 | |||
| 1989 | Ga0451847_0784703 | |||
| 1990 | Ga0451849_0149384 | |||
| 1991 | Ga0451851_0781637 | |||
| 1992 | Ga0439431_0003319 | |||
| 1993 | Ga0439433_0006255 | |||
| 1994 | Ga0439445_0054465 | |||
| 1995 | Ga0439448_0002278 | |||
| 1996 | Ga0439448_0035334 | |||
| 1997 | Ga0439448_0052078 | |||
| 1998 | Ga0439462_0016445 | |||
| 1999 | Ga0450920_031964 | |||
| 2000 | Ga0450923_003845 | |||
| 2001 | Ga0450907_005134 | |||
| 2002 | Ga0439446_0001028 | |||
| 2003 | Ga0439458_0004345 | |||
| 2004 | Ga0439434_0037562 | |||
| 2005 | Ga0466969_0020004 | |||
| 2006 | Ga0453683_0117574 | |||
| 2007 | Ga0466961_0077330 | |||
| 2008 | Ga0466961_0307584 | |||
| 2009 | Ga0466963_0000045 | |||
| 2010 | Ga0466963_0041098 | |||
| 2011 | Ga0466963_0064643 | |||
| 2012 | Ga0466963_0260097 | |||
| 2013 | Ga0466964_0000074 | |||
| 2014 | Ga0466964_0013974 | |||
| 2015 | Ga0466971_0011789 | |||
| 2016 | Ga0466971_0064302 | |||
| 2017 | Ga0466968_0008417 | |||
| 2018 | Ga0466968_0015989 | |||
| 2019 | Ga0466968_0105412 | |||
| 2020 | Ga0466957_0003753 | |||
| 2021 | Ga0466957_0088960 | |||
| 2022 | Ga0466959_0006407 | |||
| 2023 | Ga0451576_0752536 | |||
| 2024 | Ga0466958_0004688 | |||
| 2025 | Ga0466967_0000085 | |||
| 2026 | Ga0466967_0005337 | |||
| 2027 | Ga0466967_0014500 | |||
| 2028 | Ga0466967_0042350 | |||
| 2029 | Ga0466967_0254195 | |||
| 2030 | Ga0495592_0006827 | |||
| 2031 | Ga0495592_0093479 | |||
| 2032 | Ga0495603_0037612 | |||
| 2033 | Ga0495603_0270279 | |||
| 2034 | Ga0495629_0058848 | |||
| 2035 | Ga0495629_0069671 | |||
| 2036 | Ga0495629_0180481 | |||
| 2037 | Ga0495641_0002472 | |||
| 2038 | Ga0495641_0013150 | |||
| 2039 | Ga0495641_0030758 | |||
| 2040 | Ga0495641_0038579 | |||
| 2041 | Ga0495651_0034677 | |||
| 2042 | Ga0495651_0176707 | |||
| 2043 | Ga0495653_0017708 | |||
| 2044 | Ga0495653_0047653 | |||
| 2045 | Ga0495580_0012758 | |||
| 2046 | Ga0495582_0009080 | |||
| 2047 | Ga0495582_0053759 | |||
| 2048 | Ga0495582_0229057 | |||
| 2049 | Ga0495605_0014353 | |||
| 2050 | Ga0495639_0001471 | |||
| 2051 | Ga0495639_0262626 | |||
| 2052 | Ga0495662_0001052 | |||
| 2053 | Ga0495662_0241215 | |||
| 2054 | Ga0495664_0244778 | |||
| 2055 | Ga0495664_0292031 | |||
| 2056 | Ga0495584_0027488 | |||
| 2057 | Ga0495584_0428770 | |||
| 2058 | Ga0495585_0021155 | |||
| 2059 | Ga0495585_0097169 | |||
| 2060 | Ga0495594_0111326 | |||
| 2061 | Ga0495594_0237455 | |||
| 2062 | Ga0495594_0336162 | |||
| 2063 | Ga0495596_0023254 | |||
| 2064 | Ga0495596_0078477 | |||
| 2065 | Ga0495596_0080272 | |||
| 2066 | Ga0495596_0151932 | |||
| 2067 | Ga0495596_0173247 | |||
| 2068 | Ga0495607_0046332 | |||
| 2069 | Ga0495583_0246092 | |||
