metagRoot

F492617

General Info

Members	Datasets	Scaffolds	Average Seq Length
1289	1089	460	134

Family's Representative Sequence

Representative Sequence	3300050493\|nmdc:mga0k408_854754_c1\|nmdc:mga0k408_854754_c1_22_507
Length	151
Sequence	VPALFFVWQAIPFRFTATHLTKKPMGGSMIIGIGSDLIDIRRVEKTLERFGERFVKRCFTETEQRKSDGRKNRAASYAKRLGTGLAQGVLWKDMGVVNLPGGKPTMALTGGAEQRLLSLMPAGHKPAIHITITDDFPLAQAFVIIEALPAT

Samples

	Sample ID	Description	Type	Environment
1	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
2	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
3	2508501123	Mesorhizobium sp. WSM3626	Isolate	Nodule
4	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
5	2509276018	Mesorhizobium ciceri CMG6	Isolate	Nodule
6	2509276019	Ensifer aridi TW10	Isolate	Nodule
7	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
8	2509276022	Mesorhizobium australicum WSM2073	Isolate	Nodule
9	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
10	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
11	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
12	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
13	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
14	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
15	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
16	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
17	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
18	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
19	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
20	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
21	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
22	2512875024	Mesorhizobium loti R88b	Isolate	Nodule
23	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
24	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
25	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
26	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
27	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
28	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
29	2513237090	Mesorhizobium sp. WSM3224	Isolate	Nodule
30	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
31	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
32	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
33	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
34	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
35	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
36	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
37	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
38	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
39	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
40	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
41	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
42	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
43	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
44	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
45	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
46	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
47	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
48	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
49	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
50	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
51	2516143018	Ensifer sp. BR816	Isolate	Nodule
52	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
53	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
54	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
55	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
56	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
57	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
58	2523231067	Pleomorphomonas oryzae DSM 16300	Isolate	Unclassified
59	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
60	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
61	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
62	2534681786	Brucella suis 92/29	Isolate	Unclassified
63	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
64	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
65	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
66	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
67	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
68	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
69	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
70	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
71	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
72	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
73	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
74	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
75	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
76	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
77	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
78	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
79	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
80	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
81	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
82	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
83	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
84	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
85	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
86	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
87	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
88	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
89	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
90	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
91	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
92	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
93	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
94	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
95	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
96	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
97	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
98	2588253730	Mesorhizobium huakuii 7653R	Isolate	Rhizosphere
99	2597489875	Mesorhizobium ciceri ca181	Isolate	Unclassified
100	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
101	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
102	2599185301	Mesorhizobium sp. NFR06	Isolate	Rhizoplane
103	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
104	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
105	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
106	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
107	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
108	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
109	2643221550	Mesorhizobium sp. Root552	Isolate	Unclassified
110	2643221551	Mesorhizobium sp. Root1471	Isolate	Unclassified
111	2643221555	Mesorhizobium sp. Root554	Isolate	Unclassified
112	2643221557	Ensifer sp. Root558	Isolate	Unclassified
113	2643221564	Mesorhizobium sp. Root157	Isolate	Unclassified
114	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
115	2643221595	Mesorhizobium sp. Root695	Isolate	Unclassified
116	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
117	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
118	2643221610	Ensifer sp. Root74	Isolate	Unclassified
119	2643221618	Ensifer sp. Root231	Isolate	Unclassified
120	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
121	2643221626	Ensifer sp. Root31	Isolate	Unclassified
122	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
123	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
124	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
125	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
126	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
127	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
128	2643221659	Ensifer sp. Root127	Isolate	Unclassified
129	2643221668	Ensifer sp. Root423	Isolate	Unclassified
130	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
131	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
132	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
133	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
134	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
135	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
136	2643221698	Ensifer sp. Root142	Isolate	Unclassified
137	2643221712	Ensifer sp. Root258	Isolate	Unclassified
138	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
139	2643221723	Ensifer sp. Root278	Isolate	Unclassified
140	2643221726	Ensifer sp. Root954	Isolate	Unclassified
141	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
142	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
143	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
144	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
145	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
146	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
147	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
148	2718217882	Rhizobium sp. N741	Isolate	Nodule
149	2718217927	Rhizobium sp. N324	Isolate	Nodule
150	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
151	2718218009	Rhizobium sp. N561	Isolate	Nodule
152	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
153	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
154	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
155	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
156	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
157	2718218363	Rhizobium sp. N113	Isolate	Nodule
158	2718218365	Rhizobium sp. N731	Isolate	Nodule
159	2718218366	Rhizobium sp. N621	Isolate	Nodule
160	2718218423	Rhizobium sp. N941	Isolate	Nodule
161	2721755514	Rhizobium sp. N6212	Isolate	Nodule
162	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
163	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
164	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
165	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
166	2721755809	Rhizobium sp. N541	Isolate	Nodule
167	2721755810	Rhizobium sp. N871	Isolate	Nodule
168	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
169	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
170	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
171	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
172	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
173	2728369365	Rhizobium sp. N1341	Isolate	Nodule
174	2728369397	Rhizobium sp. N1314	Isolate	Nodule
175	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
176	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
177	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
178	2751185800	Brucella pituitosa AA2	Isolate	Unclassified
179	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
180	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
181	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
182	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
183	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
184	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
185	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
186	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
187	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
188	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
189	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
190	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
191	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
192	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
193	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
194	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
195	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
196	2791355256	Rhizobium sp. M10	Isolate	Nodule
197	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
198	2791355260	Rhizobium sp. L9	Isolate	Nodule
199	2791355261	Rhizobium sp. J15	Isolate	Nodule
200	2791355262	Rhizobium sp. M1	Isolate	Nodule
201	2791355263	Rhizobium chutanense C5	Isolate	Nodule
202	2791355264	Rhizobium sp. S9	Isolate	Nodule
203	2791355265	Rhizobium sp. H4	Isolate	Nodule
204	2791355266	Rhizobium sp. L43	Isolate	Nodule
205	2791355267	Rhizobium sp. L18	Isolate	Nodule
206	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
207	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
208	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
209	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
210	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
211	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
212	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
213	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
214	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
215	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
216	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
217	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
218	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
219	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
220	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
221	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
222	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
223	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
224	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
225	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
226	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
227	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
228	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
229	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
230	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
231	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
232	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
233	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
234	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
235	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
236	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
237	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
238	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
239	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
240	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
241	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
242	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
243	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
244	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
245	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
246	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
247	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
248	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
249	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
250	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
251	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
252	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
253	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
254	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
255	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
256	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
257	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
258	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
259	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
260	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
261	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
262	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
263	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
264	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
265	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
266	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
267	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
268	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
269	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
270	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
271	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
272	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
273	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
274	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
275	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
276	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
277	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
278	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
279	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
280	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
281	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
282	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
283	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
284	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
285	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
286	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
287	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
288	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
289	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
290	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
291	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
292	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
293	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
294	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
295	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
296	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
297	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
298	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
299	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
300	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
301	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
302	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
303	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
304	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
305	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
306	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
307	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
308	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
309	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
310	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
311	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
312	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
313	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
314	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
315	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
316	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
317	2847670302	Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1	Isolate	Nodule
318	2847686936	Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1	Isolate	Nodule
319	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
320	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
321	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
322	2854911287	Brucella lupini LUP21	Isolate	Unclassified
323	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
324	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
325	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
326	2856314179	Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1	Isolate	Nodule
327	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
328	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
329	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
330	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
331	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
332	2856356410	Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1	Isolate	Nodule
333	2856364286	Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1	Isolate	Nodule
334	2857349434	Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1	Isolate	Nodule
335	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
336	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
337	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
338	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
339	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
340	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
341	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
342	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
343	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
344	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
345	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
346	2869285874	Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1	Isolate	Nodule
347	2871429161	Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1	Isolate	Nodule
348	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
349	2871444079	Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1	Isolate	Nodule
350	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
351	2871459585	Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1	Isolate	Nodule
352	2871466892	Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1	Isolate	Nodule
353	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
354	2871481445	Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1	Isolate	Nodule
355	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
356	2871495908	Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1	Isolate	Nodule
357	2874102143	Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1	Isolate	Nodule
358	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
359	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
360	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
361	2874131515	Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1	Isolate	Nodule
362	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
363	2874146452	Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1	Isolate	Nodule
364	2874155637	Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1	Isolate	Nodule
365	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
366	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
367	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
368	2876369609	Mesorhizobium sp. USDA-HM6	Isolate	Unclassified
369	2876377896	Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1	Isolate	Nodule
370	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
371	2876392853	Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1	Isolate	Nodule
372	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
373	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
374	2876413966	Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1	Isolate	Nodule
375	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
376	2878035449	Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1	Isolate	Nodule
377	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
378	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
379	2878745973	Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1	Isolate	Nodule
380	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
381	2878760144	Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1	Isolate	Nodule
382	2878767105	Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1	Isolate	Nodule
383	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
384	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
385	2878788777	Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1	Isolate	Nodule
386	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
387	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
388	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
389	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
390	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
391	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
392	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
393	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
394	2885305155	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1	Isolate	Nodule
395	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
396	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
397	2885326080	Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1	Isolate	Nodule
398	2885334103	Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1	Isolate	Nodule
399	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
400	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
401	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
402	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
403	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
404	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
405	2889790730	Chelativorans xinjiangense lm93	Isolate	Rhizosphere
406	2889914905	Chelativorans alearense UJN715	Isolate	Rhizosphere
407	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
408	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
409	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
410	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
411	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
412	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
413	2903513507	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2	Isolate	Nodule
414	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
415	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
416	2903540706	Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1	Isolate	Nodule
417	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
418	2904659560	Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1	Isolate	Nodule
419	2906308376	Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1	Isolate	Nodule
420	2906321335	Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1	Isolate	Nodule
421	2906328253	Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1	Isolate	Nodule
422	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
423	2906363423	Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1	Isolate	Nodule
424	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
425	2906378014	Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1	Isolate	Nodule
426	2906386501	Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1	Isolate	Nodule
427	2906393657	Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1	Isolate	Nodule
428	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
429	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
430	2906414383	Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1	Isolate	Nodule
431	2906427513	Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1	Isolate	Nodule
432	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
433	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
434	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
435	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
436	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
437	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
438	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
439	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
440	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
441	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
442	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
443	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
444	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
445	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
446	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
447	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
448	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
449	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
450	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
451	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
452	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
453	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
454	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
455	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
456	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
457	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
458	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
459	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
460	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
461	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
462	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
463	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
464	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
465	2922158528	Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1	Isolate	Nodule
466	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
467	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
468	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
469	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
470	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
471	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
472	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
473	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
474	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
475	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
476	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
477	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
478	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
479	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
480	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
481	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
482	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
483	2924710171	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2	Isolate	Nodule
484	2924718760	Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1	Isolate	Nodule
485	2924726620	Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1	Isolate	Nodule
486	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
487	2924741084	Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2	Isolate	Nodule
488	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
489	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
490	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
491	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
492	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
493	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
494	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
495	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
496	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
497	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
498	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
499	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
500	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
501	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
502	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
503	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
504	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
505	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
506	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
507	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
508	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
509	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
510	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
511	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
512	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
513	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
514	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
515	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
516	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
517	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
518	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
519	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
520	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
521	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
522	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
523	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
524	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
525	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
526	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
527	2937813078	Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1	Isolate	Nodule
528	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
529	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
530	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
531	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
532	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
533	2937868953	Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1	Isolate	Nodule
534	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
535	2937891427	Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1	Isolate	Nodule
536	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
537	2937980651	Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1	Isolate	Nodule
538	2937994558	Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1	Isolate	Nodule
539	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
540	2939669807	Kaistia defluvii 3207	Isolate	Rhizosphere
541	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
542	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
543	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
544	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
545	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
546	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
547	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
548	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
549	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
550	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
551	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
552	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
553	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
554	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
555	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
556	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
557	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
558	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
559	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
560	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
561	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
562	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
563	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
564	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
565	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
566	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
567	2958100919	Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1	Isolate	Nodule
568	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
569	2958115193	Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1	Isolate	Nodule
570	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
571	2958130278	Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1	Isolate	Nodule
572	2958144490	Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1	Isolate	Nodule
573	2958158011	Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1	Isolate	Nodule
574	2958165035	Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1	Isolate	Nodule
575	2958172287	Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1	Isolate	Nodule
576	2958179912	Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1	Isolate	Nodule
577	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
578	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
579	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
580	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
581	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
582	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
583	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
584	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
585	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
586	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
587	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
588	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
589	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
590	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
591	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
592	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
593	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
594	2961077736	Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1	Isolate	Nodule
595	2961114664	Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1	Isolate	Nodule
596	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
597	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
598	2961163497	Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1	Isolate	Nodule
599	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
600	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
601	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
602	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
603	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
604	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
605	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
606	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
607	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
608	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
609	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
610	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
611	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
612	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
613	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
614	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
615	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
616	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
617	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
618	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
619	2965018300	Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1	Isolate	Nodule
620	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
621	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
622	2965040258	Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1	Isolate	Nodule
623	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
624	2965062239	Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1	Isolate	Nodule
625	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
626	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
627	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
628	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
629	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
630	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
631	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
632	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
633	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
634	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
635	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
636	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
637	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
638	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
639	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
640	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
641	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
642	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
643	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
644	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
645	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
646	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
647	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
648	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
649	2968091066	Mesorhizobium sp. AA23	Isolate	Unclassified
650	2968097103	Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1	Isolate	Nodule
651	2968110612	Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1	Isolate	Nodule
652	2968117919	Mesorhizobium atlanticum CNPSo 3140	Isolate	Unclassified
653	2968128360	Mesorhizobium sp. WSM3873	Isolate	Unclassified
654	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
655	2968171901	Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1	Isolate	Nodule
656	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
657	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
658	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
659	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
660	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
661	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
662	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
663	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
664	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
665	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
666	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
667	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
668	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
669	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
670	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
671	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
672	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
673	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
674	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
675	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
676	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
677	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
678	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
679	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
680	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
681	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
682	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
683	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
684	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
685	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
686	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
687	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
688	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
689	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
690	2970554993	Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1	Isolate	Nodule
691	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
692	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
693	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
694	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
695	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
696	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
697	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
698	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
699	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
700	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
701	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
702	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
703	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
704	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
705	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
706	2977843712	Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1	Isolate	Nodule
707	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
708	2977858184	Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1	Isolate	Nodule
709	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
710	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
711	2977898635	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1	Isolate	Nodule
712	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
713	2977915119	Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1	Isolate	Nodule
714	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
715	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
716	2977942078	Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1	Isolate	Nodule
717	2977950692	Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1	Isolate	Nodule
718	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
719	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
720	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
721	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
722	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
723	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
724	2979710463	Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1	Isolate	Nodule
725	2979764755	Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1	Isolate	Nodule
726	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
727	2979779861	Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1	Isolate	Nodule
728	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
729	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
730	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
731	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
732	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
733	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
734	2987636660	Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1	Isolate	Nodule
735	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
736	2987652177	Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1	Isolate	Nodule
737	2987659509	Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1	Isolate	Nodule
738	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
739	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
740	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
741	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
742	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
743	2996341866	Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1	Isolate	Nodule
744	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
745	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
746	2996887358	Rhizobium sp. R711	Isolate	Nodule
747	2996893221	Rhizobium sp. R635	Isolate	Nodule
748	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
749	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
750	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
751	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
752	3004188549	Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1	Isolate	Nodule
753	3004195979	Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1	Isolate	Nodule
754	3004203850	Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1	Isolate	Nodule
755	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
756	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
757	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
758	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
759	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
760	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
761	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
762	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
763	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
764	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
765	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
766	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
767	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
768	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
769	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
770	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
771	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
772	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
773	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
774	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
775	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
776	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
777	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
778	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
779	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
780	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
781	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
782	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
783	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
784	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
785	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
786	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
787	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
788	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
789	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
790	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
791	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
792	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
793	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
794	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
795	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
796	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
797	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
798	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
799	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
800	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
801	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
802	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
803	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
804	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
805	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
806	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
807	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
808	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
809	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
810	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
811	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
812	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
813	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
814	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
815	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
816	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
817	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
818	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
819	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
820	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
821	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
822	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
823	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
824	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
825	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
826	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
827	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
828	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
829	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
830	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
831	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
832	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
833	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
834	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
835	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
836	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
837	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
838	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
839	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
840	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
841	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
842	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
843	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
844	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
845	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
846	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
847	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
848	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
849	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
850	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
851	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
852	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
853	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
854	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
855	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
856	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
857	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
858	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
859	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
860	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
861	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
862	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
863	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
864	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
865	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
866	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
867	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
868	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
869	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
870	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
871	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
872	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
873	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
874	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
875	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
876	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
877	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
878	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
879	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
880	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
881	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
882	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
883	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
884	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
885	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
886	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
887	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
888	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
889	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
890	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
891	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
892	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
893	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
894	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
895	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
896	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
897	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
898	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
899	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
900	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
901	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
902	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
903	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
904	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
905	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
906	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
907	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
908	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
909	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
910	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
911	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
912	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
913	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
914	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
915	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
916	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
917	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
918	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
919	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
920	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
921	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
922	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
923	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
924	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
925	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
926	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
927	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
928	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
929	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
930	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
931	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
932	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
933	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
934	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
935	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
936	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
937	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
938	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
939	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
940	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
941	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
942	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
943	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
944	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
945	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
946	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
947	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
948	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
949	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
950	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
951	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
952	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
953	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
954	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
955	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
956	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
957	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
958	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
959	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
960	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
961	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
962	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
963	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
964	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
965	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
966	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
967	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
968	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
969	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
970	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
971	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
972	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
973	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
974	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
975	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
976	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
977	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
978	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
979	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
980	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
981	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
982	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
983	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
984	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
985	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
986	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
987	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
988	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
989	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
990	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
991	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
992	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
993	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
994	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
995	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
996	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
997	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
998	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
999	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
1000	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
1001	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
1002	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
1003	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
1004	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
1005	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
1006	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
1007	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
1008	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
1009	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
1010	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
1011	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
1012	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
1013	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
1014	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
1015	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
1016	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
1017	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
1018	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
1019	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
1020	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
1021	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1022	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1023	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1024	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1025	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1026	3300059624	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1027	3300059653	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1028	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
1029	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
1030	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
1031	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
1032	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
1033	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
1034	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
1035	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
1036	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
1037	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
1038	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
1039	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
1040	8004312739	Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0	Isolate	Nodule
1041	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
1042	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
1043	8004387939	Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1	Isolate	Nodule
1044	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
1045	8004445564	Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1	Isolate	Nodule
1046	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
1047	8004640170	Mesorhizobium sp. GbtcB19	Isolate	Unclassified
1048	8004695233	Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1	Isolate	Nodule
1049	8004703790	Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1	Isolate	Nodule
1050	8004714634	Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1	Isolate	Nodule
1051	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
1052	8005258706	Rhizobium sp. R693	Isolate	Nodule
1053	8005275841	Rhizobium sp. N4311	Isolate	Nodule
1054	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
1055	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
1056	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
1057	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
1058	8005321885	Rhizobium sp. R72	Isolate	Nodule
1059	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
1060	8005382845	Rhizobium sp. R634	Isolate	Nodule
1061	8005395548	Rhizobium sp. R339	Isolate	Nodule
1062	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
1063	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
1064	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
1065	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
1066	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
1067	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
1068	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
1069	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
1070	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
1071	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
1072	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
1073	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
1074	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
1075	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
1076	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
1077	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
1078	8018176218	Rhizobium sp. N122	Isolate	Nodule
1079	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
1080	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
1081	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
1082	8024501048	Rhizobium sp. H4	Isolate	Nodule
1083	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
1084	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
1085	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
1086	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
1087	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
1088	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
1089	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	34.99
Metatranscriptomes	0.7
Isolates	64.31

