F492541

General Info

Members Datasets Scaffolds Average Seq Length
1282 387 2562 331

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0920430|Ga0436361_0920430_209_1306
Length 365
Sequence MKDLPRGPNKKLADSRLAFSRSSRRKCQMAQIVFGFGTSHGPLLATPPQEWDLRAKIDRENKSLAFRSGTYDFAQLCEMRKGDNFDLQNSLDVRAERNERCQKQLDALGDMVKVSDPDVLLIIGDDHHEWFLNDIQPAFSIFRGKQVYNRALTEEEQDKKTASGNMYAMRIYYPQRDETYQCPSDLATHLVSQVVHDGFDVASIGEQPTDGGVLRQLGHSYGFVYRRILRGHSVPLIPVIVNTFYPPNQPTPARCLAFGRALGRAISSWSGQERVAVAASGGVSHFVVDEEFDRRVLKAMRDRDYDTLAKEPDINFRSGTSETKNWLVLAGILAETSLSMDVLDYVPCYRSEAGTGSGMAFAAWQ

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
354 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
373 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
374 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
381 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
382 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
383 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
384 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
385 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
386 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
387 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.39
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0.31
Rhizoplane 5.07
Rhizosphere 90.56
Stem 0
Stem Tuber 0
Unclassified 14.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0920430 3300039447 Unclassified 1674
2 JGI24744J21845_10010566 3300002077 Bacteria 1892
3 JGI24033J26618_1005216 3300002155 Bacteria 1427
4 JGI24742J22300_10000688 3300002244 Bacteria 5099
5 JGI25406J46586_10000393 3300003203 Bacteria 20038
6 JGI25406J46586_10002426 3300003203 Bacteria 8814
7 JGI25406J46586_10049082 3300003203 Bacteria 1426
8 JGI25406J46586_10054052 3300003203 Bacteria 1330
9 JGI25405J52794_10002066 3300003911 Bacteria 3413
10 Ga0065704_10138674 3300005289 Bacteria 1541
11 Ga0065712_10102051 3300005290 Bacteria 2011
12 Ga0065715_10184617 3300005293 Bacteria 1453
13 Ga0070658_10140404 3300005327 Bacteria 2018
14 Ga0070658_10228260 3300005327 Bacteria 1576
15 Ga0070676_10011166 3300005328 Bacteria 4880
16 Ga0070676_10029136 3300005328 Bacteria 3139
17 Ga0070676_10220658 3300005328 Bacteria 1252
18 Ga0070676_10227425 3300005328 Unclassified 1235
19 Ga0070683_100000301 3300005329 Bacteria 33790
20 Ga0070683_100007229 3300005329 Bacteria 9370
21 Ga0070683_100014020 3300005329 Bacteria 6999
22 Ga0070683_100050193 3300005329 Bacteria 3861
23 Ga0070683_100073743 3300005329 Bacteria 3187
24 Ga0070683_100124602 3300005329 Bacteria 2435
25 Ga0070683_100129398 3300005329 Bacteria 2388
26 Ga0070683_100251360 3300005329 Bacteria 1681
27 Ga0070690_100005585 3300005330 Bacteria 7075
28 Ga0070690_100005812 3300005330 Bacteria 6951
29 Ga0070690_100017529 3300005330 Bacteria 4309
30 Ga0070690_100026462 3300005330 Bacteria 3578
31 Ga0070690_100054616 3300005330 Unclassified 2557
32 Ga0070690_100061743 3300005330 Bacteria 2415
33 Ga0070690_100100883 3300005330 Bacteria 1914
34 Ga0070670_100000974 3300005331 Bacteria 22427
35 Ga0070670_100013453 3300005331 Bacteria 7009
36 Ga0070670_100018295 3300005331 Bacteria 6012
37 Ga0070670_100024356 3300005331 Bacteria 5204
38 Ga0070670_100048960 3300005331 Bacteria 3636
39 Ga0070670_100095815 3300005331 Unclassified 2553
40 Ga0070670_100323125 3300005331 Unclassified 1352
41 Ga0070677_10002771 3300005333 Bacteria 5610
42 Ga0070677_10008993 3300005333 Bacteria 3378
43 Ga0068869_100007259 3300005334 Bacteria 7062
44 Ga0068869_100009214 3300005334 Bacteria 6395
45 Ga0068869_100026931 3300005334 Bacteria 4004
46 Ga0068869_100035710 3300005334 Bacteria 3525
47 Ga0068869_100135283 3300005334 Bacteria 1898
48 Ga0068869_100174182 3300005334 Unclassified 1683
49 Ga0070666_10019084 3300005335 Bacteria 4421
50 Ga0070666_10030598 3300005335 Bacteria 3548
51 Ga0070666_10044920 3300005335 Bacteria 2961
52 Ga0070680_100001316 3300005336 Bacteria 17997
53 Ga0070680_100001335 3300005336 Bacteria 17856
54 Ga0070680_100009677 3300005336 Bacteria 7416
55 Ga0068868_100006725 3300005338 Bacteria 8162
56 Ga0068868_100010392 3300005338 Bacteria 6737
57 Ga0068868_100014330 3300005338 Bacteria 5842
58 Ga0068868_100029869 3300005338 Bacteria 4176
59 Ga0068868_100058202 3300005338 Bacteria 3054
60 Ga0070660_100091242 3300005339 Bacteria 2403
61 Ga0070660_100225540 3300005339 Unclassified 1524
62 Ga0070689_100012396 3300005340 Bacteria 6140
63 Ga0070689_100069996 3300005340 Unclassified 2738
64 Ga0070689_100107386 3300005340 Unclassified 2216
65 Ga0070689_100145963 3300005340 Bacteria 1905
66 Ga0070691_10000324 3300005341 Bacteria 16893
67 Ga0070687_100008670 3300005343 Unclassified 4316
68 Ga0070687_100046081 3300005343 Bacteria 2230
69 Ga0070687_100104374 3300005343 Bacteria 1593
70 Ga0070687_100178246 3300005343 Bacteria 1271
71 Ga0070661_100011281 3300005344 Bacteria 6226
72 Ga0070661_100019692 3300005344 Bacteria 4809
73 Ga0070661_100106930 3300005344 Unclassified 2086
74 Ga0070661_100150999 3300005344 Bacteria 1756
75 Ga0070661_100204408 3300005344 Bacteria 1510
76 Ga0070661_100353104 3300005344 Unclassified 1154
77 Ga0070692_10111871 3300005345 Bacteria 1511
78 Ga0070692_10200172 3300005345 Bacteria 1169
79 Ga0070669_100004616 3300005353 Bacteria 9940
80 Ga0070669_100016001 3300005353 Bacteria 5352
81 Ga0070669_100030914 3300005353 Bacteria 3865
82 Ga0070669_100278550 3300005353 Unclassified 1339
83 Ga0070675_100000644 3300005354 Bacteria 24114
84 Ga0070675_100001188 3300005354 Bacteria 18929
85 Ga0070675_100003309 3300005354 Bacteria 12223
86 Ga0070675_100027191 3300005354 Bacteria 4594
87 Ga0070675_100075583 3300005354 Unclassified 2800
88 Ga0070675_100107358 3300005354 Unclassified 2357
89 Ga0070675_100114732 3300005354 Unclassified 2283
90 Ga0070675_100328252 3300005354 Bacteria 1353
91 Ga0070671_100039225 3300005355 Bacteria 3931
92 Ga0070671_100039557 3300005355 Bacteria 3914
93 Ga0070671_100062326 3300005355 Unclassified 3106
94 Ga0070671_100122770 3300005355 Unclassified 2186
95 Ga0070671_100219325 3300005355 Bacteria 1614
96 Ga0070674_100004510 3300005356 Bacteria 7947
97 Ga0070674_100073938 3300005356 Unclassified 2417
98 Ga0070674_100090130 3300005356 Bacteria 2211
99 Ga0070674_100218530 3300005356 Unclassified 1481
100 Ga0070674_100243305 3300005356 Unclassified 1410
101 Ga0070674_100279285 3300005356 Bacteria 1323
102 Ga0070673_100020932 3300005364 Bacteria 4728
103 Ga0070673_100024873 3300005364 Bacteria 4397
104 Ga0070673_100025354 3300005364 Bacteria 4363
105 Ga0070673_100026223 3300005364 Unclassified 4302
106 Ga0070673_100132007 3300005364 Unclassified 2097
107 Ga0070673_100184448 3300005364 Bacteria 1788
108 Ga0070673_100211560 3300005364 Unclassified 1675
109 Ga0070688_100008145 3300005365 Bacteria 5678
110 Ga0070688_100013932 3300005365 Bacteria 4548
111 Ga0070688_100039988 3300005365 Bacteria 2872
112 Ga0070688_100081378 3300005365 Bacteria 2097
113 Ga0070688_100094296 3300005365 Bacteria 1962
114 Ga0070659_100008560 3300005366 Bacteria 7480
115 Ga0070659_100060974 3300005366 Unclassified 2980
116 Ga0070659_100133583 3300005366 Bacteria 2017
117 Ga0070659_100303077 3300005366 Bacteria 1333
118 Ga0070659_100314517 3300005366 Bacteria 1308
119 Ga0070667_100008209 3300005367 Bacteria 8655
120 Ga0070667_100011865 3300005367 Bacteria 7206
121 Ga0070667_100020877 3300005367 Bacteria 5440
122 Ga0070667_100048372 3300005367 Bacteria 3579
123 Ga0070667_100429441 3300005367 Bacteria 1205
124 Ga0070709_10141420 3300005434 Bacteria 1654
125 Ga0070714_100044338 3300005435 Bacteria 3765
126 Ga0070714_100138874 3300005435 Bacteria 2179
127 Ga0070714_100385438 3300005435 Unclassified 1322
128 Ga0070714_100441605 3300005435 Bacteria 1235
129 Ga0070714_100529998 3300005435 Bacteria 1126
130 Ga0070713_100018211 3300005436 Bacteria 5336
131 Ga0070713_100030488 3300005436 Bacteria 4283
132 Ga0070713_100039332 3300005436 Unclassified 3837
133 Ga0070713_100049632 3300005436 Bacteria 3463
134 Ga0070713_100069174 3300005436 Bacteria 2976
135 Ga0070713_100291034 3300005436 Bacteria 1501
136 Ga0070713_100462597 3300005436 Unclassified 1193
137 Ga0070701_10008881 3300005438 Bacteria 4373
138 Ga0070701_10013651 3300005438 Bacteria 3702
139 Ga0070701_10161672 3300005438 Unclassified 1297
140 Ga0070711_100101480 3300005439 Bacteria 2094
141 Ga0070711_100219847 3300005439 Bacteria 1476
142 Ga0070711_100251435 3300005439 Unclassified 1387
143 Ga0070705_100079777 3300005440 Unclassified 2006
144 Ga0070705_100195361 3300005440 Bacteria 1383
145 Ga0070700_100017507 3300005441 Bacteria 4100
146 Ga0070700_100023549 3300005441 Unclassified 3603
147 Ga0070700_100085121 3300005441 Bacteria 2050
148 Ga0070700_100333858 3300005441 Bacteria 1118
149 Ga0070708_100467645 3300005445 Unclassified 1190
150 Ga0070678_100033289 3300005456 Bacteria 3577
151 Ga0070678_100078695 3300005456 Bacteria 2491
152 Ga0070678_100082787 3300005456 Bacteria 2437
153 Ga0070678_100138521 3300005456 Unclassified 1944
154 Ga0070678_100304707 3300005456 Unclassified 1355
155 Ga0070662_100014432 3300005457 Bacteria 5279
156 Ga0070662_100044895 3300005457 Bacteria 3168
157 Ga0070662_100070282 3300005457 Unclassified 2579
158 Ga0070662_100108085 3300005457 Unclassified 2115
159 Ga0070681_10008296 3300005458 Bacteria 10171
160 Ga0070681_10009631 3300005458 Bacteria 9501
161 Ga0070681_10022535 3300005458 Bacteria 6325
162 Ga0070681_10032405 3300005458 Bacteria 5244
163 Ga0070681_10066078 3300005458 Unclassified 3585
164 Ga0070681_10076173 3300005458 Bacteria 3314
165 Ga0070681_10094217 3300005458 Bacteria 2943
166 Ga0070681_10172389 3300005458 Bacteria 2085
167 Ga0070681_10228249 3300005458 Unclassified 1776
168 Ga0070681_10275489 3300005458 Bacteria 1594
169 Ga0068867_100034640 3300005459 Bacteria 3660
170 Ga0068867_100037213 3300005459 Bacteria 3537
171 Ga0068867_100336738 3300005459 Unclassified 1255
172 Ga0070685_10221747 3300005466 Bacteria 1239
173 Ga0070698_100083468 3300005471 Bacteria 3184
174 Ga0070698_100342720 3300005471 Bacteria 1426
175 Ga0070699_100070838 3300005518 Bacteria 3031
176 Ga0070699_100105534 3300005518 Unclassified 2472
177 Ga0070679_100004740 3300005530 Bacteria 12542
178 Ga0070679_100015693 3300005530 Bacteria 7282
179 Ga0070679_100017008 3300005530 Bacteria 7030
180 Ga0070679_100021451 3300005530 Bacteria 6306
181 Ga0070679_100112724 3300005530 Bacteria 2705
182 Ga0070679_100210601 3300005530 Unclassified 1908
183 Ga0070684_100001680 3300005535 Bacteria 16075
184 Ga0070684_100007348 3300005535 Bacteria 8563
185 Ga0070684_100012682 3300005535 Bacteria 6762
186 Ga0070684_100076402 3300005535 Bacteria 2956
187 Ga0070684_100113031 3300005535 Unclassified 2436
188 Ga0070684_100321308 3300005535 Bacteria 1422
189 Ga0070697_100468662 3300005536 Bacteria 1099
190 Ga0068853_100013038 3300005539 Bacteria 6778
191 Ga0068853_100024105 3300005539 Bacteria 5100
192 Ga0068853_100075555 3300005539 Bacteria 2940
193 Ga0068853_100092275 3300005539 Bacteria 2664
194 Ga0068853_100154957 3300005539 Bacteria 2064
195 Ga0068853_100197011 3300005539 Bacteria 1832
196 Ga0070672_100011068 3300005543 Bacteria 6281
197 Ga0070672_100018764 3300005543 Bacteria 5009
198 Ga0070672_100023131 3300005543 Bacteria 4577
199 Ga0070672_100046934 3300005543 Bacteria 3349
200 Ga0070672_100139048 3300005543 Unclassified 2002
201 Ga0070672_100261424 3300005543 Unclassified 1460
202 Ga0070686_100009770 3300005544 Bacteria 5391
203 Ga0070686_100013446 3300005544 Bacteria 4689
204 Ga0070686_100023771 3300005544 Unclassified 3667
205 Ga0070686_100037728 3300005544 Bacteria 2999
206 Ga0070686_100122391 3300005544 Bacteria 1788
207 Ga0070695_100197823 3300005545 Bacteria 1434
208 Ga0070696_100260870 3300005546 Unclassified 1314
209 Ga0070693_100023319 3300005547 Bacteria 3306
210 Ga0070665_100008439 3300005548 Bacteria 10421
211 Ga0070665_100056481 3300005548 Unclassified 3935
212 Ga0070665_100076361 3300005548 Bacteria 3357
213 Ga0070665_100166516 3300005548 Bacteria 2206
214 Ga0070665_100263670 3300005548 Unclassified 1724
215 Ga0070704_100092750 3300005549 Bacteria 2255
216 Ga0068855_100002819 3300005563 Bacteria 21408