| 2070 | Ga0495608_0008332 | |||
| 2071 | Ga0495608_0011305 | |||
| 2072 | Ga0495608_0108761 | |||
| 2073 | Ga0495608_0337715 | |||
| 2074 | Ga0495618_0159990 | |||
| 2075 | Ga0495618_0382355 | |||
| 2076 | Ga0495628_0074619 | |||
| 2077 | Ga0495630_0063343 | |||
| 2078 | Ga0495630_0064450 | |||
| 2079 | Ga0495631_0024285 | |||
| 2080 | Ga0495637_0158376 | |||
| 2081 | Ga0495644_0023053 | |||
| 2082 | Ga0495644_0036891 | |||
| 2083 | Ga0495644_0123394 | |||
| 2084 | Ga0495663_0013836 | |||
| 2085 | Ga0495663_0063257 | |||
| 2086 | Ga0495666_0000168 | |||
| 2087 | Ga0495642_0015846 | |||
| 2088 | Ga0495652_0027449 | |||
| 2089 | Ga0495652_0117747 | |||
| 2090 | Ga0495665_0000038 | |||
| 2091 | Ga0495640_0061516 | |||
| 2092 | Ga0495640_0109551 | |||
| 2093 | Ga0495640_0170889 | |||
| 2094 | Ga0495586_0044768 | |||
| 2095 | Ga0495586_0087123 | |||
| 2096 | Ga0495587_0051345 | |||
| 2097 | Ga0495587_0136115 | |||
| 2098 | Ga0495609_0034973 | |||
| 2099 | Ga0495609_0056328 | |||
| 2100 | Ga0495609_0081141 | |||
| 2101 | Ga0495645_0020312 | |||
| 2102 | Ga0495645_0134585 | |||
| 2103 | Ga0495633_0075557 | |||
| 2104 | Ga0495656_0004926 | |||
| 2105 | Ga0495656_0020371 | |||
| 2106 | Ga0495656_0073680 | |||
| 2107 | Ga0495656_0082347 | |||
| 2108 | Ga0495668_0159375 | |||
| 2109 | Ga0495634_0032310 | |||
| 2110 | Ga0495634_0046482 | |||
| 2111 | Ga0495634_0125069 | |||
| 2112 | Ga0495611_0009038 | |||
| 2113 | Ga0495611_0087260 | |||
| 2114 | Ga0495635_0016870 | |||
| 2115 | Ga0495635_0045671 | |||
| 2116 | Ga0495659_0002908 | |||
| 2117 | Ga0495659_0009308 | |||
| 2118 | Ga0495659_0076923 | |||
| 2119 | Ga0495659_0091623 | |||
| 2120 | Ga0495588_0155332 | |||
| 2121 | Ga0495588_0162951 | |||
| 2122 | Ga0495657_0114026 | |||
| 2123 | Ga0495599_0005941 | |||
| 2124 | Ga0495599_0035792 | |||
| 2125 | Ga0495646_0016254 | |||
| 2126 | Ga0495646_0040322 | |||
| 2127 | Ga0495646_0084300 | |||
| 2128 | Ga0495647_0014147 | |||
| 2129 | Ga0495647_0194017 | |||
| 2130 | Ga0495647_0245049 | |||
| 2131 | Ga0495658_0120967 | |||
| 2132 | Ga0495658_0128567 | |||
| 2133 | Ga0495669_0018351 | |||
| 2134 | Ga0495613_0012499 | |||
| 2135 | Ga0495613_0305541 | |||
| 2136 | Ga0495624_0022102 | |||
| 2137 | Ga0495624_0044304 | |||
| 2138 | Ga0495624_0105896 | |||
| 2139 | Ga0495624_0134073 | |||
| 2140 | Ga0495589_0011190 | |||
| 2141 | Ga0495600_0096760 | |||
| 2142 | Ga0495660_0065583 | |||
| 2143 | Ga0495581_0002990 | |||
| 2144 | Ga0495581_0006726 | |||
| 2145 | Ga0495604_0175959 | |||
| 2146 | Ga0495674_0050204 | |||
| 2147 | Ga0495676_0012944 | |||
| 2148 | Ga0495676_0125215 | |||
| 2149 | Ga0495680_0041623 | |||
| 2150 | Ga0495680_0065347 | |||