Biome Distribution

Category	Percentage (%)
Aerial Root	0.31
Bulb	0
Endosphere	6.13
Nodule	51.2
Rhizoplane	1.09
Rhizosphere	28.47
Stem	0
Stem Tuber	0
Unclassified	12.8

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10002242	3300001979	Bacteria	8823
2	JGI25155J39150_1000032	3300002704	Bacteria	105511
3	JGI25156J39149_1000153	3300002705	Bacteria	50769
4	JGI25162J39368_1001557	3300002737	Bacteria	11750
5	JGI25162J39368_1002811	3300002737	Bacteria	6091
6	JGI25154J39366_1000152	3300002738	Bacteria	53779
7	JGI25158J39367_1004844	3300002739	Bacteria	2000
8	JGI25157J39369_1000061	3300002741	Bacteria	105511
9	JGI25159J45721_1000366	3300002987	Bacteria	21031
10	JGI25151J46595_10019601	3300003187	Bacteria	2871
11	JGI25151J46595_10066409	3300003187	Bacteria	1117
12	JGI25165J46597_1001133	3300003214	Bacteria	16714
13	JGI25165J46597_1001496	3300003214	Bacteria	11938
14	JGI25165J46597_1005479	3300003214	Bacteria	2435
15	rootH1_10036980	3300003316	Bacteria	1898
16	rootH2_10025346	3300003320	Bacteria	1271
17	rootL2_10108798	3300003322	Bacteria	3382
18	rootH1_10010740	3300003323	Bacteria	1261
19	JGI25160J50197_1000562	3300003354	Bacteria	21031
20	JGI25161J50226_1000436	3300003374	Bacteria	19607
21	Ga0055526_1002323	3300003771	Bacteria	12953
22	Ga0055524_1001301	3300003775	Bacteria	14618
23	Ga0055536_1000472	3300003781	Bacteria	28068
24	Ga0055530_10003197	3300003791	Bacteria	9600
25	Ga0055531_10010693	3300003794	Bacteria	4527
26	Ga0058692_1017877	3300003856	Bacteria	1545
27	Ga0055543_1000745	3300004625	Bacteria	16423
28	Ga0065165_1001769	3300005262	Bacteria	21422
29	Ga0070658_10082027	3300005327	Bacteria	2649
30	Ga0070661_100245242	3300005344	Bacteria	1381
31	Ga0070669_100187483	3300005353	Bacteria	1621
32	Ga0070659_101417337	3300005366	Bacteria	618
33	Ga0070667_101290295	3300005367	Bacteria	684
34	Ga0070663_100045415	3300005455	Bacteria	3103
35	Ga0070663_100205477	3300005455	Bacteria	1539
36	Ga0068853_101117958	3300005539	Bacteria	760
37	Ga0068853_101276318	3300005539	Bacteria	710
38	Ga0070672_100333741	3300005543	Bacteria	1290
39	Ga0070665_100044231	3300005548	Bacteria	4472
40	Ga0070665_100574797	3300005548	Bacteria	1140
41	Ga0068855_100073562	3300005563	Bacteria	3970
42	Ga0068854_100021582	3300005578	Bacteria	4371
43	Ga0068854_100094141	3300005578	Bacteria	2234
44	Ga0068856_100023678	3300005614	Bacteria	5971
45	Ga0068856_101590505	3300005614	Bacteria	667
46	Ga0068852_100104729	3300005616	Bacteria	2561
47	Ga0068851_10028724	3300005834	Bacteria	2748
48	Ga0075365_10001916	3300006038	Bacteria	9809
49	Ga0075368_10007335	3300006042	Bacteria	3888
50	Ga0075363_100076185	3300006048	Bacteria	1828
51	Ga0075364_10019200	3300006051	Bacteria	4289
52	Ga0075364_10039075	3300006051	Bacteria	3075
53	Ga0075364_10078825	3300006051	Bacteria	2176
54	Ga0075362_10018882	3300006177	Bacteria	2860
55	Ga0075367_10073857	3300006178	Bacteria	2056
56	Ga0075369_10039311	3300006186	Bacteria	2020
57	Ga0075369_10268423	3300006186	Bacteria	794
58	Ga0075366_10007799	3300006195	Bacteria	5925
59	Ga0075366_10659988	3300006195	Bacteria	649
60	Ga0079104_1001881	3300006946	Bacteria	12706
61	Ga0079104_1004220	3300006946	Bacteria	6253
62	Ga0099826_10206203	3300006948	Bacteria	1071
63	Ga0105240_10000032	3300009093	Bacteria	283907
64	Ga0105243_10054588	3300009148	Bacteria	3173
65	Ga0105243_11723506	3300009148	Bacteria	656
66	Ga0105241_10108950	3300009174	Bacteria	2214
67	Ga0105248_10166391	3300009177	Bacteria	2486
68	Ga0105248_10228356	3300009177	Bacteria	2095
69	Ga0105237_10001967	3300009545	Bacteria	26136
70	Ga0105237_10445504	3300009545	Bacteria	1301
71	Ga0105238_10714232	3300009551	Bacteria	1015
72	Ga0105238_10767530	3300009551	Bacteria	979
73	Ga0105239_10005020	3300010375	Bacteria	15622
74	Ga0105239_10025211	3300010375	Bacteria	6548
75	Ga0105239_10053931	3300010375	Bacteria	4409
76	Ga0105239_10092882	3300010375	Bacteria	3331
77	Ga0105239_10323855	3300010375	Bacteria	1738
78	Ga0105239_10477172	3300010375	Bacteria	1417
79	Ga0157373_10003685	3300013100	Bacteria	11585
80	Ga0157371_10000380	3300013102	Bacteria	55836
81	Ga0157371_10276581	3300013102	Bacteria	1212
82	Ga0157370_10000748	3300013104	Bacteria	40596
83	Ga0157370_10000986	3300013104	Bacteria	35999
84	Ga0157369_10177987	3300013105	Bacteria	2239
85	Ga0171463_1001	3300013249	Bacteria	1406070
86	Ga0157374_10538352	3300013296	Bacteria	1175
87	Ga0157374_10639545	3300013296	Bacteria	1075
88	Ga0157378_10715665	3300013297	Bacteria	1022
89	Ga0163163_10382630	3300014325	Bacteria	1465
90	Ga0182008_10069012	3300014497	Bacteria	1739
91	Ga0182008_10356705	3300014497	Bacteria	777
92	Ga0157376_12150068	3300014969	Bacteria	597
93	Ga0182006_1028288	3300015261	Bacteria	2280
94	Ga0182007_10001327	3300015262	Bacteria	13356
95	Ga0182005_1005522	3300015265	Bacteria	3944
96	Ga0183363_1105	3300015690	Bacteria	24000
97	Ga0163161_10204688	3300017792	Bacteria	1522
98	Ga0214544_1000008	3300021320	Bacteria	326027
99	Ga0214542_1005858	3300021321	Bacteria	23010
100	Ga0214542_1024109	3300021321	Bacteria	3473
101	Ga0214543_1000003	3300021327	Bacteria	692327
102	Ga0214543_1005579	3300021327	Bacteria	23010
103	Ga0228711_1000001	3300022739	Bacteria	357377
104	Ga0228710_1000001	3300022740	Bacteria	314328
105	Ga0209435_100042	3300025206	Bacteria	105563
106	Ga0209436_100888	3300025208	Bacteria	11904
107	Ga0209672_102782	3300025228	Bacteria	4013
108	Ga0209437_100033	3300025233	Bacteria	512520
109	Ga0209437_100075	3300025233	Bacteria	297202
110	Ga0209646_1000145	3300025246	Bacteria	105563
111	Ga0209026_1000160	3300025250	Bacteria	105563
112	Ga0209759_1000177	3300025256	Bacteria	105563
113	Ga0209233_1000056	3300025261	Bacteria	438104
114	Ga0209233_1000064	3300025261	Bacteria	392156
115	Ga0209130_1000007	3300025284	Bacteria	591584
116	Ga0209676_1000901	3300025292	Bacteria	37489
117	Ga0209025_1000100	3300025294	Bacteria	229182
118	Ga0209025_1000149	3300025294	Bacteria	173393
119	Ga0209025_1029856	3300025294	Bacteria	2625
120	Ga0209564_1000846	3300025295	Bacteria	41021
121	Ga0209050_1001776	3300025298	Bacteria	21253
122	Ga0209256_1002123	3300025299	Bacteria	17199
123	Ga0209256_1002627	3300025299	Bacteria	14184
124	Ga0207426_1000064	3300025302	Bacteria	358276
125	Ga0209051_1001024	3300025303	Bacteria	26621
126	Ga0209257_1001970	3300025304	Bacteria	22108
127	Ga0207656_10355704	3300025321	Bacteria	731
128	Ga0207645_10629674	3300025907	Bacteria	729
129	Ga0207705_10054760	3300025909	Bacteria	2875
130	Ga0207654_10404427	3300025911	Bacteria	950
131	Ga0207654_10704782	3300025911	Bacteria	725
132	Ga0207695_10091179	3300025913	Bacteria	3062
133	Ga0207695_11126432	3300025913	Bacteria	665
134	Ga0207657_10159904	3300025919	Bacteria	1830
135	Ga0207649_10239374	3300025920	Bacteria	1302
136	Ga0207681_10199684	3300025923	Bacteria	1535
137	Ga0207694_10192997	3300025924	Bacteria	1655
138	Ga0207694_10790863	3300025924	Bacteria	801
139	Ga0207709_10031697	3300025935	Bacteria	3090
140	Ga0207668_10392674	3300025972	Bacteria	1171
141	Ga0207677_10423321	3300026023	Bacteria	1135
142	Ga0207639_10140275	3300026041	Bacteria	2013
143	Ga0207678_10183794	3300026067	Bacteria	1785
144	Ga0207702_10024952	3300026078	Bacteria	4960
145	Ga0207674_10381603	3300026116	Bacteria	1362
146	Ga0207674_10443308	3300026116	Bacteria	1255
147	Ga0209281_1000164	3300027111	Bacteria	157372
148	Ga0209281_1000332	3300027111	Bacteria	81534
149	Ga0209371_1002143	3300027312	Bacteria	11615
150	Ga0209282_1000007	3300027666	Bacteria	254917
151	Ga0209813_10005510	3300027866	Bacteria	3075
152	Ga0268266_10030589	3300028379	Bacteria	4573
153	Ga0307517_10337580	3300028786	Bacteria	825
154	Ga0307515_10068201	3300028794	Bacteria	4891
155	Ga0307515_10101441	3300028794	Bacteria	3473
156	Ga0307515_10110122	3300028794	Bacteria	3227
157	Ga0268256_1001181	3300030500	Bacteria	16760
158	Ga0265331_10067038	3300031250	Bacteria	1684
159	Ga0307513_10001304	3300031456	Bacteria	36013
160	Ga0307513_10232949	3300031456	Bacteria	1653
161	Ga0307408_100066391	3300031548	Bacteria	2649
162	Ga0307405_10206835	3300031731	Bacteria	1430
163	Ga0307405_10249563	3300031731	Bacteria	1320
164	Ga0307410_10019616	3300031852	Bacteria	4117
165	Ga0307406_10294942	3300031901	Bacteria	1243
166	Ga0307406_10691000	3300031901	Bacteria	851
167	Ga0307412_10416366	3300031911	Bacteria	1098
168	Ga0307412_11436839	3300031911	Bacteria	625
169	Ga0315914_1000006	3300031967	Bacteria	239817
170	Ga0307409_100319523	3300031995	Bacteria	1452
171	Ga0307409_100434311	3300031995	Bacteria	1263
172	Ga0307416_100149450	3300032002	Bacteria	2140
173	Ga0307416_101957565	3300032002	Bacteria	689
174	Ga0307414_10937113	3300032004	Bacteria	795
175	Ga0315913_1000002	3300033430	Bacteria	241452
176	Ga0315915_1000001	3300033464	Bacteria	481518
177	Ga0373939_0021282	3300035114	Bacteria	1773
178	Ga0373946_0572305	3300035171	Bacteria	584
179	Ga0373962_0304414	3300035242	Bacteria	566
180	Ga0373935_0035910	3300035692	Bacteria	3095
181	Ga0373927_0000554	3300035695	Bacteria	28491
182	Ga0373947_0155640	3300035725	Bacteria	1475
183	Ga0373925_0046361	3300037068	Bacteria	3232
184	Ga0395900_0031978	3300037418	Bacteria	5409
185	Ga0395900_0102189	3300037418	Bacteria	2945
186	Ga0395905_0007575	3300037471	Bacteria	10787
187	Ga0395905_0008435	3300037471	Bacteria	10160
188	Ga0395905_0020185	3300037471	Bacteria	6311
189	Ga0395905_0837248	3300037471	Bacteria	823
190	Ga0395901_0988194	3300038443	Bacteria	818
191	Ga0439436_0000884	3300041404	Bacteria	8194
192	Ga0439436_0004198	3300041404	Bacteria	4414
193	Ga0439438_037367	3300041405	Bacteria	1270
194	Ga0439439_0032682	3300041406	Bacteria	1329
195	Ga0439439_0041327	3300041406	Bacteria	1196
196	Ga0439466_0033075	3300041411	Bacteria	1759
197	Ga0439465_0001655	3300041413	Bacteria	7274
198	Ga0451795_1250875	3300041456	Bacteria	764
199	Ga0439431_0040505	3300041997	Bacteria	1185
200	Ga0439431_0075247	3300041997	Bacteria	905
201	Ga0439442_131374	3300042002	Bacteria	551
202	Ga0439449_0007276	3300042007	Bacteria	4208
203	Ga0450923_125500	3300042125	Bacteria	608
204	Ga0450906_005347	3300042145	Bacteria	2644
205	Ga0450918_002646	3300042531	Bacteria	3373
206	Ga0466963_0088827	3300044694	Bacteria	2102
207	Ga0466970_0037949	3300044765	Bacteria	2555
208	Ga0466957_0348433	3300044842	Bacteria	1004
209	Ga0466958_0055547	3300045836	Bacteria	2403
210	Ga0466967_0200288	3300045976	Bacteria	1891
211	Ga0466967_0906576	3300045976	Bacteria	877
212	Ga0495627_151809	3300046453	Bacteria	646
213	Ga0495603_0183797	3300046455	Bacteria	1209
214	Ga0495590_0017612	3300046457	Bacteria	2569
215	Ga0495638_0064826	3300046460	Bacteria	2250
216	Ga0495638_0177628	3300046460	Bacteria	1217
217	Ga0495594_0029671	3300046499	Bacteria	2957
218	Ga0495596_0195582	3300046500	Bacteria	786
219	Ga0495606_0038216	3300046507	Bacteria	3250
220	Ga0495643_0212638	3300046522	Bacteria	922
221	Ga0495642_0018640	3300046528	Bacteria	2717
222	Ga0495622_0004143	3300046557	Bacteria	6760
223	Ga0495633_0054167	3300046558	Bacteria	1887
224	Ga0495633_0065464	3300046558	Bacteria	1698
225	Ga0495668_0191171	3300046616	Bacteria	1121
226	Ga0495611_0022597	3300046648	Bacteria	2722
227	Ga0495625_0028315	3300046660	Bacteria	4203
228	Ga0495625_0513569	3300046660	Bacteria	731
229	Ga0495661_0612603	3300046665	Bacteria	511
230	Ga0495588_0023685	3300046674	Bacteria	3042
231	Ga0495588_0082004	3300046674	Bacteria	1684
232	Ga0495671_0010893	3300046692	Bacteria	5024
233	Ga0495649_0016232	3300046694	Bacteria	4223
234	Ga0495589_0262467	3300046794	Bacteria	805
235	Ga0495672_0023775	3300047320	Bacteria	3959
236	Ga0495673_0068929	3300047469	Bacteria	1493
237	Ga0495681_0016031	3300047470	Bacteria	4223
238	Ga0495686_0106308	3300047472	Bacteria	1687
239	Ga0496101_0098621	3300048904	Bacteria	2183
240	Ga0496104_1090769	3300048907	Bacteria	702
241	Ga0496108_0319092	3300048911	Bacteria	1355
242	Ga0496110_0189692	3300048913	Bacteria	1867
243	Ga0496112_0124980	3300048915	Bacteria	2543
244	Ga0496116_0030524	3300048919	Bacteria	3870
245	Ga0496117_0000002	3300048920	Bacteria	2483758
246	Ga0496117_0035868	3300048920	Bacteria	3717
247	Ga0496118_0000214	3300048921	Bacteria	100898
248	Ga0496118_0226685	3300048921	Bacteria	1082
249	Ga0496118_0363173	3300048921	Bacteria	767
250	Ga0496119_0007236	3300048922	Bacteria	10047
251	Ga0496119_0034681	3300048922	Bacteria	3317
252	Ga0496119_0041549	3300048922	Bacteria	2926
253	Ga0496120_0000125	3300048923	Bacteria	128983
254	Ga0496121_0396049	3300048924	Bacteria	906
255	Ga0496121_0651431	3300048924	Bacteria	641
256	Ga0496122_0000001	3300048925	Bacteria	1827766
257	Ga0496122_0000492	3300048925	Bacteria	82125
258	Ga0496122_0059237	3300048925	Bacteria	2827
259	Ga0496122_0136425	3300048925	Bacteria	1545
260	Ga0496123_0000001	3300048926	Bacteria	1831497
261	Ga0496123_0000460	3300048926	Bacteria	71476
262	Ga0496123_0012003	3300048926	Bacteria	7431
263	Ga0496123_0056699	3300048926	Bacteria	2557
264	Ga0496124_0000679	3300048927	Bacteria	55901
265	Ga0496124_0004429	3300048927	Bacteria	16380
266	Ga0496124_0055284	3300048927	Bacteria	3355
267	Ga0496124_0160050	3300048927	Bacteria	1756
268	Ga0496124_0434829	3300048927	Bacteria	900
269	Ga0496125_0006717	3300048928	Bacteria	12370
270	Ga0496125_0120438	3300048928	Bacteria	1873
271	Ga0496125_0164797	3300048928	Bacteria	1499
272	Ga0496126_0000811	3300048929	Bacteria	55747
273	Ga0496126_0439272	3300048929	Bacteria	1052
274	Ga0501031_0000001	3300049568	Bacteria	219461
275	Ga0501031_0013103	3300049568	Bacteria	5408
276	Ga0501031_0044699	3300049568	Bacteria	2890
277	Ga0501031_0096366	3300049568	Bacteria	1931
278	Ga0501031_0141737	3300049568	Bacteria	1571
279	Ga0501032_0000003	3300049569	Bacteria	317700
280	Ga0501032_0011071	3300049569	Bacteria	6482
281	Ga0501032_0025563	3300049569	Bacteria	4069
282	Ga0501032_0084562	3300049569	Bacteria	2109
283	Ga0501032_0213974	3300049569	Bacteria	1256
284	Ga0501032_0239632	3300049569	Bacteria	1179
285	Ga0501032_0311189	3300049569	Bacteria	1017
286	Ga0501032_0515590	3300049569	Bacteria	763
287	Ga0501033_0000150	3300049570	Bacteria	67069
288	Ga0501033_0013116	3300049570	Bacteria	6315
289	Ga0501033_0014062	3300049570	Bacteria	6087
290	Ga0501033_0026935	3300049570	Bacteria	4324
291	Ga0501033_0063262	3300049570	Bacteria	2723
292	Ga0501033_0218574	3300049570	Bacteria	1357
293	Ga0501033_0348283	3300049570	Bacteria	1038
294	Ga0501033_0584085	3300049570	Bacteria	767
295	Ga0501034_0000005	3300049571	Bacteria	367512
296	Ga0501034_0028394	3300049571	Bacteria	5693
297	Ga0501034_0031415	3300049571	Bacteria	5393
298	Ga0501034_0170842	3300049571	Bacteria	2141
299	Ga0501034_0174112	3300049571	Bacteria	2118
300	Ga0501034_0177220	3300049571	Bacteria	2097
301	Ga0501034_0358770	3300049571	Bacteria	1385
302	Ga0501034_0553985	3300049571	Bacteria	1059
303	Ga0501036_0000018	3300049572	Bacteria	121185
304	Ga0501036_0016644	3300049572	Bacteria	6140
305	Ga0501036_0103579	3300049572	Bacteria	2407
306	Ga0501036_0115524	3300049572	Bacteria	2267
307	Ga0501036_0119924	3300049572	Bacteria	2221
308	Ga0501036_0138737	3300049572	Bacteria	2052