217 Ga0068855_100005925 3300005563 Bacteria 14901
218 Ga0068855_100040045 3300005563 Bacteria 5562
219 Ga0068855_100081259 3300005563 Unclassified 3757
220 Ga0068855_100115545 3300005563 Bacteria 3076
221 Ga0068855_100164037 3300005563 Bacteria 2520
222 Ga0068855_100188262 3300005563 Bacteria 2330
223 Ga0070664_100014604 3300005564 Bacteria 6408
224 Ga0070664_100022987 3300005564 Bacteria 5144
225 Ga0070664_100033721 3300005564 Bacteria 4291
226 Ga0070664_100216439 3300005564 Unclassified 1713
227 Ga0068857_100015291 3300005577 Bacteria 6699
228 Ga0068857_100015475 3300005577 Bacteria 6663
229 Ga0068857_100035161 3300005577 Bacteria 4435
230 Ga0068857_100126450 3300005577 Unclassified 2304
231 Ga0068857_100126977 3300005577 Bacteria 2299
232 Ga0068857_100241378 3300005577 Bacteria 1654
233 Ga0068857_100319395 3300005577 Bacteria 1434
234 Ga0068854_100237622 3300005578 Bacteria 1449
235 Ga0068856_100001168 3300005614 Bacteria 27615
236 Ga0068856_100014581 3300005614 Bacteria 7594
237 Ga0068856_100019448 3300005614 Bacteria 6591
238 Ga0068856_100026599 3300005614 Bacteria 5642
239 Ga0068856_100142501 3300005614 Bacteria 2404
240 Ga0068856_100167929 3300005614 Bacteria 2205
241 Ga0068856_100341959 3300005614 Bacteria 1514
242 Ga0070702_100008723 3300005615 Bacteria 4926
243 Ga0070702_100101337 3300005615 Unclassified 1767
244 Ga0068852_100009496 3300005616 Bacteria 7228
245 Ga0068852_100021458 3300005616 Bacteria 5158
246 Ga0068852_100146475 3300005616 Bacteria 2191
247 Ga0068852_100324058 3300005616 Unclassified 1497
248 Ga0068852_100451881 3300005616 Unclassified 1272
249 Ga0068859_100014354 3300005617 Bacteria 7946
250 Ga0068859_100078422 3300005617 Bacteria 3343
251 Ga0068859_100082514 3300005617 Bacteria 3257
252 Ga0068859_100092226 3300005617 Bacteria 3080
253 Ga0068859_100113609 3300005617 Bacteria 2772
254 Ga0068859_100132726 3300005617 Bacteria 2562
255 Ga0068859_100199251 3300005617 Bacteria 2087
256 Ga0068859_100305576 3300005617 Bacteria 1684
257 Ga0068859_100333227 3300005617 Bacteria 1612
258 Ga0068859_100391398 3300005617 Bacteria 1486
259 Ga0068864_100002489 3300005618 Bacteria 15223
260 Ga0068864_100047520 3300005618 Bacteria 3687
261 Ga0068864_100061335 3300005618 Bacteria 3257
262 Ga0068864_100119949 3300005618 Bacteria 2350
263 Ga0068864_100235155 3300005618 Unclassified 1696
264 Ga0068861_100135391 3300005719 Bacteria 2004
265 Ga0068861_100144878 3300005719 Unclassified 1943
266 Ga0068851_10083405 3300005834 Bacteria 1672
267 Ga0068870_10001158 3300005840 Bacteria 10555
268 Ga0068870_10004289 3300005840 Bacteria 6136
269 Ga0068870_10007546 3300005840 Bacteria 4854
270 Ga0068870_10099422 3300005840 Unclassified 1641
271 Ga0068870_10159685 3300005840 Unclassified 1336
272 Ga0068863_100014331 3300005841 Bacteria 7635
273 Ga0068863_100016886 3300005841 Bacteria 7000
274 Ga0068863_100023491 3300005841 Bacteria 5886
275 Ga0068863_100190271 3300005841 Unclassified 1972
276 Ga0068858_100028766 3300005842 Bacteria 5161
277 Ga0068858_100031181 3300005842 Bacteria 4950
278 Ga0068858_100041156 3300005842 Bacteria 4286
279 Ga0068858_100042373 3300005842 Bacteria 4221
280 Ga0068858_100054060 3300005842 Bacteria 3713
281 Ga0068860_100010576 3300005843 Bacteria 9113
282 Ga0068860_100018643 3300005843 Bacteria 6750
283 Ga0068860_100051204 3300005843 Bacteria 3929
284 Ga0068860_100086035 3300005843 Bacteria 2991
285 Ga0068860_100142556 3300005843 Bacteria 2304
286 Ga0068862_100020187 3300005844 Bacteria 5564
287 Ga0068862_100071365 3300005844 Bacteria 2998
288 Ga0068862_100231099 3300005844 Bacteria 1678
289 Ga0081455_10000840 3300005937 Bacteria 39521
290 Ga0081455_10021104 3300005937 Bacteria 6115
291 Ga0081455_10034725 3300005937 Bacteria 4515
292 Ga0081538_10027048 3300005981 Bacteria 3988
293 Ga0081539_10000047 3300005985 Bacteria 275235
294 Ga0081539_10002846 3300005985 Bacteria 23053
295 Ga0081539_10004786 3300005985 Bacteria 14592
296 Ga0081539_10014737 3300005985 Bacteria 5748
297 Ga0075365_10003122 3300006038 Bacteria 8432
298 Ga0075365_10010200 3300006038 Bacteria 5457
299 Ga0075365_10074434 3300006038 Bacteria 2290
300 Ga0075365_10099906 3300006038 Bacteria 1986
301 Ga0075364_10020903 3300006051 Bacteria 4121
302 Ga0070715_10099109 3300006163 Bacteria 1356
303 Ga0070712_100022120 3300006175 Bacteria 4184
304 Ga0070712_100043331 3300006175 Bacteria 3098
305 Ga0070712_100451848 3300006175 Unclassified 1070
306 Ga0075362_10043835 3300006177 Unclassified 1982
307 Ga0075362_10054401 3300006177 Bacteria 1798
308 Ga0075367_10014301 3300006178 Bacteria 4293
309 Ga0075367_10080533 3300006178 Bacteria 1970
310 Ga0075367_10106252 3300006178 Bacteria 1720
311 Ga0075367_10211142 3300006178 Bacteria 1214
312 Ga0075427_10006826 3300006194 Bacteria 1665
313 Ga0075366_10022922 3300006195 Bacteria 3635
314 Ga0097621_100012607 3300006237 Bacteria 6271
315 Ga0097621_100032737 3300006237 Bacteria 4135
316 Ga0097621_100033878 3300006237 Bacteria 4071
317 Ga0097621_100053281 3300006237 Bacteria 3297
318 Ga0097621_100074759 3300006237 Bacteria 2807
319 Ga0097621_100181121 3300006237 Bacteria 1821
320 Ga0097621_100235576 3300006237 Bacteria 1599
321 Ga0097621_100235787 3300006237 Unclassified 1598
322 Ga0097621_100277356 3300006237 Bacteria 1475
323 Ga0097621_100476508 3300006237 Bacteria 1128
324 Ga0068871_100014427 3300006358 Bacteria 5893
325 Ga0068871_100020640 3300006358 Bacteria 5051
326 Ga0068871_100079316 3300006358 Bacteria 2716
327 Ga0068871_100083862 3300006358 Unclassified 2644
328 Ga0068871_100270691 3300006358 Bacteria 1484
329 Ga0075428_100005211 3300006844 Bacteria 14451
330 Ga0075428_100034588 3300006844 Bacteria 5572
331 Ga0075428_100052788 3300006844 Bacteria 4454
332 Ga0075428_100070527 3300006844 Bacteria 3820
333 Ga0075428_100077794 3300006844 Bacteria 3621
334 Ga0075428_100095292 3300006844 Bacteria 3244
335 Ga0075428_100113329 3300006844 Bacteria 2954
336 Ga0075428_100138885 3300006844 Bacteria 2642
337 Ga0075428_100230447 3300006844 Bacteria 1999
338 Ga0075428_100304665 3300006844 Bacteria 1713
339 Ga0075430_100002643 3300006846 Bacteria 14961
340 Ga0075430_100013828 3300006846 Bacteria 6876
341 Ga0075430_100039729 3300006846 Bacteria 3982
342 Ga0075430_100056531 3300006846 Bacteria 3299
343 Ga0075430_100078529 3300006846 Bacteria 2767
344 Ga0075430_100132101 3300006846 Bacteria 2081
345 Ga0075431_100000646 3300006847 Bacteria 29552
346 Ga0075431_100031593 3300006847 Bacteria 5453
347 Ga0075431_100106227 3300006847 Bacteria 2897
348 Ga0075431_100194412 3300006847 Bacteria 2077
349 Ga0075431_100523971 3300006847 Bacteria 1174
350 Ga0075433_10000460 3300006852 Bacteria 26456
351 Ga0075433_10001289 3300006852 Bacteria 18331
352 Ga0075433_10001670 3300006852 Bacteria 16530
353 Ga0075433_10209782 3300006852 Unclassified 1731
354 Ga0075434_100003682 3300006871 Bacteria 13693
355 Ga0075434_100016390 3300006871 Bacteria 7123
356 Ga0075434_100065432 3300006871 Bacteria 3620
357 Ga0075434_100283137 3300006871 Bacteria 1677
358 Ga0075434_100323868 3300006871 Bacteria 1562
359 Ga0075429_100001853 3300006880 Bacteria 17516
360 Ga0075429_100251220 3300006880 Bacteria 1549
361 Ga0075429_100271027 3300006880 Unclassified 1487
362 Ga0068865_100003824 3300006881 Bacteria 9036
363 Ga0068865_100080632 3300006881 Unclassified 2335
364 Ga0068865_100108285 3300006881 Bacteria 2045
365 Ga0068865_100326202 3300006881 Unclassified 1237
366 Ga0097620_100014354 3300006931 Bacteria 7946
367 Ga0097620_100078423 3300006931 Bacteria 3343
368 Ga0097620_100082515 3300006931 Bacteria 3257
369 Ga0097620_100092224 3300006931 Bacteria 3080
370 Ga0097620_100113612 3300006931 Bacteria 2772
371 Ga0097620_100132726 3300006931 Bacteria 2562
372 Ga0097620_100199255 3300006931 Bacteria 2087
373 Ga0097620_100305547 3300006931 Bacteria 1684
374 Ga0097620_100333204 3300006931 Bacteria 1612
375 Ga0097620_100391354 3300006931 Bacteria 1486
376 Ga0075435_100295006 3300007076 Unclassified 1386
377 Ga0099795_10046363 3300007788 Bacteria 1566
378 Ga0105240_10007648 3300009093 Bacteria 15651
379 Ga0105240_10022565 3300009093 Bacteria 8341
380 Ga0105240_10032830 3300009093 Bacteria 6715
381 Ga0105240_10034115 3300009093 Bacteria 6567
382 Ga0105240_10060448 3300009093 Bacteria 4724
383 Ga0105240_10095953 3300009093 Bacteria 3615
384 Ga0105240_10497798 3300009093 Bacteria 1356
385 Ga0111539_10000151 3300009094 Bacteria 79134
386 Ga0111539_10000562 3300009094 Bacteria 47603
387 Ga0111539_10002437 3300009094 Bacteria 24741
388 Ga0111539_10002719 3300009094 Bacteria 23469
389 Ga0111539_10003382 3300009094 Bacteria 21034
390 Ga0111539_10015153 3300009094 Bacteria 9606
391 Ga0111539_10021998 3300009094 Bacteria 7838
392 Ga0111539_10039106 3300009094 Bacteria 5719
393 Ga0111539_10050957 3300009094 Bacteria 4932
394 Ga0111539_10150753 3300009094 Bacteria 2722
395 Ga0111539_10251357 3300009094 Bacteria 2058
396 Ga0111539_10285962 3300009094 Bacteria 1919
397 Ga0111539_10348270 3300009094 Bacteria 1724
398 Ga0105245_10001655 3300009098 Bacteria 20281
399 Ga0105245_10004216 3300009098 Bacteria 12760
400 Ga0105245_10008681 3300009098 Bacteria 8863
401 Ga0105245_10016334 3300009098 Bacteria 6473
402 Ga0105245_10036311 3300009098 Bacteria 4377
403 Ga0105247_10007255 3300009101 Bacteria 6808
404 Ga0105247_10022228 3300009101 Bacteria 3819
405 Ga0105247_10022256 3300009101 Bacteria 3817
406 Ga0114129_10000797 3300009147 Bacteria 40445
407 Ga0114129_10002798 3300009147 Bacteria 24345
408 Ga0114129_10004770 3300009147 Bacteria 19166
409 Ga0114129_10078064 3300009147 Bacteria 4606
410 Ga0114129_10119066 3300009147 Bacteria 3637
411 Ga0114129_10126143 3300009147 Bacteria 3519
412 Ga0114129_10167684 3300009147 Bacteria 2995
413 Ga0114129_10266178 3300009147 Unclassified 2295
414 Ga0114129_10314380 3300009147 Bacteria 2084
415 Ga0114129_10340973 3300009147 Bacteria 1988
416 Ga0114129_10655453 3300009147 Bacteria 1354
417 Ga0105243_10073902 3300009148 Bacteria 2764
418 Ga0105243_10079238 3300009148 Bacteria 2677
419 Ga0105243_10261055 3300009148 Bacteria 1551
420 Ga0105243_10406941 3300009148 Unclassified 1265
421 Ga0105241_10001682 3300009174 Bacteria 16818
422 Ga0105241_10157116 3300009174 Bacteria 1866
423 Ga0105241_10158844 3300009174 Bacteria 1856
424 Ga0105242_10039911 3300009176 Bacteria 3780
425 Ga0105242_10074931 3300009176 Unclassified 2817
426 Ga0105242_10224243 3300009176 Bacteria 1681
427 Ga0105242_10463875 3300009176 Bacteria 1197
428 Ga0105248_10000804 3300009177 Bacteria 35156
429 Ga0105248_10003271 3300009177 Bacteria 17979
430 Ga0105248_10004514 3300009177 Bacteria 15398
431 Ga0105248_10006795 3300009177 Bacteria 12542
432 Ga0105248_10007062 3300009177 Bacteria 12301
433 Ga0105248_10012815 3300009177 Bacteria 9249
434 Ga0105248_10023319 3300009177 Bacteria 6874
435 Ga0105248_10027991 3300009177 Bacteria 6277
436 Ga0105248_10031282 3300009177 Bacteria 5948
437 Ga0105248_10035718 3300009177 Bacteria 5559
438 Ga0105248_10074816 3300009177 Bacteria 3806
439 Ga0105248_10424526 3300009177 Bacteria 1497
440 Ga0105248_10561737 3300009177 Bacteria 1287
441 Ga0105237_10003677 3300009545 Bacteria 18071
442 Ga0105237_10004000 3300009545 Bacteria 17235
443 Ga0105237_10121241 3300009545 Bacteria 2610
444 Ga0105237_10125623 3300009545 Bacteria 2559
445 Ga0105237_10141258 3300009545 Bacteria 2402
446 Ga0105237_10210358 3300009545 Bacteria 1945
447 Ga0105237_10261983 3300009545 Unclassified 1731
448 Ga0105237_10433556 3300009545 Unclassified 1320
449 Ga0105238_10004133 3300009551 Bacteria 14403
450 Ga0105238_10010800 3300009551 Bacteria 9177
451 Ga0105238_10027156 3300009551 Bacteria 5834
452 Ga0105238_10041666 3300009551 Bacteria 4650
453 Ga0105238_10054351 3300009551 Bacteria 4021
454 Ga0105238_10107500 3300009551 Bacteria 2771
455 Ga0105238_10147305 3300009551 Bacteria 2330
456 Ga0105238_10213291 3300009551 Bacteria 1907
457 Ga0105238_10245752 3300009551 Bacteria 1767
458 Ga0105238_10253308 3300009551 Bacteria 1739
459 Ga0105238_10490031 3300009551 Bacteria 1229
460 Ga0105249_10016531 3300009553 Bacteria 6546
461 Ga0105249_10034356 3300009553 Bacteria 4595