| 2151 | Ga0495680_0262927 | |||
| 2152 | Ga0495677_0005967 | |||
| 2153 | Ga0495677_0020441 | |||
| 2154 | Ga0495677_0039234 | |||
| 2155 | Ga0495679_077974 | |||
| 2156 | Ga0495679_151229 | |||
| 2157 | Ga0495673_0132476 | |||
| 2158 | Ga0495684_0001595 | |||
| 2159 | Ga0495684_0475614 | |||
| 2160 | Ga0495593_0001683 | |||
| 2161 | Ga0495602_0033921 | |||
| 2162 | Ga0495602_0062381 | |||
| 2163 | Ga0495602_0357648 | |||
| 2164 | Ga0495614_0000113 | |||
| 2165 | Ga0495626_0117746 | |||
| 2166 | Ga0496100_0040354 | |||
| 2167 | Ga0496100_0048695 | |||
| 2168 | Ga0496100_0137668 | |||
| 2169 | Ga0496100_0242380 | |||
| 2170 | Ga0496100_0392288 | |||
| 2171 | Ga0496100_0495068 | |||
| 2172 | Ga0496101_0166317 | |||
| 2173 | Ga0496101_0186014 | |||
| 2174 | Ga0496101_0348536 | |||
| 2175 | Ga0496102_0011804 | |||
| 2176 | Ga0496102_0108999 | |||
| 2177 | Ga0496102_0244267 | |||
| 2178 | Ga0496102_0476335 | |||
| 2179 | Ga0496102_0881774 | |||
| 2180 | Ga0496103_0155600 | |||
| 2181 | Ga0496103_0187989 | |||
| 2182 | Ga0496103_0546816 | |||
| 2183 | Ga0496104_0000796 | |||
| 2184 | Ga0496104_0015518 | |||
| 2185 | Ga0496104_0055323 | |||
| 2186 | Ga0496104_0105853 | |||
| 2187 | Ga0496104_0237597 | |||
| 2188 | Ga0496105_0002479 | |||
| 2189 | Ga0496105_0004890 | |||
| 2190 | Ga0496105_0014167 | |||
| 2191 | Ga0496105_0072063 | |||
| 2192 | Ga0496105_0143570 | |||
| 2193 | Ga0496105_0973287 | |||
| 2194 | Ga0496106_0054377 | |||
| 2195 | Ga0496106_0302959 | |||
| 2196 | Ga0496107_0085794 | |||
| 2197 | Ga0496107_0108861 | |||
| 2198 | Ga0496107_0242849 | |||
| 2199 | Ga0496107_0276050 | |||
| 2200 | Ga0496107_0457240 | |||
| 2201 | Ga0496107_0537404 | |||
| 2202 | Ga0496107_0620776 | |||
| 2203 | Ga0496108_0013267 | |||
| 2204 | Ga0496108_0017218 | |||
| 2205 | Ga0496108_0023902 | |||
| 2206 | Ga0496108_0037517 | |||
| 2207 | Ga0496108_0516857 | |||
| 2208 | Ga0496109_0002279 | |||
| 2209 | Ga0496109_0003664 | |||
| 2210 | Ga0496109_0017231 | |||
| 2211 | Ga0496109_0025028 | |||
| 2212 | Ga0496109_0073603 | |||
| 2213 | Ga0496109_0189427 | |||
| 2214 | Ga0496109_0256808 | |||
| 2215 | Ga0496109_0296581 | |||
| 2216 | Ga0496109_0340359 | |||
| 2217 | Ga0496109_0351964 | |||
| 2218 | Ga0496109_0681225 | |||
| 2219 | Ga0496110_0003721 | |||
| 2220 | Ga0496110_0011450 | |||
| 2221 | Ga0496110_0025824 | |||
| 2222 | Ga0496110_0026248 | |||
| 2223 | Ga0496110_0055798 | |||
| 2224 | Ga0496110_0061868 | |||
| 2225 | Ga0496110_0166595 | |||
| 2226 | Ga0496110_0182613 | |||
| 2227 | Ga0496110_0356964 | |||
| 2228 | Ga0496110_0469651 | |||
| 2229 | Ga0496111_0005145 | |||
| 2230 | Ga0496111_0012987 | |||