309	Ga0501036_0994975	3300049572	Bacteria	686
310	Ga0501037_0000005	3300049573	Bacteria	219461
311	Ga0501037_0018356	3300049573	Bacteria	5156
312	Ga0501037_0029018	3300049573	Bacteria	4086
313	Ga0501037_0054934	3300049573	Bacteria	2912
314	Ga0501037_0240941	3300049573	Bacteria	1267
315	Ga0501038_0000001	3300049574	Bacteria	375481
316	Ga0501038_0013337	3300049574	Bacteria	7495
317	Ga0501038_0046621	3300049574	Bacteria	3758
318	Ga0501038_0161270	3300049574	Bacteria	1822
319	Ga0501038_0201111	3300049574	Bacteria	1599
320	Ga0501038_0265486	3300049574	Bacteria	1355
321	Ga0501038_0351628	3300049574	Bacteria	1148
322	Ga0501038_0534507	3300049574	Bacteria	893
323	Ga0501038_0898743	3300049574	Bacteria	654
324	Ga0501039_0000015	3300049575	Bacteria	219470
325	Ga0501039_0132223	3300049575	Bacteria	1958
326	Ga0501039_0562120	3300049575	Bacteria	895
327	Ga0501039_0570586	3300049575	Bacteria	887
328	Ga0501040_0004884	3300049576	Bacteria	8676
329	Ga0501040_0169572	3300049576	Bacteria	1545
330	Ga0501041_0344802	3300049577	Bacteria	941
331	Ga0501042_0419492	3300049578	Bacteria	970
332	Ga0501042_0444552	3300049578	Bacteria	940
333	Ga0501043_0000735	3300049579	Bacteria	29015
334	Ga0501043_0016045	3300049579	Bacteria	5873
335	Ga0501043_0017059	3300049579	Bacteria	5693
336	Ga0501043_0060007	3300049579	Bacteria	2985
337	Ga0501043_0108163	3300049579	Bacteria	2184
338	Ga0501043_0200601	3300049579	Bacteria	1548
339	Ga0501043_0791571	3300049579	Bacteria	686
340	Ga0501046_0033522	3300049580	Bacteria	4148
341	Ga0501046_0094336	3300049580	Bacteria	2300
342	Ga0501046_0115617	3300049580	Bacteria	2045
343	Ga0501046_0380848	3300049580	Bacteria	1021
344	Ga0501047_0000941	3300049581	Bacteria	29463
345	Ga0501047_0056297	3300049581	Bacteria	3802
346	Ga0501047_0081697	3300049581	Bacteria	3106
347	Ga0501047_0114990	3300049581	Bacteria	2572
348	Ga0501047_0296014	3300049581	Bacteria	1461
349	Ga0501047_0730329	3300049581	Bacteria	807
350	Ga0501047_0997611	3300049581	Bacteria	650
351	Ga0501047_1310763	3300049581	Bacteria	538
352	Ga0501048_0189005	3300049582	Bacteria	1459
353	Ga0501048_0316803	3300049582	Bacteria	1111
354	Ga0501068_0012912	3300049584	Bacteria	4746
355	Ga0501068_0378572	3300049584	Bacteria	911
356	Ga0501069_0012744	3300049585	Bacteria	4475
357	Ga0501069_0100538	3300049585	Bacteria	1641
358	Ga0501069_0315733	3300049585	Bacteria	918
359	Ga0501069_0524527	3300049585	Bacteria	708
360	Ga0501070_0000333	3300049586	Bacteria	42916
361	Ga0501070_0000812	3300049586	Bacteria	28368
362	Ga0501070_0008087	3300049586	Bacteria	8903
363	Ga0501070_0012428	3300049586	Bacteria	7181
364	Ga0501070_0041296	3300049586	Bacteria	3843
365	Ga0501070_0106674	3300049586	Bacteria	2315
366	Ga0501070_0239153	3300049586	Bacteria	1486
367	Ga0501070_0371552	3300049586	Bacteria	1159
368	Ga0501070_0642204	3300049586	Bacteria	843
369	Ga0501071_0094545	3300049587	Bacteria	2199
370	Ga0501071_0097736	3300049587	Bacteria	2162
371	Ga0501071_0546096	3300049587	Bacteria	890
372	Ga0501071_1324647	3300049587	Bacteria	556
373	Ga0501072_0238561	3300049588	Bacteria	1448
374	Ga0501073_0028634	3300049589	Bacteria	3980
375	Ga0501073_0099138	3300049589	Bacteria	2023
376	Ga0501073_0392824	3300049589	Bacteria	958
377	Ga0501073_0420621	3300049589	Bacteria	923
378	Ga0501074_0029970	3300049590	Bacteria	3943
379	Ga0501074_0031262	3300049590	Bacteria	3857
380	Ga0501074_0247994	3300049590	Bacteria	1266
381	Ga0501074_0257057	3300049590	Bacteria	1242
382	Ga0501075_0030159	3300049591	Bacteria	4016
383	Ga0501076_0569956	3300049592	Bacteria	934
384	Ga0501079_0122536	3300049741	Bacteria	2022
385	Ga0501079_0143433	3300049741	Bacteria	1861
386	Ga0501079_0229547	3300049741	Bacteria	1450
387	Ga0501079_0951998	3300049741	Bacteria	676
388	Ga0501079_1258207	3300049741	Bacteria	583
389	Ga0501080_0001902	3300049742	Bacteria	17987
390	Ga0501080_0028845	3300049742	Bacteria	5166
391	Ga0501080_0051625	3300049742	Bacteria	3827
392	Ga0501080_0285126	3300049742	Bacteria	1500
393	Ga0501080_0397651	3300049742	Bacteria	1240
394	Ga0501081_0062391	3300049743	Bacteria	2585
395	Ga0501083_0020073	3300049744	Bacteria	4650
396	Ga0501083_0427130	3300049744	Bacteria	862
397	Ga0501035_0000008	3300049822	Bacteria	313425
398	Ga0501035_0005330	3300049822	Bacteria	12166
399	Ga0501035_0041338	3300049822	Bacteria	4163
400	Ga0501035_0051164	3300049822	Bacteria	3700
401	Ga0501035_0075570	3300049822	Bacteria	2979
402	Ga0501035_0081056	3300049822	Bacteria	2864
403	Ga0501035_0284005	3300049822	Bacteria	1398
404	Ga0501035_0786960	3300049822	Bacteria	761
405	Ga0501044_0000001	3300049823	Bacteria	418087
406	Ga0501044_0078960	3300049823	Bacteria	3335
407	Ga0501044_0084038	3300049823	Bacteria	3217
408	Ga0501044_0097907	3300049823	Bacteria	2953
409	Ga0501044_0102479	3300049823	Bacteria	2878
410	Ga0501044_0155743	3300049823	Bacteria	2264
411	Ga0501044_0312411	3300049823	Bacteria	1498
412	Ga0501044_0538699	3300049823	Bacteria	1066
413	Ga0501044_0550456	3300049823	Bacteria	1051
414	Ga0501045_0089971	3300049824	Bacteria	2268
415	Ga0501045_0189820	3300049824	Bacteria	1531
416	Ga0501045_0250252	3300049824	Bacteria	1319
417	nmdc:mga03683_64096_c1	3300050489	Bacteria	1559
418	nmdc:mga03n38_801_c1	3300050490	Bacteria	8368
419	nmdc:mga00v17_287880_c1	3300050491	Bacteria	1067
420	nmdc:mga00v17_56696_c1	3300050491	Bacteria	2396
421	nmdc:mga00v17_7046_c1	3300050491	Bacteria	5988
422	nmdc:mga0yw44_10672_c1	3300050492	Bacteria	4703
423	nmdc:mga0yw44_9629_c1	3300050492	Bacteria	4900
424	nmdc:mga0k408_854754_c1	3300050493	Bacteria	529
425	nmdc:mga06z11_17652_c1	3300050494	Bacteria	3244
426	nmdc:mga04h51_12015_c1	3300050495	Bacteria	2420
427	nmdc:mga07m45_379661_c1	3300050496	Bacteria	821
428	nmdc:mga0sz30_150_c1	3300050516	Bacteria	25823
429	nmdc:mga0sz30_93860_c1	3300050516	Bacteria	1307
430	Ga0500635_0011816	3300053080	Bacteria	2491
431	Ga0500644_0024796	3300053088	Bacteria	1838
432	Ga0500651_0628494	3300053093	Bacteria	580
433	Ga0500560_000154	3300053107	Bacteria	7749
434	Ga0500572_006738	3300053111	Bacteria	2639
435	Ga0500608_046110	3300053122	Bacteria	2094
436	Ga0500655_002013	3300053133	Bacteria	3778
437	Ga0500658_0156767	3300053134	Bacteria	1029
438	Ga0500559_0003806	3300053136	Bacteria	7307
439	Ga0500561_0000418	3300053137	Bacteria	6989
440	Ga0500604_0288993	3300053151	Bacteria	568
441	Ga0500622_0001309	3300053156	Bacteria	20223
442	Ga0500624_001456	3300053157	Bacteria	3796
443	Ga0500634_0258347	3300053161	Bacteria	718
444	Ga0500636_0004652	3300053177	Bacteria	7789
445	Ga0500637_0049401	3300053178	Bacteria	2394
446	Ga0500611_023667	3300053727	Bacteria	1198
447	Ga0501084_0168500	3300054114	Bacteria	1849
448	Ga0501084_0393795	3300054114	Bacteria	1171
449	Ga0587085_007845	3300059506	Bacteria	1345
450	Ga0587088_003267	3300059508	Bacteria	1946
451	Ga0587090_005876	3300059510	Bacteria	1557
452	Ga0587091_067915	3300059511	Bacteria	773
453	Ga0587101_001296	3300059623	Bacteria	2112
454	Ga0587109_068791	3300059624	Bacteria	761
455	Ga0587108_009909	3300059653	Bacteria	792
456	Ga0587111_0021604	3300060346	Bacteria	1243
457	Ga0587111_0091034	3300060346	Bacteria	745
458	Ga0501082_0015266	3300060353	Bacteria	6615
459	Ga0501082_0216110	3300060353	Bacteria	1668
460	Ga0501082_1706814	3300060353	Bacteria	549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300060346	Ga0587111_0091034	Ga0587111_0091034_33_422	115
2	3300037418	Ga0395900_0031978	Ga0395900_0031978_2141_2542	122
3	3300037471	Ga0395905_0020185	Ga0395905_0020185_195_596	122
4	3300038443	Ga0395901_0988194	Ga0395901_0988194_132_533	122
5	3300006195	Ga0075366_10659988	Ga0075366_106599882	123
6	3300028794	Ga0307515_10110122	Ga0307515_101101224	123
7	3300031456	Ga0307513_10232949	Ga0307513_102329493	123
8	3300050493	nmdc:mga0k408_854754_c1	nmdc:mga0k408_854754_c1_22_507	123
9	iso_pu_bacteria	2775507049	2776912713	127
10	iso_pu_bacteria	2939669807	2939670968	128
11	iso_pu_bacteria	2513237351	2514588241	129
12	iso_pu_bacteria	2643221623	2644132838	129
13	iso_pu_bacteria	2671180139	2671694555	129
14	iso_pu_bacteria	2757320392	2757570734	129
15	iso_pu_bacteria	2837651117	2837653385	129
16	iso_pu_bacteria	2889790730	2889795297	129
17	iso_pu_bacteria	2889914905	2889916834	129
18	iso_pu_bacteria	2989771324	2989772000	129
19	iso_pu_bacteria	2996310559	2996313257	129
20	3300048927	Ga0496124_0434829	Ga0496124_0434829_274_666	130
21	3300053111	Ga0500572_006738	Ga0500572_006738_305_697	130
22	3300053177	Ga0500636_0004652	Ga0500636_0004652_7152_7544	130
23	iso_pu_bacteria	2503198000	2503203380	130
24	iso_pu_bacteria	2508501122	2509108461	130
25	iso_pu_bacteria	2508501123	2509116139	130
26	iso_pu_bacteria	2508501127	2509141539	130
27	iso_pu_bacteria	2509276018	2509370106	130
28	iso_pu_bacteria	2509276019	2509374512	130
29	iso_pu_bacteria	2509276021	2509387768	130
30	iso_pu_bacteria	2509276022	2509397806	130
31	iso_pu_bacteria	2509276033	2509443127	130
32	iso_pu_bacteria	2510065019	2510132251	130
33	iso_pu_bacteria	2510065057	2510306594	130
34	iso_pu_bacteria	2510065059	2510319064	130
35	iso_pu_bacteria	2510461069	2510840285	130
36	iso_pu_bacteria	2510461076	2510898589	130
37	iso_pu_bacteria	2510917022	2511133539	130
38	iso_pu_bacteria	2510917028	2511182789	130
39	iso_pu_bacteria	2510917030	2511197204	130
40	iso_pu_bacteria	2511231027	2511392710	130
41	iso_pu_bacteria	2511231052	2511500957	130
42	iso_pu_bacteria	2512047086	2512532372	130
43	iso_pu_bacteria	2512875016	2512929739	130
44	iso_pu_bacteria	2512875024	2512964509	130
45	iso_pu_bacteria	2512875026	2512972298	130
46	iso_pu_bacteria	2513237084	2513569088	130
47	iso_pu_bacteria	2513237085	2513580769	130
48	iso_pu_bacteria	2513237086	2513583505	130
49	iso_pu_bacteria	2513237088	2513596197	130
50	iso_pu_bacteria	2513237089	2513603377	130
51	iso_pu_bacteria	2513237090	2513608380	130
52	iso_pu_bacteria	2513237091	2513617646	130
53	iso_pu_bacteria	2513237093	2513630844	130
54	iso_pu_bacteria	2513237103	2513709255	130
55	iso_pu_bacteria	2513237138	2513865671	130
56	iso_pu_bacteria	2513237140	2513882718	130
57	iso_pu_bacteria	2513237143	2513905263	130
58	iso_pu_bacteria	2513237144	2513907574	130
59	iso_pu_bacteria	2513237146	2513925659	130
60	iso_pu_bacteria	2513237156	2513983982	130
61	iso_pu_bacteria	2513237159	2513999499	130
62	iso_pu_bacteria	2513237160	2514004832	130
63	iso_pu_bacteria	2513237162	2514020800	130
64	iso_pu_bacteria	2513237164	2514033379	130
65	iso_pu_bacteria	2513237305	2514419123	130
66	iso_pu_bacteria	2515075009	2515111235	130
67	iso_pu_bacteria	2515154107	2515608075	130
68	iso_pu_bacteria	2515154113	2515635978	130
69	iso_pu_bacteria	2515154114	2515642630	130
70	iso_pu_bacteria	2515154116	2515659240	130
71	iso_pu_bacteria	2515154134	2515740413	130
72	iso_pu_bacteria	2516143018	2516208829	130
73	iso_pu_bacteria	2516653046	2516892238	130
74	iso_pu_bacteria	2516653077	2517039877	130
75	iso_pu_bacteria	2516653085	2517075418	130
76	iso_pu_bacteria	2517093000	2517094007	130
77	iso_pu_bacteria	2517287029	2517405821	130
78	iso_pu_bacteria	2517487022	2517569037	130
79	iso_pu_bacteria	2523231067	2523467260	130
80	iso_pu_bacteria	2524023207	2524451196	130
81	iso_pu_bacteria	2524023209	2524460702	130
82	iso_pu_bacteria	2529292951	2530643942	130
83	iso_pu_bacteria	2534681786	2535484409	130
84	iso_pu_bacteria	2534681796	2535515667	130
85	iso_pu_bacteria	2537561587	2537874445	130
86	iso_pu_bacteria	2551306084	2551676417	130
87	iso_pu_bacteria	2551306085	2551687226	130
88	iso_pu_bacteria	2551306087	2551703171	130
89	iso_pu_bacteria	2551306089	2551712368	130
90	iso_pu_bacteria	2551306093	2551740387	130
91	iso_pu_bacteria	2554235003	2554247055	130
92	iso_pu_bacteria	2558860100	2558863539	130
93	iso_pu_bacteria	2558860242	2559294280	130
94	iso_pu_bacteria	2582581283	2585165491	130
95	iso_pu_bacteria	2582581294	2585203027	130
96	iso_pu_bacteria	2582581298	2585220941	130
97	iso_pu_bacteria	2582581299	2585231546	130
98	iso_pu_bacteria	2582581304	2585256664	130
99	iso_pu_bacteria	2582581306	2585266241	130
100	iso_pu_bacteria	2582581307	2585273309	130
101	iso_pu_bacteria	2582581308	2585278855	130
102	iso_pu_bacteria	2582581315	2585325531	130
103	iso_pu_bacteria	2582581316	2585329685	130
104	iso_pu_bacteria	2582581865	2585387243	130
105	iso_pu_bacteria	2582581866	2585392656	130
106	iso_pu_bacteria	2582581867	2585400177	130
107	iso_pu_bacteria	2585427526	2585527915	130
108	iso_pu_bacteria	2585427527	2585530653	130
109	iso_pu_bacteria	2585427528	2585541481	130
110	iso_pu_bacteria	2585427529	2585549959	130
111	iso_pu_bacteria	2585427530	2585554833	130
112	iso_pu_bacteria	2585427531	2585559391	130
113	iso_pu_bacteria	2585427590	2585822736	130
114	iso_pu_bacteria	2585427593	2585839386	130
115	iso_pu_bacteria	2585427594	2585847268	130
116	iso_pu_bacteria	2585427608	2585902061	130
117	iso_pu_bacteria	2585427609	2585905233	130
118	iso_pu_bacteria	2585428125	2587979652	130
119	iso_pu_bacteria	2588253730	2588515322	130
120	iso_pu_bacteria	2597489875	2597815079	130
121	iso_pu_bacteria	2599185170	2599418641	130
122	iso_pu_bacteria	2599185210	2599602655	130
123	iso_pu_bacteria	2599185301	2599940334	130
124	iso_pu_bacteria	2599185352	2600191875	130
125	iso_pu_bacteria	2600255279	2601608733	130
126	iso_pu_bacteria	2600255308	2601745507	130
127	iso_pu_bacteria	2615840626	2616305871	130
128	iso_pu_bacteria	2615840698	2616553887	130
129	iso_pu_bacteria	2617270742	2617383811	130
130	iso_pu_bacteria	2643221550	2643770218	130
131	iso_pu_bacteria	2643221551	2643774879	130
132	iso_pu_bacteria	2643221555	2643793323	130
133	iso_pu_bacteria	2643221557	2643807260	130
134	iso_pu_bacteria	2643221564	2643838716	130
135	iso_pu_bacteria	2643221582	2643918655	130
136	iso_pu_bacteria	2643221595	2643985415	130
137	iso_pu_bacteria	2643221599	2644007872	130
138	iso_pu_bacteria	2643221607	2644046640	130
139	iso_pu_bacteria	2643221610	2644069473	130
140	iso_pu_bacteria	2643221618	2644109051	130
141	iso_pu_bacteria	2643221626	2644151573	130
142	iso_pu_bacteria	2643221627	2644152111	130
143	iso_pu_bacteria	2643221634	2644196463	130
144	iso_pu_bacteria	2643221636	2644202347	130
145	iso_pu_bacteria	2643221637	2644206276	130
146	iso_pu_bacteria	2643221643	2644242835	130
147	iso_pu_bacteria	2643221655	2644311707	130
148	iso_pu_bacteria	2643221659	2644329964	130
149	iso_pu_bacteria	2643221668	2644380642	130
150	iso_pu_bacteria	2643221675	2644420627	130
151	iso_pu_bacteria	2643221680	2644454152	130
152	iso_pu_bacteria	2643221686	2644479429	130
153	iso_pu_bacteria	2643221688	2644493457	130
154	iso_pu_bacteria	2643221689	2644502468	130
155	iso_pu_bacteria	2643221693	2644518802	130
156	iso_pu_bacteria	2643221698	2644546638	130
157	iso_pu_bacteria	2643221712	2644617506	130
158	iso_pu_bacteria	2643221718	2644649924	130
159	iso_pu_bacteria	2643221723	2644675709	130
160	iso_pu_bacteria	2643221726	2644689489	130
161	iso_pu_bacteria	2657244999	2657683317	130
162	iso_pu_bacteria	2667528174	2671115363	130
163	iso_pu_bacteria	2687453392	2688600212	130
164	iso_pu_bacteria	2690316117	2692316877	130