462 Ga0105249_10037423 3300009553 Bacteria 4404
463 Ga0105249_10169053 3300009553 Bacteria 2119
464 Ga0105249_10276991 3300009553 Bacteria 1674
465 Ga0105249_10669541 3300009553 Unclassified 1096
466 Ga0105239_10003090 3300010375 Bacteria 20668
467 Ga0105239_10029968 3300010375 Bacteria 5984
468 Ga0105239_10032820 3300010375 Bacteria 5705
469 Ga0105246_10005632 3300011119 Bacteria 7639
470 Ga0105246_10012119 3300011119 Bacteria 5372
471 Ga0105246_10018044 3300011119 Bacteria 4494
472 Ga0105246_10088512 3300011119 Bacteria 2225
473 Ga0157371_10046819 3300013102 Unclassified 3075
474 Ga0157370_10005689 3300013104 Bacteria 13934
475 Ga0157370_10024535 3300013104 Bacteria 5972
476 Ga0157370_10037770 3300013104 Unclassified 4677
477 Ga0157370_10053386 3300013104 Bacteria 3854
478 Ga0157370_10076945 3300013104 Bacteria 3143
479 Ga0157370_10088466 3300013104 Bacteria 2909
480 Ga0157370_10131762 3300013104 Unclassified 2332
481 Ga0157369_10005817 3300013105 Bacteria 14337
482 Ga0157369_10006422 3300013105 Bacteria 13628
483 Ga0157369_10008198 3300013105 Bacteria 11984
484 Ga0157369_10017939 3300013105 Bacteria 7946
485 Ga0157369_10024815 3300013105 Bacteria 6661
486 Ga0157369_10026929 3300013105 Bacteria 6376
487 Ga0157369_10030918 3300013105 Bacteria 5901
488 Ga0157369_10200327 3300013105 Bacteria 2096
489 Ga0157374_10048689 3300013296 Bacteria 3934
490 Ga0157374_10110136 3300013296 Bacteria 2648
491 Ga0157374_10110381 3300013296 Bacteria 2645
492 Ga0157374_10146220 3300013296 Bacteria 2296
493 Ga0157374_10171620 3300013296 Bacteria 2116
494 Ga0157374_10285780 3300013296 Unclassified 1629
495 Ga0157374_10295616 3300013296 Bacteria 1601
496 Ga0157374_10402242 3300013296 Bacteria 1366
497 Ga0157378_10000433 3300013297 Bacteria 40819
498 Ga0157378_10018216 3300013297 Bacteria 6164
499 Ga0157378_10026213 3300013297 Bacteria 5138
500 Ga0157378_10037138 3300013297 Bacteria 4314
501 Ga0163162_10000523 3300013306 Bacteria 35637
502 Ga0163162_10001473 3300013306 Bacteria 21902
503 Ga0163162_10010532 3300013306 Bacteria 8992
504 Ga0163162_10101430 3300013306 Bacteria 2970
505 Ga0163162_10190517 3300013306 Unclassified 2178
506 Ga0157372_10008964 3300013307 Bacteria 10632
507 Ga0157372_10009357 3300013307 Bacteria 10429
508 Ga0157372_10050473 3300013307 Bacteria 4628
509 Ga0157372_10151249 3300013307 Bacteria 2679
510 Ga0157372_10321529 3300013307 Unclassified 1801
511 Ga0157372_10643624 3300013307 Bacteria 1235
512 Ga0157375_10000096 3300013308 Bacteria 88714
513 Ga0157375_10001100 3300013308 Bacteria 23449
514 Ga0157375_10002834 3300013308 Bacteria 15010
515 Ga0157375_10032745 3300013308 Unclassified 4932
516 Ga0157375_10274087 3300013308 Bacteria 1849
517 Ga0157375_10489292 3300013308 Unclassified 1395
518 Ga0157375_10630701 3300013308 Bacteria 1229
519 Ga0163163_10000519 3300014325 Bacteria 34361
520 Ga0163163_10005836 3300014325 Bacteria 10706
521 Ga0163163_10011623 3300014325 Bacteria 7998
522 Ga0163163_10019966 3300014325 Bacteria 6304
523 Ga0163163_10024867 3300014325 Bacteria 5702
524 Ga0163163_10029198 3300014325 Bacteria 5303
525 Ga0163163_10036959 3300014325 Bacteria 4748
526 Ga0163163_10050921 3300014325 Bacteria 4080
527 Ga0163163_10053175 3300014325 Bacteria 3997
528 Ga0163163_10075777 3300014325 Bacteria 3358
529 Ga0163163_10083082 3300014325 Bacteria 3207
530 Ga0163163_10145301 3300014325 Bacteria 2415
531 Ga0163163_10281701 3300014325 Unclassified 1714
532 Ga0163163_10545038 3300014325 Bacteria 1222
533 Ga0157380_10009740 3300014326 Bacteria 6895
534 Ga0157380_10031353 3300014326 Bacteria 4080
535 Ga0157380_10182923 3300014326 Unclassified 1843
536 Ga0157380_10259762 3300014326 Unclassified 1577
537 Ga0157380_10405032 3300014326 Bacteria 1295
538 Ga0182008_10038596 3300014497 Bacteria 2388
539 Ga0182008_10058613 3300014497 Bacteria 1900
540 Ga0157377_10005753 3300014745 Bacteria 5850
541 Ga0157377_10047133 3300014745 Unclassified 2413
542 Ga0157379_10000048 3300014968 Bacteria 74712
543 Ga0157379_10028278 3300014968 Bacteria 4990
544 Ga0157379_10034446 3300014968 Bacteria 4515
545 Ga0157379_10092480 3300014968 Unclassified 2713
546 Ga0157379_10202954 3300014968 Bacteria 1793
547 Ga0157379_10210969 3300014968 Bacteria 1758
548 Ga0157379_10338164 3300014968 Unclassified 1376
549 Ga0157379_10417020 3300014968 Bacteria 1236
550 Ga0157376_10015271 3300014969 Bacteria 5797
551 Ga0157376_10131823 3300014969 Bacteria 2231
552 Ga0157376_10142625 3300014969 Bacteria 2151
553 Ga0157376_10156728 3300014969 Bacteria 2060
554 Ga0157376_10192888 3300014969 Bacteria 1869
555 Ga0157376_10216788 3300014969 Bacteria 1770
556 Ga0163161_10009974 3300017792 Bacteria 6579
557 Ga0163161_10017593 3300017792 Bacteria 5004
558 Ga0163161_10039091 3300017792 Bacteria 3404
559 Ga0163161_10106956 3300017792 Bacteria 2088
560 Ga0197907_10850651 3300020069 Bacteria 1197
561 Ga0206356_11897132 3300020070 Bacteria 2890
562 Ga0206350_10155620 3300020080 Bacteria 1177
563 Ga0213873_10010289 3300021358 Bacteria 1969
564 Ga0213872_10083289 3300021361 Unclassified 1436
565 Ga0213876_10046150 3300021384 Bacteria 2304
566 Ga0213875_10006251 3300021388 Bacteria 6272
567 Ga0213875_10049184 3300021388 Bacteria 1977
568 Ga0213875_10059169 3300021388 Unclassified 1793
569 Ga0224712_10042923 3300022467 Bacteria 1716
570 Ga0224712_10126744 3300022467 Bacteria 1111
571 Ga0207697_10039759 3300025315 Bacteria 1930
572 Ga0207656_10055051 3300025321 Bacteria 1731
573 Ga0207682_10000836 3300025893 Bacteria 14232
574 Ga0207682_10004927 3300025893 Bacteria 5490
575 Ga0207682_10015461 3300025893 Bacteria 2970
576 Ga0207682_10036173 3300025893 Bacteria 1997
577 Ga0207692_10076430 3300025898 Bacteria 1779
578 Ga0207642_10037706 3300025899 Bacteria 2085
579 Ga0207642_10217829 3300025899 Unclassified 1065
580 Ga0207688_10000186 3300025901 Bacteria 27430
581 Ga0207688_10020244 3300025901 Bacteria 3632
582 Ga0207688_10159776 3300025901 Bacteria 1335
583 Ga0207680_10023341 3300025903 Bacteria 3376
584 Ga0207680_10121120 3300025903 Bacteria 1711
585 Ga0207647_10049677 3300025904 Bacteria 2601
586 Ga0207645_10001480 3300025907 Bacteria 19207
587 Ga0207645_10028334 3300025907 Bacteria 3616
588 Ga0207645_10080038 3300025907 Bacteria 2094
589 Ga0207645_10127347 3300025907 Unclassified 1656
590 Ga0207643_10000951 3300025908 Bacteria 17361
591 Ga0207643_10001949 3300025908 Bacteria 11409
592 Ga0207643_10010366 3300025908 Bacteria 5018
593 Ga0207705_10115587 3300025909 Bacteria 1986
594 Ga0207705_10312776 3300025909 Bacteria 1206
595 Ga0207654_10016475 3300025911 Plasmid 3849
596 Ga0207654_10081629 3300025911 Bacteria 1947
597 Ga0207707_10000565 3300025912 Bacteria 37586
598 Ga0207707_10001148 3300025912 Bacteria 25091
599 Ga0207707_10008127 3300025912 Bacteria 9110
600 Ga0207707_10008357 3300025912 Bacteria 8980
601 Ga0207707_10008871 3300025912 Bacteria 8732
602 Ga0207707_10112729 3300025912 Bacteria 2377
603 Ga0207707_10163477 3300025912 Bacteria 1946
604 Ga0207695_10001854 3300025913 Bacteria 33123
605 Ga0207695_10004549 3300025913 Bacteria 18867
606 Ga0207695_10031205 3300025913 Bacteria 5850
607 Ga0207695_10047903 3300025913 Bacteria 4518
608 Ga0207695_10067034 3300025913 Bacteria 3683
609 Ga0207695_10084497 3300025913 Bacteria 3205
610 Ga0207695_10491629 3300025913 Bacteria 1109
611 Ga0207671_10078097 3300025914 Bacteria 2479
612 Ga0207671_10200627 3300025914 Bacteria 1558
613 Ga0207671_10235597 3300025914 Bacteria 1437
614 Ga0207693_10002478 3300025915 Bacteria 16048
615 Ga0207693_10058496 3300025915 Bacteria 3019
616 Ga0207693_10149479 3300025915 Unclassified 1837
617 Ga0207663_10227981 3300025916 Bacteria 1359
618 Ga0207660_10009726 3300025917 Bacteria 6223
619 Ga0207660_10018474 3300025917 Bacteria 4648
620 Ga0207660_10036917 3300025917 Bacteria 3400
621 Ga0207662_10007393 3300025918 Bacteria 5980
622 Ga0207662_10067296 3300025918 Bacteria 2160
623 Ga0207662_10122402 3300025918 Bacteria 1633
624 Ga0207657_10074316 3300025919 Bacteria 2871
625 Ga0207657_10124458 3300025919 Unclassified 2118
626 Ga0207649_10100403 3300025920 Bacteria 1914
627 Ga0207649_10130722 3300025920 Bacteria 1705
628 Ga0207649_10266490 3300025920 Bacteria 1240
629 Ga0207652_10002881 3300025921 Bacteria 14381
630 Ga0207652_10003929 3300025921 Bacteria 12155
631 Ga0207652_10114221 3300025921 Bacteria 2397
632 Ga0207652_10173941 3300025921 Bacteria 1933
633 Ga0207652_10199713 3300025921 Bacteria 1800
634 Ga0207652_10263411 3300025921 Bacteria 1555
635 Ga0207646_10001462 3300025922 Bacteria 29242
636 Ga0207681_10037459 3300025923 Bacteria 3206
637 Ga0207681_10058154 3300025923 Bacteria 2646
638 Ga0207681_10308466 3300025923 Bacteria 1254
639 Ga0207694_10000738 3300025924 Bacteria 29385
640 Ga0207694_10003104 3300025924 Bacteria 13290
641 Ga0207694_10025390 3300025924 Bacteria 4504
642 Ga0207694_10034277 3300025924 Bacteria 3892
643 Ga0207694_10067555 3300025924 Bacteria 2790
644 Ga0207694_10117646 3300025924 Bacteria 2119
645 Ga0207694_10143418 3300025924 Bacteria 1921
646 Ga0207650_10000510 3300025925 Bacteria 32441
647 Ga0207650_10006456 3300025925 Bacteria 7987
648 Ga0207650_10048603 3300025925 Bacteria 3129
649 Ga0207659_10000797 3300025926 Bacteria 18647
650 Ga0207659_10008431 3300025926 Bacteria 6398
651 Ga0207659_10019281 3300025926 Bacteria 4486
652 Ga0207659_10035142 3300025926 Bacteria 3462
653 Ga0207659_10054824 3300025926 Bacteria 2848
654 Ga0207659_10082916 3300025926 Unclassified 2375
655 Ga0207659_10110241 3300025926 Unclassified 2091
656 Ga0207659_10446663 3300025926 Bacteria 1088
657 Ga0207687_10003947 3300025927 Bacteria 9933
658 Ga0207687_10004393 3300025927 Bacteria 9409
659 Ga0207687_10010486 3300025927 Bacteria 6053
660 Ga0207687_10035423 3300025927 Bacteria 3395
661 Ga0207700_10029586 3300025928 Unclassified 3867
662 Ga0207700_10052950 3300025928 Bacteria 3038
663 Ga0207700_10123810 3300025928 Bacteria 2100
664 Ga0207700_10174898 3300025928 Bacteria 1794
665 Ga0207700_10336643 3300025928 Unclassified 1311
666 Ga0207664_10214974 3300025929 Bacteria 1665
667 Ga0207644_10027675 3300025931 Unclassified 3918
668 Ga0207644_10047399 3300025931 Bacteria 3066
669 Ga0207644_10066118 3300025931 Bacteria 2631
670 Ga0207644_10068049 3300025931 Unclassified 2597
671 Ga0207644_10139841 3300025931 Unclassified 1863
672 Ga0207690_10077757 3300025932 Bacteria 2307
673 Ga0207690_10126248 3300025932 Bacteria 1866
674 Ga0207706_10004052 3300025933 Bacteria 13859
675 Ga0207706_10101855 3300025933 Unclassified 2527
676 Ga0207706_10105691 3300025933 Unclassified 2477
677 Ga0207686_10002608 3300025934 Bacteria 9778
678 Ga0207686_10027803 3300025934 Plasmid 3316
679 Ga0207686_10075955 3300025934 Bacteria 2177
680 Ga0207686_10115462 3300025934 Bacteria 1818
681 Ga0207686_10284969 3300025934 Bacteria 1221
682 Ga0207709_10010381 3300025935 Bacteria 5127
683 Ga0207709_10150281 3300025935 Bacteria 1612
684 Ga0207670_10015421 3300025936 Bacteria 4566
685 Ga0207670_10332910 3300025936 Unclassified 1198
686 Ga0207669_10006302 3300025937 Bacteria 5409
687 Ga0207669_10009677 3300025937 Bacteria 4607
688 Ga0207669_10092463 3300025937 Bacteria 1973
689 Ga0207704_10006585 3300025938 Bacteria 5432
690 Ga0207704_10011867 3300025938 Bacteria 4307
691 Ga0207704_10012447 3300025938 Bacteria 4223
692 Ga0207704_10079710 3300025938 Bacteria 2111
693 Ga0207704_10176114 3300025938 Unclassified 1540
694 Ga0207691_10012333 3300025940 Bacteria 8192
695 Ga0207691_10013158 3300025940 Bacteria 7923
696 Ga0207691_10019418 3300025940 Bacteria 6431
697 Ga0207691_10053281 3300025940 Bacteria 3694
698 Ga0207691_10136640 3300025940 Bacteria 2162
699 Ga0207691_10237820 3300025940 Unclassified 1575
700 Ga0207711_10000641 3300025941 Bacteria 34997
701 Ga0207711_10000804 3300025941 Bacteria 30837
702 Ga0207711_10000883 3300025941 Bacteria 28937
703 Ga0207711_10013257 3300025941 Bacteria 6849
704 Ga0207711_10013402 3300025941 Bacteria 6811
705 Ga0207711_10017416 3300025941 Bacteria 5970
706 Ga0207711_10060014 3300025941 Unclassified 3276
707 Ga0207711_10087121 3300025941 Bacteria 2739
708 Ga0207711_10119103 3300025941 Unclassified 2355
709 Ga0207689_10002411 3300025942 Bacteria 17395