| 2231 | Ga0496111_0024923 | |||
| 2232 | Ga0496111_0036864 | |||
| 2233 | Ga0496111_0050839 | |||
| 2234 | Ga0496111_0058734 | |||
| 2235 | Ga0496111_0061451 | |||
| 2236 | Ga0496111_0108228 | |||
| 2237 | Ga0496111_0257099 | |||
| 2238 | Ga0496111_0887150 | |||
| 2239 | Ga0496112_0009544 | |||
| 2240 | Ga0496112_0028258 | |||
| 2241 | Ga0496112_0055404 | |||
| 2242 | Ga0496112_0101343 | |||
| 2243 | Ga0496112_0127573 | |||
| 2244 | Ga0496112_0183213 | |||
| 2245 | Ga0496112_0312290 | |||
| 2246 | Ga0496112_0328738 | |||
| 2247 | Ga0496112_0375135 | |||
| 2248 | Ga0496112_0532175 | |||
| 2249 | Ga0496112_0996578 | |||
| 2250 | Ga0496113_0027915 | |||
| 2251 | Ga0496113_0028180 | |||
| 2252 | Ga0496113_0050677 | |||
| 2253 | Ga0496113_0096668 | |||
| 2254 | Ga0496113_0250008 | |||
| 2255 | Ga0496113_0262144 | |||
| 2256 | Ga0496114_0005323 | |||
| 2257 | Ga0496114_0014999 | |||
| 2258 | Ga0496114_0029594 | |||
| 2259 | Ga0496114_0075226 | |||
| 2260 | Ga0496114_0137754 | |||
| 2261 | Ga0496114_0224911 | |||
| 2262 | Ga0496114_0400247 | |||
| 2263 | Ga0496114_0861432 | |||
| 2264 | Ga0496115_0019305 | |||
| 2265 | Ga0496115_0029074 | |||
| 2266 | Ga0496115_0100380 | |||
| 2267 | Ga0496115_0648755 | |||
| 2268 | Ga0496115_0738063 | |||
| 2269 | Ga0501031_0018283 | |||
| 2270 | Ga0501031_0035031 | |||
| 2271 | Ga0501031_0042296 | |||
| 2272 | Ga0501031_0187148 | |||
| 2273 | Ga0501031_0357122 | |||
| 2274 | Ga0501031_0379115 | |||
| 2275 | Ga0501032_0017415 | |||
| 2276 | Ga0501032_0057394 | |||
| 2277 | Ga0501032_0059129 | |||
| 2278 | Ga0501032_0696749 | |||
| 2279 | Ga0501033_0033324 | |||
| 2280 | Ga0501033_0063914 | |||
| 2281 | Ga0501033_0128523 | |||
| 2282 | Ga0501033_0160272 | |||
| 2283 | Ga0501034_0241020 | |||
| 2284 | Ga0501034_0426389 | |||
| 2285 | Ga0501036_0007462 | |||
| 2286 | Ga0501036_0012198 | |||
| 2287 | Ga0501036_0018707 | |||
| 2288 | Ga0501036_0040352 | |||
| 2289 | Ga0501036_0095912 | |||
| 2290 | Ga0501036_0141522 | |||
| 2291 | Ga0501036_0178641 | |||
| 2292 | Ga0501036_0627690 | |||
| 2293 | Ga0501037_0007291 | |||
| 2294 | Ga0501037_0175286 | |||
| 2295 | Ga0501037_0289727 | |||
| 2296 | Ga0501037_0299508 | |||
| 2297 | Ga0501037_0342775 | |||
| 2298 | Ga0501037_0455887 | |||
| 2299 | Ga0501038_0034894 | |||
| 2300 | Ga0501038_0039536 | |||
| 2301 | Ga0501038_0039616 | |||
| 2302 | Ga0501038_0159160 | |||
| 2303 | Ga0501038_0402683 | |||
| 2304 | Ga0501038_0475108 | |||
| 2305 | Ga0501038_0713714 | |||
| 2306 | Ga0501039_0009095 | |||
| 2307 | Ga0501039_0009928 | |||
| 2308 | Ga0501039_0016770 | |||
| 2309 | Ga0501039_0021738 | |||
| 2310 | Ga0501039_0343500 | |||
| 2311 | Ga0501039_0387720 | |||