165	iso_pu_bacteria	2693429783	2694633784	130
166	iso_pu_bacteria	2693429784	2694639876	130
167	iso_pu_bacteria	2718217882	2719180235	130
168	iso_pu_bacteria	2718217927	2719384803	130
169	iso_pu_bacteria	2718217997	2719664564	130
170	iso_pu_bacteria	2718218009	2719730984	130
171	iso_pu_bacteria	2718218199	2720490984	130
172	iso_pu_bacteria	2718218232	2720612346	130
173	iso_pu_bacteria	2718218233	2720619184	130
174	iso_pu_bacteria	2718218235	2720630586	130
175	iso_pu_bacteria	2718218269	2720774279	130
176	iso_pu_bacteria	2718218363	2721146329	130
177	iso_pu_bacteria	2718218365	2721157849	130
178	iso_pu_bacteria	2718218366	2721163208	130
179	iso_pu_bacteria	2718218423	2721398523	130
180	iso_pu_bacteria	2721755514	2722839378	130
181	iso_pu_bacteria	2721755556	2723026006	130
182	iso_pu_bacteria	2721755684	2723559550	130
183	iso_pu_bacteria	2721755685	2723566167	130
184	iso_pu_bacteria	2721755686	2723577489	130
185	iso_pu_bacteria	2721755809	2724037336	130
186	iso_pu_bacteria	2721755810	2724043740	130
187	iso_pu_bacteria	2721755819	2724088886	130
188	iso_pu_bacteria	2721755822	2724103432	130
189	iso_pu_bacteria	2721755823	2724109277	130
190	iso_pu_bacteria	2724679232	2725948435	130
191	iso_pu_bacteria	2728369352	2730106942	130
192	iso_pu_bacteria	2728369365	2730163472	130
193	iso_pu_bacteria	2728369397	2730297481	130
194	iso_pu_bacteria	2738541293	2738802112	130
195	iso_pu_bacteria	2738541333	2739035847	130
196	iso_pu_bacteria	2738543031	2739347770	130
197	iso_pu_bacteria	2751185800	2753358975	130
198	iso_pu_bacteria	2751185821	2753460757	130
199	iso_pu_bacteria	2756170246	2756673227	130
200	iso_pu_bacteria	2758568016	2758641210	130
201	iso_pu_bacteria	2765235802	2765465147	130
202	iso_pu_bacteria	2765235942	2766067652	130
203	iso_pu_bacteria	2767802442	2770197294	130
204	iso_pu_bacteria	2775506902	2776272000	130
205	iso_pu_bacteria	2775506904	2776279481	130
206	iso_pu_bacteria	2775507266	2778177411	130
207	iso_pu_bacteria	2791355082	2792584112	130
208	iso_pu_bacteria	2791355091	2792622736	130
209	iso_pu_bacteria	2791355092	2792628344	130
210	iso_pu_bacteria	2791355094	2792638394	130
211	iso_pu_bacteria	2791355123	2792749197	130
212	iso_pu_bacteria	2791355253	2793282251	130
213	iso_pu_bacteria	2791355256	2793296153	130
214	iso_pu_bacteria	2791355259	2793317475	130
215	iso_pu_bacteria	2791355260	2793321152	130
216	iso_pu_bacteria	2791355261	2793327181	130
217	iso_pu_bacteria	2791355262	2793333568	130
218	iso_pu_bacteria	2791355263	2793339853	130
219	iso_pu_bacteria	2791355264	2793347876	130
220	iso_pu_bacteria	2791355265	2793353522	130
221	iso_pu_bacteria	2791355266	2793358863	130
222	iso_pu_bacteria	2791355267	2793367798	130
223	iso_pu_bacteria	2802428858	2802717680	130
224	iso_pu_bacteria	2802428859	2802723392	130
225	iso_pu_bacteria	2802428860	2802731157	130
226	iso_pu_bacteria	2802428861	2802736164	130
227	iso_pu_bacteria	2802428862	2802743626	130
228	iso_pu_bacteria	2802428863	2802750662	130
229	iso_pu_bacteria	2802429268	2804751293	130
230	iso_pu_bacteria	2802429605	2805926625	130
231	iso_pu_bacteria	2802429633	2806046974	130
232	iso_pu_bacteria	2802429634	2806052557	130
233	iso_pu_bacteria	2802429635	2806058672	130
234	iso_pu_bacteria	2802429636	2806067560	130
235	iso_pu_bacteria	2802429637	2806073931	130
236	iso_pu_bacteria	2808606387	2808985945	130
237	iso_pu_bacteria	2818991439	2819556065	130
238	iso_pu_bacteria	2818991448	2819612262	130
239	iso_pu_bacteria	2818991453	2819639300	130
240	iso_pu_bacteria	2838016132	2838017235	130
241	iso_pu_bacteria	2838022645	2838023216	130
242	iso_pu_bacteria	2838029111	2838031367	130
243	iso_pu_bacteria	2838035591	2838037668	130
244	iso_pu_bacteria	2838042994	2838048040	130
245	iso_pu_bacteria	2838048938	2838049283	130
246	iso_pu_bacteria	2838061910	2838063271	130
247	iso_pu_bacteria	2838068647	2838074097	130
248	iso_pu_bacteria	2838074704	2838076389	130
249	iso_pu_bacteria	2838661181	2838662675	130
250	iso_pu_bacteria	2838668709	2838670798	130
251	iso_pu_bacteria	2838675328	2838676791	130
252	iso_pu_bacteria	2838680041	2838681289	130
253	iso_pu_bacteria	2838686498	2838688666	130
254	iso_pu_bacteria	2838694306	2838694676	130
255	iso_pu_bacteria	2838701080	2838703169	130
256	iso_pu_bacteria	2838707686	2838708054	130
257	iso_pu_bacteria	2838714209	2838715675	130
258	iso_pu_bacteria	2838719591	2838720525	130
259	iso_pu_bacteria	2838724970	2838726431	130
260	iso_pu_bacteria	2838729681	2838730961	130
261	iso_pu_bacteria	2838742623	2838744145	130
262	iso_pu_bacteria	2839993093	2839995946	130
263	iso_pu_bacteria	2840764183	2840769619	130
264	iso_pu_bacteria	2841734538	2841741198	130
265	iso_pu_bacteria	2841846520	2841847459	130
266	iso_pu_bacteria	2841851746	2841856826	130
267	iso_pu_bacteria	2841859092	2841860005	130
268	iso_pu_bacteria	2841864319	2841865531	130
269	iso_pu_bacteria	2842077413	2842080715	130
270	iso_pu_bacteria	2842110456	2842117618	130
271	iso_pu_bacteria	2842118031	2842121334	130
272	iso_pu_bacteria	2842124991	2842126511	130
273	iso_pu_bacteria	2842130223	2842131684	130
274	iso_pu_bacteria	2842146304	2842147607	130
275	iso_pu_bacteria	2842152218	2842153147	130
276	iso_pu_bacteria	2842156927	2842159996	130
277	iso_pu_bacteria	2842163707	2842168238	130
278	iso_pu_bacteria	2842170452	2842171918	130
279	iso_pu_bacteria	2842175837	2842176766	130
280	iso_pu_bacteria	2842180545	2842183387	130
281	iso_pu_bacteria	2842187318	2842188783	130
282	iso_pu_bacteria	2842192696	2842197901	130
283	iso_pu_bacteria	2842198810	2842199644	130
284	iso_pu_bacteria	2842205361	2842207749	130
285	iso_pu_bacteria	2842211629	2842213094	130
286	iso_pu_bacteria	2842217011	2842221154	130
287	iso_pu_bacteria	2842224351	2842225287	130
288	iso_pu_bacteria	2842229732	2842235012	130
289	iso_pu_bacteria	2842237096	2842237465	130
290	iso_pu_bacteria	2842243621	2842245609	130
291	iso_pu_bacteria	2842250916	2842252673	130
292	iso_pu_bacteria	2842257432	2842259741	130
293	iso_pu_bacteria	2842264693	2842270143	130
294	iso_pu_bacteria	2842271015	2842274580	130
295	iso_pu_bacteria	2842278818	2842281456	130
296	iso_pu_bacteria	2842285085	2842287165	130
297	iso_pu_bacteria	2842291075	2842294371	130
298	iso_pu_bacteria	2842298080	2842302506	130
299	iso_pu_bacteria	2842304105	2842306824	130
300	iso_pu_bacteria	2842311132	2842314504	130
301	iso_pu_bacteria	2842317721	2842318701	130
302	iso_pu_bacteria	2842341865	2842343652	130
303	iso_pu_bacteria	2842357229	2842360761	130
304	iso_pu_bacteria	2842363717	2842365192	130
305	iso_pu_bacteria	2842370503	2842371752	130
306	iso_pu_bacteria	2842377471	2842380769	130
307	iso_pu_bacteria	2842384541	2842387840	130
308	iso_pu_bacteria	2842395702	2842398322	130
309	iso_pu_bacteria	2842402390	2842404433	130
310	iso_pu_bacteria	2842409023	2842410882	130
311	iso_pu_bacteria	2842415677	2842417662	130
312	iso_pu_bacteria	2842422224	2842427303	130
313	iso_pu_bacteria	2842428310	2842433965	130
314	iso_pu_bacteria	2842434925	2842440341	130
315	iso_pu_bacteria	2842441272	2842446880	130
316	iso_pu_bacteria	2842447887	2842453420	130
317	iso_pu_bacteria	2842462802	2842468384	130
318	iso_pu_bacteria	2842469257	2842474902	130
319	iso_pu_bacteria	2842475841	2842478038	130
320	iso_pu_bacteria	2842482326	2842482801	130
321	iso_pu_bacteria	2842489311	2842493709	130
322	iso_pu_bacteria	2842495871	2842497336	130
323	iso_pu_bacteria	2842502639	2842504847	130
324	iso_pu_bacteria	2842509118	2842509673	130
325	iso_pu_bacteria	2842515876	2842516790	130
326	iso_pu_bacteria	2842521101	2842525293	130
327	iso_pu_bacteria	2842871566	2842874575	130
328	iso_pu_bacteria	2844002411	2844005687	130
329	iso_pu_bacteria	2844009547	2844015529	130
330	iso_pu_bacteria	2844163670	2844168575	130
331	iso_pu_bacteria	2844454524	2844455183	130
332	iso_pu_bacteria	2847417321	2847418056	130
333	iso_pu_bacteria	2847670302	2847671900	130
334	iso_pu_bacteria	2847686936	2847688128	130
335	iso_pu_bacteria	2848992105	2848993031	130
336	iso_pu_bacteria	2850079185	2850080422	130
337	iso_pu_bacteria	2852387548	2852389016	130
338	iso_pu_bacteria	2854911287	2854914491	130
339	iso_pu_bacteria	2855825444	2855831308	130
340	iso_pu_bacteria	2855839649	2855840433	130
341	iso_pu_bacteria	2855872281	2855879169	130
342	iso_pu_bacteria	2856314179	2856318370	130
343	iso_pu_bacteria	2856320880	2856324322	130
344	iso_pu_bacteria	2856328259	2856328515	130
345	iso_pu_bacteria	2856334872	2856339200	130
346	iso_pu_bacteria	2856342000	2856345528	130
347	iso_pu_bacteria	2856349417	2856352573	130
348	iso_pu_bacteria	2856356410	2856361051	130
349	iso_pu_bacteria	2856364286	2856364726	130
350	iso_pu_bacteria	2857349434	2857354999	130
351	iso_pu_bacteria	2857367948	2857375068	130
352	iso_pu_bacteria	2857516855	2857520341	130
353	iso_pu_bacteria	2858800743	2858800961	130
354	iso_pu_bacteria	2869169390	2869169606	130
355	iso_pu_bacteria	2869234852	2869241834	130
356	iso_pu_bacteria	2869242130	2869242293	130
357	iso_pu_bacteria	2869249662	2869250650	130
358	iso_pu_bacteria	2869256925	2869257557	130
359	iso_pu_bacteria	2869264136	2869264693	130
360	iso_pu_bacteria	2869271264	2869277658	130
361	iso_pu_bacteria	2869278585	2869281680	130
362	iso_pu_bacteria	2869285874	2869289825	130
363	iso_pu_bacteria	2871429161	2871431946	130
364	iso_pu_bacteria	2871435913	2871436355	130
365	iso_pu_bacteria	2871444079	2871451305	130
366	iso_pu_bacteria	2871451962	2871455673	130
367	iso_pu_bacteria	2871459585	2871460759	130
368	iso_pu_bacteria	2871466892	2871471132	130
369	iso_pu_bacteria	2871474448	2871478791	130
370	iso_pu_bacteria	2871481445	2871488562	130
371	iso_pu_bacteria	2871488783	2871494017	130
372	iso_pu_bacteria	2871495908	2871500215	130
373	iso_pu_bacteria	2874102143	2874103321	130
374	iso_pu_bacteria	2874109183	2874115257	130
375	iso_pu_bacteria	2874116593	2874118938	130
376	iso_pu_bacteria	2874123672	2874127647	130
377	iso_pu_bacteria	2874131515	2874138343	130
378	iso_pu_bacteria	2874139085	2874140655	130
379	iso_pu_bacteria	2874146452	2874155569	130
380	iso_pu_bacteria	2874155637	2874162426	130
381	iso_pu_bacteria	2874162495	2874165739	130
382	iso_pu_bacteria	2874168670	2874175368	130
383	iso_pu_bacteria	2876363079	2876366698	130
384	iso_pu_bacteria	2876369609	2876376538	130
385	iso_pu_bacteria	2876377896	2876383845	130
386	iso_pu_bacteria	2876386047	2876390665	130
387	iso_pu_bacteria	2876392853	2876399383	130
388	iso_pu_bacteria	2876399893	2876400507	130
389	iso_pu_bacteria	2876406927	2876413287	130
390	iso_pu_bacteria	2876413966	2876420914	130
391	iso_pu_bacteria	2876420981	2876427213	130
392	iso_pu_bacteria	2878035449	2878037706	130
393	iso_pu_bacteria	2878730984	2878737200	130
394	iso_pu_bacteria	2878738818	2878742437	130
395	iso_pu_bacteria	2878745973	2878748552	130
396	iso_pu_bacteria	2878753008	2878756593	130
397	iso_pu_bacteria	2878760144	2878764326	130
398	iso_pu_bacteria	2878767105	2878771407	130
399	iso_pu_bacteria	2878774303	2878775408	130
400	iso_pu_bacteria	2878781027	2878787328	130
401	iso_pu_bacteria	2878788777	2878790589	130
402	iso_pu_bacteria	2881147464	2881153749	130
403	iso_pu_bacteria	2881155292	2881157536	130
404	iso_pu_bacteria	2881161766	2881162898	130
405	iso_pu_bacteria	2881845957	2881847135	130
406	iso_pu_bacteria	2881853255	2881859878	130
407	iso_pu_bacteria	2881861095	2881861997	130
408	iso_pu_bacteria	2882632389	2882634464	130
409	iso_pu_bacteria	2882912400	2882918843	130
410	iso_pu_bacteria	2885305155	2885311682	130
411	iso_pu_bacteria	2885312484	2885316322	130
412	iso_pu_bacteria	2885318864	2885321972	130
413	iso_pu_bacteria	2885326080	2885327385	130
414	iso_pu_bacteria	2885334103	2885337199	130
415	iso_pu_bacteria	2885342637	2885349840	130
416	iso_pu_bacteria	2885350715	2885353815	130
417	iso_pu_bacteria	2888337043	2888341395	130
418	iso_pu_bacteria	2888343758	2888348555	130
419	iso_pu_bacteria	2888350351	2888350722	130
420	iso_pu_bacteria	2889010040	2889013062	130
421	iso_pu_bacteria	2891373044	2891374743	130
422	iso_pu_bacteria	2896384573	2896386590	130
423	iso_pu_bacteria	2899792073	2899794963	130
424	iso_pu_bacteria	2899845264	2899847190	130
425	iso_pu_bacteria	2903448605	2903452874	130
426	iso_pu_bacteria	2903492973	2903502479	130
427	iso_pu_bacteria	2903492973	2903506174	130
428	iso_pu_bacteria	2903513507	2903514503	130
429	iso_pu_bacteria	2903521522	2903524565	130
430	iso_pu_bacteria	2903528002	2903531192	130
431	iso_pu_bacteria	2903540706	2903545028	130
432	iso_pu_bacteria	2904578770	2904581316	130
433	iso_pu_bacteria	2904659560	2904665910	130
434	iso_pu_bacteria	2906308376	2906312114	130
435	iso_pu_bacteria	2906321335	2906323852	130
436	iso_pu_bacteria	2906328253	2906331295	130
437	iso_pu_bacteria	2906354277	2906354929	130
438	iso_pu_bacteria	2906363423	2906365801	130
439	iso_pu_bacteria	2906370794	2906375297	130
440	iso_pu_bacteria	2906378014	2906382813	130
441	iso_pu_bacteria	2906386501	2906391820	130
442	iso_pu_bacteria	2906393657	2906397441	130
443	iso_pu_bacteria	2906401398	2906402645	130
444	iso_pu_bacteria	2906408224	2906414219	130
445	iso_pu_bacteria	2906414383	2906418407	130
446	iso_pu_bacteria	2906427513	2906428025	130
447	iso_pu_bacteria	2913295892	2913297493	130
448	iso_pu_bacteria	2915650412	2915651479	130
449	iso_pu_bacteria	2915980308	2915986160	130
450	iso_pu_bacteria	2915986958	2915990909	130
451	iso_pu_bacteria	2915993759	2915996275	130
452	iso_pu_bacteria	2916000859	2916005753	130
453	iso_pu_bacteria	2916007675	2916010912	130
454	iso_pu_bacteria	2916014648	2916016549	130
455	iso_pu_bacteria	2916021584	2916024748	130
456	iso_pu_bacteria	2916028427	2916032195	130
457	iso_pu_bacteria	2916035215	2916038150	130
458	iso_pu_bacteria	2916041962	2916047922	130
459	iso_pu_bacteria	2916048683	2916054357	130
460	iso_pu_bacteria	2916055098	2916055372	130
461	iso_pu_bacteria	2916061851	2916062811	130
462	iso_pu_bacteria	2916076590	2916078182	130
463	iso_pu_bacteria	2919114240	2919115878	130
464	iso_pu_bacteria	2919119836	2919122555	130
465	iso_pu_bacteria	2919408235	2919409253	130
466	iso_pu_bacteria	2920760137	2920762925	130
467	iso_pu_bacteria	2920822456	2920823792	130
468	iso_pu_bacteria	2921201388	2921204926	130
469	iso_pu_bacteria	2921208531	2921213516	130
470	iso_pu_bacteria	2921237296	2921241608	130
471	iso_pu_bacteria	2921244191	2921247530	130
472	iso_pu_bacteria	2921250672	2921250942	130
473	iso_pu_bacteria	2921257292	2921261595	130
474	iso_pu_bacteria	2921263974	2921264249	130
475	iso_pu_bacteria	2921282425	2921282754	130
476	iso_pu_bacteria	2921289301	2921290144	130
477	iso_pu_bacteria	2921296804	2921300899	130
478	iso_pu_bacteria	2922130491	2922130765	130
479	iso_pu_bacteria	2922151315	2922157794	130
480	iso_pu_bacteria	2922158528	2922161588	130
481	iso_pu_bacteria	2922172374	2922172430	130
482	iso_pu_bacteria	2922178524	2922185148	130
483	iso_pu_bacteria	2922185730	2922187452	130
484	iso_pu_bacteria	2923556063	2923557622	130
485	iso_pu_bacteria	2924144063	2924145614	130
486	iso_pu_bacteria	2924150972	2924157256	130