710 Ga0207689_10015797 3300025942 Bacteria 6392
711 Ga0207689_10016668 3300025942 Bacteria 6218
712 Ga0207689_10033221 3300025942 Bacteria 4287
713 Ga0207689_10247746 3300025942 Bacteria 1473
714 Ga0207689_10360542 3300025942 Bacteria 1209
715 Ga0207661_10002990 3300025944 Bacteria 11693
716 Ga0207661_10007186 3300025944 Bacteria 7912
717 Ga0207661_10013583 3300025944 Bacteria 5947
718 Ga0207661_10017976 3300025944 Bacteria 5247
719 Ga0207661_10096187 3300025944 Bacteria 2477
720 Ga0207661_10118433 3300025944 Bacteria 2251
721 Ga0207661_10141359 3300025944 Bacteria 2072
722 Ga0207679_10004577 3300025945 Bacteria 8614
723 Ga0207679_10013618 3300025945 Bacteria 5332
724 Ga0207679_10025369 3300025945 Bacteria 4075
725 Ga0207679_10126137 3300025945 Bacteria 2046
726 Ga0207667_10000636 3300025949 Bacteria 45432
727 Ga0207667_10001683 3300025949 Bacteria 27858
728 Ga0207667_10005002 3300025949 Bacteria 16196
729 Ga0207667_10005718 3300025949 Bacteria 15167
730 Ga0207667_10027397 3300025949 Bacteria 6203
731 Ga0207667_10139209 3300025949 Bacteria 2499
732 Ga0207667_10463835 3300025949 Bacteria 1286
733 Ga0207651_10009725 3300025960 Bacteria 5285
734 Ga0207651_10021241 3300025960 Bacteria 3940
735 Ga0207651_10026193 3300025960 Bacteria 3638
736 Ga0207712_10017934 3300025961 Bacteria 4607
737 Ga0207712_10033299 3300025961 Bacteria 3483
738 Ga0207712_10042765 3300025961 Bacteria 3123
739 Ga0207668_10100612 3300025972 Bacteria 2147
740 Ga0207640_10055008 3300025981 Bacteria 2604
741 Ga0207658_10015567 3300025986 Bacteria 5218
742 Ga0207658_10020306 3300025986 Unclassified 4600
743 Ga0207658_10042015 3300025986 Bacteria 3314
744 Ga0207658_10172427 3300025986 Bacteria 1783
745 Ga0207677_10027359 3300026023 Bacteria 3590
746 Ga0207677_10046628 3300026023 Unclassified 2903
747 Ga0207677_10053414 3300026023 Bacteria 2750
748 Ga0207677_10219672 3300026023 Bacteria 1523
749 Ga0207703_10009226 3300026035 Bacteria 7758
750 Ga0207703_10014205 3300026035 Bacteria 6210
751 Ga0207703_10026582 3300026035 Bacteria 4556
752 Ga0207703_10061983 3300026035 Bacteria 3063
753 Ga0207703_10102676 3300026035 Bacteria 2426
754 Ga0207703_10104988 3300026035 Bacteria 2401
755 Ga0207703_10122406 3300026035 Bacteria 2235
756 Ga0207703_10196686 3300026035 Unclassified 1789
757 Ga0207703_10310306 3300026035 Unclassified 1442
758 Ga0207703_10402314 3300026035 Bacteria 1271
759 Ga0207703_10423033 3300026035 Bacteria 1240
760 Ga0207639_10064912 3300026041 Bacteria 2832
761 Ga0207639_10064932 3300026041 Bacteria 2832
762 Ga0207639_10278501 3300026041 Bacteria 1470
763 Ga0207678_10032096 3300026067 Bacteria 4578
764 Ga0207678_10056416 3300026067 Unclassified 3381
765 Ga0207678_10281630 3300026067 Bacteria 1427
766 Ga0207708_10020707 3300026075 Bacteria 4961
767 Ga0207708_10041022 3300026075 Bacteria 3530
768 Ga0207702_10009053 3300026078 Bacteria 8380
769 Ga0207702_10021939 3300026078 Bacteria 5289
770 Ga0207702_10029649 3300026078 Bacteria 4554
771 Ga0207702_10084483 3300026078 Bacteria 2764
772 Ga0207702_10109864 3300026078 Bacteria 2449
773 Ga0207702_10175373 3300026078 Unclassified 1969
774 Ga0207641_10002077 3300026088 Bacteria 18985
775 Ga0207641_10014597 3300026088 Bacteria 6440
776 Ga0207641_10034849 3300026088 Unclassified 4189
777 Ga0207641_10036386 3300026088 Bacteria 4109
778 Ga0207641_10177398 3300026088 Bacteria 1949
779 Ga0207641_10186174 3300026088 Bacteria 1905
780 Ga0207641_10197671 3300026088 Bacteria 1852
781 Ga0207648_10006827 3300026089 Bacteria 11308
782 Ga0207648_10006985 3300026089 Bacteria 11164
783 Ga0207648_10013242 3300026089 Bacteria 7683
784 Ga0207648_10071445 3300026089 Unclassified 3025
785 Ga0207648_10210077 3300026089 Bacteria 1727
786 Ga0207648_10220578 3300026089 Bacteria 1685
787 Ga0207676_10010042 3300026095 Bacteria 6734
788 Ga0207676_10473124 3300026095 Unclassified 1185
789 Ga0207676_10476901 3300026095 Bacteria 1181
790 Ga0207674_10000166 3300026116 Bacteria 79149
791 Ga0207674_10003310 3300026116 Bacteria 19811
792 Ga0207674_10004029 3300026116 Bacteria 17829
793 Ga0207674_10026232 3300026116 Bacteria 6195
794 Ga0207674_10091119 3300026116 Bacteria 3039
795 Ga0207674_10101423 3300026116 Bacteria 2859
796 Ga0207674_10146177 3300026116 Unclassified 2323
797 Ga0207674_10181479 3300026116 Bacteria 2056
798 Ga0207674_10249624 3300026116 Bacteria 1721
799 Ga0207675_100004439 3300026118 Bacteria 13560
800 Ga0207675_100008362 3300026118 Bacteria 9752
801 Ga0207675_100116686 3300026118 Bacteria 2523
802 Ga0207675_100146237 3300026118 Unclassified 2247
803 Ga0207675_100400906 3300026118 Unclassified 1352
804 Ga0207683_10047440 3300026121 Bacteria 3762
805 Ga0207683_10057250 3300026121 Bacteria 3422
806 Ga0207683_10091143 3300026121 Bacteria 2715
807 Ga0207683_10106952 3300026121 Bacteria 2502
808 Ga0207683_10112561 3300026121 Bacteria 2437
809 Ga0207683_10353071 3300026121 Unclassified 1350
810 Ga0207698_10011187 3300026142 Bacteria 5806
811 Ga0207698_10098854 3300026142 Bacteria 2412
812 Ga0207698_10191770 3300026142 Bacteria 1821
813 Ga0207698_10203476 3300026142 Bacteria 1775
814 Ga0207698_10408586 3300026142 Bacteria 1299
815 Ga0207428_10000144 3300027907 Bacteria 96684
816 Ga0207428_10000643 3300027907 Bacteria 41046
817 Ga0207428_10005048 3300027907 Bacteria 12399
818 Ga0207428_10019680 3300027907 Bacteria 5753
819 Ga0207428_10067349 3300027907 Unclassified 2819
820 Ga0207428_10076601 3300027907 Bacteria 2619
821 Ga0207428_10079218 3300027907 Bacteria 2569
822 Ga0268266_10058015 3300028379 Bacteria 3333
823 Ga0268266_10159670 3300028379 Bacteria 2038
824 Ga0268266_10355052 3300028379 Unclassified 1378
825 Ga0268265_10005432 3300028380 Bacteria 8715
826 Ga0268265_10012385 3300028380 Bacteria 5780
827 Ga0268265_10103021 3300028380 Bacteria 2310
828 Ga0268264_10006882 3300028381 Bacteria 9541
829 Ga0268264_10017518 3300028381 Bacteria 5867
830 Ga0268264_10020797 3300028381 Bacteria 5363
831 Ga0268264_10026845 3300028381 Bacteria 4705
832 Ga0268264_10037903 3300028381 Bacteria 3976
833 Ga0268264_10275649 3300028381 Bacteria 1573
834 Ga0265338_10019045 3300028800 Bacteria 7310
835 Ga0265338_10056036 3300028800 Bacteria 3501
836 Ga0265332_10022094 3300031238 Bacteria 2808
837 Ga0265325_10001345 3300031241 Bacteria 17418
838 Ga0265340_10067748 3300031247 Bacteria 1696
839 Ga0265327_10042200 3300031251 Bacteria 2451
840 Ga0307408_100004306 3300031548 Bacteria 9661
841 Ga0265313_10003580 3300031595 Bacteria 12495
842 Ga0265313_10005853 3300031595 Bacteria 8920
843 Ga0265314_10000282 3300031711 Bacteria 73865
844 Ga0265314_10005473 3300031711 Bacteria 11450
845 Ga0307405_10004173 3300031731 Bacteria 6797
846 Ga0307410_10004522 3300031852 Bacteria 7205
847 Ga0307407_10038224 3300031903 Unclassified 2658
848 Ga0307412_10033419 3300031911 Bacteria 3269
849 Ga0307416_100005845 3300032002 Bacteria 7630
850 Ga0307416_100281571 3300032002 Bacteria 1640
851 Ga0307414_10001278 3300032004 Bacteria 12989
852 Ga0307411_10043665 3300032005 Unclassified 2869
853 Ga0373934_0003589 3300035086 Bacteria 5705
854 Ga0373934_0015265 3300035086 Bacteria 2913
855 Ga0373934_0024847 3300035086 Bacteria 2318
856 Ga0373952_0005495 3300035092 Bacteria 2318
857 Ga0373923_0036905 3300035111 Bacteria 1997
858 Ga0373923_0105874 3300035111 Unclassified 1244
859 Ga0373936_0069032 3300035113 Bacteria 1454
860 Ga0373936_0120286 3300035113 Unclassified 1121
861 Ga0373941_0011829 3300035115 Bacteria 2266
862 Ga0373945_0015626 3300035116 Bacteria 2556
863 Ga0373945_0020436 3300035116 Bacteria 2266
864 Ga0373954_0004540 3300035118 Bacteria 5977
865 Ga0373954_0012448 3300035118 Bacteria 3782
866 Ga0373954_0013095 3300035118 Bacteria 3693
867 Ga0373956_0053978 3300035119 Bacteria 1810
868 Ga0373946_0050300 3300035171 Bacteria 1741
869 Ga0373946_0081907 3300035171 Bacteria 1414
870 Ga0373955_0022908 3300035172 Unclassified 3175
871 Ga0373955_0024402 3300035172 Bacteria 3093
872 Ga0373955_0037499 3300035172 Unclassified 2577
873 Ga0373955_0055064 3300035172 Bacteria 2177
874 Ga0373955_0066247 3300035172 Unclassified 2007
875 Ga0373955_0086923 3300035172 Bacteria 1776
876 Ga0373955_0090386 3300035172 Bacteria 1744
877 Ga0373955_0174685 3300035172 Bacteria 1273
878 Ga0373924_0003596 3300035410 Bacteria 5345
879 Ga0373931_0002400 3300035691 Bacteria 8293
880 Ga0373931_0013157 3300035691 Bacteria 4025
881 Ga0373931_0022597 3300035691 Bacteria 3167
882 Ga0373935_0012614 3300035692 Bacteria 5084
883 Ga0373935_0132807 3300035692 Bacteria 1674
884 Ga0373935_0161721 3300035692 Bacteria 1526
885 Ga0373927_0011148 3300035695 Bacteria 5988
886 Ga0373927_0062708 3300035695 Bacteria 2404
887 Ga0373927_0090628 3300035695 Bacteria 1986
888 Ga0373933_0002707 3300035724 Bacteria 9919
889 Ga0373933_0006335 3300035724 Bacteria 6439
890 Ga0373933_0016000 3300035724 Bacteria 4189
891 Ga0373933_0038756 3300035724 Bacteria 2801
892 Ga0373933_0046795 3300035724 Bacteria 2570
893 Ga0373933_0049454 3300035724 Bacteria 2507
894 Ga0373947_0238739 3300035725 Bacteria 1199
895 Ga0373937_0000238 3300036401 Bacteria 53880
896 Ga0373937_0000744 3300036401 Bacteria 28108
897 Ga0373937_0000994 3300036401 Bacteria 24079
898 Ga0373937_0007751 3300036401 Bacteria 9308
899 Ga0373937_0013713 3300036401 Bacteria 7141
900 Ga0373937_0015199 3300036401 Bacteria 6803
901 Ga0373937_0019061 3300036401 Bacteria 6139
902 Ga0373937_0019271 3300036401 Bacteria 6106
903 Ga0373937_0021816 3300036401 Bacteria 5749
904 Ga0373937_0031015 3300036401 Bacteria 4841
905 Ga0373937_0035309 3300036401 Bacteria 4550
906 Ga0373937_0099881 3300036401 Bacteria 2692
907 Ga0373937_0228427 3300036401 Bacteria 1752
908 Ga0373937_0277680 3300036401 Bacteria 1582
909 Ga0373937_0340528 3300036401 Bacteria 1420
910 Ga0373925_0035321 3300037068 Unclassified 3687
911 Ga0373925_0078134 3300037068 Unclassified 2513
912 Ga0373925_0089525 3300037068 Bacteria 2351
913 Ga0373925_0107792 3300037068 Unclassified 2149
914 Ga0373925_0286724 3300037068 Bacteria 1327
915 Ga0395899_0023273 3300037312 Bacteria 4694
916 Ga0395900_0327319 3300037418 Bacteria 1511
917 Ga0395900_0414458 3300037418 Bacteria 1309
918 Ga0395905_0307899 3300037471 Bacteria 1472
919 Ga0436364_0112721 3300037853 Bacteria 14300
920 Ga0436364_0249501 3300037853 Unclassified 3406
921 Ga0436365_0017926 3300039437 Bacteria 5872
922 Ga0436365_0568945 3300039437 Bacteria 3327
923 Ga0436365_0801801 3300039437 Bacteria 4255
924 Ga0436365_1426598 3300039437 Bacteria 4746
925 Ga0436365_1432540 3300039437 Bacteria 4156
926 Ga0436365_1776714 3300039437 Bacteria 1301
927 Ga0436361_0232929 3300039447 Bacteria 1330
928 Ga0436361_0539861 3300039447 Bacteria 2222
929 Ga0436361_0909974 3300039447 Bacteria 2622
930 Ga0436361_1062872 3300039447 Bacteria 3427
931 Ga0436362_0945639 3300039453 Unclassified 3969
932 Ga0439453_0017209 3300041408 Unclassified 1267
933 Ga0451853_2651878 3300041512 Bacteria 1208
934 Ga0439435_0001937 3300042436 Bacteria 3979
935 Ga0451577_0378157 3300042876 Bacteria 1285
936 Ga0466969_0056832 3300044656 Bacteria 1909
937 Ga0466969_0085459 3300044656 Bacteria 1500
938 Ga0466977_0000756 3300044666 Bacteria 11706
939 Ga0466966_0020782 3300044684 Bacteria 4315
940 Ga0466971_0038928 3300044719 Bacteria 2134
941 Ga0466959_0319402 3300045049 Bacteria 1062
942 Ga0466958_0023945 3300045836 Bacteria 3590
943 Ga0466967_0052631 3300045976 Bacteria 3575
944 Ga0466967_0199837 3300045976 Bacteria 1893
945 Ga0466967_0360972 3300045976 Bacteria 1408
946 Ga0495592_0006726 3300046454 Bacteria 8577
947 Ga0495592_0070841 3300046454 Bacteria 2539
948 Ga0495592_0077669 3300046454 Bacteria 2406
949 Ga0495603_0011113 3300046455 Bacteria 5458
950 Ga0495638_0083735 3300046460 Unclassified 1931
951 Ga0495641_0009978 3300046461 Bacteria 5576
952 Ga0495651_0115472 3300046462 Unclassified 1979
953 Ga0495651_0335036 3300046462 Bacteria 1004
954 Ga0495580_0018560 3300046472 Bacteria 5177
955 Ga0495580_0046636 3300046472 Unclassified 3074
956 Ga0495580_0154508 3300046472 Bacteria 1589
957 Ga0495580_0247342 3300046472 Bacteria 1221
958 Ga0495580_0289280 3300046472 Unclassified 1117
959 Ga0495582_0000742 3300046473 Bacteria 18034