| 2312 | Ga0501039_0485459 | |||
| 2313 | Ga0501039_0576329 | |||
| 2314 | Ga0501040_0002593 | |||
| 2315 | Ga0501040_0018564 | |||
| 2316 | Ga0501040_0028374 | |||
| 2317 | Ga0501040_0041491 | |||
| 2318 | Ga0501040_0045154 | |||
| 2319 | Ga0501040_0152107 | |||
| 2320 | Ga0501040_0269586 | |||
| 2321 | Ga0501040_0315898 | |||
| 2322 | Ga0501040_0358307 | |||
| 2323 | Ga0501041_0007274 | |||
| 2324 | Ga0501041_0012870 | |||
| 2325 | Ga0501041_0028611 | |||
| 2326 | Ga0501041_0046929 | |||
| 2327 | Ga0501041_0072387 | |||
| 2328 | Ga0501041_0118236 | |||
| 2329 | Ga0501041_0119709 | |||
| 2330 | Ga0501041_0273289 | |||
| 2331 | Ga0501041_0476377 | |||
| 2332 | Ga0501042_0004401 | |||
| 2333 | Ga0501042_0061438 | |||
| 2334 | Ga0501042_0076005 | |||
| 2335 | Ga0501042_0084004 | |||
| 2336 | Ga0501042_0095116 | |||
| 2337 | Ga0501042_0199933 | |||
| 2338 | Ga0501042_0800539 | |||
| 2339 | Ga0501043_0017112 | |||
| 2340 | Ga0501043_0111447 | |||
| 2341 | Ga0501043_0127343 | |||
| 2342 | Ga0501043_0222958 | |||
| 2343 | Ga0501046_0002178 | |||
| 2344 | Ga0501046_0012656 | |||
| 2345 | Ga0501046_0027500 | |||
| 2346 | Ga0501046_0073092 | |||
| 2347 | Ga0501046_0080985 | |||
| 2348 | Ga0501047_0046233 | |||
| 2349 | Ga0501048_0028695 | |||
| 2350 | Ga0501048_0030829 | |||
| 2351 | Ga0501048_0056720 | |||
| 2352 | Ga0501048_0063481 | |||
| 2353 | Ga0501048_0165342 | |||
| 2354 | Ga0501048_0833981 | |||
| 2355 | Ga0501067_0007990 | |||
| 2356 | Ga0501067_0028914 | |||
| 2357 | Ga0501067_0118208 | |||
| 2358 | Ga0501067_0118402 | |||
| 2359 | Ga0501067_0140764 | |||
| 2360 | Ga0501068_0003747 | |||
| 2361 | Ga0501068_0007558 | |||
| 2362 | Ga0501068_0008746 | |||
| 2363 | Ga0501068_0035139 | |||
| 2364 | Ga0501068_0041057 | |||
| 2365 | Ga0501068_0255294 | |||
| 2366 | Ga0501068_0508359 | |||
| 2367 | Ga0501069_0000968 | |||
| 2368 | Ga0501069_0015555 | |||
| 2369 | Ga0501069_0016217 | |||
| 2370 | Ga0501069_0028350 | |||
| 2371 | Ga0501069_0053876 | |||
| 2372 | Ga0501069_0069932 | |||
| 2373 | Ga0501070_0002450 | |||
| 2374 | Ga0501070_0074032 | |||
| 2375 | Ga0501070_0080974 | |||
| 2376 | Ga0501070_0089238 | |||
| 2377 | Ga0501070_0175751 | |||
| 2378 | Ga0501070_0742260 | |||
| 2379 | Ga0501071_0001822 | |||
| 2380 | Ga0501071_0003354 | |||
| 2381 | Ga0501071_0006541 | |||
| 2382 | Ga0501071_0011840 | |||
| 2383 | Ga0501071_0048676 | |||
| 2384 | Ga0501071_0073754 | |||
| 2385 | Ga0501071_0172275 | |||
| 2386 | Ga0501071_0227235 | |||
| 2387 | Ga0501071_0275830 | |||
| 2388 | Ga0501071_0281216 | |||
| 2389 | Ga0501071_0304897 | |||
| 2390 | Ga0501071_0427304 | |||
| 2391 | Ga0501071_0924042 | |||
| 2392 | Ga0501072_0008618 | |||