487	iso_pu_bacteria	2924158325	2924160559	130
488	iso_pu_bacteria	2924165586	2924168165	130
489	iso_pu_bacteria	2924172951	2924173412	130
490	iso_pu_bacteria	2924179722	2924186328	130
491	iso_pu_bacteria	2924186466	2924189498	130
492	iso_pu_bacteria	2924193448	2924198234	130
493	iso_pu_bacteria	2924200457	2924204073	130
494	iso_pu_bacteria	2924207177	2924209895	130
495	iso_pu_bacteria	2924214083	2924215915	130
496	iso_pu_bacteria	2924221636	2924226243	130
497	iso_pu_bacteria	2924228884	2924234920	130
498	iso_pu_bacteria	2924710171	2924711062	130
499	iso_pu_bacteria	2924718760	2924719495	130
500	iso_pu_bacteria	2924726620	2924726734	130
501	iso_pu_bacteria	2924733363	2924735473	130
502	iso_pu_bacteria	2924741084	2924742886	130
503	iso_pu_bacteria	2924748358	2924751583	130
504	iso_pu_bacteria	2924762789	2924764548	130
505	iso_pu_bacteria	2924776078	2924780237	130
506	iso_pu_bacteria	2924784321	2924788179	130
507	iso_pu_bacteria	2926754445	2926756818	130
508	iso_pu_bacteria	2926760298	2926761057	130
509	iso_pu_bacteria	2929138655	2929139467	130
510	iso_pu_bacteria	2933006813	2933007790	130
511	iso_pu_bacteria	2933011516	2933012568	130
512	iso_pu_bacteria	2933016740	2933018860	130
513	iso_pu_bacteria	2933570622	2933573062	130
514	iso_pu_bacteria	2933586486	2933593712	130
515	iso_pu_bacteria	2933594066	2933595010	130
516	iso_pu_bacteria	2933599457	2933604552	130
517	iso_pu_bacteria	2935894831	2935895198	130
518	iso_pu_bacteria	2935901341	2935904188	130
519	iso_pu_bacteria	2936367885	2936368176	130
520	iso_pu_bacteria	2936375103	2936381431	130
521	iso_pu_bacteria	2936381700	2936387441	130
522	iso_pu_bacteria	2936996657	2937001240	130
523	iso_pu_bacteria	2937002841	2937009528	130
524	iso_pu_bacteria	2937009748	2937010872	130
525	iso_pu_bacteria	2937016420	2937018999	130
526	iso_pu_bacteria	2937023124	2937027939	130
527	iso_pu_bacteria	2937029754	2937029879	130
528	iso_pu_bacteria	2937036028	2937036905	130
529	iso_pu_bacteria	2937042894	2937048975	130
530	iso_pu_bacteria	2937049772	2937056298	130
531	iso_pu_bacteria	2937056579	2937063359	130
532	iso_pu_bacteria	2937063883	2937070639	130
533	iso_pu_bacteria	2937071275	2937072173	130
534	iso_pu_bacteria	2937078374	2937082986	130
535	iso_pu_bacteria	2937084907	2937088173	130
536	iso_pu_bacteria	2937091812	2937097503	130
537	iso_pu_bacteria	2937098957	2937103649	130
538	iso_pu_bacteria	2937106411	2937112548	130
539	iso_pu_bacteria	2937113482	2937118188	130
540	iso_pu_bacteria	2937119839	2937121171	130
541	iso_pu_bacteria	2937126314	2937129805	130
542	iso_pu_bacteria	2937813078	2937818062	130
543	iso_pu_bacteria	2937822353	2937829193	130
544	iso_pu_bacteria	2937836603	2937840754	130
545	iso_pu_bacteria	2937843397	2937846735	130
546	iso_pu_bacteria	2937848649	2937850777	130
547	iso_pu_bacteria	2937861824	2937867036	130
548	iso_pu_bacteria	2937877337	2937882757	130
549	iso_pu_bacteria	2937891427	2937894592	130
550	iso_pu_bacteria	2937972304	2937973269	130
551	iso_pu_bacteria	2937980651	2937986478	130
552	iso_pu_bacteria	2937994558	2937998875	130
553	iso_pu_bacteria	2938014810	2938022134	130
554	iso_pu_bacteria	2941499720	2941500273	130
555	iso_pu_bacteria	2957375807	2957380038	130
556	iso_pu_bacteria	2957382221	2957385083	130
557	iso_pu_bacteria	2957388812	2957389146	130
558	iso_pu_bacteria	2957395598	2957396392	130
559	iso_pu_bacteria	2957402308	2957405462	130
560	iso_pu_bacteria	2957408893	2957413265	130
561	iso_pu_bacteria	2957415311	2957419184	130
562	iso_pu_bacteria	2957422303	2957427719	130
563	iso_pu_bacteria	2957430029	2957431105	130
564	iso_pu_bacteria	2957437181	2957441976	130
565	iso_pu_bacteria	2957443900	2957446668	130
566	iso_pu_bacteria	2957450854	2957454176	130
567	iso_pu_bacteria	2957457609	2957457617	130
568	iso_pu_bacteria	2957464669	2957467762	130
569	iso_pu_bacteria	2957471148	2957477804	130
570	iso_pu_bacteria	2957478035	2957480642	130
571	iso_pu_bacteria	2957484790	2957485804	130
572	iso_pu_bacteria	2957491536	2957495980	130
573	iso_pu_bacteria	2957498199	2957501022	130
574	iso_pu_bacteria	2957505466	2957509578	130
575	iso_pu_bacteria	2958034702	2958037641	130
576	iso_pu_bacteria	2958041894	2958047352	130
577	iso_pu_bacteria	2958041894	2958056601	130
578	iso_pu_bacteria	2958064165	2958066015	130
579	iso_pu_bacteria	2958071322	2958075109	130
580	iso_pu_bacteria	2958084443	2958089882	130
581	iso_pu_bacteria	2958100919	2958107882	130
582	iso_pu_bacteria	2958108152	2958109200	130
583	iso_pu_bacteria	2958115193	2958116908	130
584	iso_pu_bacteria	2958122699	2958123748	130
585	iso_pu_bacteria	2958130278	2958134197	130
586	iso_pu_bacteria	2958144490	2958149398	130
587	iso_pu_bacteria	2958158011	2958163820	130
588	iso_pu_bacteria	2958165035	2958169350	130
589	iso_pu_bacteria	2958172287	2958174755	130
590	iso_pu_bacteria	2958179912	2958183843	130
591	iso_pu_bacteria	2960584000	2960586630	130
592	iso_pu_bacteria	2960591022	2960595560	130
593	iso_pu_bacteria	2960597568	2960600589	130
594	iso_pu_bacteria	2960603979	2960609489	130
595	iso_pu_bacteria	2960610863	2960616725	130
596	iso_pu_bacteria	2960617483	2960617689	130
597	iso_pu_bacteria	2960624210	2960629782	130
598	iso_pu_bacteria	2960631154	2960633239	130
599	iso_pu_bacteria	2960637947	2960640193	130
600	iso_pu_bacteria	2960645483	2960648742	130
601	iso_pu_bacteria	2960652885	2960659500	130
602	iso_pu_bacteria	2960660292	2960666390	130
603	iso_pu_bacteria	2960667422	2960673911	130
604	iso_pu_bacteria	2960674078	2960678818	130
605	iso_pu_bacteria	2960680706	2960684149	130
606	iso_pu_bacteria	2960687367	2960692065	130
607	iso_pu_bacteria	2960693952	2960696360	130
608	iso_pu_bacteria	2961077736	2961081809	130
609	iso_pu_bacteria	2961114664	2961121254	130
610	iso_pu_bacteria	2961127735	2961133629	130
611	iso_pu_bacteria	2961136820	2961137323	130
612	iso_pu_bacteria	2961163497	2961167811	130
613	iso_pu_bacteria	2961170736	2961172883	130
614	iso_pu_bacteria	2963644680	2963649492	130
615	iso_pu_bacteria	2964607997	2964609726	130
616	iso_pu_bacteria	2964615318	2964620715	130
617	iso_pu_bacteria	2964621998	2964627793	130
618	iso_pu_bacteria	2964628898	2964633131	130
619	iso_pu_bacteria	2964636051	2964637211	130
620	iso_pu_bacteria	2964643177	2964646147	130
621	iso_pu_bacteria	2964649959	2964653089	130
622	iso_pu_bacteria	2964656573	2964661898	130
623	iso_pu_bacteria	2964663802	2964665987	130
624	iso_pu_bacteria	2964670856	2964671700	130
625	iso_pu_bacteria	2964678106	2964678973	130
626	iso_pu_bacteria	2964685014	2964688094	130
627	iso_pu_bacteria	2964691889	2964695827	130
628	iso_pu_bacteria	2964698721	2964703609	130
629	iso_pu_bacteria	2964705432	2964706170	130
630	iso_pu_bacteria	2964712639	2964716285	130
631	iso_pu_bacteria	2964719344	2964726471	130
632	iso_pu_bacteria	2965018300	2965022630	130
633	iso_pu_bacteria	2965025482	2965026136	130
634	iso_pu_bacteria	2965032056	2965038919	130
635	iso_pu_bacteria	2965040258	2965042621	130
636	iso_pu_bacteria	2965047637	2965053500	130
637	iso_pu_bacteria	2965062239	2965069926	130
638	iso_pu_bacteria	2965089291	2965091618	130
639	iso_pu_bacteria	2965102966	2965106218	130
640	iso_pu_bacteria	2965110997	2965111876	130
641	iso_pu_bacteria	2967664464	2967667357	130
642	iso_pu_bacteria	2967671571	2967672158	130
643	iso_pu_bacteria	2967678726	2967678911	130
644	iso_pu_bacteria	2967686174	2967686402	130
645	iso_pu_bacteria	2967693043	2967693231	130
646	iso_pu_bacteria	2967699805	2967704254	130
647	iso_pu_bacteria	2967706974	2967712934	130
648	iso_pu_bacteria	2967714385	2967716543	130
649	iso_pu_bacteria	2967721400	2967724572	130
650	iso_pu_bacteria	2967728569	2967734748	130
651	iso_pu_bacteria	2967735183	2967737594	130
652	iso_pu_bacteria	2967742019	2967747859	130
653	iso_pu_bacteria	2967748971	2967752119	130
654	iso_pu_bacteria	2967755722	2967757720	130
655	iso_pu_bacteria	2967762386	2967763805	130
656	iso_pu_bacteria	2967769361	2967770778	130
657	iso_pu_bacteria	2967775926	2967782163	130
658	iso_pu_bacteria	2967996073	2967998093	130
659	iso_pu_bacteria	2968003550	2968008745	130
660	iso_pu_bacteria	2968016561	2968019524	130
661	iso_pu_bacteria	2968083720	2968084655	130
662	iso_pu_bacteria	2968091066	2968092334	130
663	iso_pu_bacteria	2968097103	2968097618	130
664	iso_pu_bacteria	2968110612	2968117406	130
665	iso_pu_bacteria	2968117919	2968118414	130
666	iso_pu_bacteria	2968128360	2968131747	130
667	iso_pu_bacteria	2968138860	2968142191	130
668	iso_pu_bacteria	2968171901	2968176211	130
669	iso_pu_bacteria	2970019648	2970026057	130
670	iso_pu_bacteria	2970026789	2970031802	130
671	iso_pu_bacteria	2970033650	2970037788	130
672	iso_pu_bacteria	2970040964	2970043299	130
673	iso_pu_bacteria	2970047711	2970049934	130
674	iso_pu_bacteria	2970054988	2970059622	130
675	iso_pu_bacteria	2970061556	2970065308	130
676	iso_pu_bacteria	2970068827	2970075669	130
677	iso_pu_bacteria	2970076120	2970076983	130
678	iso_pu_bacteria	2970082768	2970085662	130
679	iso_pu_bacteria	2970088815	2970093294	130
680	iso_pu_bacteria	2970095765	2970096809	130
681	iso_pu_bacteria	2970102677	2970108550	130
682	iso_pu_bacteria	2970109326	2970109833	130
683	iso_pu_bacteria	2970116247	2970117982	130
684	iso_pu_bacteria	2970122695	2970128192	130
685	iso_pu_bacteria	2970129317	2970129504	130
686	iso_pu_bacteria	2970136068	2970143164	130
687	iso_pu_bacteria	2970143518	2970148659	130
688	iso_pu_bacteria	2970149975	2970153828	130
689	iso_pu_bacteria	2970156795	2970162820	130
690	iso_pu_bacteria	2970164137	2970167490	130
691	iso_pu_bacteria	2970170962	2970171780	130
692	iso_pu_bacteria	2970177841	2970184118	130
693	iso_pu_bacteria	2970184632	2970185130	130
694	iso_pu_bacteria	2970191845	2970198338	130
695	iso_pu_bacteria	2970469710	2970472845	130
696	iso_pu_bacteria	2970489779	2970494860	130
697	iso_pu_bacteria	2970503327	2970505477	130
698	iso_pu_bacteria	2970510686	2970518085	130
699	iso_pu_bacteria	2970524798	2970529635	130
700	iso_pu_bacteria	2970532167	2970537646	130
701	iso_pu_bacteria	2970540015	2970543007	130
702	iso_pu_bacteria	2970547951	2970547958	130
703	iso_pu_bacteria	2970554993	2970559170	130
704	iso_pu_bacteria	2970593180	2970596283	130
705	iso_pu_bacteria	2970619444	2970625805	130
706	iso_pu_bacteria	2970627176	2970633000	130
707	iso_pu_bacteria	2977516862	2977523653	130
708	iso_pu_bacteria	2977523885	2977527641	130
709	iso_pu_bacteria	2977530762	2977531886	130
710	iso_pu_bacteria	2977537788	2977537975	130
711	iso_pu_bacteria	2977544691	2977544919	130
712	iso_pu_bacteria	2977551784	2977551973	130
713	iso_pu_bacteria	2977558990	2977561686	130
714	iso_pu_bacteria	2977565890	2977568968	130
715	iso_pu_bacteria	2977572785	2977578975	130
716	iso_pu_bacteria	2977579622	2977581508	130
717	iso_pu_bacteria	2977821940	2977825773	130
718	iso_pu_bacteria	2977828996	2977833532	130
719	iso_pu_bacteria	2977843712	2977851160	130
720	iso_pu_bacteria	2977851361	2977852969	130
721	iso_pu_bacteria	2977858184	2977862136	130
722	iso_pu_bacteria	2977864932	2977869478	130
723	iso_pu_bacteria	2977872689	2977872822	130
724	iso_pu_bacteria	2977898635	2977906008	130
725	iso_pu_bacteria	2977907340	2977909889	130
726	iso_pu_bacteria	2977915119	2977919062	130
727	iso_pu_bacteria	2977922695	2977926308	130
728	iso_pu_bacteria	2977935797	2977941699	130
729	iso_pu_bacteria	2977942078	2977943941	130
730	iso_pu_bacteria	2977950692	2977955096	130
731	iso_pu_bacteria	2977957713	2977964349	130
732	iso_pu_bacteria	2977971508	2977971946	130
733	iso_pu_bacteria	2977986579	2977990976	130
734	iso_pu_bacteria	2979089926	2979093664	130
735	iso_pu_bacteria	2979095461	2979098952	130
736	iso_pu_bacteria	2979100975	2979105642	130
737	iso_pu_bacteria	2979710463	2979714009	130
738	iso_pu_bacteria	2979764755	2979764987	130
739	iso_pu_bacteria	2979779861	2979781222	130
740	iso_pu_bacteria	2979793036	2979795722	130
741	iso_pu_bacteria	2979808191	2979810198	130
742	iso_pu_bacteria	2984509177	2984512512	130
743	iso_pu_bacteria	2984518228	2984521127	130
744	iso_pu_bacteria	2984537506	2984540421	130
745	iso_pu_bacteria	2984601300	2984602618	130
746	iso_pu_bacteria	2987636660	2987643600	130
747	iso_pu_bacteria	2987645492	2987650013	130
748	iso_pu_bacteria	2987652177	2987659212	130
749	iso_pu_bacteria	2987659509	2987663820	130
750	iso_pu_bacteria	2987666974	2987667352	130
751	iso_pu_bacteria	2987673487	2987676778	130
752	iso_pu_bacteria	2989349275	2989354234	130
753	iso_pu_bacteria	2996341866	2996343154	130
754	iso_pu_bacteria	2996348954	2996352036	130
755	iso_pu_bacteria	2996386984	2996392082	130
756	iso_pu_bacteria	2996887358	2996891526	130
757	iso_pu_bacteria	2996893221	2996896570	130
758	iso_pu_bacteria	3000135777	3000141934	130
759	iso_pu_bacteria	3002141150	3002143275	130
760	iso_pu_bacteria	3003930520	3003932612	130
761	iso_pu_bacteria	3004167301	3004170989	130
762	iso_pu_bacteria	3004188549	3004192876	130
763	iso_pu_bacteria	3004195979	3004203808	130
764	iso_pu_bacteria	3004203850	3004207145	130
765	iso_pu_bacteria	3004211236	3004214566	130
766	iso_pu_bacteria	3004218560	3004219248	130
767	iso_pu_bacteria	3004232784	3004238806	130
768	iso_pu_bacteria	3004239961	3004246657	130
769	iso_pu_bacteria	3004248173	3004252286	130
770	iso_pu_bacteria	3004268573	3004273476	130
771	iso_pu_bacteria	3004275668	3004278734	130
772	iso_pu_bacteria	3004289098	3004295520	130
773	iso_pu_bacteria	3004334049	3004339318	130
774	iso_pu_bacteria	3005409236	3005412394	130
775	iso_pu_bacteria	3005416602	3005417090	130
776	iso_pu_bacteria	3005445848	3005446709	130
777	iso_pu_bacteria	3005452660	3005453392	130
778	iso_pu_bacteria	637000159	637079483	130
779	iso_pu_bacteria	639633055	639647386	130
780	iso_pu_bacteria	643692032	643825033	130
781	iso_pu_bacteria	648276728	648736352	130
782	iso_pu_bacteria	649633066	649874687	130
783	iso_pu_bacteria	650716007	650739477	130
784	iso_pu_bacteria	8003570095	8003570520	130
785	iso_pu_bacteria	8003992118	8003992930	130
786	iso_pu_bacteria	8003999396	8004000170	130
787	iso_pu_bacteria	8004300914	8004303799	130
788	iso_pu_bacteria	8004312739	8004317579	130
789	iso_pu_bacteria	8004361976	8004364313	130
790	iso_pu_bacteria	8004374579	8004378181	130
791	iso_pu_bacteria	8004387939	8004391702	130
792	iso_pu_bacteria	8004445564	8004451863	130
793	iso_pu_bacteria	8004633249	8004638261	130
794	iso_pu_bacteria	8004640170	8004641278	130
795	iso_pu_bacteria	8004695233	8004695838	130
796	iso_pu_bacteria	8004703790	8004710790	130
797	iso_pu_bacteria	8004714634	8004717071	130
798	iso_pu_bacteria	8004727605	8004731484	130
799	iso_pu_bacteria	8005258706	8005261752	130
800	iso_pu_bacteria	8005275841	8005279521	130
801	iso_pu_bacteria	8005282627	8005284834	130
802	iso_pu_bacteria	8005301065	8005304544	130
803	iso_pu_bacteria	8005307578	8005309116	130
804	iso_pu_bacteria	8005314921	8005315151	130
805	iso_pu_bacteria	8005321885	8005326053	130
806	iso_pu_bacteria	8005376324	8005376663	130
807	iso_pu_bacteria	8005382845	8005386054	130
808	iso_pu_bacteria	8005395548	8005399418	130
809	iso_pu_bacteria	8005430974	8005432213	130