960 Ga0495582_0016027 3300046473 Bacteria 4109
961 Ga0495582_0127094 3300046473 Bacteria 1439
962 Ga0495605_0000116 3300046474 Bacteria 103357
963 Ga0495639_0015091 3300046475 Bacteria 3350
964 Ga0495662_0020144 3300046476 Bacteria 3227
965 Ga0495584_0034106 3300046491 Unclassified 2575
966 Ga0495585_0014925 3300046492 Bacteria 4518
967 Ga0495585_0040936 3300046492 Bacteria 2600
968 Ga0495585_0078024 3300046492 Bacteria 1797
969 Ga0495594_0078587 3300046499 Bacteria 1841
970 Ga0495594_0082134 3300046499 Unclassified 1800
971 Ga0495596_0000078 3300046500 Bacteria 67709
972 Ga0495607_0000057 3300046501 Bacteria 110023
973 Ga0495607_0021836 3300046501 Bacteria 4025
974 Ga0495607_0062293 3300046501 Bacteria 2115
975 Ga0495608_0009055 3300046511 Bacteria 6963
976 Ga0495608_0021672 3300046511 Bacteria 4410
977 Ga0495616_0034297 3300046513 Bacteria 2636
978 Ga0495616_0062383 3300046513 Bacteria 1825
979 Ga0495618_0217909 3300046514 Unclassified 1205
980 Ga0495628_0072665 3300046516 Bacteria 2680
981 Ga0495628_0323700 3300046516 Bacteria 1137
982 Ga0495630_0039488 3300046517 Bacteria 3528
983 Ga0495632_0002942 3300046519 Bacteria 12500
984 Ga0495632_0016297 3300046519 Bacteria 4139
985 Ga0495637_0055645 3300046520 Bacteria 1640
986 Ga0495643_0000347 3300046522 Bacteria 62970
987 Ga0495643_0009518 3300046522 Bacteria 6036
988 Ga0495643_0012675 3300046522 Bacteria 5077
989 Ga0495643_0033848 3300046522 Bacteria 2823
990 Ga0495644_0003021 3300046523 Bacteria 6661
991 Ga0495642_0001005 3300046528 Bacteria 13089
992 Ga0495642_0015247 3300046528 Bacteria 2984
993 Ga0495652_0018819 3300046529 Bacteria 6155
994 Ga0495652_0064227 3300046529 Unclassified 3088
995 Ga0495652_0067287 3300046529 Bacteria 3004
996 Ga0495652_0359748 3300046529 Bacteria 1040
997 Ga0495665_0042159 3300046531 Bacteria 2430
998 Ga0495640_0083054 3300046533 Unclassified 2126
999 Ga0495587_0000558 3300046536 Bacteria 25658
1000 Ga0495587_0001220 3300046536 Bacteria 17012
1001 Ga0495587_0004299 3300046536 Bacteria 9405
1002 Ga0495587_0028966 3300046536 Bacteria 3364
1003 Ga0495587_0071106 3300046536 Bacteria 2024
1004 Ga0495621_0080601 3300046539 Bacteria 1213
1005 Ga0495621_0096439 3300046539 Unclassified 1121
1006 Ga0495645_0007662 3300046543 Bacteria 7509
1007 Ga0495645_0045560 3300046543 Bacteria 3200
1008 Ga0495645_0267122 3300046543 Bacteria 1130
1009 Ga0495633_0004527 3300046558 Bacteria 8787
1010 Ga0495667_0001591 3300046559 Bacteria 15043
1011 Ga0495667_0040259 3300046559 Bacteria 3104
1012 Ga0495667_0049036 3300046559 Bacteria 2788
1013 Ga0495656_0012822 3300046615 Bacteria 3104
1014 Ga0495656_0039230 3300046615 Unclassified 1966
1015 Ga0495668_0002736 3300046616 Bacteria 14123
1016 Ga0495634_0024844 3300046642 Bacteria 4200
1017 Ga0495634_0083618 3300046642 Bacteria 2083
1018 Ga0495611_0124750 3300046648 Bacteria 1201
1019 Ga0495625_0000014 3300046660 Bacteria 323486
1020 Ga0495659_0014646 3300046664 Bacteria 2570
1021 Ga0495661_0000221 3300046665 Bacteria 65361
1022 Ga0495661_0012090 3300046665 Bacteria 5837
1023 Ga0495661_0165978 3300046665 Bacteria 1181
1024 Ga0495588_0039789 3300046674 Bacteria 2396
1025 Ga0495657_0001304 3300046675 Bacteria 21715
1026 Ga0495599_0006862 3300046678 Bacteria 6885
1027 Ga0495599_0065895 3300046678 Bacteria 2263
1028 Ga0495623_0048616 3300046679 Unclassified 2690
1029 Ga0495623_0100504 3300046679 Bacteria 1762
1030 Ga0495623_0123540 3300046679 Bacteria 1556
1031 Ga0495646_0068769 3300046680 Unclassified 2090
1032 Ga0495646_0095465 3300046680 Unclassified 1711
1033 Ga0495658_0009083 3300046683 Bacteria 4943
1034 Ga0495658_0011647 3300046683 Unclassified 4431
1035 Ga0495658_0015511 3300046683 Bacteria 3910
1036 Ga0495658_0084179 3300046683 Unclassified 1872
1037 Ga0495669_0001150 3300046684 Bacteria 10977
1038 Ga0495669_0005036 3300046684 Bacteria 5494
1039 Ga0495613_0000428 3300046689 Bacteria 35924
1040 Ga0495613_0013455 3300046689 Bacteria 6077
1041 Ga0495613_0047679 3300046689 Bacteria 3165
1042 Ga0495613_0094297 3300046689 Unclassified 2166
1043 Ga0495613_0164428 3300046689 Bacteria 1577
1044 Ga0495613_0178618 3300046689 Unclassified 1504
1045 Ga0495670_0014695 3300046691 Bacteria 3851
1046 Ga0495670_0042086 3300046691 Bacteria 2279
1047 Ga0495649_0000205 3300046694 Bacteria 52102
1048 Ga0495649_0025062 3300046694 Bacteria 3323
1049 Ga0495589_0000022 3300046794 Bacteria 196021
1050 Ga0495660_0000044 3300046810 Bacteria 150926
1051 Ga0495581_0030525 3300047315 Bacteria 3123
1052 Ga0495604_0087995 3300047317 Unclassified 2312
1053 Ga0495604_0095535 3300047317 Unclassified 2195
1054 Ga0495604_0105351 3300047317 Bacteria 2064
1055 Ga0495604_0205571 3300047317 Unclassified 1363
1056 Ga0495636_0017297 3300047318 Bacteria 2886
1057 Ga0495636_0119296 3300047318 Unclassified 1166
1058 Ga0495674_0057298 3300047319 Bacteria 3410
1059 Ga0495674_0088288 3300047319 Bacteria 2652
1060 Ga0495674_0172345 3300047319 Bacteria 1805
1061 Ga0495674_0242839 3300047319 Bacteria 1484
1062 Ga0495672_0005576 3300047320 Bacteria 9950
1063 Ga0495672_0026596 3300047320 Bacteria 3690
1064 Ga0495672_0097613 3300047320 Bacteria 1600
1065 Ga0495680_0169769 3300047322 Bacteria 1580
1066 Ga0495687_000099 3300047443 Bacteria 132139
1067 Ga0495675_0001554 3300047444 Bacteria 13851
1068 Ga0495677_0000419 3300047445 Bacteria 18284
1069 Ga0495677_0004940 3300047445 Bacteria 5084
1070 Ga0495684_0000117 3300047471 Bacteria 57879
1071 Ga0495684_0008684 3300047471 Bacteria 7858
1072 Ga0495684_0042205 3300047471 Bacteria 3494
1073 Ga0495684_0114162 3300047471 Bacteria 2036
1074 Ga0495684_0149120 3300047471 Bacteria 1749
1075 Ga0495684_0310983 3300047471 Bacteria 1129
1076 Ga0495602_0000454 3300048088 Bacteria 38246
1077 Ga0495602_0000669 3300048088 Bacteria 32135
1078 Ga0495602_0004373 3300048088 Bacteria 14738
1079 Ga0495602_0144256 3300048088 Bacteria 1881
1080 Ga0495602_0188091 3300048088 Bacteria 1586
1081 Ga0495602_0248140 3300048088 Bacteria 1328
1082 Ga0495602_0389834 3300048088 Unclassified 996
1083 Ga0495626_0000021 3300048091 Bacteria 217213
1084 Ga0496100_0070591 3300048903 Bacteria 2329
1085 Ga0496100_0086867 3300048903 Unclassified 2125
1086 Ga0496100_0091451 3300048903 Bacteria 2077
1087 Ga0496100_0092390 3300048903 Bacteria 2068
1088 Ga0496101_0018442 3300048904 Bacteria 4745
1089 Ga0496101_0074533 3300048904 Unclassified 2496
1090 Ga0496101_0109219 3300048904 Unclassified 2081
1091 Ga0496101_0149827 3300048904 Bacteria 1784
1092 Ga0496102_0013554 3300048905 Bacteria 7065
1093 Ga0496102_0082749 3300048905 Bacteria 2960
1094 Ga0496102_0114287 3300048905 Bacteria 2518
1095 Ga0496103_0005396 3300048906 Bacteria 7654
1096 Ga0496103_0047269 3300048906 Unclassified 2659
1097 Ga0496103_0100911 3300048906 Bacteria 1826
1098 Ga0496104_0000406 3300048907 Bacteria 37705
1099 Ga0496104_0009455 3300048907 Bacteria 8672
1100 Ga0496104_0027628 3300048907 Bacteria 5253
1101 Ga0496104_0036142 3300048907 Bacteria 4616
1102 Ga0496104_0113400 3300048907 Bacteria 2599
1103 Ga0496104_0115802 3300048907 Bacteria 2572
1104 Ga0496104_0368957 3300048907 Unclassified 1348
1105 Ga0496105_0002573 3300048908 Bacteria 13183
1106 Ga0496105_0002868 3300048908 Bacteria 12630
1107 Ga0496105_0017770 3300048908 Bacteria 5705
1108 Ga0496105_0034460 3300048908 Bacteria 4164
1109 Ga0496105_0053149 3300048908 Bacteria 3345
1110 Ga0496106_0031605 3300048909 Bacteria 3945
1111 Ga0496106_0085382 3300048909 Bacteria 2430
1112 Ga0496106_0225318 3300048909 Bacteria 1496
1113 Ga0496106_0245160 3300048909 Bacteria 1432
1114 Ga0496107_0020257 3300048910 Bacteria 4695
1115 Ga0496107_0068933 3300048910 Bacteria 2566
1116 Ga0496108_0003849 3300048911 Bacteria 12043
1117 Ga0496108_0027901 3300048911 Bacteria 4667
1118 Ga0496108_0102265 3300048911 Unclassified 2445
1119 Ga0496108_0216034 3300048911 Bacteria 1665
1120 Ga0496108_0293763 3300048911 Bacteria 1415
1121 Ga0496109_0032041 3300048912 Bacteria 4722
1122 Ga0496109_0032874 3300048912 Plasmid 4666
1123 Ga0496109_0048858 3300048912 Bacteria 3849
1124 Ga0496109_0130752 3300048912 Bacteria 2343
1125 Ga0496109_0147574 3300048912 Bacteria 2201
1126 Ga0496109_0476035 3300048912 Bacteria 1179
1127 Ga0496110_0015183 3300048913 Bacteria 6406
1128 Ga0496110_0017621 3300048913 Bacteria 5970
1129 Ga0496110_0200228 3300048913 Unclassified 1814
1130 Ga0496111_0051025 3300048914 Bacteria 2986
1131 Ga0496112_0002042 3300048915 Bacteria 15992
1132 Ga0496112_0015636 3300048915 Bacteria 7088
1133 Ga0496112_0036338 3300048915 Bacteria 4805
1134 Ga0496112_0083923 3300048915 Bacteria 3151
1135 Ga0496112_0145766 3300048915 Unclassified 2336
1136 Ga0496112_0303488 3300048915 Bacteria 1542
1137 Ga0496113_0011578 3300048916 Bacteria 5893
1138 Ga0496113_0059654 3300048916 Bacteria 2874
1139 Ga0496114_0028747 3300048917 Bacteria 4564
1140 Ga0496114_0028999 3300048917 Bacteria 4546
1141 Ga0496114_0066980 3300048917 Plasmid 3011
1142 Ga0496114_0463203 3300048917 Bacteria 1122
1143 Ga0496115_0005401 3300048918 Bacteria 9292
1144 Ga0496115_0012759 3300048918 Bacteria 6334
1145 Ga0496115_0058850 3300048918 Bacteria 3093
1146 Ga0496115_0065587 3300048918 Bacteria 2933
1147 Ga0496115_0149452 3300048918 Unclassified 1928
1148 Ga0496115_0261719 3300048918 Bacteria 1422
1149 Ga0496121_0355228 3300048924 Bacteria 975
1150 Ga0496126_0091329 3300048929 Bacteria 2678
1151 Ga0501298_010232 3300049521 Unclassified 1610
1152 Ga0501034_0005118 3300049571 Bacteria 14384
1153 Ga0501034_0019520 3300049571 Bacteria 6932
1154 Ga0501034_0020632 3300049571 Bacteria 6730
1155 Ga0501034_0091869 3300049571 Bacteria 3033
1156 Ga0501036_0262139 3300049572 Bacteria 1448
1157 Ga0501041_0081607 3300049577 Bacteria 1991
1158 Ga0501042_0014192 3300049578 Bacteria 5434
1159 Ga0501043_0324623 3300049579 Bacteria 1173
1160 Ga0501046_0063906 3300049580 Bacteria 2874
1161 Ga0501046_0355800 3300049580 Bacteria 1062
1162 Ga0501047_0066421 3300049581 Bacteria 3477
1163 Ga0501047_0135420 3300049581 Bacteria 2344
1164 Ga0501047_0273771 3300049581 Bacteria 1534
1165 Ga0501068_0133883 3300049584 Bacteria 1551
1166 Ga0501069_0096551 3300049585 Bacteria 1675
1167 Ga0501070_0043503 3300049586 Unclassified 3737
1168 Ga0501070_0055626 3300049586 Bacteria 3280
1169 Ga0501070_0064543 3300049586 Bacteria 3032
1170 Ga0501070_0088970 3300049586 Bacteria 2556
1171 Ga0501070_0213533 3300049586 Bacteria 1583
1172 Ga0501071_0033438 3300049587 Bacteria 3654
1173 Ga0501072_0063265 3300049588 Bacteria 2919
1174 Ga0501072_0403707 3300049588 Bacteria 1084
1175 Ga0501074_0126106 3300049590 Bacteria 1831
1176 Ga0501075_0060558 3300049591 Bacteria 2852
1177 Ga0501075_0068460 3300049591 Bacteria 2682
1178 Ga0501075_0163699 3300049591 Unclassified 1697
1179 Ga0501076_0028885 3300049592 Bacteria 4310
1180 Ga0501079_0025243 3300049741 Bacteria 4559
1181 Ga0501079_0315507 3300049741 Unclassified 1224
1182 Ga0501080_0063543 3300049742 Bacteria 3436
1183 Ga0501080_0180770 3300049742 Unclassified 1941
1184 Ga0501081_0070318 3300049743 Bacteria 2439
1185 Ga0501272_001824 3300049769 Bacteria 2073
1186 Ga0501283_001260 3300049779 Bacteria 3343
1187 Ga0501045_0060947 3300049824 Bacteria 2767
1188 nmdc:mga03n38_7494_c1 3300050490 Bacteria 3864
1189 nmdc:mga0yw44_153427_c1 3300050492 Bacteria 1504
1190 nmdc:mga0yw44_2164_c1 3300050492 Bacteria 8247
1191 nmdc:mga0yw44_55158_c1 3300050492 Bacteria 2417
1192 nmdc:mga06z11_1143_c1 3300050494 Bacteria 7945
1193 nmdc:mga06z11_118152_c1 3300050494 Bacteria 1476
1194 nmdc:mga06z11_211721_c1 3300050494 Bacteria 1130
1195 nmdc:mga06z11_22438_c1 3300050494 Bacteria 2948
1196 nmdc:mga06z11_54001_c1 3300050494 Bacteria 2069
1197 nmdc:mga07m45_44184_c1 3300050496 Bacteria 2499
1198 nmdc:mga05p37_11743_c1 3300050507 Bacteria 10441
1199 nmdc:mga05p37_16523_c1 3300050507 Bacteria 8891
1200 nmdc:mga05p37_216107_c1 3300050507 Unclassified 2316
1201 nmdc:mga05p37_259281_c1 3300050507 Bacteria 2081
1202 nmdc:mga05p37_28051_c1 3300050507 Bacteria 6860
1203 nmdc:mga05p37_35787_c1 3300050507 Bacteria 6090
1204 nmdc:mga05p37_413989_c1 3300050507 Bacteria 1570
1205 nmdc:mga05p37_520847_c1 3300050507 Bacteria 1360