| 2393 | Ga0501072_0013405 | |||
| 2394 | Ga0501072_0022455 | |||
| 2395 | Ga0501072_0029064 | |||
| 2396 | Ga0501072_0054949 | |||
| 2397 | Ga0501072_0073731 | |||
| 2398 | Ga0501072_0075660 | |||
| 2399 | Ga0501072_0153749 | |||
| 2400 | Ga0501072_0213739 | |||
| 2401 | Ga0501072_0259620 | |||
| 2402 | Ga0501073_0003805 | |||
| 2403 | Ga0501073_0043484 | |||
| 2404 | Ga0501074_0001334 | |||
| 2405 | Ga0501074_0023942 | |||
| 2406 | Ga0501074_0032573 | |||
| 2407 | Ga0501074_0050916 | |||
| 2408 | Ga0501074_0127027 | |||
| 2409 | Ga0501074_0213677 | |||
| 2410 | Ga0501074_0274828 | |||
| 2411 | Ga0501075_0014061 | |||
| 2412 | Ga0501075_0030416 | |||
| 2413 | Ga0501075_0031563 | |||
| 2414 | Ga0501075_0031655 | |||
| 2415 | Ga0501075_0106004 | |||
| 2416 | Ga0501075_0168536 | |||
| 2417 | Ga0501075_0169271 | |||
| 2418 | Ga0501075_0303363 | |||
| 2419 | Ga0501075_0314927 | |||
| 2420 | Ga0501076_0001883 | |||
| 2421 | Ga0501076_0004930 | |||
| 2422 | Ga0501076_0014766 | |||
| 2423 | Ga0501076_0024867 | |||
| 2424 | Ga0501076_0030603 | |||
| 2425 | Ga0501076_0031075 | |||
| 2426 | Ga0501076_0049285 | |||
| 2427 | Ga0501076_0330005 | |||
| 2428 | Ga0501076_0360689 | |||
| 2429 | Ga0501076_0591820 | |||
| 2430 | Ga0501077_0011665 | |||
| 2431 | Ga0501077_0019049 | |||
| 2432 | Ga0501077_0020984 | |||
| 2433 | Ga0501077_0022898 | |||
| 2434 | Ga0501077_0033852 | |||
| 2435 | Ga0501077_0049117 | |||
| 2436 | Ga0501077_0212765 | |||
| 2437 | Ga0501077_0218055 | |||
| 2438 | Ga0501077_0636810 | |||
| 2439 | Ga0501079_0004568 | |||
| 2440 | Ga0501079_0007431 | |||
| 2441 | Ga0501079_0011783 | |||
| 2442 | Ga0501079_0031637 | |||
| 2443 | Ga0501079_0089736 | |||
| 2444 | Ga0501079_0102494 | |||
| 2445 | Ga0501079_0166093 | |||
| 2446 | Ga0501079_0178441 | |||
| 2447 | Ga0501079_0186151 | |||
| 2448 | Ga0501079_0256442 | |||
| 2449 | Ga0501079_0607452 | |||
| 2450 | Ga0501080_0003932 | |||
| 2451 | Ga0501080_0026594 | |||
| 2452 | Ga0501080_0035680 | |||
| 2453 | Ga0501080_0138230 | |||
| 2454 | Ga0501080_0205385 | |||
| 2455 | Ga0501080_0215163 | |||
| 2456 | Ga0501080_0237799 | |||
| 2457 | Ga0501080_0609863 | |||
| 2458 | Ga0501081_0004593 | |||
| 2459 | Ga0501081_0012409 | |||
| 2460 | Ga0501081_0013193 | |||
| 2461 | Ga0501081_0030588 | |||
| 2462 | Ga0501081_0129607 | |||
| 2463 | Ga0501081_0133495 | |||
| 2464 | Ga0501081_0171740 | |||
| 2465 | Ga0501081_0199485 | |||
| 2466 | Ga0501081_0491569 | |||
| 2467 | Ga0501081_0519755 | |||
| 2468 | Ga0501083_0031235 | |||
| 2469 | Ga0501083_0091182 | |||
| 2470 | Ga0501083_0196210 | |||
| 2471 | Ga0501083_0368241 | |||
| 2472 | Ga0501083_0601399 | |||
| 2473 | Ga0501035_0004561 | |||