810	iso_pu_bacteria	8005460587	8005461879	130
811	iso_pu_bacteria	8005484373	8005485680	130
812	iso_pu_bacteria	8005497431	8005499279	130
813	iso_pu_bacteria	8005542996	8005544298	130
814	iso_pu_bacteria	8005556819	8005558974	130
815	iso_pu_bacteria	8005563573	8005570388	130
816	iso_pu_bacteria	8005570704	8005572632	130
817	iso_pu_bacteria	8005619151	8005620474	130
818	iso_pu_bacteria	8005626139	8005627560	130
819	iso_pu_bacteria	8005645114	8005648301	130
820	iso_pu_bacteria	8005668836	8005670695	130
821	iso_pu_bacteria	8005682033	8005684626	130
822	iso_pu_bacteria	8005688590	8005690967	130
823	iso_pu_bacteria	8005695170	8005698847	130
824	iso_pu_bacteria	8018163183	8018169109	130
825	iso_pu_bacteria	8018176218	8018177302	130
826	iso_pu_bacteria	8023680758	8023687008	130
827	iso_pu_bacteria	8024479707	8024481054	130
828	iso_pu_bacteria	8024486573	8024489799	130
829	iso_pu_bacteria	8024501048	8024503300	130
830	iso_pu_bacteria	8046767195	8046767625	130
831	iso_pu_bacteria	8049293176	8049293870	130
832	iso_pu_bacteria	8054558443	8054562237	130
833	iso_pu_bacteria	8056375014	8056380679	130
834	iso_pu_bacteria	8056382006	8056384804	130
835	iso_pu_bacteria	8057575449	8057582254	130
836	iso_pu_bacteria	8057874678	8057879539	130
837	3300031250	Ga0265331_10067038	Ga0265331_100670382	131
838	3300049569	Ga0501032_0213974	Ga0501032_0213974_358_756	131
839	3300049570	Ga0501033_0584085	Ga0501033_0584085_332_730	131
840	3300049571	Ga0501034_0174112	Ga0501034_0174112_768_1166	131
841	3300049572	Ga0501036_0103579	Ga0501036_0103579_1254_1652	131
842	3300049573	Ga0501037_0018356	Ga0501037_0018356_3611_4009	131
843	3300049575	Ga0501039_0562120	Ga0501039_0562120_366_764	131
844	3300049585	Ga0501069_0315733	Ga0501069_0315733_205_603	131
845	3300049586	Ga0501070_0008087	Ga0501070_0008087_2837_3235	131
846	3300049589	Ga0501073_0392824	Ga0501073_0392824_139_537	131
847	3300049590	Ga0501074_0031262	Ga0501074_0031262_1373_1771	131
848	3300049741	Ga0501079_0951998	Ga0501079_0951998_228_626	131
849	3300049742	Ga0501080_0028845	Ga0501080_0028845_3816_4214	131
850	3300049822	Ga0501035_0051164	Ga0501035_0051164_1092_1490	131
851	3300049823	Ga0501044_0538699	Ga0501044_0538699_537_935	131
852	3300053093	Ga0500651_0628494	Ga0500651_0628494_11_442	132
853	3300006051	Ga0075364_10039075	Ga0075364_100390752	133
854	3300009148	Ga0105243_11723506	Ga0105243_117235061	133
855	3300010375	Ga0105239_10025211	Ga0105239_100252118	133
856	3300013297	Ga0157378_10715665	Ga0157378_107156652	133
857	3300031901	Ga0307406_10294942	Ga0307406_102949422	133
858	3300035171	Ga0373946_0572305	Ga0373946_0572305_31_432	133
859	3300035242	Ga0373962_0304414	Ga0373962_0304414_36_440	133
860	3300035692	Ga0373935_0035910	Ga0373935_0035910_2497_2898	133
861	3300035695	Ga0373927_0000554	Ga0373927_0000554_11539_11940	133
862	3300035725	Ga0373947_0155640	Ga0373947_0155640_430_831	133
863	3300037068	Ga0373925_0046361	Ga0373925_0046361_305_706	133
864	3300037471	Ga0395905_0007575	Ga0395905_0007575_9357_9758	133
865	3300037471	Ga0395905_0008435	Ga0395905_0008435_5610_6092	133
866	3300046460	Ga0495638_0064826	Ga0495638_0064826_1774_2175	133
867	3300049568	Ga0501031_0141737	Ga0501031_0141737_1018_1419	133
868	3300049571	Ga0501034_0358770	Ga0501034_0358770_256_657	133
869	3300049585	Ga0501069_0524527	Ga0501069_0524527_88_489	133
870	3300049822	Ga0501035_0284005	Ga0501035_0284005_28_429	133
871	3300050491	nmdc:mga00v17_287880_c1	nmdc:mga00v17_287880_c1_209_610	133
872	3300053088	Ga0500644_0024796	Ga0500644_0024796_807_1208	133
873	3300053122	Ga0500608_046110	Ga0500608_046110_1042_1443	133
874	3300053136	Ga0500559_0003806	Ga0500559_0003806_6556_6957	133
875	3300053156	Ga0500622_0001309	Ga0500622_0001309_15839_16240	133
876	3300059510	Ga0587090_005876	Ga0587090_005876_320_721	133
877	3300059511	Ga0587091_067915	Ga0587091_067915_59_460	133
878	3300059653	Ga0587108_009909	Ga0587108_009909_316_717	133
879	3300060346	Ga0587111_0021604	Ga0587111_0021604_524_925	133
880	3300001979	JGI24740J21852_10002242	JGI24740J21852_100022425	134
881	3300002704	JGI25155J39150_1000032	JGI25155J39150_1000032107	134
882	3300002705	JGI25156J39149_1000153	JGI25156J39149_100015356	134
883	3300002737	JGI25162J39368_1001557	JGI25162J39368_100155710	134
884	3300002737	JGI25162J39368_1002811	JGI25162J39368_10028114	134
885	3300002738	JGI25154J39366_1000152	JGI25154J39366_100015259	134
886	3300002739	JGI25158J39367_1004844	JGI25158J39367_10048443	134
887	3300002741	JGI25157J39369_1000061	JGI25157J39369_1000061107	134
888	3300002987	JGI25159J45721_1000366	JGI25159J45721_100036612	134
889	3300003187	JGI25151J46595_10019601	JGI25151J46595_100196014	134
890	3300003187	JGI25151J46595_10066409	JGI25151J46595_100664091	134
891	3300003214	JGI25165J46597_1001133	JGI25165J46597_10011335	134
892	3300003214	JGI25165J46597_1001496	JGI25165J46597_10014967	134
893	3300003214	JGI25165J46597_1005479	JGI25165J46597_10054794	134
894	3300003316	rootH1_10036980	rootH1_100369803	134
895	3300003320	rootH2_10025346	rootH2_100253462	134
896	3300003322	rootL2_10108798	rootL2_101087984	134
897	3300003323	rootH1_10010740	rootH1_100107402	134
898	3300003354	JGI25160J50197_1000562	JGI25160J50197_100056210	134
899	3300003374	JGI25161J50226_1000436	JGI25161J50226_10004368	134
900	3300003771	Ga0055526_1002323	Ga0055526_10023239	134
901	3300003775	Ga0055524_1001301	Ga0055524_100130111	134
902	3300003781	Ga0055536_1000472	Ga0055536_10004723	134
903	3300003791	Ga0055530_10003197	Ga0055530_100031974	134
904	3300003794	Ga0055531_10010693	Ga0055531_100106935	134
905	3300003856	Ga0058692_1017877	Ga0058692_10178773	134
906	3300004625	Ga0055543_1000745	Ga0055543_100074510	134
907	3300005262	Ga0065165_1001769	Ga0065165_100176912	134
908	3300005327	Ga0070658_10082027	Ga0070658_100820275	134
909	3300005344	Ga0070661_100245242	Ga0070661_1002452422	134
910	3300005353	Ga0070669_100187483	Ga0070669_1001874831	134
911	3300005366	Ga0070659_101417337	Ga0070659_1014173371	134
912	3300005367	Ga0070667_101290295	Ga0070667_1012902951	134
913	3300005455	Ga0070663_100045415	Ga0070663_1000454152	134
914	3300005455	Ga0070663_100205477	Ga0070663_1002054771	134
915	3300005539	Ga0068853_101117958	Ga0068853_1011179581	134
916	3300005539	Ga0068853_101276318	Ga0068853_1012763182	134
917	3300005543	Ga0070672_100333741	Ga0070672_1003337411	134
918	3300005548	Ga0070665_100044231	Ga0070665_1000442312	134
919	3300005548	Ga0070665_100574797	Ga0070665_1005747971	134
920	3300005563	Ga0068855_100073562	Ga0068855_1000735624	134
921	3300005578	Ga0068854_100021582	Ga0068854_1000215824	134
922	3300005578	Ga0068854_100094141	Ga0068854_1000941412	134
923	3300005614	Ga0068856_100023678	Ga0068856_1000236785	134
924	3300005614	Ga0068856_101590505	Ga0068856_1015905051	134
925	3300005616	Ga0068852_100104729	Ga0068852_1001047294	134
926	3300005834	Ga0068851_10028724	Ga0068851_100287242	134
927	3300006038	Ga0075365_10001916	Ga0075365_100019169	134
928	3300006042	Ga0075368_10007335	Ga0075368_100073354	134
929	3300006048	Ga0075363_100076185	Ga0075363_1000761852	134
930	3300006051	Ga0075364_10019200	Ga0075364_100192003	134
931	3300006051	Ga0075364_10078825	Ga0075364_100788252	134
932	3300006177	Ga0075362_10018882	Ga0075362_100188822	134
933	3300006178	Ga0075367_10073857	Ga0075367_100738572	134
934	3300006186	Ga0075369_10039311	Ga0075369_100393113	134
935	3300006186	Ga0075369_10268423	Ga0075369_102684232	134
936	3300006195	Ga0075366_10007799	Ga0075366_100077997	134
937	3300006946	Ga0079104_1001881	Ga0079104_10018819	134
938	3300006946	Ga0079104_1004220	Ga0079104_10042208	134
939	3300006948	Ga0099826_10206203	Ga0099826_102062031	134
940	3300009093	Ga0105240_10000032	Ga0105240_10000032267	134
941	3300009148	Ga0105243_10054588	Ga0105243_100545882	134
942	3300009174	Ga0105241_10108950	Ga0105241_101089504	134
943	3300009177	Ga0105248_10166391	Ga0105248_101663912	134
944	3300009177	Ga0105248_10228356	Ga0105248_102283562	134
945	3300009545	Ga0105237_10001967	Ga0105237_1000196717	134
946	3300009545	Ga0105237_10445504	Ga0105237_104455042	134
947	3300009551	Ga0105238_10714232	Ga0105238_107142322	134
948	3300009551	Ga0105238_10767530	Ga0105238_107675302	134
949	3300010375	Ga0105239_10005020	Ga0105239_100050206	134
950	3300010375	Ga0105239_10053931	Ga0105239_100539312	134
951	3300010375	Ga0105239_10092882	Ga0105239_100928821	134
952	3300010375	Ga0105239_10323855	Ga0105239_103238553	134
953	3300010375	Ga0105239_10477172	Ga0105239_104771723	134
954	3300013100	Ga0157373_10003685	Ga0157373_1000368511	134
955	3300013102	Ga0157371_10000380	Ga0157371_1000038047	134
956	3300013102	Ga0157371_10276581	Ga0157371_102765812	134
957	3300013104	Ga0157370_10000748	Ga0157370_1000074832	134
958	3300013104	Ga0157370_10000986	Ga0157370_1000098638	134
959	3300013105	Ga0157369_10177987	Ga0157369_101779872	134
960	3300013249	Ga0171463_1001	Ga0171463_1001281	134
961	3300013296	Ga0157374_10538352	Ga0157374_105383522	134
962	3300013296	Ga0157374_10639545	Ga0157374_106395452	134
963	3300014325	Ga0163163_10382630	Ga0163163_103826302	134
964	3300014497	Ga0182008_10069012	Ga0182008_100690123	134
965	3300014497	Ga0182008_10356705	Ga0182008_103567051	134
966	3300014969	Ga0157376_12150068	Ga0157376_121500681	134
967	3300015261	Ga0182006_1028288	Ga0182006_10282882	134
968	3300015262	Ga0182007_10001327	Ga0182007_1000132711	134
969	3300015265	Ga0182005_1005522	Ga0182005_10055222	134
970	3300015690	Ga0183363_1105	Ga0183363_110523	134
971	3300017792	Ga0163161_10204688	Ga0163161_102046882	134
972	3300021320	Ga0214544_1000008	Ga0214544_10000089	134
973	3300021321	Ga0214542_1005858	Ga0214542_10058589	134
974	3300021321	Ga0214542_1024109	Ga0214542_10241093	134
975	3300021327	Ga0214543_1000003	Ga0214543_1000003421	134
976	3300021327	Ga0214543_1005579	Ga0214543_10055799	134
977	3300022739	Ga0228711_1000001	Ga0228711_1000001126	134
978	3300022740	Ga0228710_1000001	Ga0228710_1000001199	134
979	3300025206	Ga0209435_100042	Ga0209435_100042108	134
980	3300025208	Ga0209436_100888	Ga0209436_10088810	134
981	3300025228	Ga0209672_102782	Ga0209672_1027824	134
982	3300025233	Ga0209437_100033	Ga0209437_100033225	134
983	3300025233	Ga0209437_100075	Ga0209437_100075287	134
984	3300025246	Ga0209646_1000145	Ga0209646_1000145108	134
985	3300025250	Ga0209026_1000160	Ga0209026_1000160108	134
986	3300025256	Ga0209759_1000177	Ga0209759_1000177108	134
987	3300025261	Ga0209233_1000056	Ga0209233_1000056111	134
988	3300025261	Ga0209233_1000064	Ga0209233_1000064197	134
989	3300025284	Ga0209130_1000007	Ga0209130_100000712	134
990	3300025292	Ga0209676_1000901	Ga0209676_100090114	134
991	3300025294	Ga0209025_1000100	Ga0209025_1000100157	134
992	3300025294	Ga0209025_1000149	Ga0209025_100014912	134
993	3300025294	Ga0209025_1029856	Ga0209025_10298564	134
994	3300025295	Ga0209564_1000846	Ga0209564_100084610	134
995	3300025298	Ga0209050_1001776	Ga0209050_100177611	134
996	3300025299	Ga0209256_1002123	Ga0209256_10021238	134
997	3300025299	Ga0209256_1002627	Ga0209256_10026275	134
998	3300025302	Ga0207426_1000064	Ga0207426_100006412	134
999	3300025303	Ga0209051_1001024	Ga0209051_100102416	134
1000	3300025304	Ga0209257_1001970	Ga0209257_100197012	134
1001	3300025321	Ga0207656_10355704	Ga0207656_103557042	134
1002	3300025907	Ga0207645_10629674	Ga0207645_106296741	134
1003	3300025909	Ga0207705_10054760	Ga0207705_100547603	134
1004	3300025911	Ga0207654_10404427	Ga0207654_104044272	134
1005	3300025911	Ga0207654_10704782	Ga0207654_107047822	134
1006	3300025913	Ga0207695_10091179	Ga0207695_100911794	134
1007	3300025913	Ga0207695_11126432	Ga0207695_111264322	134
1008	3300025919	Ga0207657_10159904	Ga0207657_101599042	134
1009	3300025920	Ga0207649_10239374	Ga0207649_102393742	134
1010	3300025923	Ga0207681_10199684	Ga0207681_101996842	134
1011	3300025924	Ga0207694_10192997	Ga0207694_101929971	134
1012	3300025924	Ga0207694_10790863	Ga0207694_107908632	134
1013	3300025935	Ga0207709_10031697	Ga0207709_100316972	134
1014	3300025972	Ga0207668_10392674	Ga0207668_103926741	134
1015	3300026023	Ga0207677_10423321	Ga0207677_104233212	134
1016	3300026041	Ga0207639_10140275	Ga0207639_101402752	134
1017	3300026067	Ga0207678_10183794	Ga0207678_101837942	134
1018	3300026078	Ga0207702_10024952	Ga0207702_100249522	134
1019	3300026116	Ga0207674_10381603	Ga0207674_103816033	134
1020	3300026116	Ga0207674_10443308	Ga0207674_104433082	134
1021	3300027111	Ga0209281_1000164	Ga0209281_100016431	134
1022	3300027111	Ga0209281_1000332	Ga0209281_10003329	134
1023	3300027312	Ga0209371_1002143	Ga0209371_10021436	134
1024	3300027666	Ga0209282_1000007	Ga0209282_1000007126	134
1025	3300027866	Ga0209813_10005510	Ga0209813_100055103	134
1026	3300028379	Ga0268266_10030589	Ga0268266_100305892	134
1027	3300028786	Ga0307517_10337580	Ga0307517_103375802	134
1028	3300028794	Ga0307515_10068201	Ga0307515_100682012	134
1029	3300028794	Ga0307515_10101441	Ga0307515_101014412	134
1030	3300030500	Ga0268256_1001181	Ga0268256_10011819	134
1031	3300031456	Ga0307513_10001304	Ga0307513_1000130417	134
1032	3300031548	Ga0307408_100066391	Ga0307408_1000663913	134
1033	3300031731	Ga0307405_10206835	Ga0307405_102068352	134
1034	3300031731	Ga0307405_10249563	Ga0307405_102495631	134
1035	3300031852	Ga0307410_10019616	Ga0307410_100196164	134
1036	3300031901	Ga0307406_10691000	Ga0307406_106910002	134
1037	3300031911	Ga0307412_10416366	Ga0307412_104163662	134
1038	3300031911	Ga0307412_11436839	Ga0307412_114368391	134
1039	3300031967	Ga0315914_1000006	Ga0315914_1000006117	134
1040	3300031995	Ga0307409_100319523	Ga0307409_1003195233	134
1041	3300031995	Ga0307409_100434311	Ga0307409_1004343112	134
1042	3300032002	Ga0307416_100149450	Ga0307416_1001494503	134
1043	3300032002	Ga0307416_101957565	Ga0307416_1019575651	134
1044	3300032004	Ga0307414_10937113	Ga0307414_109371132	134
1045	3300033430	Ga0315913_1000002	Ga0315913_1000002126	134
1046	3300033464	Ga0315915_1000001	Ga0315915_1000001361	134
1047	3300035114	Ga0373939_0021282	Ga0373939_0021282_1050_1469	134
1048	3300037418	Ga0395900_0102189	Ga0395900_0102189_188_601	134
1049	3300037471	Ga0395905_0837248	Ga0395905_0837248_359_772	134
1050	3300041404	Ga0439436_0000884	Ga0439436_0000884_2338_2757	134
1051	3300041404	Ga0439436_0004198	Ga0439436_0004198_2116_2535	134
1052	3300041405	Ga0439438_037367	Ga0439438_037367_368_787	134
1053	3300041406	Ga0439439_0032682	Ga0439439_0032682_734_1153	134
1054	3300041406	Ga0439439_0041327	Ga0439439_0041327_229_648	134
1055	3300041411	Ga0439466_0033075	Ga0439466_0033075_286_705	134
1056	3300041413	Ga0439465_0001655	Ga0439465_0001655_4083_4502	134
1057	3300041456	Ga0451795_1250875	Ga0451795_1250875_210_623	134
1058	3300041997	Ga0439431_0040505	Ga0439431_0040505_549_968	134
1059	3300041997	Ga0439431_0075247	Ga0439431_0075247_198_602	134
1060	3300042002	Ga0439442_131374	Ga0439442_131374_76_495	134
1061	3300042007	Ga0439449_0007276	Ga0439449_0007276_539_958	134
1062	3300042125	Ga0450923_125500	Ga0450923_125500_101_520	134