1206 nmdc:mga05p37_524734_c1 3300050507 Bacteria 1354
1207 nmdc:mga05p37_55206_c1 3300050507 Bacteria 4887
1208 nmdc:mga05p37_61022_c1 3300050507 Bacteria 4642
1209 nmdc:mga05p37_72924_c1 3300050507 Bacteria 4225
1210 nmdc:mga09592_14008_c1 3300050508 Bacteria 6545
1211 nmdc:mga09592_141557_c1 3300050508 Unclassified 2074
1212 nmdc:mga09592_212316_c1 3300050508 Bacteria 1677
1213 nmdc:mga09592_257445_c1 3300050508 Unclassified 1513
1214 nmdc:mga09592_52344_c1 3300050508 Unclassified 3446
1215 nmdc:mga09592_967_c1 3300050508 Bacteria 22695
1216 nmdc:mga0qj67_136894_c1 3300050509 Bacteria 1984
1217 nmdc:mga0qj67_15628_c1 3300050509 Bacteria 5749
1218 nmdc:mga0qj67_16084_c1 3300050509 Bacteria 5667
1219 nmdc:mga0qj67_201389_c1 3300050509 Bacteria 1618
1220 nmdc:mga0qj67_293274_c1 3300050509 Unclassified 1318
1221 nmdc:mga0qj67_86334_c1 3300050509 Bacteria 2517
1222 nmdc:mga06r32_118689_c1 3300050510 Bacteria 2608
1223 nmdc:mga08y16_12039_c1 3300050511 Bacteria 9089
1224 nmdc:mga08y16_128960_c1 3300050511 Bacteria 2631
1225 nmdc:mga08y16_1769_c1 3300050511 Bacteria 21886
1226 nmdc:mga08y16_2215_c1 3300050511 Bacteria 19933
1227 nmdc:mga08y16_2889_c1 3300050511 Bacteria 17675
1228 nmdc:mga08y16_309471_c1 3300050511 Bacteria 1627
1229 nmdc:mga08y16_317592_c1 3300050511 Bacteria 1604
1230 nmdc:mga08y16_37188_c1 3300050511 Bacteria 5114
1231 nmdc:mga08y16_47758_c1 3300050511 Bacteria 4480
1232 nmdc:mga08y16_5902_c1 3300050511 Bacteria 12836
1233 nmdc:mga08y16_63674_c1 3300050511 Bacteria 3851
1234 nmdc:mga08y16_83338_c1 3300050511 Bacteria 3332
1235 nmdc:mga0n895_146918_c1 3300050512 Bacteria 2387
1236 nmdc:mga0n895_17227_c1 3300050512 Bacteria 6657
1237 nmdc:mga0n895_443684_c1 3300050512 Bacteria 1311
1238 nmdc:mga0n895_44481_c1 3300050512 Bacteria 4330
1239 nmdc:mga0n895_92567_c1 3300050512 Bacteria 3026
1240 nmdc:mga0rr50_160160_c1 3300050513 Bacteria 1826
1241 nmdc:mga0rr50_185733_c1 3300050513 Bacteria 1701
1242 nmdc:mga0rr50_416265_c1 3300050513 Bacteria 1136
1243 nmdc:mga0a205_2492_c1 3300050515 Bacteria 16226
1244 nmdc:mga0a205_332334_c1 3300050515 Bacteria 1389
1245 nmdc:mga0a205_478306_c1 3300050515 Bacteria 1104
1246 nmdc:mga0a205_824_c1 3300050515 Bacteria 25229
1247 nmdc:mga0sz30_13246_c1 3300050516 Bacteria 3226
1248 Ga0495601_0000639 3300053077 Bacteria 18674
1249 Ga0495601_0004849 3300053077 Bacteria 7804
1250 Ga0495601_0034498 3300053077 Bacteria 3158
1251 Ga0495601_0048748 3300053077 Bacteria 2668
1252 Ga0495601_0096989 3300053077 Bacteria 1902
1253 Ga0495601_0205033 3300053077 Bacteria 1288
1254 Ga0495601_0268441 3300053077 Unclassified 1113
1255 Ga0495595_0002937 3300053084 Bacteria 6725
1256 Ga0495619_0000356 3300053085 Bacteria 31805
1257 Ga0495619_0006623 3300053085 Bacteria 7330
1258 Ga0495619_0019614 3300053085 Bacteria 4300
1259 Ga0495619_0100740 3300053085 Bacteria 1966
1260 Ga0500641_0005080 3300053096 Bacteria 4663
1261 Ga0500595_022630 3300053119 Unclassified 2221
1262 Ga0500595_034881 3300053119 Bacteria 1661
1263 Ga0500652_000004 3300053131 Bacteria 173428
1264 Ga0500652_000021 3300053131 Bacteria 119100
1265 Ga0500568_0000656 3300053139 Bacteria 24982
1266 Ga0500568_0004824 3300053139 Bacteria 7126
1267 Ga0500634_0010186 3300053161 Bacteria 4794
1268 Ga0500636_0002225 3300053177 Bacteria 10748
1269 Ga0500636_0066608 3300053177 Unclassified 2094
1270 Ga0501084_0106166 3300054114 Bacteria 2359
1271 Ga0501084_0343399 3300054114 Bacteria 1261
1272 Ga0501082_0331610 3300060353 Bacteria 1326
1273 Ga0530510_0042041 3300061734 Bacteria 3301
1274 Ga0530510_0356859 3300061734 Unclassified 1098
1275 2510251177 2510065045 Bacteria 7761063
1276 2515685507 2515154122 Bacteria 8609520
1277 2719640304 2718217991 Bacteria 7829542
1278 2792838858 2791355137 Bacteria 9654227
1279 2902688269 2902682994 Bacteria 8951596
1280 8047678393 8047673197 Bacteria 7395230
1281 8055271629 8055266321 Bacteria 7999742
1282 Ga0436361_0920430
1283 JGI24744J21845_10010566
1284 JGI24033J26618_1005216
1285 JGI24742J22300_10000688
1286 JGI25406J46586_10000393
1287 JGI25406J46586_10002426
1288 JGI25406J46586_10049082
1289 JGI25406J46586_10054052
1290 JGI25405J52794_10002066
1291 Ga0065704_10138674
1292 Ga0065712_10102051
1293 Ga0065715_10184617
1294 Ga0070658_10140404
1295 Ga0070658_10228260
1296 Ga0070676_10011166
1297 Ga0070676_10029136
1298 Ga0070676_10220658
1299 Ga0070676_10227425
1300 Ga0070683_100000301
1301 Ga0070683_100007229
1302 Ga0070683_100014020
1303 Ga0070683_100050193
1304 Ga0070683_100073743
1305 Ga0070683_100124602
1306 Ga0070683_100129398
1307 Ga0070683_100251360
1308 Ga0070690_100005585
1309 Ga0070690_100005812
1310 Ga0070690_100017529
1311 Ga0070690_100026462
1312 Ga0070690_100054616
1313 Ga0070690_100061743
1314 Ga0070690_100100883
1315 Ga0070670_100000974
1316 Ga0070670_100013453
1317 Ga0070670_100018295
1318 Ga0070670_100024356
1319 Ga0070670_100048960
1320 Ga0070670_100095815
1321 Ga0070670_100323125
1322 Ga0070677_10002771
1323 Ga0070677_10008993
1324 Ga0068869_100007259
1325 Ga0068869_100009214
1326 Ga0068869_100026931
1327 Ga0068869_100035710
1328 Ga0068869_100135283
1329 Ga0068869_100174182
1330 Ga0070666_10019084
1331 Ga0070666_10030598
1332 Ga0070666_10044920
1333 Ga0070680_100001316
1334 Ga0070680_100001335
1335 Ga0070680_100009677
1336 Ga0068868_100006725
1337 Ga0068868_100010392
1338 Ga0068868_100014330
1339 Ga0068868_100029869
1340 Ga0068868_100058202
1341 Ga0070660_100091242
1342 Ga0070660_100225540
1343 Ga0070689_100012396
1344 Ga0070689_100069996
1345 Ga0070689_100107386
1346 Ga0070689_100145963
1347 Ga0070691_10000324
1348 Ga0070687_100008670
1349 Ga0070687_100046081
1350 Ga0070687_100104374
1351 Ga0070687_100178246
1352 Ga0070661_100011281
1353 Ga0070661_100019692
1354 Ga0070661_100106930
1355 Ga0070661_100150999
1356 Ga0070661_100204408
1357 Ga0070661_100353104
1358 Ga0070692_10111871
1359 Ga0070692_10200172
1360 Ga0070669_100004616
1361 Ga0070669_100016001
1362 Ga0070669_100030914
1363 Ga0070669_100278550
1364 Ga0070675_100000644
1365 Ga0070675_100001188
1366 Ga0070675_100003309
1367 Ga0070675_100027191
1368 Ga0070675_100075583
1369 Ga0070675_100107358
1370 Ga0070675_100114732
1371 Ga0070675_100328252
1372 Ga0070671_100039225
1373 Ga0070671_100039557
1374 Ga0070671_100062326
1375 Ga0070671_100122770
1376 Ga0070671_100219325
1377 Ga0070674_100004510
1378 Ga0070674_100073938
1379 Ga0070674_100090130
1380 Ga0070674_100218530
1381 Ga0070674_100243305
1382 Ga0070674_100279285
1383 Ga0070673_100020932
1384 Ga0070673_100024873
1385 Ga0070673_100025354
1386 Ga0070673_100026223
1387 Ga0070673_100132007
1388 Ga0070673_100184448
1389 Ga0070673_100211560
1390 Ga0070688_100008145
1391 Ga0070688_100013932
1392 Ga0070688_100039988
1393 Ga0070688_100081378
1394 Ga0070688_100094296
1395 Ga0070659_100008560
1396 Ga0070659_100060974
1397 Ga0070659_100133583
1398 Ga0070659_100303077
1399 Ga0070659_100314517
1400 Ga0070667_100008209
1401 Ga0070667_100011865
1402 Ga0070667_100020877
1403 Ga0070667_100048372
1404 Ga0070667_100429441
1405 Ga0070709_10141420
1406 Ga0070714_100044338
1407 Ga0070714_100138874
1408 Ga0070714_100385438
1409 Ga0070714_100441605
1410 Ga0070714_100529998
1411 Ga0070713_100018211
1412 Ga0070713_100030488
1413 Ga0070713_100039332
1414 Ga0070713_100049632
1415 Ga0070713_100069174
1416 Ga0070713_100291034
1417 Ga0070713_100462597
1418 Ga0070701_10008881
1419 Ga0070701_10013651
1420 Ga0070701_10161672
1421 Ga0070711_100101480
1422 Ga0070711_100219847
1423 Ga0070711_100251435
1424 Ga0070705_100079777
1425 Ga0070705_100195361
1426 Ga0070700_100017507
1427 Ga0070700_100023549
1428 Ga0070700_100085121
1429 Ga0070700_100333858
1430 Ga0070708_100467645
1431 Ga0070678_100033289
1432 Ga0070678_100078695
1433 Ga0070678_100082787
1434 Ga0070678_100138521
1435 Ga0070678_100304707
1436 Ga0070662_100014432
1437 Ga0070662_100044895
1438 Ga0070662_100070282
1439 Ga0070662_100108085
1440 Ga0070681_10008296
1441 Ga0070681_10009631
1442 Ga0070681_10022535
1443 Ga0070681_10032405
1444 Ga0070681_10066078
1445 Ga0070681_10076173
1446 Ga0070681_10094217
1447 Ga0070681_10172389
1448 Ga0070681_10228249
1449 Ga0070681_10275489
1450 Ga0068867_100034640
1451 Ga0068867_100037213
1452 Ga0068867_100336738
1453 Ga0070685_10221747
1454 Ga0070698_100083468
1455 Ga0070698_100342720
1456 Ga0070699_100070838
1457 Ga0070699_100105534
1458 Ga0070679_100004740
1459 Ga0070679_100015693
1460 Ga0070679_100017008
1461 Ga0070679_100021451
1462 Ga0070679_100112724
1463 Ga0070679_100210601
1464 Ga0070684_100001680
1465 Ga0070684_100007348
1466 Ga0070684_100012682
1467 Ga0070684_100076402
1468 Ga0070684_100113031
1469 Ga0070684_100321308
1470 Ga0070697_100468662
1471 Ga0068853_100013038
1472 Ga0068853_100024105
1473 Ga0068853_100075555
1474 Ga0068853_100092275
1475 Ga0068853_100154957
1476 Ga0068853_100197011
1477 Ga0070672_100011068
1478 Ga0070672_100018764
1479 Ga0070672_100023131
1480 Ga0070672_100046934
1481 Ga0070672_100139048
1482 Ga0070672_100261424
1483 Ga0070686_100009770
1484 Ga0070686_100013446
1485 Ga0070686_100023771
1486 Ga0070686_100037728
1487 Ga0070686_100122391
1488 Ga0070695_100197823
1489 Ga0070696_100260870
1490 Ga0070693_100023319
1491 Ga0070665_100008439
1492 Ga0070665_100056481
1493 Ga0070665_100076361
1494 Ga0070665_100166516
1495 Ga0070665_100263670
1496 Ga0070704_100092750
1497 Ga0068855_100002819
1498 Ga0068855_100005925
1499 Ga0068855_100040045
1500 Ga0068855_100081259
1501 Ga0068855_100115545
1502 Ga0068855_100164037
1503 Ga0068855_100188262
1504 Ga0070664_100014604
1505 Ga0070664_100022987
1506 Ga0070664_100033721
1507 Ga0070664_100216439
1508 Ga0068857_100015291
1509 Ga0068857_100015475
1510 Ga0068857_100035161
1511 Ga0068857_100126450
1512 Ga0068857_100126977
1513 Ga0068857_100241378
1514 Ga0068857_100319395
1515 Ga0068854_100237622
1516 Ga0068856_100001168
1517 Ga0068856_100014581
1518 Ga0068856_100019448
1519 Ga0068856_100026599
1520 Ga0068856_100142501
1521 Ga0068856_100167929
1522 Ga0068856_100341959
1523 Ga0070702_100008723
1524 Ga0070702_100101337
1525 Ga0068852_100009496
1526 Ga0068852_100021458
1527 Ga0068852_100146475
1528 Ga0068852_100324058
1529 Ga0068852_100451881
1530 Ga0068859_100014354
1531 Ga0068859_100078422
1532 Ga0068859_100082514
1533 Ga0068859_100092226
1534 Ga0068859_100113609
1535 Ga0068859_100132726
1536 Ga0068859_100199251
1537 Ga0068859_100305576
1538 Ga0068859_100333227
1539 Ga0068859_100391398
1540 Ga0068864_100002489
1541 Ga0068864_100047520
1542 Ga0068864_100061335
1543 Ga0068864_100119949
1544 Ga0068864_100235155
1545 Ga0068861_100135391
1546 Ga0068861_100144878
1547 Ga0068851_10083405
1548 Ga0068870_10001158
1549 Ga0068870_10004289
1550 Ga0068870_10007546
1551 Ga0068870_10099422
1552 Ga0068870_10159685
1553 Ga0068863_100014331
1554 Ga0068863_100016886
1555 Ga0068863_100023491
1556 Ga0068863_100190271
1557 Ga0068858_100028766
1558 Ga0068858_100031181
1559 Ga0068858_100041156
1560 Ga0068858_100042373
1561 Ga0068858_100054060
1562 Ga0068860_100010576
1563 Ga0068860_100018643
1564 Ga0068860_100051204
1565 Ga0068860_100086035
1566 Ga0068860_100142556
1567 Ga0068862_100020187
1568 Ga0068862_100071365
1569 Ga0068862_100231099
1570 Ga0081455_10000840
1571 Ga0081455_10021104
1572 Ga0081455_10034725
1573 Ga0081538_10027048
1574 Ga0081539_10000047
1575 Ga0081539_10002846
1576 Ga0081539_10004786
1577 Ga0081539_10014737
1578 Ga0075365_10003122
1579 Ga0075365_10010200
1580 Ga0075365_10074434
1581 Ga0075365_10099906
1582 Ga0075364_10020903
1583 Ga0070715_10099109
1584 Ga0070712_100022120
1585 Ga0070712_100043331
1586 Ga0070712_100451848
1587 Ga0075362_10043835
1588 Ga0075362_10054401
1589 Ga0075367_10014301
1590 Ga0075367_10080533
1591 Ga0075367_10106252
1592 Ga0075367_10211142
1593 Ga0075427_10006826
1594 Ga0075366_10022922
1595 Ga0097621_100012607
1596 Ga0097621_100032737
1597 Ga0097621_100033878
1598 Ga0097621_100053281
1599 Ga0097621_100074759
1600 Ga0097621_100181121
1601 Ga0097621_100235576
1602 Ga0097621_100235787
1603 Ga0097621_100277356
1604 Ga0097621_100476508
1605 Ga0068871_100014427
1606 Ga0068871_100020640
1607 Ga0068871_100079316
1608 Ga0068871_100083862
1609 Ga0068871_100270691
1610 Ga0075428_100005211
1611 Ga0075428_100034588
1612 Ga0075428_100052788
1613 Ga0075428_100070527
1614 Ga0075428_100077794
1615 Ga0075428_100095292
1616 Ga0075428_100113329
1617 Ga0075428_100138885
1618 Ga0075428_100230447
1619 Ga0075428_100304665
1620 Ga0075430_100002643
1621 Ga0075430_100013828
1622 Ga0075430_100039729
1623 Ga0075430_100056531
1624 Ga0075430_100078529
1625 Ga0075430_100132101
1626 Ga0075431_100000646
1627 Ga0075431_100031593
1628 Ga0075431_100106227
1629 Ga0075431_100194412
1630 Ga0075431_100523971
1631 Ga0075433_10000460
1632 Ga0075433_10001289
1633 Ga0075433_10001670
1634 Ga0075433_10209782
1635 Ga0075434_100003682
1636 Ga0075434_100016390
1637 Ga0075434_100065432
1638 Ga0075434_100283137
1639 Ga0075434_100323868
1640 Ga0075429_100001853
1641 Ga0075429_100251220
1642 Ga0075429_100271027
1643 Ga0068865_100003824
1644 Ga0068865_100080632
1645 Ga0068865_100108285
1646 Ga0068865_100326202
1647 Ga0097620_100014354
1648 Ga0097620_100078423
1649 Ga0097620_100082515
1650 Ga0097620_100092224
1651 Ga0097620_100113612
1652 Ga0097620_100132726
1653 Ga0097620_100199255
1654 Ga0097620_100305547
1655 Ga0097620_100333204
1656 Ga0097620_100391354
1657 Ga0075435_100295006
1658 Ga0099795_10046363
1659 Ga0105240_10007648
1660 Ga0105240_10022565
1661 Ga0105240_10032830
1662 Ga0105240_10034115
1663 Ga0105240_10060448
1664 Ga0105240_10095953
1665 Ga0105240_10497798
1666 Ga0111539_10000151
1667 Ga0111539_10000562
1668 Ga0111539_10002437
1669 Ga0111539_10002719
1670 Ga0111539_10003382
1671 Ga0111539_10015153
1672 Ga0111539_10021998
1673 Ga0111539_10039106
1674 Ga0111539_10050957
1675 Ga0111539_10150753
1676 Ga0111539_10251357
1677 Ga0111539_10285962
1678 Ga0111539_10348270
1679 Ga0105245_10001655
1680 Ga0105245_10004216
1681 Ga0105245_10008681
1682 Ga0105245_10016334
1683 Ga0105245_10036311
1684 Ga0105247_10007255
1685 Ga0105247_10022228
1686 Ga0105247_10022256
1687 Ga0114129_10000797
1688 Ga0114129_10002798
1689 Ga0114129_10004770
1690 Ga0114129_10078064
1691 Ga0114129_10119066
1692 Ga0114129_10126143
1693 Ga0114129_10167684
1694 Ga0114129_10266178
1695 Ga0114129_10314380
1696 Ga0114129_10340973
1697 Ga0114129_10655453
1698 Ga0105243_10073902
1699 Ga0105243_10079238
1700 Ga0105243_10261055
1701 Ga0105243_10406941
1702 Ga0105241_10001682
1703 Ga0105241_10157116
1704 Ga0105241_10158844
1705 Ga0105242_10039911
1706 Ga0105242_10074931
1707 Ga0105242_10224243
1708 Ga0105242_10463875
1709 Ga0105248_10000804
1710 Ga0105248_10003271
1711 Ga0105248_10004514
1712 Ga0105248_10006795
1713 Ga0105248_10007062
1714 Ga0105248_10012815
1715 Ga0105248_10023319
1716 Ga0105248_10027991
1717 Ga0105248_10031282
1718 Ga0105248_10035718
1719 Ga0105248_10074816
1720 Ga0105248_10424526
1721 Ga0105248_10561737
1722 Ga0105237_10003677
1723 Ga0105237_10004000
1724 Ga0105237_10121241
1725 Ga0105237_10125623
1726 Ga0105237_10141258
1727 Ga0105237_10210358
1728 Ga0105237_10261983
1729 Ga0105237_10433556
1730 Ga0105238_10004133
1731 Ga0105238_10010800
1732 Ga0105238_10027156
1733 Ga0105238_10041666
1734 Ga0105238_10054351
1735 Ga0105238_10107500
1736 Ga0105238_10147305
1737 Ga0105238_10213291
1738 Ga0105238_10245752
1739 Ga0105238_10253308
1740 Ga0105238_10490031
1741 Ga0105249_10016531
1742 Ga0105249_10034356
1743 Ga0105249_10037423
1744 Ga0105249_10169053
1745 Ga0105249_10276991
1746 Ga0105249_10669541
1747 Ga0105239_10003090
1748 Ga0105239_10029968
1749 Ga0105239_10032820
1750 Ga0105246_10005632
1751 Ga0105246_10012119
1752 Ga0105246_10018044
1753 Ga0105246_10088512
1754 Ga0157371_10046819
1755 Ga0157370_10005689
1756 Ga0157370_10024535
1757 Ga0157370_10037770
1758 Ga0157370_10053386
1759 Ga0157370_10076945
1760 Ga0157370_10088466
1761 Ga0157370_10131762
1762 Ga0157369_10005817
1763 Ga0157369_10006422
1764 Ga0157369_10008198
1765 Ga0157369_10017939
1766 Ga0157369_10024815
1767 Ga0157369_10026929
1768 Ga0157369_10030918
1769 Ga0157369_10200327
1770 Ga0157374_10048689
1771 Ga0157374_10110136
1772 Ga0157374_10110381
1773 Ga0157374_10146220
1774 Ga0157374_10171620
1775 Ga0157374_10285780
1776 Ga0157374_10295616
1777 Ga0157374_10402242
1778 Ga0157378_10000433
1779 Ga0157378_10018216
1780 Ga0157378_10026213
1781 Ga0157378_10037138
1782 Ga0163162_10000523
1783 Ga0163162_10001473
1784 Ga0163162_10010532
1785 Ga0163162_10101430
1786 Ga0163162_10190517
1787 Ga0157372_10008964
1788 Ga0157372_10009357
1789 Ga0157372_10050473
1790 Ga0157372_10151249
1791 Ga0157372_10321529
1792 Ga0157372_10643624
1793 Ga0157375_10000096
1794 Ga0157375_10001100
1795 Ga0157375_10002834
1796 Ga0157375_10032745
1797 Ga0157375_10274087
1798 Ga0157375_10489292
1799 Ga0157375_10630701
1800 Ga0163163_10000519
1801 Ga0163163_10005836
1802 Ga0163163_10011623
1803 Ga0163163_10019966
1804 Ga0163163_10024867
1805 Ga0163163_10029198
1806 Ga0163163_10036959
1807 Ga0163163_10050921
1808 Ga0163163_10053175
1809 Ga0163163_10075777
1810 Ga0163163_10083082
1811 Ga0163163_10145301
1812 Ga0163163_10281701
1813 Ga0163163_10545038
1814 Ga0157380_10009740
1815 Ga0157380_10031353
1816 Ga0157380_10182923
1817 Ga0157380_10259762
1818 Ga0157380_10405032
1819 Ga0182008_10038596
1820 Ga0182008_10058613
1821 Ga0157377_10005753
1822 Ga0157377_10047133
1823 Ga0157379_10000048
1824 Ga0157379_10028278
1825 Ga0157379_10034446
1826 Ga0157379_10092480
1827 Ga0157379_10202954
1828 Ga0157379_10210969
1829 Ga0157379_10338164
1830 Ga0157379_10417020
1831 Ga0157376_10015271
1832 Ga0157376_10131823
1833 Ga0157376_10142625
1834 Ga0157376_10156728
1835 Ga0157376_10192888
1836 Ga0157376_10216788
1837 Ga0163161_10009974
1838 Ga0163161_10017593
1839 Ga0163161_10039091
1840 Ga0163161_10106956
1841 Ga0197907_10850651
1842 Ga0206356_11897132
1843 Ga0206350_10155620
1844 Ga0213873_10010289
1845 Ga0213872_10083289
1846 Ga0213876_10046150
1847 Ga0213875_10006251
1848 Ga0213875_10049184
1849 Ga0213875_10059169
1850 Ga0224712_10042923
1851 Ga0224712_10126744
1852 Ga0207697_10039759
1853 Ga0207656_10055051
1854 Ga0207682_10000836
1855 Ga0207682_10004927
1856 Ga0207682_10015461
1857 Ga0207682_10036173
1858 Ga0207692_10076430
1859 Ga0207642_10037706
1860 Ga0207642_10217829
1861 Ga0207688_10000186
1862 Ga0207688_10020244
1863 Ga0207688_10159776
1864 Ga0207680_10023341
1865 Ga0207680_10121120
1866 Ga0207647_10049677
1867 Ga0207645_10001480
1868 Ga0207645_10028334
1869 Ga0207645_10080038
1870 Ga0207645_10127347
1871 Ga0207643_10000951
1872 Ga0207643_10001949
1873 Ga0207643_10010366
1874 Ga0207705_10115587
1875 Ga0207705_10312776
1876 Ga0207654_10016475
1877 Ga0207654_10081629
1878 Ga0207707_10000565
1879 Ga0207707_10001148
1880 Ga0207707_10008127
1881 Ga0207707_10008357
1882 Ga0207707_10008871
1883 Ga0207707_10112729
1884 Ga0207707_10163477
1885 Ga0207695_10001854
1886 Ga0207695_10004549
1887 Ga0207695_10031205
1888 Ga0207695_10047903
1889 Ga0207695_10067034
1890 Ga0207695_10084497
1891 Ga0207695_10491629
1892 Ga0207671_10078097
1893 Ga0207671_10200627
1894 Ga0207671_10235597
1895 Ga0207693_10002478
1896 Ga0207693_10058496
1897 Ga0207693_10149479
1898 Ga0207663_10227981
1899 Ga0207660_10009726
1900 Ga0207660_10018474
1901 Ga0207660_10036917
1902 Ga0207662_10007393
1903 Ga0207662_10067296
1904 Ga0207662_10122402
1905 Ga0207657_10074316
1906 Ga0207657_10124458
1907 Ga0207649_10100403
1908 Ga0207649_10130722
1909 Ga0207649_10266490
1910 Ga0207652_10002881
1911 Ga0207652_10003929
1912 Ga0207652_10114221
1913 Ga0207652_10173941
1914 Ga0207652_10199713
1915 Ga0207652_10263411
1916 Ga0207646_10001462
1917 Ga0207681_10037459
1918 Ga0207681_10058154
1919 Ga0207681_10308466
1920 Ga0207694_10000738
1921 Ga0207694_10003104
1922 Ga0207694_10025390
1923 Ga0207694_10034277
1924 Ga0207694_10067555
1925 Ga0207694_10117646
1926 Ga0207694_10143418
1927 Ga0207650_10000510
1928 Ga0207650_10006456
1929 Ga0207650_10048603
1930 Ga0207659_10000797
1931 Ga0207659_10008431
1932 Ga0207659_10019281
1933 Ga0207659_10035142
1934 Ga0207659_10054824
1935 Ga0207659_10082916
1936 Ga0207659_10110241
1937 Ga0207659_10446663
1938 Ga0207687_10003947
1939 Ga0207687_10004393
1940 Ga0207687_10010486
1941 Ga0207687_10035423
1942 Ga0207700_10029586
1943 Ga0207700_10052950
1944 Ga0207700_10123810
1945 Ga0207700_10174898
1946 Ga0207700_10336643
1947 Ga0207664_10214974
1948 Ga0207644_10027675
1949 Ga0207644_10047399
1950 Ga0207644_10066118
1951 Ga0207644_10068049
1952 Ga0207644_10139841
1953 Ga0207690_10077757
1954 Ga0207690_10126248
1955 Ga0207706_10004052
1956 Ga0207706_10101855
1957 Ga0207706_10105691
1958 Ga0207686_10002608
1959 Ga0207686_10027803
1960 Ga0207686_10075955
1961 Ga0207686_10115462
1962 Ga0207686_10284969
1963 Ga0207709_10010381
1964 Ga0207709_10150281
1965 Ga0207670_10015421
1966 Ga0207670_10332910
1967 Ga0207669_10006302
1968 Ga0207669_10009677
1969 Ga0207669_10092463
1970 Ga0207704_10006585
1971 Ga0207704_10011867
1972 Ga0207704_10012447
1973 Ga0207704_10079710
1974 Ga0207704_10176114
1975 Ga0207691_10012333
1976 Ga0207691_10013158
1977 Ga0207691_10019418
1978 Ga0207691_10053281
1979 Ga0207691_10136640
1980 Ga0207691_10237820
1981 Ga0207711_10000641
1982 Ga0207711_10000804
1983 Ga0207711_10000883
1984 Ga0207711_10013257
1985 Ga0207711_10013402
1986 Ga0207711_10017416
1987 Ga0207711_10060014
1988 Ga0207711_10087121
1989 Ga0207711_10119103
1990 Ga0207689_10002411
1991 Ga0207689_10015797
1992 Ga0207689_10016668
1993 Ga0207689_10033221
1994 Ga0207689_10247746
1995 Ga0207689_10360542
1996 Ga0207661_10002990
1997 Ga0207661_10007186
1998 Ga0207661_10013583
1999 Ga0207661_10017976
2000 Ga0207661_10096187
2001 Ga0207661_10118433
2002 Ga0207661_10141359
2003 Ga0207679_10004577
2004 Ga0207679_10013618
2005 Ga0207679_10025369
2006 Ga0207679_10126137
2007 Ga0207667_10000636
2008 Ga0207667_10001683
2009 Ga0207667_10005002
2010 Ga0207667_10005718
2011 Ga0207667_10027397
2012 Ga0207667_10139209
2013 Ga0207667_10463835
2014 Ga0207651_10009725
2015 Ga0207651_10021241
2016 Ga0207651_10026193
2017 Ga0207712_10017934
2018 Ga0207712_10033299
2019 Ga0207712_10042765
2020 Ga0207668_10100612
2021 Ga0207640_10055008
2022 Ga0207658_10015567
2023 Ga0207658_10020306
2024 Ga0207658_10042015
2025 Ga0207658_10172427
2026 Ga0207677_10027359
2027 Ga0207677_10046628
2028 Ga0207677_10053414
2029 Ga0207677_10219672
2030 Ga0207703_10009226
2031 Ga0207703_10014205
2032 Ga0207703_10026582
2033 Ga0207703_10061983
2034 Ga0207703_10102676
2035 Ga0207703_10104988
2036 Ga0207703_10122406
2037 Ga0207703_10196686
2038 Ga0207703_10310306
2039 Ga0207703_10402314
2040 Ga0207703_10423033
2041 Ga0207639_10064912
2042 Ga0207639_10064932
2043 Ga0207639_10278501
2044 Ga0207678_10032096
2045 Ga0207678_10056416
2046 Ga0207678_10281630
2047 Ga0207708_10020707
2048 Ga0207708_10041022
2049 Ga0207702_10009053
2050 Ga0207702_10021939
2051 Ga0207702_10029649
2052 Ga0207702_10084483
2053 Ga0207702_10109864
2054 Ga0207702_10175373
2055 Ga0207641_10002077
2056 Ga0207641_10014597
2057 Ga0207641_10034849
2058 Ga0207641_10036386
2059 Ga0207641_10177398
2060 Ga0207641_10186174
2061 Ga0207641_10197671
2062 Ga0207648_10006827
2063 Ga0207648_10006985
2064 Ga0207648_10013242
2065 Ga0207648_10071445
2066 Ga0207648_10210077
2067 Ga0207648_10220578
2068 Ga0207676_10010042
2069 Ga0207676_10473124
2070 Ga0207676_10476901
2071 Ga0207674_10000166
2072 Ga0207674_10003310
2073 Ga0207674_10004029
2074 Ga0207674_10026232
2075 Ga0207674_10091119
2076 Ga0207674_10101423
2077 Ga0207674_10146177
2078 Ga0207674_10181479
2079 Ga0207674_10249624
2080 Ga0207675_100004439
2081 Ga0207675_100008362
2082 Ga0207675_100116686
2083 Ga0207675_100146237
2084 Ga0207675_100400906
2085 Ga0207683_10047440
2086 Ga0207683_10057250
2087 Ga0207683_10091143
2088 Ga0207683_10106952
2089 Ga0207683_10112561
2090 Ga0207683_10353071
2091 Ga0207698_10011187
2092 Ga0207698_10098854
2093 Ga0207698_10191770
2094 Ga0207698_10203476
2095 Ga0207698_10408586
2096 Ga0207428_10000144
2097 Ga0207428_10000643
2098 Ga0207428_10005048
2099 Ga0207428_10019680
2100 Ga0207428_10067349
2101 Ga0207428_10076601
2102 Ga0207428_10079218
2103 Ga0268266_10058015
2104 Ga0268266_10159670
2105 Ga0268266_10355052
2106 Ga0268265_10005432
2107 Ga0268265_10012385
2108 Ga0268265_10103021
2109 Ga0268264_10006882
2110 Ga0268264_10017518
2111 Ga0268264_10020797
2112 Ga0268264_10026845
2113 Ga0268264_10037903
2114 Ga0268264_10275649
2115 Ga0265338_10019045
2116 Ga0265338_10056036
2117 Ga0265332_10022094
2118 Ga0265325_10001345
2119 Ga0265340_10067748
2120 Ga0265327_10042200
2121 Ga0307408_100004306
2122 Ga0265313_10003580
2123 Ga0265313_10005853
2124 Ga0265314_10000282
2125 Ga0265314_10005473
2126 Ga0307405_10004173
2127 Ga0307410_10004522
2128 Ga0307407_10038224
2129 Ga0307412_10033419
2130 Ga0307416_100005845
2131 Ga0307416_100281571
2132 Ga0307414_10001278
2133 Ga0307411_10043665
2134 Ga0373934_0003589
2135 Ga0373934_0015265
2136 Ga0373934_0024847
2137 Ga0373952_0005495
2138 Ga0373923_0036905
2139 Ga0373923_0105874
2140 Ga0373936_0069032
2141 Ga0373936_0120286
2142 Ga0373941_0011829
2143 Ga0373945_0015626
2144 Ga0373945_0020436
2145 Ga0373954_0004540
2146 Ga0373954_0012448
2147 Ga0373954_0013095
2148 Ga0373956_0053978
2149 Ga0373946_0050300
2150 Ga0373946_0081907
2151 Ga0373955_0022908
2152 Ga0373955_0024402
2153 Ga0373955_0037499
2154 Ga0373955_0055064
2155 Ga0373955_0066247
2156 Ga0373955_0086923
2157 Ga0373955_0090386
2158 Ga0373955_0174685
2159 Ga0373924_0003596
2160 Ga0373931_0002400
2161 Ga0373931_0013157
2162 Ga0373931_0022597
2163 Ga0373935_0012614
2164 Ga0373935_0132807
2165 Ga0373935_0161721
2166 Ga0373927_0011148
2167 Ga0373927_0062708
2168 Ga0373927_0090628
2169 Ga0373933_0002707
2170 Ga0373933_0006335
2171 Ga0373933_0016000
2172 Ga0373933_0038756
2173 Ga0373933_0046795
2174 Ga0373933_0049454
2175 Ga0373947_0238739
2176 Ga0373937_0000238
2177 Ga0373937_0000744
2178 Ga0373937_0000994
2179 Ga0373937_0007751
2180 Ga0373937_0013713
2181 Ga0373937_0015199
2182 Ga0373937_0019061
2183 Ga0373937_0019271
2184 Ga0373937_0021816
2185 Ga0373937_0031015
2186 Ga0373937_0035309
2187 Ga0373937_0099881
2188 Ga0373937_0228427
2189 Ga0373937_0277680
2190 Ga0373937_0340528
2191 Ga0373925_0035321
2192 Ga0373925_0078134
2193 Ga0373925_0089525
2194 Ga0373925_0107792
2195 Ga0373925_0286724
2196 Ga0395899_0023273
2197 Ga0395900_0327319
2198 Ga0395900_0414458
2199 Ga0395905_0307899
2200 Ga0436364_0112721
2201 Ga0436364_0249501
2202 Ga0436365_0017926
2203 Ga0436365_0568945
2204 Ga0436365_0801801
2205 Ga0436365_1426598
2206 Ga0436365_1432540
2207 Ga0436365_1776714
2208 Ga0436361_0232929
2209 Ga0436361_0539861
2210 Ga0436361_0909974
2211 Ga0436361_1062872
2212 Ga0436362_0945639
2213 Ga0439453_0017209
2214 Ga0451853_2651878
2215 Ga0439435_0001937
2216 Ga0451577_0378157
2217 Ga0466969_0056832
2218 Ga0466969_0085459
2219 Ga0466977_0000756
2220 Ga0466966_0020782
2221 Ga0466971_0038928
2222 Ga0466959_0319402
2223 Ga0466958_0023945
2224 Ga0466967_0052631
2225 Ga0466967_0199837
2226 Ga0466967_0360972
2227 Ga0495592_0006726
2228 Ga0495592_0070841
2229 Ga0495592_0077669
2230 Ga0495603_0011113
2231 Ga0495638_0083735
2232 Ga0495641_0009978
2233 Ga0495651_0115472
2234 Ga0495651_0335036
2235 Ga0495580_0018560
2236 Ga0495580_0046636
2237 Ga0495580_0154508
2238 Ga0495580_0247342
2239 Ga0495580_0289280
2240 Ga0495582_0000742
2241 Ga0495582_0016027
2242 Ga0495582_0127094
2243 Ga0495605_0000116
2244 Ga0495639_0015091
2245 Ga0495662_0020144
2246 Ga0495584_0034106
2247 Ga0495585_0014925
2248 Ga0495585_0040936
2249 Ga0495585_0078024
2250 Ga0495594_0078587
2251 Ga0495594_0082134
2252 Ga0495596_0000078
2253 Ga0495607_0000057
2254 Ga0495607_0021836
2255 Ga0495607_0062293
2256 Ga0495608_0009055
2257 Ga0495608_0021672
2258 Ga0495616_0034297
2259 Ga0495616_0062383
2260 Ga0495618_0217909
2261 Ga0495628_0072665
2262 Ga0495628_0323700
2263 Ga0495630_0039488
2264 Ga0495632_0002942
2265 Ga0495632_0016297
2266 Ga0495637_0055645
2267 Ga0495643_0000347
2268 Ga0495643_0009518
2269 Ga0495643_0012675
2270 Ga0495643_0033848
2271 Ga0495644_0003021
2272 Ga0495642_0001005
2273 Ga0495642_0015247
2274 Ga0495652_0018819
2275 Ga0495652_0064227
2276 Ga0495652_0067287
2277 Ga0495652_0359748
2278 Ga0495665_0042159
2279 Ga0495640_0083054
2280 Ga0495587_0000558
2281 Ga0495587_0001220
2282 Ga0495587_0004299
2283 Ga0495587_0028966
2284 Ga0495587_0071106
2285 Ga0495621_0080601
2286 Ga0495621_0096439
2287 Ga0495645_0007662
2288 Ga0495645_0045560
2289 Ga0495645_0267122
2290 Ga0495633_0004527
2291 Ga0495667_0001591
2292 Ga0495667_0040259
2293 Ga0495667_0049036
2294 Ga0495656_0012822
2295 Ga0495656_0039230
2296 Ga0495668_0002736
2297 Ga0495634_0024844
2298 Ga0495634_0083618
2299 Ga0495611_0124750
2300 Ga0495625_0000014
2301 Ga0495659_0014646
2302 Ga0495661_0000221
2303 Ga0495661_0012090
2304 Ga0495661_0165978
2305 Ga0495588_0039789
2306 Ga0495657_0001304
2307 Ga0495599_0006862
2308 Ga0495599_0065895
2309 Ga0495623_0048616
2310 Ga0495623_0100504
2311 Ga0495623_0123540
2312 Ga0495646_0068769
2313 Ga0495646_0095465
2314 Ga0495658_0009083
2315 Ga0495658_0011647
2316 Ga0495658_0015511
2317 Ga0495658_0084179
2318 Ga0495669_0001150
2319 Ga0495669_0005036
2320 Ga0495613_0000428
2321 Ga0495613_0013455
2322 Ga0495613_0047679
2323 Ga0495613_0094297
2324 Ga0495613_0164428
2325 Ga0495613_0178618
2326 Ga0495670_0014695
2327 Ga0495670_0042086
2328 Ga0495649_0000205
2329 Ga0495649_0025062
2330 Ga0495589_0000022
2331 Ga0495660_0000044
2332 Ga0495581_0030525
2333 Ga0495604_0087995
2334 Ga0495604_0095535
2335 Ga0495604_0105351
2336 Ga0495604_0205571
2337 Ga0495636_0017297
2338 Ga0495636_0119296
2339 Ga0495674_0057298
2340 Ga0495674_0088288
2341 Ga0495674_0172345
2342 Ga0495674_0242839
2343 Ga0495672_0005576
2344 Ga0495672_0026596
2345 Ga0495672_0097613
2346 Ga0495680_0169769
2347 Ga0495687_000099
2348 Ga0495675_0001554
2349 Ga0495677_0000419
2350 Ga0495677_0004940
2351 Ga0495684_0000117
2352 Ga0495684_0008684
2353 Ga0495684_0042205
2354 Ga0495684_0114162
2355 Ga0495684_0149120
2356 Ga0495684_0310983
2357 Ga0495602_0000454
2358 Ga0495602_0000669
2359 Ga0495602_0004373
2360 Ga0495602_0144256
2361 Ga0495602_0188091
2362 Ga0495602_0248140
2363 Ga0495602_0389834
2364 Ga0495626_0000021
2365 Ga0496100_0070591
2366 Ga0496100_0086867
2367 Ga0496100_0091451
2368 Ga0496100_0092390
2369 Ga0496101_0018442
2370 Ga0496101_0074533
2371 Ga0496101_0109219
2372 Ga0496101_0149827
2373 Ga0496102_0013554
2374 Ga0496102_0082749
2375 Ga0496102_0114287
2376 Ga0496103_0005396
2377 Ga0496103_0047269
2378 Ga0496103_0100911
2379 Ga0496104_0000406
2380 Ga0496104_0009455
2381 Ga0496104_0027628
2382 Ga0496104_0036142
2383 Ga0496104_0113400
2384 Ga0496104_0115802
2385 Ga0496104_0368957
2386 Ga0496105_0002573
2387 Ga0496105_0002868
2388 Ga0496105_0017770
2389 Ga0496105_0034460
2390 Ga0496105_0053149
2391 Ga0496106_0031605
2392 Ga0496106_0085382
2393 Ga0496106_0225318
2394 Ga0496106_0245160
2395 Ga0496107_0020257
2396 Ga0496107_0068933
2397 Ga0496108_0003849
2398 Ga0496108_0027901
2399 Ga0496108_0102265
2400 Ga0496108_0216034
2401 Ga0496108_0293763
2402 Ga0496109_0032041
2403 Ga0496109_0032874
2404 Ga0496109_0048858
2405 Ga0496109_0130752
2406 Ga0496109_0147574
2407 Ga0496109_0476035
2408 Ga0496110_0015183
2409 Ga0496110_0017621
2410 Ga0496110_0200228
2411 Ga0496111_0051025
2412 Ga0496112_0002042
2413 Ga0496112_0015636
2414 Ga0496112_0036338
2415 Ga0496112_0083923
2416 Ga0496112_0145766
2417 Ga0496112_0303488
2418 Ga0496113_0011578
2419 Ga0496113_0059654
2420 Ga0496114_0028747
2421 Ga0496114_0028999
2422 Ga0496114_0066980
2423 Ga0496114_0463203
2424 Ga0496115_0005401
2425 Ga0496115_0012759
2426 Ga0496115_0058850
2427 Ga0496115_0065587
2428 Ga0496115_0149452
2429 Ga0496115_0261719
2430 Ga0496121_0355228
2431 Ga0496126_0091329
2432 Ga0501298_010232
2433 Ga0501034_0005118
2434 Ga0501034_0019520
2435 Ga0501034_0020632
2436 Ga0501034_0091869
2437 Ga0501036_0262139
2438 Ga0501041_0081607
2439 Ga0501042_0014192
2440 Ga0501043_0324623
2441 Ga0501046_0063906
2442 Ga0501046_0355800
2443 Ga0501047_0066421
2444 Ga0501047_0135420
2445 Ga0501047_0273771
2446 Ga0501068_0133883
2447 Ga0501069_0096551
2448 Ga0501070_0043503
2449 Ga0501070_0055626
2450 Ga0501070_0064543
2451 Ga0501070_0088970
2452 Ga0501070_0213533
2453 Ga0501071_0033438
2454 Ga0501072_0063265
2455 Ga0501072_0403707
2456 Ga0501074_0126106
2457 Ga0501075_0060558
2458 Ga0501075_0068460
2459 Ga0501075_0163699
2460 Ga0501076_0028885
2461 Ga0501079_0025243
2462 Ga0501079_0315507
2463 Ga0501080_0063543
2464 Ga0501080_0180770
2465 Ga0501081_0070318
2466 Ga0501272_001824
2467 Ga0501283_001260
2468 Ga0501045_0060947
2469 nmdc:mga03n38_7494_c1
2470 nmdc:mga0yw44_153427_c1
2471 nmdc:mga0yw44_2164_c1
2472 nmdc:mga0yw44_55158_c1
2473 nmdc:mga06z11_1143_c1
2474 nmdc:mga06z11_118152_c1
2475 nmdc:mga06z11_211721_c1
2476 nmdc:mga06z11_22438_c1
2477 nmdc:mga06z11_54001_c1
2478 nmdc:mga07m45_44184_c1
2479 nmdc:mga05p37_11743_c1
2480 nmdc:mga05p37_16523_c1
2481 nmdc:mga05p37_216107_c1
2482 nmdc:mga05p37_259281_c1
2483 nmdc:mga05p37_28051_c1
2484 nmdc:mga05p37_35787_c1
2485 nmdc:mga05p37_413989_c1
2486 nmdc:mga05p37_520847_c1
2487 nmdc:mga05p37_524734_c1
2488 nmdc:mga05p37_55206_c1
2489 nmdc:mga05p37_61022_c1
2490 nmdc:mga05p37_72924_c1
2491 nmdc:mga09592_14008_c1
2492 nmdc:mga09592_141557_c1
2493 nmdc:mga09592_212316_c1
2494 nmdc:mga09592_257445_c1
2495 nmdc:mga09592_52344_c1
2496 nmdc:mga09592_967_c1
2497 nmdc:mga0qj67_136894_c1
2498 nmdc:mga0qj67_15628_c1
2499 nmdc:mga0qj67_16084_c1
2500 nmdc:mga0qj67_201389_c1
2501 nmdc:mga0qj67_293274_c1
2502 nmdc:mga0qj67_86334_c1
2503 nmdc:mga06r32_118689_c1
2504 nmdc:mga08y16_12039_c1
2505 nmdc:mga08y16_128960_c1
2506 nmdc:mga08y16_1769_c1
2507 nmdc:mga08y16_2215_c1
2508 nmdc:mga08y16_2889_c1
2509 nmdc:mga08y16_309471_c1
2510 nmdc:mga08y16_317592_c1
2511 nmdc:mga08y16_37188_c1
2512 nmdc:mga08y16_47758_c1
2513 nmdc:mga08y16_5902_c1
2514 nmdc:mga08y16_63674_c1
2515 nmdc:mga08y16_83338_c1
2516 nmdc:mga0n895_146918_c1
2517 nmdc:mga0n895_17227_c1
2518 nmdc:mga0n895_443684_c1
2519 nmdc:mga0n895_44481_c1
2520 nmdc:mga0n895_92567_c1
2521 nmdc:mga0rr50_160160_c1
2522 nmdc:mga0rr50_185733_c1
2523 nmdc:mga0rr50_416265_c1
2524 nmdc:mga0a205_2492_c1
2525 nmdc:mga0a205_332334_c1
2526 nmdc:mga0a205_478306_c1
2527 nmdc:mga0a205_824_c1
2528 nmdc:mga0sz30_13246_c1
2529 Ga0495601_0000639
2530 Ga0495601_0004849
2531 Ga0495601_0034498
2532 Ga0495601_0048748
2533 Ga0495601_0096989
2534 Ga0495601_0205033
2535 Ga0495601_0268441
2536 Ga0495595_0002937
2537 Ga0495619_0000356
2538 Ga0495619_0006623
2539 Ga0495619_0019614
2540 Ga0495619_0100740
2541 Ga0500641_0005080
2542 Ga0500595_022630
2543 Ga0500595_034881
2544 Ga0500652_000004
2545 Ga0500652_000021
2546 Ga0500568_0000656
2547 Ga0500568_0004824
2548 Ga0500634_0010186
2549 Ga0500636_0002225
2550 Ga0500636_0066608
2551 Ga0501084_0106166
2552 Ga0501084_0343399
2553 Ga0501082_0331610
2554 Ga0530510_0042041
2555 Ga0530510_0356859
2556 2510251177
2557 2515685507
2558 2719640304
2559 2792838858
2560 2902688269
2561 8047678393
2562 8055271629

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

92

354

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.7759 3 336
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.7757 3 334
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7394 3 336
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.7312 3 336
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7255 3 336
ID Description Score Start End Superfamily
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7759 3 336 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7658 3 334 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7109 3 334 3.40.830.10
3vsgD00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7105 3 336 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.6984 3 336 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A7X4JDN2-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9849 1 337 GO:0008198
GO:0019489
GO:0051213
AF-A0A7X4JDN2-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.982 1 337 GO:0008198
GO:0019489
GO:0051213
AF-A0A2V7E7F6-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9819 214 337 GO:0008198
GO:0016491
AF-A0A1D2UK10-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9803 1 337 GO:0008198
GO:0019489
GO:0051213
AF-A0A2V8JNL5-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9802 224 337 GO:0008198
GO:0051213

Map