| 2474 | Ga0501035_0040200 | |||
| 2475 | Ga0501035_0064632 | |||
| 2476 | Ga0501035_0251491 | |||
| 2477 | Ga0501035_0289560 | |||
| 2478 | Ga0501035_1063158 | |||
| 2479 | Ga0501044_0029988 | |||
| 2480 | Ga0501044_0098704 | |||
| 2481 | Ga0501044_0224412 | |||
| 2482 | Ga0501044_0246877 | |||
| 2483 | Ga0501044_0520460 | |||
| 2484 | Ga0501045_0017589 | |||
| 2485 | Ga0501045_0021351 | |||
| 2486 | Ga0501045_0031191 | |||
| 2487 | Ga0501045_0038060 | |||
| 2488 | Ga0501045_0047388 | |||
| 2489 | Ga0501045_0070913 | |||
| 2490 | Ga0501045_0081791 | |||
| 2491 | Ga0501045_0535239 | |||
| 2492 | nmdc:mga0yw44_241822_c1 | |||
| 2493 | nmdc:mga06z11_68021_c1 | |||
| 2494 | nmdc:mga05p37_10748_c1 | |||
| 2495 | nmdc:mga05p37_1190645_c1 | |||
| 2496 | nmdc:mga05p37_144056_c1 | |||
| 2497 | nmdc:mga05p37_15198_c1 | |||
| 2498 | nmdc:mga05p37_204218_c1 | |||
| 2499 | nmdc:mga05p37_328080_c1 | |||
| 2500 | nmdc:mga05p37_51818_c1 | |||
| 2501 | nmdc:mga05p37_556335_c1 | |||
| 2502 | nmdc:mga05p37_79479_c1 | |||
| 2503 | nmdc:mga05p37_96370_c1 | |||
| 2504 | nmdc:mga05p37_96568_c1 | |||
| 2505 | nmdc:mga09592_129799_c1 | |||
| 2506 | nmdc:mga09592_146226_c1 | |||
| 2507 | nmdc:mga09592_61944_c1 | |||
| 2508 | nmdc:mga09592_648919_c1 | |||
| 2509 | nmdc:mga0qj67_190955_c1 | |||
| 2510 | nmdc:mga06r32_108753_c1 | |||
| 2511 | nmdc:mga06r32_56625_c1 | |||
| 2512 | nmdc:mga06r32_663616_c1 | |||
| 2513 | nmdc:mga08y16_1224188_c1 | |||
| 2514 | nmdc:mga08y16_23953_c1 | |||
| 2515 | nmdc:mga08y16_314437_c1 | |||
| 2516 | nmdc:mga08y16_402098_c1 | |||
| 2517 | nmdc:mga08y16_406548_c1 | |||
| 2518 | nmdc:mga08y16_51762_c1 | |||
| 2519 | nmdc:mga08y16_55749_c1 | |||
| 2520 | nmdc:mga08y16_948234_c1 | |||
| 2521 | nmdc:mga08y16_9589_c1 | |||
| 2522 | nmdc:mga08y16_9855_c1 | |||
| 2523 | nmdc:mga0n895_1343907_c1 | |||
| 2524 | nmdc:mga0n895_198815_c1 | |||
| 2525 | nmdc:mga0n895_227061_c1 | |||
| 2526 | nmdc:mga0n895_2841_c1 | |||
| 2527 | nmdc:mga0n895_380147_c1 | |||
| 2528 | nmdc:mga0n895_624106_c1 | |||
| 2529 | nmdc:mga0n895_820070_c1 | |||
| 2530 | nmdc:mga0rr50_1093779_c1 | |||
| 2531 | nmdc:mga0rr50_114286_c1 | |||
| 2532 | nmdc:mga0rr50_153156_c1 | |||
| 2533 | nmdc:mga0rr50_425948_c1 | |||
| 2534 | nmdc:mga0rr50_64909_c1 | |||
| 2535 | nmdc:mga0rr50_9123_c1 | |||
| 2536 | nmdc:mga08x19_101458_c1 | |||
| 2537 | nmdc:mga08x19_337176_c1 | |||
| 2538 | nmdc:mga08x19_41493_c1 | |||
| 2539 | nmdc:mga08x19_509024_c1 | |||
| 2540 | nmdc:mga08x19_7105_c1 | |||
| 2541 | nmdc:mga0a205_108212_c1 | |||
| 2542 | nmdc:mga0a205_145716_c2 | |||
| 2543 | nmdc:mga0a205_16200_c2 | |||
| 2544 | nmdc:mga0a205_34944_c1 | |||
| 2545 | nmdc:mga0a205_388828_c1 | |||