1063	3300042145	Ga0450906_005347	Ga0450906_005347_2188_2607	134
1064	3300042531	Ga0450918_002646	Ga0450918_002646_2647_3066	134
1065	3300044694	Ga0466963_0088827	Ga0466963_0088827_265_669	134
1066	3300044765	Ga0466970_0037949	Ga0466970_0037949_2040_2444	134
1067	3300044842	Ga0466957_0348433	Ga0466957_0348433_188_592	134
1068	3300045836	Ga0466958_0055547	Ga0466958_0055547_221_625	134
1069	3300045976	Ga0466967_0200288	Ga0466967_0200288_113_517	134
1070	3300045976	Ga0466967_0906576	Ga0466967_0906576_107_523	134
1071	3300046453	Ga0495627_151809	Ga0495627_151809_142_549	134
1072	3300046455	Ga0495603_0183797	Ga0495603_0183797_168_587	134
1073	3300046457	Ga0495590_0017612	Ga0495590_0017612_678_1097	134
1074	3300046460	Ga0495638_0177628	Ga0495638_0177628_121_534	134
1075	3300046499	Ga0495594_0029671	Ga0495594_0029671_622_1041	134
1076	3300046500	Ga0495596_0195582	Ga0495596_0195582_329_748	134
1077	3300046507	Ga0495606_0038216	Ga0495606_0038216_1464_1868	134
1078	3300046522	Ga0495643_0212638	Ga0495643_0212638_357_761	134
1079	3300046528	Ga0495642_0018640	Ga0495642_0018640_996_1415	134
1080	3300046557	Ga0495622_0004143	Ga0495622_0004143_659_1078	134
1081	3300046558	Ga0495633_0054167	Ga0495633_0054167_556_960	134
1082	3300046558	Ga0495633_0065464	Ga0495633_0065464_78_482	134
1083	3300046616	Ga0495668_0191171	Ga0495668_0191171_549_962	134
1084	3300046648	Ga0495611_0022597	Ga0495611_0022597_1454_1873	134
1085	3300046660	Ga0495625_0028315	Ga0495625_0028315_1392_1799	134
1086	3300046660	Ga0495625_0513569	Ga0495625_0513569_296_700	134
1087	3300046665	Ga0495661_0612603	Ga0495661_0612603_80_493	134
1088	3300046674	Ga0495588_0023685	Ga0495588_0023685_1803_2207	134
1089	3300046674	Ga0495588_0082004	Ga0495588_0082004_947_1354	134
1090	3300046692	Ga0495671_0010893	Ga0495671_0010893_1920_2324	134
1091	3300046694	Ga0495649_0016232	Ga0495649_0016232_357_776	134
1092	3300046794	Ga0495589_0262467	Ga0495589_0262467_357_776	134
1093	3300047320	Ga0495672_0023775	Ga0495672_0023775_2144_2563	134
1094	3300047469	Ga0495673_0068929	Ga0495673_0068929_1006_1425	134
1095	3300047470	Ga0495681_0016031	Ga0495681_0016031_958_1362	134
1096	3300047472	Ga0495686_0106308	Ga0495686_0106308_250_654	134
1097	3300048904	Ga0496101_0098621	Ga0496101_0098621_1437_1841	134
1098	3300048907	Ga0496104_1090769	Ga0496104_1090769_189_602	134
1099	3300048911	Ga0496108_0319092	Ga0496108_0319092_30_443	134
1100	3300048913	Ga0496110_0189692	Ga0496110_0189692_1332_1745	134
1101	3300048915	Ga0496112_0124980	Ga0496112_0124980_1341_1754	134
1102	3300048919	Ga0496116_0030524	Ga0496116_0030524_2012_2416	134
1103	3300048920	Ga0496117_0000002	Ga0496117_0000002_1546161_1546565	134
1104	3300048920	Ga0496117_0035868	Ga0496117_0035868_2779_3192	134
1105	3300048921	Ga0496118_0000214	Ga0496118_0000214_2425_2829	134
1106	3300048921	Ga0496118_0226685	Ga0496118_0226685_315_719	134
1107	3300048921	Ga0496118_0363173	Ga0496118_0363173_331_744	134
1108	3300048922	Ga0496119_0007236	Ga0496119_0007236_2305_2709	134
1109	3300048922	Ga0496119_0034681	Ga0496119_0034681_2206_2610	134
1110	3300048922	Ga0496119_0041549	Ga0496119_0041549_1656_2060	134
1111	3300048923	Ga0496120_0000125	Ga0496120_0000125_114808_115212	134
1112	3300048924	Ga0496121_0396049	Ga0496121_0396049_411_824	134
1113	3300048924	Ga0496121_0651431	Ga0496121_0651431_50_454	134
1114	3300048925	Ga0496122_0000001	Ga0496122_0000001_916950_917354	134
1115	3300048925	Ga0496122_0000492	Ga0496122_0000492_76269_76682	134
1116	3300048925	Ga0496122_0059237	Ga0496122_0059237_563_967	134
1117	3300048925	Ga0496122_0136425	Ga0496122_0136425_23_427	134
1118	3300048926	Ga0496123_0000001	Ga0496123_0000001_920681_921085	134
1119	3300048926	Ga0496123_0000460	Ga0496123_0000460_59120_59533	134
1120	3300048926	Ga0496123_0012003	Ga0496123_0012003_4141_4545	134
1121	3300048926	Ga0496123_0056699	Ga0496123_0056699_279_683	134
1122	3300048927	Ga0496124_0000679	Ga0496124_0000679_43532_43945	134
1123	3300048927	Ga0496124_0004429	Ga0496124_0004429_2862_3266	134
1124	3300048927	Ga0496124_0055284	Ga0496124_0055284_2585_2989	134
1125	3300048927	Ga0496124_0160050	Ga0496124_0160050_1124_1537	134
1126	3300048928	Ga0496125_0006717	Ga0496125_0006717_930_1343	134
1127	3300048928	Ga0496125_0120438	Ga0496125_0120438_23_427	134
1128	3300048928	Ga0496125_0164797	Ga0496125_0164797_23_427	134
1129	3300048929	Ga0496126_0000811	Ga0496126_0000811_2614_3027	134
1130	3300048929	Ga0496126_0439272	Ga0496126_0439272_605_1018	134
1131	3300049568	Ga0501031_0000001	Ga0501031_0000001_80470_80883	134
1132	3300049568	Ga0501031_0013103	Ga0501031_0013103_2816_3229	134
1133	3300049568	Ga0501031_0044699	Ga0501031_0044699_2146_2556	134
1134	3300049568	Ga0501031_0096366	Ga0501031_0096366_573_983	134
1135	3300049569	Ga0501032_0000003	Ga0501032_0000003_80479_80892	134
1136	3300049569	Ga0501032_0011071	Ga0501032_0011071_4210_4629	134
1137	3300049569	Ga0501032_0025563	Ga0501032_0025563_428_841	134
1138	3300049569	Ga0501032_0084562	Ga0501032_0084562_1587_1997	134
1139	3300049569	Ga0501032_0239632	Ga0501032_0239632_194_601	134
1140	3300049569	Ga0501032_0311189	Ga0501032_0311189_166_576	134
1141	3300049569	Ga0501032_0515590	Ga0501032_0515590_60_470	134
1142	3300049570	Ga0501033_0000150	Ga0501033_0000150_26371_26784	134
1143	3300049570	Ga0501033_0013116	Ga0501033_0013116_2572_2982	134
1144	3300049570	Ga0501033_0014062	Ga0501033_0014062_976_1389	134
1145	3300049570	Ga0501033_0026935	Ga0501033_0026935_3581_4000	134
1146	3300049570	Ga0501033_0063262	Ga0501033_0063262_1794_2204	134
1147	3300049570	Ga0501033_0218574	Ga0501033_0218574_50_460	134
1148	3300049570	Ga0501033_0348283	Ga0501033_0348283_177_587	134
1149	3300049571	Ga0501034_0000005	Ga0501034_0000005_80479_80892	134
1150	3300049571	Ga0501034_0028394	Ga0501034_0028394_4831_5247	134
1151	3300049571	Ga0501034_0031415	Ga0501034_0031415_1085_1504	134
1152	3300049571	Ga0501034_0170842	Ga0501034_0170842_784_1215	134
1153	3300049571	Ga0501034_0177220	Ga0501034_0177220_1518_1928	134
1154	3300049571	Ga0501034_0553985	Ga0501034_0553985_396_806	134
1155	3300049572	Ga0501036_0000018	Ga0501036_0000018_80479_80892	134
1156	3300049572	Ga0501036_0016644	Ga0501036_0016644_347_766	134
1157	3300049572	Ga0501036_0115524	Ga0501036_0115524_346_756	134
1158	3300049572	Ga0501036_0119924	Ga0501036_0119924_158_571	134
1159	3300049572	Ga0501036_0138737	Ga0501036_0138737_1193_1603	134
1160	3300049572	Ga0501036_0994975	Ga0501036_0994975_47_460	134
1161	3300049573	Ga0501037_0000005	Ga0501037_0000005_80470_80883	134
1162	3300049573	Ga0501037_0029018	Ga0501037_0029018_1945_2364	134
1163	3300049573	Ga0501037_0054934	Ga0501037_0054934_998_1408	134
1164	3300049573	Ga0501037_0240941	Ga0501037_0240941_628_1041	134
1165	3300049574	Ga0501038_0000001	Ga0501038_0000001_80479_80892	134
1166	3300049574	Ga0501038_0013337	Ga0501038_0013337_3431_3850	134
1167	3300049574	Ga0501038_0046621	Ga0501038_0046621_692_1102	134
1168	3300049574	Ga0501038_0161270	Ga0501038_0161270_944_1354	134
1169	3300049574	Ga0501038_0201111	Ga0501038_0201111_708_1118	134
1170	3300049574	Ga0501038_0265486	Ga0501038_0265486_326_742	134
1171	3300049574	Ga0501038_0351628	Ga0501038_0351628_593_1000	134
1172	3300049574	Ga0501038_0534507	Ga0501038_0534507_25_432	134
1173	3300049574	Ga0501038_0898743	Ga0501038_0898743_207_617	134
1174	3300049575	Ga0501039_0000015	Ga0501039_0000015_138579_138992	134
1175	3300049575	Ga0501039_0132223	Ga0501039_0132223_1210_1629	134
1176	3300049575	Ga0501039_0570586	Ga0501039_0570586_141_554	134
1177	3300049576	Ga0501040_0004884	Ga0501040_0004884_7744_8157	134
1178	3300049576	Ga0501040_0169572	Ga0501040_0169572_305_712	134
1179	3300049577	Ga0501041_0344802	Ga0501041_0344802_28_435	134
1180	3300049578	Ga0501042_0419492	Ga0501042_0419492_134_541	134
1181	3300049578	Ga0501042_0444552	Ga0501042_0444552_104_517	134
1182	3300049579	Ga0501043_0000735	Ga0501043_0000735_11696_12109	134
1183	3300049579	Ga0501043_0016045	Ga0501043_0016045_2466_2876	134
1184	3300049579	Ga0501043_0017059	Ga0501043_0017059_15_425	134
1185	3300049579	Ga0501043_0060007	Ga0501043_0060007_601_1011	134
1186	3300049579	Ga0501043_0108163	Ga0501043_0108163_718_1137	134
1187	3300049579	Ga0501043_0200601	Ga0501043_0200601_105_518	134
1188	3300049579	Ga0501043_0791571	Ga0501043_0791571_47_460	134
1189	3300049580	Ga0501046_0033522	Ga0501046_0033522_3419_3829	134
1190	3300049580	Ga0501046_0094336	Ga0501046_0094336_1644_2063	134
1191	3300049580	Ga0501046_0115617	Ga0501046_0115617_465_878	134
1192	3300049580	Ga0501046_0380848	Ga0501046_0380848_199_606	134
1193	3300049581	Ga0501047_0000941	Ga0501047_0000941_17631_18044	134
1194	3300049581	Ga0501047_0056297	Ga0501047_0056297_2333_2743	134
1195	3300049581	Ga0501047_0081697	Ga0501047_0081697_1831_2247	134
1196	3300049581	Ga0501047_0114990	Ga0501047_0114990_1199_1618	134
1197	3300049581	Ga0501047_0296014	Ga0501047_0296014_803_1213	134
1198	3300049581	Ga0501047_0730329	Ga0501047_0730329_299_718	134
1199	3300049581	Ga0501047_0997611	Ga0501047_0997611_133_546	134
1200	3300049581	Ga0501047_1310763	Ga0501047_1310763_61_474	134
1201	3300049582	Ga0501048_0189005	Ga0501048_0189005_16_429	134
1202	3300049582	Ga0501048_0316803	Ga0501048_0316803_472_891	134
1203	3300049584	Ga0501068_0012912	Ga0501068_0012912_1782_2195	134
1204	3300049584	Ga0501068_0378572	Ga0501068_0378572_348_755	134
1205	3300049585	Ga0501069_0012744	Ga0501069_0012744_3204_3614	134
1206	3300049585	Ga0501069_0100538	Ga0501069_0100538_1079_1489	134
1207	3300049586	Ga0501070_0000333	Ga0501070_0000333_41550_41960	134
1208	3300049586	Ga0501070_0000812	Ga0501070_0000812_21514_21924	134
1209	3300049586	Ga0501070_0012428	Ga0501070_0012428_3174_3587	134
1210	3300049586	Ga0501070_0041296	Ga0501070_0041296_1812_2228	134
1211	3300049586	Ga0501070_0106674	Ga0501070_0106674_1168_1587	134
1212	3300049586	Ga0501070_0239153	Ga0501070_0239153_307_720	134
1213	3300049586	Ga0501070_0371552	Ga0501070_0371552_139_549	134
1214	3300049586	Ga0501070_0642204	Ga0501070_0642204_212_622	134
1215	3300049587	Ga0501071_0094545	Ga0501071_0094545_381_797	134
1216	3300049587	Ga0501071_0097736	Ga0501071_0097736_310_717	134
1217	3300049587	Ga0501071_0546096	Ga0501071_0546096_47_457	134
1218	3300049587	Ga0501071_1324647	Ga0501071_1324647_75_485	134
1219	3300049588	Ga0501072_0238561	Ga0501072_0238561_82_489	134
1220	3300049589	Ga0501073_0028634	Ga0501073_0028634_1195_1611	134
1221	3300049589	Ga0501073_0099138	Ga0501073_0099138_1051_1461	134
1222	3300049589	Ga0501073_0420621	Ga0501073_0420621_303_713	134
1223	3300049590	Ga0501074_0029970	Ga0501074_0029970_2735_3151	134
1224	3300049590	Ga0501074_0247994	Ga0501074_0247994_162_572	134
1225	3300049590	Ga0501074_0257057	Ga0501074_0257057_609_1019	134
1226	3300049591	Ga0501075_0030159	Ga0501075_0030159_1986_2393	134
1227	3300049592	Ga0501076_0569956	Ga0501076_0569956_412_828	134
1228	3300049741	Ga0501079_0122536	Ga0501079_0122536_1534_1941	134
1229	3300049741	Ga0501079_0143433	Ga0501079_0143433_1407_1823	134
1230	3300049741	Ga0501079_0229547	Ga0501079_0229547_552_962	134
1231	3300049741	Ga0501079_1258207	Ga0501079_1258207_46_459	134
1232	3300049742	Ga0501080_0001902	Ga0501080_0001902_7188_7598	134
1233	3300049742	Ga0501080_0051625	Ga0501080_0051625_600_1010	134
1234	3300049742	Ga0501080_0285126	Ga0501080_0285126_638_1054	134
1235	3300049742	Ga0501080_0397651	Ga0501080_0397651_205_615	134
1236	3300049743	Ga0501081_0062391	Ga0501081_0062391_544_951	134
1237	3300049744	Ga0501083_0020073	Ga0501083_0020073_2069_2485	134
1238	3300049744	Ga0501083_0427130	Ga0501083_0427130_375_782	134
1239	3300049822	Ga0501035_0000008	Ga0501035_0000008_26358_26771	134
1240	3300049822	Ga0501035_0005330	Ga0501035_0005330_4622_5032	134
1241	3300049822	Ga0501035_0041338	Ga0501035_0041338_996_1406	134
1242	3300049822	Ga0501035_0075570	Ga0501035_0075570_105_518	134
1243	3300049822	Ga0501035_0081056	Ga0501035_0081056_2037_2447	134
1244	3300049822	Ga0501035_0786960	Ga0501035_0786960_251_658	134
1245	3300049823	Ga0501044_0000001	Ga0501044_0000001_337196_337609	134
1246	3300049823	Ga0501044_0078960	Ga0501044_0078960_1593_2003	134
1247	3300049823	Ga0501044_0084038	Ga0501044_0084038_598_1008	134
1248	3300049823	Ga0501044_0097907	Ga0501044_0097907_20_439	134
1249	3300049823	Ga0501044_0102479	Ga0501044_0102479_1454_1864	134
1250	3300049823	Ga0501044_0155743	Ga0501044_0155743_687_1097	134
1251	3300049823	Ga0501044_0312411	Ga0501044_0312411_124_537	134
1252	3300049823	Ga0501044_0550456	Ga0501044_0550456_574_993	134
1253	3300049824	Ga0501045_0089971	Ga0501045_0089971_402_815	134
1254	3300049824	Ga0501045_0189820	Ga0501045_0189820_927_1340	134
1255	3300049824	Ga0501045_0250252	Ga0501045_0250252_126_533	134
1256	3300050489	nmdc:mga03683_64096_c1	nmdc:mga03683_64096_c1_543_947	134
1257	3300050490	nmdc:mga03n38_801_c1	nmdc:mga03n38_801_c1_6139_6543	134
1258	3300050491	nmdc:mga00v17_56696_c1	nmdc:mga00v17_56696_c1_1319_1732	134
1259	3300050491	nmdc:mga00v17_7046_c1	nmdc:mga00v17_7046_c1_1721_2125	134
1260	3300050492	nmdc:mga0yw44_10672_c1	nmdc:mga0yw44_10672_c1_1233_1646	134
1261	3300050492	nmdc:mga0yw44_9629_c1	nmdc:mga0yw44_9629_c1_1100_1504	134
1262	3300050494	nmdc:mga06z11_17652_c1	nmdc:mga06z11_17652_c1_1499_1903	134
1263	3300050495	nmdc:mga04h51_12015_c1	nmdc:mga04h51_12015_c1_1499_1903	134
1264	3300050496	nmdc:mga07m45_379661_c1	nmdc:mga07m45_379661_c1_352_765	134
1265	3300050516	nmdc:mga0sz30_150_c1	nmdc:mga0sz30_150_c1_16364_16768	134
1266	3300050516	nmdc:mga0sz30_93860_c1	nmdc:mga0sz30_93860_c1_605_1018	134
1267	3300053080	Ga0500635_0011816	Ga0500635_0011816_739_1158	134
1268	3300053107	Ga0500560_000154	Ga0500560_000154_6635_7039	134
1269	3300053133	Ga0500655_002013	Ga0500655_002013_1578_1997	134
1270	3300053134	Ga0500658_0156767	Ga0500658_0156767_376_789	134
1271	3300053137	Ga0500561_0000418	Ga0500561_0000418_4664_5068	134
1272	3300053151	Ga0500604_0288993	Ga0500604_0288993_54_467	134
1273	3300053157	Ga0500624_001456	Ga0500624_001456_3080_3484	134
1274	3300053161	Ga0500634_0258347	Ga0500634_0258347_296_703	134
1275	3300053178	Ga0500637_0049401	Ga0500637_0049401_43_462	134
1276	3300053727	Ga0500611_023667	Ga0500611_023667_209_622	134
1277	3300054114	Ga0501084_0168500	Ga0501084_0168500_1140_1556	134
1278	3300054114	Ga0501084_0393795	Ga0501084_0393795_199_606	134
1279	3300059506	Ga0587085_007845	Ga0587085_007845_31_435	134
1280	3300059508	Ga0587088_003267	Ga0587088_003267_601_1005	134
1281	3300059623	Ga0587101_001296	Ga0587101_001296_778_1182	134
1282	3300059624	Ga0587109_068791	Ga0587109_068791_327_731	134
1283	3300060353	Ga0501082_0015266	Ga0501082_0015266_5687_6136	134
1284	3300060353	Ga0501082_0216110	Ga0501082_0216110_805_1212	134
1285	3300060353	Ga0501082_1706814	Ga0501082_1706814_45_455	134
1286	iso_pu_bacteria	2937868953	2937876635	134
1287	iso_pu_bacteria	2961183825	2961188580	134
1288	iso_pu_bacteria	2979772303	2979772311	134
1289	iso_pu_bacteria	8004395343	8004396967	134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

32

140

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3qmn-assembly1.cif.gz_B	crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor	0.9371	1	128
5xuh-assembly1.cif.gz_C	crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa	0.9228	1	128
5xu7-assembly1.cif.gz_C	crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps)	0.9216	1	128
5xu7-assembly1.cif.gz_A	crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps)	0.9205	1	128
5xuh-assembly1.cif.gz_B	crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa	0.9189	1	128

ID	Description	Score	Start	End	Superfamily
5xuhB00	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain	0.9189	1	128	3.90.470.20
5xuhB00	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain	0.9042	1	128	3.90.470.20
5xukA00	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain	0.8948	5	128	3.90.470.20
2wdyA00	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain	0.8935	2	127	3.90.470.20
2wasC00	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain	0.8855	4	128	3.90.470.20

ID	Description	Score	Start	End	GO Terms
AF-A0A7W6LE47-F1-model_v4	Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS)	0.9925	1	134	GO:0000287 GO:0005737 GO:0006633 GO:0008897
AF-A0A1E4ATP7-F1-model_v4	deleted	0.9919	1	115
AF-A0A525KPW6-F1-model_v4	Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS)	0.9915	1	131	GO:0000287 GO:0005737 GO:0006633 GO:0008897
AF-G9A2Y4-F1-model_v4	Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS)	0.9911	1	134	GO:0000287 GO:0005737 GO:0006633 GO:0008897
AF-A0A397KZG9-F1-model_v4	deleted	0.9911	1	134

Feature Viewer

pLDDT	pTM	Quality
96.11	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F492617

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

32

140

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map