| 2546 | Ga0495601_0250938 | |||
| 2547 | Ga0495612_0014657 | |||
| 2548 | Ga0495612_0030486 | |||
| 2549 | Ga0495612_0225927 | |||
| 2550 | Ga0495612_0359188 | |||
| 2551 | Ga0495595_0030251 | |||
| 2552 | Ga0495595_0073577 | |||
| 2553 | Ga0495619_0105815 | |||
| 2554 | Ga0495619_0419371 | |||
| 2555 | Ga0500566_0060298 | |||
| 2556 | Ga0501084_0000702 | |||
| 2557 | Ga0501084_0004889 | |||
| 2558 | Ga0501084_0015097 | |||
| 2559 | Ga0501084_0053524 | |||
| 2560 | Ga0501084_0058015 | |||
| 2561 | Ga0501084_0099065 | |||
| 2562 | Ga0501084_0122327 | |||
| 2563 | Ga0501084_0207121 | |||
| 2564 | Ga0501084_0688380 | |||
| 2565 | Ga0501082_0008395 | |||
| 2566 | Ga0501082_0028610 | |||
| 2567 | Ga0501082_0046862 | |||
| 2568 | Ga0501082_0097199 | |||
| 2569 | Ga0501082_0524538 | |||
| 2570 | Ga0466962_0007956 | |||
| 2571 | Ga0466962_0069637 | |||
| 2572 | Ga0466962_0130698 | |||
| 2573 | Ga0530510_0013522 | |||
| 2574 | Ga0530510_0022536 | |||
| 2575 | Ga0530510_0029037 | |||
| 2576 | Ga0530510_0029848 | |||
| 2577 | Ga0530510_0038507 | |||
| 2578 | Ga0530510_0052654 | |||
| 2579 | Ga0530510_0069822 | |||
| 2580 | Ga0530510_0187655 | |||
| 2581 | Ga0530510_0548071 | |||
| 2582 | Ga0530510_0628636 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.8478 | 41 | 214 |
| 8iig-assembly1.cif.gz_A | complex form of msmudgx h109a mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by udgx h109a | 0.8134 | 58 | 213 |
| 8iiq-assembly1.cif.gz_A | msmudgx h109s/e52n double mutant | 0.8129 | 56 | 214 |
| 8iij-assembly1.cif.gz_A | h109g mutant of uracil dna glycosylase x | 0.812 | 54 | 214 |
| 8iir-assembly1.cif.gz_A | msmudgx h109s/q53a double mutant | 0.8119 | 56 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8477 | 41 | 214 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8025 | 41 | 216 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7701 | 41 | 214 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7372 | 41 | 216 | 3.40.470.10 |
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7037 | 36 | 213 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8XIA1-F1-model_v4 | Uracil-DNA glycosylase | 0.9918 | 76 | 216 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7V8XIA1-F1-model_v4 | Uracil-DNA glycosylase | 0.9848 | 76 | 216 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7W0PTT7-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.9821 | 130 | 216 |
|
| AF-A0A7W0Z0J1-F1-model_v4 | Uracil-DNA glycosylase | 0.9778 | 25 | 216 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7W0Z0J1-F1-model_v4 | Uracil-DNA glycosylase | 0.9678 | 25 | 216 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |