F492541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1282 | 387 | 2562 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0920430|Ga0436361_0920430_209_1306 |
| Length | 365 |
| Sequence | MKDLPRGPNKKLADSRLAFSRSSRRKCQMAQIVFGFGTSHGPLLATPPQEWDLRAKIDRENKSLAFRSGTYDFAQLCEMRKGDNFDLQNSLDVRAERNERCQKQLDALGDMVKVSDPDVLLIIGDDHHEWFLNDIQPAFSIFRGKQVYNRALTEEEQDKKTASGNMYAMRIYYPQRDETYQCPSDLATHLVSQVVHDGFDVASIGEQPTDGGVLRQLGHSYGFVYRRILRGHSVPLIPVIVNTFYPPNQPTPARCLAFGRALGRAISSWSGQERVAVAASGGVSHFVVDEEFDRRVLKAMRDRDYDTLAKEPDINFRSGTSETKNWLVLAGILAETSLSMDVLDYVPCYRSEAGTGSGMAFAAWQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 135 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 246 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 334 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 354 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 373 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 381 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 382 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 383 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 384 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 385 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 386 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 387 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.06 |
| Metatranscriptomes | 0.39 |
| Isolates | 0.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0.31 |
| Rhizoplane | 5.07 |
| Rhizosphere | 90.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_0920430 | 3300039447 | Unclassified | 1674 |
| 2 | JGI24744J21845_10010566 | 3300002077 | Bacteria | 1892 |
| 3 | JGI24033J26618_1005216 | 3300002155 | Bacteria | 1427 |
| 4 | JGI24742J22300_10000688 | 3300002244 | Bacteria | 5099 |
| 5 | JGI25406J46586_10000393 | 3300003203 | Bacteria | 20038 |
| 6 | JGI25406J46586_10002426 | 3300003203 | Bacteria | 8814 |
| 7 | JGI25406J46586_10049082 | 3300003203 | Bacteria | 1426 |
| 8 | JGI25406J46586_10054052 | 3300003203 | Bacteria | 1330 |
| 9 | JGI25405J52794_10002066 | 3300003911 | Bacteria | 3413 |
| 10 | Ga0065704_10138674 | 3300005289 | Bacteria | 1541 |
| 11 | Ga0065712_10102051 | 3300005290 | Bacteria | 2011 |
| 12 | Ga0065715_10184617 | 3300005293 | Bacteria | 1453 |
| 13 | Ga0070658_10140404 | 3300005327 | Bacteria | 2018 |
| 14 | Ga0070658_10228260 | 3300005327 | Bacteria | 1576 |
| 15 | Ga0070676_10011166 | 3300005328 | Bacteria | 4880 |
| 16 | Ga0070676_10029136 | 3300005328 | Bacteria | 3139 |
| 17 | Ga0070676_10220658 | 3300005328 | Bacteria | 1252 |
| 18 | Ga0070676_10227425 | 3300005328 | Unclassified | 1235 |
| 19 | Ga0070683_100000301 | 3300005329 | Bacteria | 33790 |
| 20 | Ga0070683_100007229 | 3300005329 | Bacteria | 9370 |
| 21 | Ga0070683_100014020 | 3300005329 | Bacteria | 6999 |
| 22 | Ga0070683_100050193 | 3300005329 | Bacteria | 3861 |
| 23 | Ga0070683_100073743 | 3300005329 | Bacteria | 3187 |
| 24 | Ga0070683_100124602 | 3300005329 | Bacteria | 2435 |
| 25 | Ga0070683_100129398 | 3300005329 | Bacteria | 2388 |
| 26 | Ga0070683_100251360 | 3300005329 | Bacteria | 1681 |
| 27 | Ga0070690_100005585 | 3300005330 | Bacteria | 7075 |
| 28 | Ga0070690_100005812 | 3300005330 | Bacteria | 6951 |
| 29 | Ga0070690_100017529 | 3300005330 | Bacteria | 4309 |
| 30 | Ga0070690_100026462 | 3300005330 | Bacteria | 3578 |
| 31 | Ga0070690_100054616 | 3300005330 | Unclassified | 2557 |
| 32 | Ga0070690_100061743 | 3300005330 | Bacteria | 2415 |
| 33 | Ga0070690_100100883 | 3300005330 | Bacteria | 1914 |
| 34 | Ga0070670_100000974 | 3300005331 | Bacteria | 22427 |
| 35 | Ga0070670_100013453 | 3300005331 | Bacteria | 7009 |
| 36 | Ga0070670_100018295 | 3300005331 | Bacteria | 6012 |
| 37 | Ga0070670_100024356 | 3300005331 | Bacteria | 5204 |
| 38 | Ga0070670_100048960 | 3300005331 | Bacteria | 3636 |
| 39 | Ga0070670_100095815 | 3300005331 | Unclassified | 2553 |
| 40 | Ga0070670_100323125 | 3300005331 | Unclassified | 1352 |
| 41 | Ga0070677_10002771 | 3300005333 | Bacteria | 5610 |
| 42 | Ga0070677_10008993 | 3300005333 | Bacteria | 3378 |
| 43 | Ga0068869_100007259 | 3300005334 | Bacteria | 7062 |
| 44 | Ga0068869_100009214 | 3300005334 | Bacteria | 6395 |
| 45 | Ga0068869_100026931 | 3300005334 | Bacteria | 4004 |
| 46 | Ga0068869_100035710 | 3300005334 | Bacteria | 3525 |
| 47 | Ga0068869_100135283 | 3300005334 | Bacteria | 1898 |
| 48 | Ga0068869_100174182 | 3300005334 | Unclassified | 1683 |
| 49 | Ga0070666_10019084 | 3300005335 | Bacteria | 4421 |
| 50 | Ga0070666_10030598 | 3300005335 | Bacteria | 3548 |
| 51 | Ga0070666_10044920 | 3300005335 | Bacteria | 2961 |
| 52 | Ga0070680_100001316 | 3300005336 | Bacteria | 17997 |
| 53 | Ga0070680_100001335 | 3300005336 | Bacteria | 17856 |
| 54 | Ga0070680_100009677 | 3300005336 | Bacteria | 7416 |
| 55 | Ga0068868_100006725 | 3300005338 | Bacteria | 8162 |
| 56 | Ga0068868_100010392 | 3300005338 | Bacteria | 6737 |
| 57 | Ga0068868_100014330 | 3300005338 | Bacteria | 5842 |
| 58 | Ga0068868_100029869 | 3300005338 | Bacteria | 4176 |
| 59 | Ga0068868_100058202 | 3300005338 | Bacteria | 3054 |
| 60 | Ga0070660_100091242 | 3300005339 | Bacteria | 2403 |
| 61 | Ga0070660_100225540 | 3300005339 | Unclassified | 1524 |
| 62 | Ga0070689_100012396 | 3300005340 | Bacteria | 6140 |
| 63 | Ga0070689_100069996 | 3300005340 | Unclassified | 2738 |
| 64 | Ga0070689_100107386 | 3300005340 | Unclassified | 2216 |
| 65 | Ga0070689_100145963 | 3300005340 | Bacteria | 1905 |
| 66 | Ga0070691_10000324 | 3300005341 | Bacteria | 16893 |
| 67 | Ga0070687_100008670 | 3300005343 | Unclassified | 4316 |
| 68 | Ga0070687_100046081 | 3300005343 | Bacteria | 2230 |
| 69 | Ga0070687_100104374 | 3300005343 | Bacteria | 1593 |
| 70 | Ga0070687_100178246 | 3300005343 | Bacteria | 1271 |
| 71 | Ga0070661_100011281 | 3300005344 | Bacteria | 6226 |
| 72 | Ga0070661_100019692 | 3300005344 | Bacteria | 4809 |
| 73 | Ga0070661_100106930 | 3300005344 | Unclassified | 2086 |
| 74 | Ga0070661_100150999 | 3300005344 | Bacteria | 1756 |
| 75 | Ga0070661_100204408 | 3300005344 | Bacteria | 1510 |
| 76 | Ga0070661_100353104 | 3300005344 | Unclassified | 1154 |
| 77 | Ga0070692_10111871 | 3300005345 | Bacteria | 1511 |
| 78 | Ga0070692_10200172 | 3300005345 | Bacteria | 1169 |
| 79 | Ga0070669_100004616 | 3300005353 | Bacteria | 9940 |
| 80 | Ga0070669_100016001 | 3300005353 | Bacteria | 5352 |
| 81 | Ga0070669_100030914 | 3300005353 | Bacteria | 3865 |
| 82 | Ga0070669_100278550 | 3300005353 | Unclassified | 1339 |
| 83 | Ga0070675_100000644 | 3300005354 | Bacteria | 24114 |
| 84 | Ga0070675_100001188 | 3300005354 | Bacteria | 18929 |
| 85 | Ga0070675_100003309 | 3300005354 | Bacteria | 12223 |
| 86 | Ga0070675_100027191 | 3300005354 | Bacteria | 4594 |
| 87 | Ga0070675_100075583 | 3300005354 | Unclassified | 2800 |
| 88 | Ga0070675_100107358 | 3300005354 | Unclassified | 2357 |
| 89 | Ga0070675_100114732 | 3300005354 | Unclassified | 2283 |
| 90 | Ga0070675_100328252 | 3300005354 | Bacteria | 1353 |
| 91 | Ga0070671_100039225 | 3300005355 | Bacteria | 3931 |
| 92 | Ga0070671_100039557 | 3300005355 | Bacteria | 3914 |
| 93 | Ga0070671_100062326 | 3300005355 | Unclassified | 3106 |
| 94 | Ga0070671_100122770 | 3300005355 | Unclassified | 2186 |
| 95 | Ga0070671_100219325 | 3300005355 | Bacteria | 1614 |
| 96 | Ga0070674_100004510 | 3300005356 | Bacteria | 7947 |
| 97 | Ga0070674_100073938 | 3300005356 | Unclassified | 2417 |
| 98 | Ga0070674_100090130 | 3300005356 | Bacteria | 2211 |
| 99 | Ga0070674_100218530 | 3300005356 | Unclassified | 1481 |
| 100 | Ga0070674_100243305 | 3300005356 | Unclassified | 1410 |
| 101 | Ga0070674_100279285 | 3300005356 | Bacteria | 1323 |
| 102 | Ga0070673_100020932 | 3300005364 | Bacteria | 4728 |
| 103 | Ga0070673_100024873 | 3300005364 | Bacteria | 4397 |
| 104 | Ga0070673_100025354 | 3300005364 | Bacteria | 4363 |
| 105 | Ga0070673_100026223 | 3300005364 | Unclassified | 4302 |
| 106 | Ga0070673_100132007 | 3300005364 | Unclassified | 2097 |
| 107 | Ga0070673_100184448 | 3300005364 | Bacteria | 1788 |
| 108 | Ga0070673_100211560 | 3300005364 | Unclassified | 1675 |
| 109 | Ga0070688_100008145 | 3300005365 | Bacteria | 5678 |
| 110 | Ga0070688_100013932 | 3300005365 | Bacteria | 4548 |
| 111 | Ga0070688_100039988 | 3300005365 | Bacteria | 2872 |
| 112 | Ga0070688_100081378 | 3300005365 | Bacteria | 2097 |
| 113 | Ga0070688_100094296 | 3300005365 | Bacteria | 1962 |
| 114 | Ga0070659_100008560 | 3300005366 | Bacteria | 7480 |
| 115 | Ga0070659_100060974 | 3300005366 | Unclassified | 2980 |
| 116 | Ga0070659_100133583 | 3300005366 | Bacteria | 2017 |
| 117 | Ga0070659_100303077 | 3300005366 | Bacteria | 1333 |
| 118 | Ga0070659_100314517 | 3300005366 | Bacteria | 1308 |
| 119 | Ga0070667_100008209 | 3300005367 | Bacteria | 8655 |
| 120 | Ga0070667_100011865 | 3300005367 | Bacteria | 7206 |
| 121 | Ga0070667_100020877 | 3300005367 | Bacteria | 5440 |
| 122 | Ga0070667_100048372 | 3300005367 | Bacteria | 3579 |
| 123 | Ga0070667_100429441 | 3300005367 | Bacteria | 1205 |
| 124 | Ga0070709_10141420 | 3300005434 | Bacteria | 1654 |
| 125 | Ga0070714_100044338 | 3300005435 | Bacteria | 3765 |
| 126 | Ga0070714_100138874 | 3300005435 | Bacteria | 2179 |
| 127 | Ga0070714_100385438 | 3300005435 | Unclassified | 1322 |
| 128 | Ga0070714_100441605 | 3300005435 | Bacteria | 1235 |
| 129 | Ga0070714_100529998 | 3300005435 | Bacteria | 1126 |
| 130 | Ga0070713_100018211 | 3300005436 | Bacteria | 5336 |
| 131 | Ga0070713_100030488 | 3300005436 | Bacteria | 4283 |
| 132 | Ga0070713_100039332 | 3300005436 | Unclassified | 3837 |
| 133 | Ga0070713_100049632 | 3300005436 | Bacteria | 3463 |
| 134 | Ga0070713_100069174 | 3300005436 | Bacteria | 2976 |
| 135 | Ga0070713_100291034 | 3300005436 | Bacteria | 1501 |
| 136 | Ga0070713_100462597 | 3300005436 | Unclassified | 1193 |
| 137 | Ga0070701_10008881 | 3300005438 | Bacteria | 4373 |
| 138 | Ga0070701_10013651 | 3300005438 | Bacteria | 3702 |
| 139 | Ga0070701_10161672 | 3300005438 | Unclassified | 1297 |
| 140 | Ga0070711_100101480 | 3300005439 | Bacteria | 2094 |
| 141 | Ga0070711_100219847 | 3300005439 | Bacteria | 1476 |
| 142 | Ga0070711_100251435 | 3300005439 | Unclassified | 1387 |
| 143 | Ga0070705_100079777 | 3300005440 | Unclassified | 2006 |
| 144 | Ga0070705_100195361 | 3300005440 | Bacteria | 1383 |
| 145 | Ga0070700_100017507 | 3300005441 | Bacteria | 4100 |
| 146 | Ga0070700_100023549 | 3300005441 | Unclassified | 3603 |
| 147 | Ga0070700_100085121 | 3300005441 | Bacteria | 2050 |
| 148 | Ga0070700_100333858 | 3300005441 | Bacteria | 1118 |
| 149 | Ga0070708_100467645 | 3300005445 | Unclassified | 1190 |
| 150 | Ga0070678_100033289 | 3300005456 | Bacteria | 3577 |
| 151 | Ga0070678_100078695 | 3300005456 | Bacteria | 2491 |
| 152 | Ga0070678_100082787 | 3300005456 | Bacteria | 2437 |
| 153 | Ga0070678_100138521 | 3300005456 | Unclassified | 1944 |
| 154 | Ga0070678_100304707 | 3300005456 | Unclassified | 1355 |
| 155 | Ga0070662_100014432 | 3300005457 | Bacteria | 5279 |
| 156 | Ga0070662_100044895 | 3300005457 | Bacteria | 3168 |
| 157 | Ga0070662_100070282 | 3300005457 | Unclassified | 2579 |
| 158 | Ga0070662_100108085 | 3300005457 | Unclassified | 2115 |
| 159 | Ga0070681_10008296 | 3300005458 | Bacteria | 10171 |
| 160 | Ga0070681_10009631 | 3300005458 | Bacteria | 9501 |
| 161 | Ga0070681_10022535 | 3300005458 | Bacteria | 6325 |
| 162 | Ga0070681_10032405 | 3300005458 | Bacteria | 5244 |
| 163 | Ga0070681_10066078 | 3300005458 | Unclassified | 3585 |
| 164 | Ga0070681_10076173 | 3300005458 | Bacteria | 3314 |
| 165 | Ga0070681_10094217 | 3300005458 | Bacteria | 2943 |
| 166 | Ga0070681_10172389 | 3300005458 | Bacteria | 2085 |
| 167 | Ga0070681_10228249 | 3300005458 | Unclassified | 1776 |
| 168 | Ga0070681_10275489 | 3300005458 | Bacteria | 1594 |
| 169 | Ga0068867_100034640 | 3300005459 | Bacteria | 3660 |
| 170 | Ga0068867_100037213 | 3300005459 | Bacteria | 3537 |
| 171 | Ga0068867_100336738 | 3300005459 | Unclassified | 1255 |
| 172 | Ga0070685_10221747 | 3300005466 | Bacteria | 1239 |
| 173 | Ga0070698_100083468 | 3300005471 | Bacteria | 3184 |
| 174 | Ga0070698_100342720 | 3300005471 | Bacteria | 1426 |
| 175 | Ga0070699_100070838 | 3300005518 | Bacteria | 3031 |
| 176 | Ga0070699_100105534 | 3300005518 | Unclassified | 2472 |
| 177 | Ga0070679_100004740 | 3300005530 | Bacteria | 12542 |
| 178 | Ga0070679_100015693 | 3300005530 | Bacteria | 7282 |
| 179 | Ga0070679_100017008 | 3300005530 | Bacteria | 7030 |
| 180 | Ga0070679_100021451 | 3300005530 | Bacteria | 6306 |
| 181 | Ga0070679_100112724 | 3300005530 | Bacteria | 2705 |
| 182 | Ga0070679_100210601 | 3300005530 | Unclassified | 1908 |
| 183 | Ga0070684_100001680 | 3300005535 | Bacteria | 16075 |
| 184 | Ga0070684_100007348 | 3300005535 | Bacteria | 8563 |
| 185 | Ga0070684_100012682 | 3300005535 | Bacteria | 6762 |
| 186 | Ga0070684_100076402 | 3300005535 | Bacteria | 2956 |
| 187 | Ga0070684_100113031 | 3300005535 | Unclassified | 2436 |
| 188 | Ga0070684_100321308 | 3300005535 | Bacteria | 1422 |
| 189 | Ga0070697_100468662 | 3300005536 | Bacteria | 1099 |
| 190 | Ga0068853_100013038 | 3300005539 | Bacteria | 6778 |
| 191 | Ga0068853_100024105 | 3300005539 | Bacteria | 5100 |
| 192 | Ga0068853_100075555 | 3300005539 | Bacteria | 2940 |
| 193 | Ga0068853_100092275 | 3300005539 | Bacteria | 2664 |
| 194 | Ga0068853_100154957 | 3300005539 | Bacteria | 2064 |
| 195 | Ga0068853_100197011 | 3300005539 | Bacteria | 1832 |
| 196 | Ga0070672_100011068 | 3300005543 | Bacteria | 6281 |
| 197 | Ga0070672_100018764 | 3300005543 | Bacteria | 5009 |
| 198 | Ga0070672_100023131 | 3300005543 | Bacteria | 4577 |
| 199 | Ga0070672_100046934 | 3300005543 | Bacteria | 3349 |
| 200 | Ga0070672_100139048 | 3300005543 | Unclassified | 2002 |
| 201 | Ga0070672_100261424 | 3300005543 | Unclassified | 1460 |
| 202 | Ga0070686_100009770 | 3300005544 | Bacteria | 5391 |
| 203 | Ga0070686_100013446 | 3300005544 | Bacteria | 4689 |
| 204 | Ga0070686_100023771 | 3300005544 | Unclassified | 3667 |
| 205 | Ga0070686_100037728 | 3300005544 | Bacteria | 2999 |
| 206 | Ga0070686_100122391 | 3300005544 | Bacteria | 1788 |
| 207 | Ga0070695_100197823 | 3300005545 | Bacteria | 1434 |
| 208 | Ga0070696_100260870 | 3300005546 | Unclassified | 1314 |
| 209 | Ga0070693_100023319 | 3300005547 | Bacteria | 3306 |
| 210 | Ga0070665_100008439 | 3300005548 | Bacteria | 10421 |
| 211 | Ga0070665_100056481 | 3300005548 | Unclassified | 3935 |
| 212 | Ga0070665_100076361 | 3300005548 | Bacteria | 3357 |
| 213 | Ga0070665_100166516 | 3300005548 | Bacteria | 2206 |
| 214 | Ga0070665_100263670 | 3300005548 | Unclassified | 1724 |
| 215 | Ga0070704_100092750 | 3300005549 | Bacteria | 2255 |
| 216 | Ga0068855_100002819 | 3300005563 | Bacteria | 21408 |
| 217 | Ga0068855_100005925 | 3300005563 | Bacteria | 14901 |
| 218 | Ga0068855_100040045 | 3300005563 | Bacteria | 5562 |
| 219 | Ga0068855_100081259 | 3300005563 | Unclassified | 3757 |
| 220 | Ga0068855_100115545 | 3300005563 | Bacteria | 3076 |
| 221 | Ga0068855_100164037 | 3300005563 | Bacteria | 2520 |
| 222 | Ga0068855_100188262 | 3300005563 | Bacteria | 2330 |
| 223 | Ga0070664_100014604 | 3300005564 | Bacteria | 6408 |
| 224 | Ga0070664_100022987 | 3300005564 | Bacteria | 5144 |
| 225 | Ga0070664_100033721 | 3300005564 | Bacteria | 4291 |
| 226 | Ga0070664_100216439 | 3300005564 | Unclassified | 1713 |
| 227 | Ga0068857_100015291 | 3300005577 | Bacteria | 6699 |
| 228 | Ga0068857_100015475 | 3300005577 | Bacteria | 6663 |
| 229 | Ga0068857_100035161 | 3300005577 | Bacteria | 4435 |
| 230 | Ga0068857_100126450 | 3300005577 | Unclassified | 2304 |
| 231 | Ga0068857_100126977 | 3300005577 | Bacteria | 2299 |
| 232 | Ga0068857_100241378 | 3300005577 | Bacteria | 1654 |
| 233 | Ga0068857_100319395 | 3300005577 | Bacteria | 1434 |
| 234 | Ga0068854_100237622 | 3300005578 | Bacteria | 1449 |
| 235 | Ga0068856_100001168 | 3300005614 | Bacteria | 27615 |
| 236 | Ga0068856_100014581 | 3300005614 | Bacteria | 7594 |
| 237 | Ga0068856_100019448 | 3300005614 | Bacteria | 6591 |
| 238 | Ga0068856_100026599 | 3300005614 | Bacteria | 5642 |
| 239 | Ga0068856_100142501 | 3300005614 | Bacteria | 2404 |
| 240 | Ga0068856_100167929 | 3300005614 | Bacteria | 2205 |
| 241 | Ga0068856_100341959 | 3300005614 | Bacteria | 1514 |
| 242 | Ga0070702_100008723 | 3300005615 | Bacteria | 4926 |
| 243 | Ga0070702_100101337 | 3300005615 | Unclassified | 1767 |
| 244 | Ga0068852_100009496 | 3300005616 | Bacteria | 7228 |
| 245 | Ga0068852_100021458 | 3300005616 | Bacteria | 5158 |
| 246 | Ga0068852_100146475 | 3300005616 | Bacteria | 2191 |
| 247 | Ga0068852_100324058 | 3300005616 | Unclassified | 1497 |
| 248 | Ga0068852_100451881 | 3300005616 | Unclassified | 1272 |
| 249 | Ga0068859_100014354 | 3300005617 | Bacteria | 7946 |
| 250 | Ga0068859_100078422 | 3300005617 | Bacteria | 3343 |
| 251 | Ga0068859_100082514 | 3300005617 | Bacteria | 3257 |
| 252 | Ga0068859_100092226 | 3300005617 | Bacteria | 3080 |
| 253 | Ga0068859_100113609 | 3300005617 | Bacteria | 2772 |
| 254 | Ga0068859_100132726 | 3300005617 | Bacteria | 2562 |
| 255 | Ga0068859_100199251 | 3300005617 | Bacteria | 2087 |
| 256 | Ga0068859_100305576 | 3300005617 | Bacteria | 1684 |
| 257 | Ga0068859_100333227 | 3300005617 | Bacteria | 1612 |
| 258 | Ga0068859_100391398 | 3300005617 | Bacteria | 1486 |
| 259 | Ga0068864_100002489 | 3300005618 | Bacteria | 15223 |
| 260 | Ga0068864_100047520 | 3300005618 | Bacteria | 3687 |
| 261 | Ga0068864_100061335 | 3300005618 | Bacteria | 3257 |
| 262 | Ga0068864_100119949 | 3300005618 | Bacteria | 2350 |
| 263 | Ga0068864_100235155 | 3300005618 | Unclassified | 1696 |
| 264 | Ga0068861_100135391 | 3300005719 | Bacteria | 2004 |
| 265 | Ga0068861_100144878 | 3300005719 | Unclassified | 1943 |
| 266 | Ga0068851_10083405 | 3300005834 | Bacteria | 1672 |
| 267 | Ga0068870_10001158 | 3300005840 | Bacteria | 10555 |
| 268 | Ga0068870_10004289 | 3300005840 | Bacteria | 6136 |
| 269 | Ga0068870_10007546 | 3300005840 | Bacteria | 4854 |
| 270 | Ga0068870_10099422 | 3300005840 | Unclassified | 1641 |
| 271 | Ga0068870_10159685 | 3300005840 | Unclassified | 1336 |
| 272 | Ga0068863_100014331 | 3300005841 | Bacteria | 7635 |
| 273 | Ga0068863_100016886 | 3300005841 | Bacteria | 7000 |
| 274 | Ga0068863_100023491 | 3300005841 | Bacteria | 5886 |
| 275 | Ga0068863_100190271 | 3300005841 | Unclassified | 1972 |
| 276 | Ga0068858_100028766 | 3300005842 | Bacteria | 5161 |
| 277 | Ga0068858_100031181 | 3300005842 | Bacteria | 4950 |
| 278 | Ga0068858_100041156 | 3300005842 | Bacteria | 4286 |
| 279 | Ga0068858_100042373 | 3300005842 | Bacteria | 4221 |
| 280 | Ga0068858_100054060 | 3300005842 | Bacteria | 3713 |
| 281 | Ga0068860_100010576 | 3300005843 | Bacteria | 9113 |
| 282 | Ga0068860_100018643 | 3300005843 | Bacteria | 6750 |
| 283 | Ga0068860_100051204 | 3300005843 | Bacteria | 3929 |
| 284 | Ga0068860_100086035 | 3300005843 | Bacteria | 2991 |
| 285 | Ga0068860_100142556 | 3300005843 | Bacteria | 2304 |
| 286 | Ga0068862_100020187 | 3300005844 | Bacteria | 5564 |
| 287 | Ga0068862_100071365 | 3300005844 | Bacteria | 2998 |
| 288 | Ga0068862_100231099 | 3300005844 | Bacteria | 1678 |
| 289 | Ga0081455_10000840 | 3300005937 | Bacteria | 39521 |
| 290 | Ga0081455_10021104 | 3300005937 | Bacteria | 6115 |
| 291 | Ga0081455_10034725 | 3300005937 | Bacteria | 4515 |
| 292 | Ga0081538_10027048 | 3300005981 | Bacteria | 3988 |
| 293 | Ga0081539_10000047 | 3300005985 | Bacteria | 275235 |
| 294 | Ga0081539_10002846 | 3300005985 | Bacteria | 23053 |
| 295 | Ga0081539_10004786 | 3300005985 | Bacteria | 14592 |
| 296 | Ga0081539_10014737 | 3300005985 | Bacteria | 5748 |
| 297 | Ga0075365_10003122 | 3300006038 | Bacteria | 8432 |
| 298 | Ga0075365_10010200 | 3300006038 | Bacteria | 5457 |
| 299 | Ga0075365_10074434 | 3300006038 | Bacteria | 2290 |
| 300 | Ga0075365_10099906 | 3300006038 | Bacteria | 1986 |
| 301 | Ga0075364_10020903 | 3300006051 | Bacteria | 4121 |
| 302 | Ga0070715_10099109 | 3300006163 | Bacteria | 1356 |
| 303 | Ga0070712_100022120 | 3300006175 | Bacteria | 4184 |
| 304 | Ga0070712_100043331 | 3300006175 | Bacteria | 3098 |
| 305 | Ga0070712_100451848 | 3300006175 | Unclassified | 1070 |
| 306 | Ga0075362_10043835 | 3300006177 | Unclassified | 1982 |
| 307 | Ga0075362_10054401 | 3300006177 | Bacteria | 1798 |
| 308 | Ga0075367_10014301 | 3300006178 | Bacteria | 4293 |
| 309 | Ga0075367_10080533 | 3300006178 | Bacteria | 1970 |
| 310 | Ga0075367_10106252 | 3300006178 | Bacteria | 1720 |
| 311 | Ga0075367_10211142 | 3300006178 | Bacteria | 1214 |
| 312 | Ga0075427_10006826 | 3300006194 | Bacteria | 1665 |
| 313 | Ga0075366_10022922 | 3300006195 | Bacteria | 3635 |
| 314 | Ga0097621_100012607 | 3300006237 | Bacteria | 6271 |
| 315 | Ga0097621_100032737 | 3300006237 | Bacteria | 4135 |
| 316 | Ga0097621_100033878 | 3300006237 | Bacteria | 4071 |
| 317 | Ga0097621_100053281 | 3300006237 | Bacteria | 3297 |
| 318 | Ga0097621_100074759 | 3300006237 | Bacteria | 2807 |
| 319 | Ga0097621_100181121 | 3300006237 | Bacteria | 1821 |
| 320 | Ga0097621_100235576 | 3300006237 | Bacteria | 1599 |
| 321 | Ga0097621_100235787 | 3300006237 | Unclassified | 1598 |
| 322 | Ga0097621_100277356 | 3300006237 | Bacteria | 1475 |
| 323 | Ga0097621_100476508 | 3300006237 | Bacteria | 1128 |
| 324 | Ga0068871_100014427 | 3300006358 | Bacteria | 5893 |
| 325 | Ga0068871_100020640 | 3300006358 | Bacteria | 5051 |
| 326 | Ga0068871_100079316 | 3300006358 | Bacteria | 2716 |
| 327 | Ga0068871_100083862 | 3300006358 | Unclassified | 2644 |
| 328 | Ga0068871_100270691 | 3300006358 | Bacteria | 1484 |
| 329 | Ga0075428_100005211 | 3300006844 | Bacteria | 14451 |
| 330 | Ga0075428_100034588 | 3300006844 | Bacteria | 5572 |
| 331 | Ga0075428_100052788 | 3300006844 | Bacteria | 4454 |
| 332 | Ga0075428_100070527 | 3300006844 | Bacteria | 3820 |
| 333 | Ga0075428_100077794 | 3300006844 | Bacteria | 3621 |
| 334 | Ga0075428_100095292 | 3300006844 | Bacteria | 3244 |
| 335 | Ga0075428_100113329 | 3300006844 | Bacteria | 2954 |
| 336 | Ga0075428_100138885 | 3300006844 | Bacteria | 2642 |
| 337 | Ga0075428_100230447 | 3300006844 | Bacteria | 1999 |
| 338 | Ga0075428_100304665 | 3300006844 | Bacteria | 1713 |
| 339 | Ga0075430_100002643 | 3300006846 | Bacteria | 14961 |
| 340 | Ga0075430_100013828 | 3300006846 | Bacteria | 6876 |
| 341 | Ga0075430_100039729 | 3300006846 | Bacteria | 3982 |
| 342 | Ga0075430_100056531 | 3300006846 | Bacteria | 3299 |
| 343 | Ga0075430_100078529 | 3300006846 | Bacteria | 2767 |
| 344 | Ga0075430_100132101 | 3300006846 | Bacteria | 2081 |
| 345 | Ga0075431_100000646 | 3300006847 | Bacteria | 29552 |
| 346 | Ga0075431_100031593 | 3300006847 | Bacteria | 5453 |
| 347 | Ga0075431_100106227 | 3300006847 | Bacteria | 2897 |
| 348 | Ga0075431_100194412 | 3300006847 | Bacteria | 2077 |
| 349 | Ga0075431_100523971 | 3300006847 | Bacteria | 1174 |
| 350 | Ga0075433_10000460 | 3300006852 | Bacteria | 26456 |
| 351 | Ga0075433_10001289 | 3300006852 | Bacteria | 18331 |
| 352 | Ga0075433_10001670 | 3300006852 | Bacteria | 16530 |
| 353 | Ga0075433_10209782 | 3300006852 | Unclassified | 1731 |
| 354 | Ga0075434_100003682 | 3300006871 | Bacteria | 13693 |
| 355 | Ga0075434_100016390 | 3300006871 | Bacteria | 7123 |
| 356 | Ga0075434_100065432 | 3300006871 | Bacteria | 3620 |
| 357 | Ga0075434_100283137 | 3300006871 | Bacteria | 1677 |
| 358 | Ga0075434_100323868 | 3300006871 | Bacteria | 1562 |
| 359 | Ga0075429_100001853 | 3300006880 | Bacteria | 17516 |
| 360 | Ga0075429_100251220 | 3300006880 | Bacteria | 1549 |
| 361 | Ga0075429_100271027 | 3300006880 | Unclassified | 1487 |
| 362 | Ga0068865_100003824 | 3300006881 | Bacteria | 9036 |
| 363 | Ga0068865_100080632 | 3300006881 | Unclassified | 2335 |
| 364 | Ga0068865_100108285 | 3300006881 | Bacteria | 2045 |
| 365 | Ga0068865_100326202 | 3300006881 | Unclassified | 1237 |
| 366 | Ga0097620_100014354 | 3300006931 | Bacteria | 7946 |
| 367 | Ga0097620_100078423 | 3300006931 | Bacteria | 3343 |
| 368 | Ga0097620_100082515 | 3300006931 | Bacteria | 3257 |
| 369 | Ga0097620_100092224 | 3300006931 | Bacteria | 3080 |
| 370 | Ga0097620_100113612 | 3300006931 | Bacteria | 2772 |
| 371 | Ga0097620_100132726 | 3300006931 | Bacteria | 2562 |
| 372 | Ga0097620_100199255 | 3300006931 | Bacteria | 2087 |
| 373 | Ga0097620_100305547 | 3300006931 | Bacteria | 1684 |
| 374 | Ga0097620_100333204 | 3300006931 | Bacteria | 1612 |
| 375 | Ga0097620_100391354 | 3300006931 | Bacteria | 1486 |
| 376 | Ga0075435_100295006 | 3300007076 | Unclassified | 1386 |
| 377 | Ga0099795_10046363 | 3300007788 | Bacteria | 1566 |
| 378 | Ga0105240_10007648 | 3300009093 | Bacteria | 15651 |
| 379 | Ga0105240_10022565 | 3300009093 | Bacteria | 8341 |
| 380 | Ga0105240_10032830 | 3300009093 | Bacteria | 6715 |
| 381 | Ga0105240_10034115 | 3300009093 | Bacteria | 6567 |
| 382 | Ga0105240_10060448 | 3300009093 | Bacteria | 4724 |
| 383 | Ga0105240_10095953 | 3300009093 | Bacteria | 3615 |
| 384 | Ga0105240_10497798 | 3300009093 | Bacteria | 1356 |
| 385 | Ga0111539_10000151 | 3300009094 | Bacteria | 79134 |
| 386 | Ga0111539_10000562 | 3300009094 | Bacteria | 47603 |
| 387 | Ga0111539_10002437 | 3300009094 | Bacteria | 24741 |
| 388 | Ga0111539_10002719 | 3300009094 | Bacteria | 23469 |
| 389 | Ga0111539_10003382 | 3300009094 | Bacteria | 21034 |
| 390 | Ga0111539_10015153 | 3300009094 | Bacteria | 9606 |
| 391 | Ga0111539_10021998 | 3300009094 | Bacteria | 7838 |
| 392 | Ga0111539_10039106 | 3300009094 | Bacteria | 5719 |
| 393 | Ga0111539_10050957 | 3300009094 | Bacteria | 4932 |
| 394 | Ga0111539_10150753 | 3300009094 | Bacteria | 2722 |
| 395 | Ga0111539_10251357 | 3300009094 | Bacteria | 2058 |
| 396 | Ga0111539_10285962 | 3300009094 | Bacteria | 1919 |
| 397 | Ga0111539_10348270 | 3300009094 | Bacteria | 1724 |
| 398 | Ga0105245_10001655 | 3300009098 | Bacteria | 20281 |
| 399 | Ga0105245_10004216 | 3300009098 | Bacteria | 12760 |
| 400 | Ga0105245_10008681 | 3300009098 | Bacteria | 8863 |
| 401 | Ga0105245_10016334 | 3300009098 | Bacteria | 6473 |
| 402 | Ga0105245_10036311 | 3300009098 | Bacteria | 4377 |
| 403 | Ga0105247_10007255 | 3300009101 | Bacteria | 6808 |
| 404 | Ga0105247_10022228 | 3300009101 | Bacteria | 3819 |
| 405 | Ga0105247_10022256 | 3300009101 | Bacteria | 3817 |
| 406 | Ga0114129_10000797 | 3300009147 | Bacteria | 40445 |
| 407 | Ga0114129_10002798 | 3300009147 | Bacteria | 24345 |
| 408 | Ga0114129_10004770 | 3300009147 | Bacteria | 19166 |
| 409 | Ga0114129_10078064 | 3300009147 | Bacteria | 4606 |
| 410 | Ga0114129_10119066 | 3300009147 | Bacteria | 3637 |
| 411 | Ga0114129_10126143 | 3300009147 | Bacteria | 3519 |
| 412 | Ga0114129_10167684 | 3300009147 | Bacteria | 2995 |
| 413 | Ga0114129_10266178 | 3300009147 | Unclassified | 2295 |
| 414 | Ga0114129_10314380 | 3300009147 | Bacteria | 2084 |
| 415 | Ga0114129_10340973 | 3300009147 | Bacteria | 1988 |
| 416 | Ga0114129_10655453 | 3300009147 | Bacteria | 1354 |
| 417 | Ga0105243_10073902 | 3300009148 | Bacteria | 2764 |
| 418 | Ga0105243_10079238 | 3300009148 | Bacteria | 2677 |
| 419 | Ga0105243_10261055 | 3300009148 | Bacteria | 1551 |
| 420 | Ga0105243_10406941 | 3300009148 | Unclassified | 1265 |
| 421 | Ga0105241_10001682 | 3300009174 | Bacteria | 16818 |
| 422 | Ga0105241_10157116 | 3300009174 | Bacteria | 1866 |
| 423 | Ga0105241_10158844 | 3300009174 | Bacteria | 1856 |
| 424 | Ga0105242_10039911 | 3300009176 | Bacteria | 3780 |
| 425 | Ga0105242_10074931 | 3300009176 | Unclassified | 2817 |
| 426 | Ga0105242_10224243 | 3300009176 | Bacteria | 1681 |
| 427 | Ga0105242_10463875 | 3300009176 | Bacteria | 1197 |
| 428 | Ga0105248_10000804 | 3300009177 | Bacteria | 35156 |
| 429 | Ga0105248_10003271 | 3300009177 | Bacteria | 17979 |
| 430 | Ga0105248_10004514 | 3300009177 | Bacteria | 15398 |
| 431 | Ga0105248_10006795 | 3300009177 | Bacteria | 12542 |
| 432 | Ga0105248_10007062 | 3300009177 | Bacteria | 12301 |
| 433 | Ga0105248_10012815 | 3300009177 | Bacteria | 9249 |
| 434 | Ga0105248_10023319 | 3300009177 | Bacteria | 6874 |
| 435 | Ga0105248_10027991 | 3300009177 | Bacteria | 6277 |
| 436 | Ga0105248_10031282 | 3300009177 | Bacteria | 5948 |
| 437 | Ga0105248_10035718 | 3300009177 | Bacteria | 5559 |
| 438 | Ga0105248_10074816 | 3300009177 | Bacteria | 3806 |
| 439 | Ga0105248_10424526 | 3300009177 | Bacteria | 1497 |
| 440 | Ga0105248_10561737 | 3300009177 | Bacteria | 1287 |
| 441 | Ga0105237_10003677 | 3300009545 | Bacteria | 18071 |
| 442 | Ga0105237_10004000 | 3300009545 | Bacteria | 17235 |
| 443 | Ga0105237_10121241 | 3300009545 | Bacteria | 2610 |
| 444 | Ga0105237_10125623 | 3300009545 | Bacteria | 2559 |
| 445 | Ga0105237_10141258 | 3300009545 | Bacteria | 2402 |
| 446 | Ga0105237_10210358 | 3300009545 | Bacteria | 1945 |
| 447 | Ga0105237_10261983 | 3300009545 | Unclassified | 1731 |
| 448 | Ga0105237_10433556 | 3300009545 | Unclassified | 1320 |
| 449 | Ga0105238_10004133 | 3300009551 | Bacteria | 14403 |
| 450 | Ga0105238_10010800 | 3300009551 | Bacteria | 9177 |
| 451 | Ga0105238_10027156 | 3300009551 | Bacteria | 5834 |
| 452 | Ga0105238_10041666 | 3300009551 | Bacteria | 4650 |
| 453 | Ga0105238_10054351 | 3300009551 | Bacteria | 4021 |
| 454 | Ga0105238_10107500 | 3300009551 | Bacteria | 2771 |
| 455 | Ga0105238_10147305 | 3300009551 | Bacteria | 2330 |
| 456 | Ga0105238_10213291 | 3300009551 | Bacteria | 1907 |
| 457 | Ga0105238_10245752 | 3300009551 | Bacteria | 1767 |
| 458 | Ga0105238_10253308 | 3300009551 | Bacteria | 1739 |
| 459 | Ga0105238_10490031 | 3300009551 | Bacteria | 1229 |
| 460 | Ga0105249_10016531 | 3300009553 | Bacteria | 6546 |
| 461 | Ga0105249_10034356 | 3300009553 | Bacteria | 4595 |
| 462 | Ga0105249_10037423 | 3300009553 | Bacteria | 4404 |
| 463 | Ga0105249_10169053 | 3300009553 | Bacteria | 2119 |
| 464 | Ga0105249_10276991 | 3300009553 | Bacteria | 1674 |
| 465 | Ga0105249_10669541 | 3300009553 | Unclassified | 1096 |
| 466 | Ga0105239_10003090 | 3300010375 | Bacteria | 20668 |
| 467 | Ga0105239_10029968 | 3300010375 | Bacteria | 5984 |
| 468 | Ga0105239_10032820 | 3300010375 | Bacteria | 5705 |
| 469 | Ga0105246_10005632 | 3300011119 | Bacteria | 7639 |
| 470 | Ga0105246_10012119 | 3300011119 | Bacteria | 5372 |
| 471 | Ga0105246_10018044 | 3300011119 | Bacteria | 4494 |
| 472 | Ga0105246_10088512 | 3300011119 | Bacteria | 2225 |
| 473 | Ga0157371_10046819 | 3300013102 | Unclassified | 3075 |
| 474 | Ga0157370_10005689 | 3300013104 | Bacteria | 13934 |
| 475 | Ga0157370_10024535 | 3300013104 | Bacteria | 5972 |
| 476 | Ga0157370_10037770 | 3300013104 | Unclassified | 4677 |
| 477 | Ga0157370_10053386 | 3300013104 | Bacteria | 3854 |
| 478 | Ga0157370_10076945 | 3300013104 | Bacteria | 3143 |
| 479 | Ga0157370_10088466 | 3300013104 | Bacteria | 2909 |
| 480 | Ga0157370_10131762 | 3300013104 | Unclassified | 2332 |
| 481 | Ga0157369_10005817 | 3300013105 | Bacteria | 14337 |
| 482 | Ga0157369_10006422 | 3300013105 | Bacteria | 13628 |
| 483 | Ga0157369_10008198 | 3300013105 | Bacteria | 11984 |
| 484 | Ga0157369_10017939 | 3300013105 | Bacteria | 7946 |
| 485 | Ga0157369_10024815 | 3300013105 | Bacteria | 6661 |
| 486 | Ga0157369_10026929 | 3300013105 | Bacteria | 6376 |
| 487 | Ga0157369_10030918 | 3300013105 | Bacteria | 5901 |
| 488 | Ga0157369_10200327 | 3300013105 | Bacteria | 2096 |
| 489 | Ga0157374_10048689 | 3300013296 | Bacteria | 3934 |
| 490 | Ga0157374_10110136 | 3300013296 | Bacteria | 2648 |
| 491 | Ga0157374_10110381 | 3300013296 | Bacteria | 2645 |
| 492 | Ga0157374_10146220 | 3300013296 | Bacteria | 2296 |
| 493 | Ga0157374_10171620 | 3300013296 | Bacteria | 2116 |
| 494 | Ga0157374_10285780 | 3300013296 | Unclassified | 1629 |
| 495 | Ga0157374_10295616 | 3300013296 | Bacteria | 1601 |
| 496 | Ga0157374_10402242 | 3300013296 | Bacteria | 1366 |
| 497 | Ga0157378_10000433 | 3300013297 | Bacteria | 40819 |
| 498 | Ga0157378_10018216 | 3300013297 | Bacteria | 6164 |
| 499 | Ga0157378_10026213 | 3300013297 | Bacteria | 5138 |
| 500 | Ga0157378_10037138 | 3300013297 | Bacteria | 4314 |
| 501 | Ga0163162_10000523 | 3300013306 | Bacteria | 35637 |
| 502 | Ga0163162_10001473 | 3300013306 | Bacteria | 21902 |
| 503 | Ga0163162_10010532 | 3300013306 | Bacteria | 8992 |
| 504 | Ga0163162_10101430 | 3300013306 | Bacteria | 2970 |
| 505 | Ga0163162_10190517 | 3300013306 | Unclassified | 2178 |
| 506 | Ga0157372_10008964 | 3300013307 | Bacteria | 10632 |
| 507 | Ga0157372_10009357 | 3300013307 | Bacteria | 10429 |
| 508 | Ga0157372_10050473 | 3300013307 | Bacteria | 4628 |
| 509 | Ga0157372_10151249 | 3300013307 | Bacteria | 2679 |
| 510 | Ga0157372_10321529 | 3300013307 | Unclassified | 1801 |
| 511 | Ga0157372_10643624 | 3300013307 | Bacteria | 1235 |
| 512 | Ga0157375_10000096 | 3300013308 | Bacteria | 88714 |
| 513 | Ga0157375_10001100 | 3300013308 | Bacteria | 23449 |
| 514 | Ga0157375_10002834 | 3300013308 | Bacteria | 15010 |
| 515 | Ga0157375_10032745 | 3300013308 | Unclassified | 4932 |
| 516 | Ga0157375_10274087 | 3300013308 | Bacteria | 1849 |
| 517 | Ga0157375_10489292 | 3300013308 | Unclassified | 1395 |
| 518 | Ga0157375_10630701 | 3300013308 | Bacteria | 1229 |
| 519 | Ga0163163_10000519 | 3300014325 | Bacteria | 34361 |
| 520 | Ga0163163_10005836 | 3300014325 | Bacteria | 10706 |
| 521 | Ga0163163_10011623 | 3300014325 | Bacteria | 7998 |
| 522 | Ga0163163_10019966 | 3300014325 | Bacteria | 6304 |
| 523 | Ga0163163_10024867 | 3300014325 | Bacteria | 5702 |
| 524 | Ga0163163_10029198 | 3300014325 | Bacteria | 5303 |
| 525 | Ga0163163_10036959 | 3300014325 | Bacteria | 4748 |
| 526 | Ga0163163_10050921 | 3300014325 | Bacteria | 4080 |
| 527 | Ga0163163_10053175 | 3300014325 | Bacteria | 3997 |
| 528 | Ga0163163_10075777 | 3300014325 | Bacteria | 3358 |
| 529 | Ga0163163_10083082 | 3300014325 | Bacteria | 3207 |
| 530 | Ga0163163_10145301 | 3300014325 | Bacteria | 2415 |
| 531 | Ga0163163_10281701 | 3300014325 | Unclassified | 1714 |
| 532 | Ga0163163_10545038 | 3300014325 | Bacteria | 1222 |
| 533 | Ga0157380_10009740 | 3300014326 | Bacteria | 6895 |
| 534 | Ga0157380_10031353 | 3300014326 | Bacteria | 4080 |
| 535 | Ga0157380_10182923 | 3300014326 | Unclassified | 1843 |
| 536 | Ga0157380_10259762 | 3300014326 | Unclassified | 1577 |
| 537 | Ga0157380_10405032 | 3300014326 | Bacteria | 1295 |
| 538 | Ga0182008_10038596 | 3300014497 | Bacteria | 2388 |
| 539 | Ga0182008_10058613 | 3300014497 | Bacteria | 1900 |
| 540 | Ga0157377_10005753 | 3300014745 | Bacteria | 5850 |
| 541 | Ga0157377_10047133 | 3300014745 | Unclassified | 2413 |
| 542 | Ga0157379_10000048 | 3300014968 | Bacteria | 74712 |
| 543 | Ga0157379_10028278 | 3300014968 | Bacteria | 4990 |
| 544 | Ga0157379_10034446 | 3300014968 | Bacteria | 4515 |
| 545 | Ga0157379_10092480 | 3300014968 | Unclassified | 2713 |
| 546 | Ga0157379_10202954 | 3300014968 | Bacteria | 1793 |
| 547 | Ga0157379_10210969 | 3300014968 | Bacteria | 1758 |
| 548 | Ga0157379_10338164 | 3300014968 | Unclassified | 1376 |
| 549 | Ga0157379_10417020 | 3300014968 | Bacteria | 1236 |
| 550 | Ga0157376_10015271 | 3300014969 | Bacteria | 5797 |
| 551 | Ga0157376_10131823 | 3300014969 | Bacteria | 2231 |
| 552 | Ga0157376_10142625 | 3300014969 | Bacteria | 2151 |
| 553 | Ga0157376_10156728 | 3300014969 | Bacteria | 2060 |
| 554 | Ga0157376_10192888 | 3300014969 | Bacteria | 1869 |
| 555 | Ga0157376_10216788 | 3300014969 | Bacteria | 1770 |
| 556 | Ga0163161_10009974 | 3300017792 | Bacteria | 6579 |
| 557 | Ga0163161_10017593 | 3300017792 | Bacteria | 5004 |
| 558 | Ga0163161_10039091 | 3300017792 | Bacteria | 3404 |
| 559 | Ga0163161_10106956 | 3300017792 | Bacteria | 2088 |
| 560 | Ga0197907_10850651 | 3300020069 | Bacteria | 1197 |
| 561 | Ga0206356_11897132 | 3300020070 | Bacteria | 2890 |
| 562 | Ga0206350_10155620 | 3300020080 | Bacteria | 1177 |
| 563 | Ga0213873_10010289 | 3300021358 | Bacteria | 1969 |
| 564 | Ga0213872_10083289 | 3300021361 | Unclassified | 1436 |
| 565 | Ga0213876_10046150 | 3300021384 | Bacteria | 2304 |
| 566 | Ga0213875_10006251 | 3300021388 | Bacteria | 6272 |
| 567 | Ga0213875_10049184 | 3300021388 | Bacteria | 1977 |
| 568 | Ga0213875_10059169 | 3300021388 | Unclassified | 1793 |
| 569 | Ga0224712_10042923 | 3300022467 | Bacteria | 1716 |
| 570 | Ga0224712_10126744 | 3300022467 | Bacteria | 1111 |
| 571 | Ga0207697_10039759 | 3300025315 | Bacteria | 1930 |
| 572 | Ga0207656_10055051 | 3300025321 | Bacteria | 1731 |
| 573 | Ga0207682_10000836 | 3300025893 | Bacteria | 14232 |
| 574 | Ga0207682_10004927 | 3300025893 | Bacteria | 5490 |
| 575 | Ga0207682_10015461 | 3300025893 | Bacteria | 2970 |
| 576 | Ga0207682_10036173 | 3300025893 | Bacteria | 1997 |
| 577 | Ga0207692_10076430 | 3300025898 | Bacteria | 1779 |
| 578 | Ga0207642_10037706 | 3300025899 | Bacteria | 2085 |
| 579 | Ga0207642_10217829 | 3300025899 | Unclassified | 1065 |
| 580 | Ga0207688_10000186 | 3300025901 | Bacteria | 27430 |
| 581 | Ga0207688_10020244 | 3300025901 | Bacteria | 3632 |
| 582 | Ga0207688_10159776 | 3300025901 | Bacteria | 1335 |
| 583 | Ga0207680_10023341 | 3300025903 | Bacteria | 3376 |
| 584 | Ga0207680_10121120 | 3300025903 | Bacteria | 1711 |
| 585 | Ga0207647_10049677 | 3300025904 | Bacteria | 2601 |
| 586 | Ga0207645_10001480 | 3300025907 | Bacteria | 19207 |
| 587 | Ga0207645_10028334 | 3300025907 | Bacteria | 3616 |
| 588 | Ga0207645_10080038 | 3300025907 | Bacteria | 2094 |
| 589 | Ga0207645_10127347 | 3300025907 | Unclassified | 1656 |
| 590 | Ga0207643_10000951 | 3300025908 | Bacteria | 17361 |
| 591 | Ga0207643_10001949 | 3300025908 | Bacteria | 11409 |
| 592 | Ga0207643_10010366 | 3300025908 | Bacteria | 5018 |
| 593 | Ga0207705_10115587 | 3300025909 | Bacteria | 1986 |
| 594 | Ga0207705_10312776 | 3300025909 | Bacteria | 1206 |
| 595 | Ga0207654_10016475 | 3300025911 | Plasmid | 3849 |
| 596 | Ga0207654_10081629 | 3300025911 | Bacteria | 1947 |
| 597 | Ga0207707_10000565 | 3300025912 | Bacteria | 37586 |
| 598 | Ga0207707_10001148 | 3300025912 | Bacteria | 25091 |
| 599 | Ga0207707_10008127 | 3300025912 | Bacteria | 9110 |
| 600 | Ga0207707_10008357 | 3300025912 | Bacteria | 8980 |
| 601 | Ga0207707_10008871 | 3300025912 | Bacteria | 8732 |
| 602 | Ga0207707_10112729 | 3300025912 | Bacteria | 2377 |
| 603 | Ga0207707_10163477 | 3300025912 | Bacteria | 1946 |
| 604 | Ga0207695_10001854 | 3300025913 | Bacteria | 33123 |
| 605 | Ga0207695_10004549 | 3300025913 | Bacteria | 18867 |
| 606 | Ga0207695_10031205 | 3300025913 | Bacteria | 5850 |
| 607 | Ga0207695_10047903 | 3300025913 | Bacteria | 4518 |
| 608 | Ga0207695_10067034 | 3300025913 | Bacteria | 3683 |
| 609 | Ga0207695_10084497 | 3300025913 | Bacteria | 3205 |
| 610 | Ga0207695_10491629 | 3300025913 | Bacteria | 1109 |
| 611 | Ga0207671_10078097 | 3300025914 | Bacteria | 2479 |
| 612 | Ga0207671_10200627 | 3300025914 | Bacteria | 1558 |
| 613 | Ga0207671_10235597 | 3300025914 | Bacteria | 1437 |
| 614 | Ga0207693_10002478 | 3300025915 | Bacteria | 16048 |
| 615 | Ga0207693_10058496 | 3300025915 | Bacteria | 3019 |
| 616 | Ga0207693_10149479 | 3300025915 | Unclassified | 1837 |
| 617 | Ga0207663_10227981 | 3300025916 | Bacteria | 1359 |
| 618 | Ga0207660_10009726 | 3300025917 | Bacteria | 6223 |
| 619 | Ga0207660_10018474 | 3300025917 | Bacteria | 4648 |
| 620 | Ga0207660_10036917 | 3300025917 | Bacteria | 3400 |
| 621 | Ga0207662_10007393 | 3300025918 | Bacteria | 5980 |
| 622 | Ga0207662_10067296 | 3300025918 | Bacteria | 2160 |
| 623 | Ga0207662_10122402 | 3300025918 | Bacteria | 1633 |
| 624 | Ga0207657_10074316 | 3300025919 | Bacteria | 2871 |
| 625 | Ga0207657_10124458 | 3300025919 | Unclassified | 2118 |
| 626 | Ga0207649_10100403 | 3300025920 | Bacteria | 1914 |
| 627 | Ga0207649_10130722 | 3300025920 | Bacteria | 1705 |
| 628 | Ga0207649_10266490 | 3300025920 | Bacteria | 1240 |
| 629 | Ga0207652_10002881 | 3300025921 | Bacteria | 14381 |
| 630 | Ga0207652_10003929 | 3300025921 | Bacteria | 12155 |
| 631 | Ga0207652_10114221 | 3300025921 | Bacteria | 2397 |
| 632 | Ga0207652_10173941 | 3300025921 | Bacteria | 1933 |
| 633 | Ga0207652_10199713 | 3300025921 | Bacteria | 1800 |
| 634 | Ga0207652_10263411 | 3300025921 | Bacteria | 1555 |
| 635 | Ga0207646_10001462 | 3300025922 | Bacteria | 29242 |
| 636 | Ga0207681_10037459 | 3300025923 | Bacteria | 3206 |
| 637 | Ga0207681_10058154 | 3300025923 | Bacteria | 2646 |
| 638 | Ga0207681_10308466 | 3300025923 | Bacteria | 1254 |
| 639 | Ga0207694_10000738 | 3300025924 | Bacteria | 29385 |
| 640 | Ga0207694_10003104 | 3300025924 | Bacteria | 13290 |
| 641 | Ga0207694_10025390 | 3300025924 | Bacteria | 4504 |
| 642 | Ga0207694_10034277 | 3300025924 | Bacteria | 3892 |
| 643 | Ga0207694_10067555 | 3300025924 | Bacteria | 2790 |
| 644 | Ga0207694_10117646 | 3300025924 | Bacteria | 2119 |
| 645 | Ga0207694_10143418 | 3300025924 | Bacteria | 1921 |
| 646 | Ga0207650_10000510 | 3300025925 | Bacteria | 32441 |
| 647 | Ga0207650_10006456 | 3300025925 | Bacteria | 7987 |
| 648 | Ga0207650_10048603 | 3300025925 | Bacteria | 3129 |
| 649 | Ga0207659_10000797 | 3300025926 | Bacteria | 18647 |
| 650 | Ga0207659_10008431 | 3300025926 | Bacteria | 6398 |
| 651 | Ga0207659_10019281 | 3300025926 | Bacteria | 4486 |
| 652 | Ga0207659_10035142 | 3300025926 | Bacteria | 3462 |
| 653 | Ga0207659_10054824 | 3300025926 | Bacteria | 2848 |
| 654 | Ga0207659_10082916 | 3300025926 | Unclassified | 2375 |
| 655 | Ga0207659_10110241 | 3300025926 | Unclassified | 2091 |
| 656 | Ga0207659_10446663 | 3300025926 | Bacteria | 1088 |
| 657 | Ga0207687_10003947 | 3300025927 | Bacteria | 9933 |
| 658 | Ga0207687_10004393 | 3300025927 | Bacteria | 9409 |
| 659 | Ga0207687_10010486 | 3300025927 | Bacteria | 6053 |
| 660 | Ga0207687_10035423 | 3300025927 | Bacteria | 3395 |
| 661 | Ga0207700_10029586 | 3300025928 | Unclassified | 3867 |
| 662 | Ga0207700_10052950 | 3300025928 | Bacteria | 3038 |
| 663 | Ga0207700_10123810 | 3300025928 | Bacteria | 2100 |
| 664 | Ga0207700_10174898 | 3300025928 | Bacteria | 1794 |
| 665 | Ga0207700_10336643 | 3300025928 | Unclassified | 1311 |
| 666 | Ga0207664_10214974 | 3300025929 | Bacteria | 1665 |
| 667 | Ga0207644_10027675 | 3300025931 | Unclassified | 3918 |
| 668 | Ga0207644_10047399 | 3300025931 | Bacteria | 3066 |
| 669 | Ga0207644_10066118 | 3300025931 | Bacteria | 2631 |
| 670 | Ga0207644_10068049 | 3300025931 | Unclassified | 2597 |
| 671 | Ga0207644_10139841 | 3300025931 | Unclassified | 1863 |
| 672 | Ga0207690_10077757 | 3300025932 | Bacteria | 2307 |
| 673 | Ga0207690_10126248 | 3300025932 | Bacteria | 1866 |
| 674 | Ga0207706_10004052 | 3300025933 | Bacteria | 13859 |
| 675 | Ga0207706_10101855 | 3300025933 | Unclassified | 2527 |
| 676 | Ga0207706_10105691 | 3300025933 | Unclassified | 2477 |
| 677 | Ga0207686_10002608 | 3300025934 | Bacteria | 9778 |
| 678 | Ga0207686_10027803 | 3300025934 | Plasmid | 3316 |
| 679 | Ga0207686_10075955 | 3300025934 | Bacteria | 2177 |
| 680 | Ga0207686_10115462 | 3300025934 | Bacteria | 1818 |
| 681 | Ga0207686_10284969 | 3300025934 | Bacteria | 1221 |
| 682 | Ga0207709_10010381 | 3300025935 | Bacteria | 5127 |
| 683 | Ga0207709_10150281 | 3300025935 | Bacteria | 1612 |
| 684 | Ga0207670_10015421 | 3300025936 | Bacteria | 4566 |
| 685 | Ga0207670_10332910 | 3300025936 | Unclassified | 1198 |
| 686 | Ga0207669_10006302 | 3300025937 | Bacteria | 5409 |
| 687 | Ga0207669_10009677 | 3300025937 | Bacteria | 4607 |
| 688 | Ga0207669_10092463 | 3300025937 | Bacteria | 1973 |
| 689 | Ga0207704_10006585 | 3300025938 | Bacteria | 5432 |
| 690 | Ga0207704_10011867 | 3300025938 | Bacteria | 4307 |
| 691 | Ga0207704_10012447 | 3300025938 | Bacteria | 4223 |
| 692 | Ga0207704_10079710 | 3300025938 | Bacteria | 2111 |
| 693 | Ga0207704_10176114 | 3300025938 | Unclassified | 1540 |
| 694 | Ga0207691_10012333 | 3300025940 | Bacteria | 8192 |
| 695 | Ga0207691_10013158 | 3300025940 | Bacteria | 7923 |
| 696 | Ga0207691_10019418 | 3300025940 | Bacteria | 6431 |
| 697 | Ga0207691_10053281 | 3300025940 | Bacteria | 3694 |
| 698 | Ga0207691_10136640 | 3300025940 | Bacteria | 2162 |
| 699 | Ga0207691_10237820 | 3300025940 | Unclassified | 1575 |
| 700 | Ga0207711_10000641 | 3300025941 | Bacteria | 34997 |
| 701 | Ga0207711_10000804 | 3300025941 | Bacteria | 30837 |
| 702 | Ga0207711_10000883 | 3300025941 | Bacteria | 28937 |
| 703 | Ga0207711_10013257 | 3300025941 | Bacteria | 6849 |
| 704 | Ga0207711_10013402 | 3300025941 | Bacteria | 6811 |
| 705 | Ga0207711_10017416 | 3300025941 | Bacteria | 5970 |
| 706 | Ga0207711_10060014 | 3300025941 | Unclassified | 3276 |
| 707 | Ga0207711_10087121 | 3300025941 | Bacteria | 2739 |
| 708 | Ga0207711_10119103 | 3300025941 | Unclassified | 2355 |
| 709 | Ga0207689_10002411 | 3300025942 | Bacteria | 17395 |
| 710 | Ga0207689_10015797 | 3300025942 | Bacteria | 6392 |
| 711 | Ga0207689_10016668 | 3300025942 | Bacteria | 6218 |
| 712 | Ga0207689_10033221 | 3300025942 | Bacteria | 4287 |
| 713 | Ga0207689_10247746 | 3300025942 | Bacteria | 1473 |
| 714 | Ga0207689_10360542 | 3300025942 | Bacteria | 1209 |
| 715 | Ga0207661_10002990 | 3300025944 | Bacteria | 11693 |
| 716 | Ga0207661_10007186 | 3300025944 | Bacteria | 7912 |
| 717 | Ga0207661_10013583 | 3300025944 | Bacteria | 5947 |
| 718 | Ga0207661_10017976 | 3300025944 | Bacteria | 5247 |
| 719 | Ga0207661_10096187 | 3300025944 | Bacteria | 2477 |
| 720 | Ga0207661_10118433 | 3300025944 | Bacteria | 2251 |
| 721 | Ga0207661_10141359 | 3300025944 | Bacteria | 2072 |
| 722 | Ga0207679_10004577 | 3300025945 | Bacteria | 8614 |
| 723 | Ga0207679_10013618 | 3300025945 | Bacteria | 5332 |
| 724 | Ga0207679_10025369 | 3300025945 | Bacteria | 4075 |
| 725 | Ga0207679_10126137 | 3300025945 | Bacteria | 2046 |
| 726 | Ga0207667_10000636 | 3300025949 | Bacteria | 45432 |
| 727 | Ga0207667_10001683 | 3300025949 | Bacteria | 27858 |
| 728 | Ga0207667_10005002 | 3300025949 | Bacteria | 16196 |
| 729 | Ga0207667_10005718 | 3300025949 | Bacteria | 15167 |
| 730 | Ga0207667_10027397 | 3300025949 | Bacteria | 6203 |
| 731 | Ga0207667_10139209 | 3300025949 | Bacteria | 2499 |
| 732 | Ga0207667_10463835 | 3300025949 | Bacteria | 1286 |
| 733 | Ga0207651_10009725 | 3300025960 | Bacteria | 5285 |
| 734 | Ga0207651_10021241 | 3300025960 | Bacteria | 3940 |
| 735 | Ga0207651_10026193 | 3300025960 | Bacteria | 3638 |
| 736 | Ga0207712_10017934 | 3300025961 | Bacteria | 4607 |
| 737 | Ga0207712_10033299 | 3300025961 | Bacteria | 3483 |
| 738 | Ga0207712_10042765 | 3300025961 | Bacteria | 3123 |
| 739 | Ga0207668_10100612 | 3300025972 | Bacteria | 2147 |
| 740 | Ga0207640_10055008 | 3300025981 | Bacteria | 2604 |
| 741 | Ga0207658_10015567 | 3300025986 | Bacteria | 5218 |
| 742 | Ga0207658_10020306 | 3300025986 | Unclassified | 4600 |
| 743 | Ga0207658_10042015 | 3300025986 | Bacteria | 3314 |
| 744 | Ga0207658_10172427 | 3300025986 | Bacteria | 1783 |
| 745 | Ga0207677_10027359 | 3300026023 | Bacteria | 3590 |
| 746 | Ga0207677_10046628 | 3300026023 | Unclassified | 2903 |
| 747 | Ga0207677_10053414 | 3300026023 | Bacteria | 2750 |
| 748 | Ga0207677_10219672 | 3300026023 | Bacteria | 1523 |
| 749 | Ga0207703_10009226 | 3300026035 | Bacteria | 7758 |
| 750 | Ga0207703_10014205 | 3300026035 | Bacteria | 6210 |
| 751 | Ga0207703_10026582 | 3300026035 | Bacteria | 4556 |
| 752 | Ga0207703_10061983 | 3300026035 | Bacteria | 3063 |
| 753 | Ga0207703_10102676 | 3300026035 | Bacteria | 2426 |
| 754 | Ga0207703_10104988 | 3300026035 | Bacteria | 2401 |
| 755 | Ga0207703_10122406 | 3300026035 | Bacteria | 2235 |
| 756 | Ga0207703_10196686 | 3300026035 | Unclassified | 1789 |
| 757 | Ga0207703_10310306 | 3300026035 | Unclassified | 1442 |
| 758 | Ga0207703_10402314 | 3300026035 | Bacteria | 1271 |
| 759 | Ga0207703_10423033 | 3300026035 | Bacteria | 1240 |
| 760 | Ga0207639_10064912 | 3300026041 | Bacteria | 2832 |
| 761 | Ga0207639_10064932 | 3300026041 | Bacteria | 2832 |
| 762 | Ga0207639_10278501 | 3300026041 | Bacteria | 1470 |
| 763 | Ga0207678_10032096 | 3300026067 | Bacteria | 4578 |
| 764 | Ga0207678_10056416 | 3300026067 | Unclassified | 3381 |
| 765 | Ga0207678_10281630 | 3300026067 | Bacteria | 1427 |
| 766 | Ga0207708_10020707 | 3300026075 | Bacteria | 4961 |
| 767 | Ga0207708_10041022 | 3300026075 | Bacteria | 3530 |
| 768 | Ga0207702_10009053 | 3300026078 | Bacteria | 8380 |
| 769 | Ga0207702_10021939 | 3300026078 | Bacteria | 5289 |
| 770 | Ga0207702_10029649 | 3300026078 | Bacteria | 4554 |
| 771 | Ga0207702_10084483 | 3300026078 | Bacteria | 2764 |
| 772 | Ga0207702_10109864 | 3300026078 | Bacteria | 2449 |
| 773 | Ga0207702_10175373 | 3300026078 | Unclassified | 1969 |
| 774 | Ga0207641_10002077 | 3300026088 | Bacteria | 18985 |
| 775 | Ga0207641_10014597 | 3300026088 | Bacteria | 6440 |
| 776 | Ga0207641_10034849 | 3300026088 | Unclassified | 4189 |
| 777 | Ga0207641_10036386 | 3300026088 | Bacteria | 4109 |
| 778 | Ga0207641_10177398 | 3300026088 | Bacteria | 1949 |
| 779 | Ga0207641_10186174 | 3300026088 | Bacteria | 1905 |
| 780 | Ga0207641_10197671 | 3300026088 | Bacteria | 1852 |
| 781 | Ga0207648_10006827 | 3300026089 | Bacteria | 11308 |
| 782 | Ga0207648_10006985 | 3300026089 | Bacteria | 11164 |
| 783 | Ga0207648_10013242 | 3300026089 | Bacteria | 7683 |
| 784 | Ga0207648_10071445 | 3300026089 | Unclassified | 3025 |
| 785 | Ga0207648_10210077 | 3300026089 | Bacteria | 1727 |
| 786 | Ga0207648_10220578 | 3300026089 | Bacteria | 1685 |
| 787 | Ga0207676_10010042 | 3300026095 | Bacteria | 6734 |
| 788 | Ga0207676_10473124 | 3300026095 | Unclassified | 1185 |
| 789 | Ga0207676_10476901 | 3300026095 | Bacteria | 1181 |
| 790 | Ga0207674_10000166 | 3300026116 | Bacteria | 79149 |
| 791 | Ga0207674_10003310 | 3300026116 | Bacteria | 19811 |
| 792 | Ga0207674_10004029 | 3300026116 | Bacteria | 17829 |
| 793 | Ga0207674_10026232 | 3300026116 | Bacteria | 6195 |
| 794 | Ga0207674_10091119 | 3300026116 | Bacteria | 3039 |
| 795 | Ga0207674_10101423 | 3300026116 | Bacteria | 2859 |
| 796 | Ga0207674_10146177 | 3300026116 | Unclassified | 2323 |
| 797 | Ga0207674_10181479 | 3300026116 | Bacteria | 2056 |
| 798 | Ga0207674_10249624 | 3300026116 | Bacteria | 1721 |
| 799 | Ga0207675_100004439 | 3300026118 | Bacteria | 13560 |
| 800 | Ga0207675_100008362 | 3300026118 | Bacteria | 9752 |
| 801 | Ga0207675_100116686 | 3300026118 | Bacteria | 2523 |
| 802 | Ga0207675_100146237 | 3300026118 | Unclassified | 2247 |
| 803 | Ga0207675_100400906 | 3300026118 | Unclassified | 1352 |
| 804 | Ga0207683_10047440 | 3300026121 | Bacteria | 3762 |
| 805 | Ga0207683_10057250 | 3300026121 | Bacteria | 3422 |
| 806 | Ga0207683_10091143 | 3300026121 | Bacteria | 2715 |
| 807 | Ga0207683_10106952 | 3300026121 | Bacteria | 2502 |
| 808 | Ga0207683_10112561 | 3300026121 | Bacteria | 2437 |
| 809 | Ga0207683_10353071 | 3300026121 | Unclassified | 1350 |
| 810 | Ga0207698_10011187 | 3300026142 | Bacteria | 5806 |
| 811 | Ga0207698_10098854 | 3300026142 | Bacteria | 2412 |
| 812 | Ga0207698_10191770 | 3300026142 | Bacteria | 1821 |
| 813 | Ga0207698_10203476 | 3300026142 | Bacteria | 1775 |
| 814 | Ga0207698_10408586 | 3300026142 | Bacteria | 1299 |
| 815 | Ga0207428_10000144 | 3300027907 | Bacteria | 96684 |
| 816 | Ga0207428_10000643 | 3300027907 | Bacteria | 41046 |
| 817 | Ga0207428_10005048 | 3300027907 | Bacteria | 12399 |
| 818 | Ga0207428_10019680 | 3300027907 | Bacteria | 5753 |
| 819 | Ga0207428_10067349 | 3300027907 | Unclassified | 2819 |
| 820 | Ga0207428_10076601 | 3300027907 | Bacteria | 2619 |
| 821 | Ga0207428_10079218 | 3300027907 | Bacteria | 2569 |
| 822 | Ga0268266_10058015 | 3300028379 | Bacteria | 3333 |
| 823 | Ga0268266_10159670 | 3300028379 | Bacteria | 2038 |
| 824 | Ga0268266_10355052 | 3300028379 | Unclassified | 1378 |
| 825 | Ga0268265_10005432 | 3300028380 | Bacteria | 8715 |
| 826 | Ga0268265_10012385 | 3300028380 | Bacteria | 5780 |
| 827 | Ga0268265_10103021 | 3300028380 | Bacteria | 2310 |
| 828 | Ga0268264_10006882 | 3300028381 | Bacteria | 9541 |
| 829 | Ga0268264_10017518 | 3300028381 | Bacteria | 5867 |
| 830 | Ga0268264_10020797 | 3300028381 | Bacteria | 5363 |
| 831 | Ga0268264_10026845 | 3300028381 | Bacteria | 4705 |
| 832 | Ga0268264_10037903 | 3300028381 | Bacteria | 3976 |
| 833 | Ga0268264_10275649 | 3300028381 | Bacteria | 1573 |
| 834 | Ga0265338_10019045 | 3300028800 | Bacteria | 7310 |
| 835 | Ga0265338_10056036 | 3300028800 | Bacteria | 3501 |
| 836 | Ga0265332_10022094 | 3300031238 | Bacteria | 2808 |
| 837 | Ga0265325_10001345 | 3300031241 | Bacteria | 17418 |
| 838 | Ga0265340_10067748 | 3300031247 | Bacteria | 1696 |
| 839 | Ga0265327_10042200 | 3300031251 | Bacteria | 2451 |
| 840 | Ga0307408_100004306 | 3300031548 | Bacteria | 9661 |
| 841 | Ga0265313_10003580 | 3300031595 | Bacteria | 12495 |
| 842 | Ga0265313_10005853 | 3300031595 | Bacteria | 8920 |
| 843 | Ga0265314_10000282 | 3300031711 | Bacteria | 73865 |
| 844 | Ga0265314_10005473 | 3300031711 | Bacteria | 11450 |
| 845 | Ga0307405_10004173 | 3300031731 | Bacteria | 6797 |
| 846 | Ga0307410_10004522 | 3300031852 | Bacteria | 7205 |
| 847 | Ga0307407_10038224 | 3300031903 | Unclassified | 2658 |
| 848 | Ga0307412_10033419 | 3300031911 | Bacteria | 3269 |
| 849 | Ga0307416_100005845 | 3300032002 | Bacteria | 7630 |
| 850 | Ga0307416_100281571 | 3300032002 | Bacteria | 1640 |
| 851 | Ga0307414_10001278 | 3300032004 | Bacteria | 12989 |
| 852 | Ga0307411_10043665 | 3300032005 | Unclassified | 2869 |
| 853 | Ga0373934_0003589 | 3300035086 | Bacteria | 5705 |
| 854 | Ga0373934_0015265 | 3300035086 | Bacteria | 2913 |
| 855 | Ga0373934_0024847 | 3300035086 | Bacteria | 2318 |
| 856 | Ga0373952_0005495 | 3300035092 | Bacteria | 2318 |
| 857 | Ga0373923_0036905 | 3300035111 | Bacteria | 1997 |
| 858 | Ga0373923_0105874 | 3300035111 | Unclassified | 1244 |
| 859 | Ga0373936_0069032 | 3300035113 | Bacteria | 1454 |
| 860 | Ga0373936_0120286 | 3300035113 | Unclassified | 1121 |
| 861 | Ga0373941_0011829 | 3300035115 | Bacteria | 2266 |
| 862 | Ga0373945_0015626 | 3300035116 | Bacteria | 2556 |
| 863 | Ga0373945_0020436 | 3300035116 | Bacteria | 2266 |
| 864 | Ga0373954_0004540 | 3300035118 | Bacteria | 5977 |
| 865 | Ga0373954_0012448 | 3300035118 | Bacteria | 3782 |
| 866 | Ga0373954_0013095 | 3300035118 | Bacteria | 3693 |
| 867 | Ga0373956_0053978 | 3300035119 | Bacteria | 1810 |
| 868 | Ga0373946_0050300 | 3300035171 | Bacteria | 1741 |
| 869 | Ga0373946_0081907 | 3300035171 | Bacteria | 1414 |
| 870 | Ga0373955_0022908 | 3300035172 | Unclassified | 3175 |
| 871 | Ga0373955_0024402 | 3300035172 | Bacteria | 3093 |
| 872 | Ga0373955_0037499 | 3300035172 | Unclassified | 2577 |
| 873 | Ga0373955_0055064 | 3300035172 | Bacteria | 2177 |
| 874 | Ga0373955_0066247 | 3300035172 | Unclassified | 2007 |
| 875 | Ga0373955_0086923 | 3300035172 | Bacteria | 1776 |
| 876 | Ga0373955_0090386 | 3300035172 | Bacteria | 1744 |
| 877 | Ga0373955_0174685 | 3300035172 | Bacteria | 1273 |
| 878 | Ga0373924_0003596 | 3300035410 | Bacteria | 5345 |
| 879 | Ga0373931_0002400 | 3300035691 | Bacteria | 8293 |
| 880 | Ga0373931_0013157 | 3300035691 | Bacteria | 4025 |
| 881 | Ga0373931_0022597 | 3300035691 | Bacteria | 3167 |
| 882 | Ga0373935_0012614 | 3300035692 | Bacteria | 5084 |
| 883 | Ga0373935_0132807 | 3300035692 | Bacteria | 1674 |
| 884 | Ga0373935_0161721 | 3300035692 | Bacteria | 1526 |
| 885 | Ga0373927_0011148 | 3300035695 | Bacteria | 5988 |
| 886 | Ga0373927_0062708 | 3300035695 | Bacteria | 2404 |
| 887 | Ga0373927_0090628 | 3300035695 | Bacteria | 1986 |
| 888 | Ga0373933_0002707 | 3300035724 | Bacteria | 9919 |
| 889 | Ga0373933_0006335 | 3300035724 | Bacteria | 6439 |
| 890 | Ga0373933_0016000 | 3300035724 | Bacteria | 4189 |
| 891 | Ga0373933_0038756 | 3300035724 | Bacteria | 2801 |
| 892 | Ga0373933_0046795 | 3300035724 | Bacteria | 2570 |
| 893 | Ga0373933_0049454 | 3300035724 | Bacteria | 2507 |
| 894 | Ga0373947_0238739 | 3300035725 | Bacteria | 1199 |
| 895 | Ga0373937_0000238 | 3300036401 | Bacteria | 53880 |
| 896 | Ga0373937_0000744 | 3300036401 | Bacteria | 28108 |
| 897 | Ga0373937_0000994 | 3300036401 | Bacteria | 24079 |
| 898 | Ga0373937_0007751 | 3300036401 | Bacteria | 9308 |
| 899 | Ga0373937_0013713 | 3300036401 | Bacteria | 7141 |
| 900 | Ga0373937_0015199 | 3300036401 | Bacteria | 6803 |
| 901 | Ga0373937_0019061 | 3300036401 | Bacteria | 6139 |
| 902 | Ga0373937_0019271 | 3300036401 | Bacteria | 6106 |
| 903 | Ga0373937_0021816 | 3300036401 | Bacteria | 5749 |
| 904 | Ga0373937_0031015 | 3300036401 | Bacteria | 4841 |
| 905 | Ga0373937_0035309 | 3300036401 | Bacteria | 4550 |
| 906 | Ga0373937_0099881 | 3300036401 | Bacteria | 2692 |
| 907 | Ga0373937_0228427 | 3300036401 | Bacteria | 1752 |
| 908 | Ga0373937_0277680 | 3300036401 | Bacteria | 1582 |
| 909 | Ga0373937_0340528 | 3300036401 | Bacteria | 1420 |
| 910 | Ga0373925_0035321 | 3300037068 | Unclassified | 3687 |
| 911 | Ga0373925_0078134 | 3300037068 | Unclassified | 2513 |
| 912 | Ga0373925_0089525 | 3300037068 | Bacteria | 2351 |
| 913 | Ga0373925_0107792 | 3300037068 | Unclassified | 2149 |
| 914 | Ga0373925_0286724 | 3300037068 | Bacteria | 1327 |
| 915 | Ga0395899_0023273 | 3300037312 | Bacteria | 4694 |
| 916 | Ga0395900_0327319 | 3300037418 | Bacteria | 1511 |
| 917 | Ga0395900_0414458 | 3300037418 | Bacteria | 1309 |
| 918 | Ga0395905_0307899 | 3300037471 | Bacteria | 1472 |
| 919 | Ga0436364_0112721 | 3300037853 | Bacteria | 14300 |
| 920 | Ga0436364_0249501 | 3300037853 | Unclassified | 3406 |
| 921 | Ga0436365_0017926 | 3300039437 | Bacteria | 5872 |
| 922 | Ga0436365_0568945 | 3300039437 | Bacteria | 3327 |
| 923 | Ga0436365_0801801 | 3300039437 | Bacteria | 4255 |
| 924 | Ga0436365_1426598 | 3300039437 | Bacteria | 4746 |
| 925 | Ga0436365_1432540 | 3300039437 | Bacteria | 4156 |
| 926 | Ga0436365_1776714 | 3300039437 | Bacteria | 1301 |
| 927 | Ga0436361_0232929 | 3300039447 | Bacteria | 1330 |
| 928 | Ga0436361_0539861 | 3300039447 | Bacteria | 2222 |
| 929 | Ga0436361_0909974 | 3300039447 | Bacteria | 2622 |
| 930 | Ga0436361_1062872 | 3300039447 | Bacteria | 3427 |
| 931 | Ga0436362_0945639 | 3300039453 | Unclassified | 3969 |
| 932 | Ga0439453_0017209 | 3300041408 | Unclassified | 1267 |
| 933 | Ga0451853_2651878 | 3300041512 | Bacteria | 1208 |
| 934 | Ga0439435_0001937 | 3300042436 | Bacteria | 3979 |
| 935 | Ga0451577_0378157 | 3300042876 | Bacteria | 1285 |
| 936 | Ga0466969_0056832 | 3300044656 | Bacteria | 1909 |
| 937 | Ga0466969_0085459 | 3300044656 | Bacteria | 1500 |
| 938 | Ga0466977_0000756 | 3300044666 | Bacteria | 11706 |
| 939 | Ga0466966_0020782 | 3300044684 | Bacteria | 4315 |
| 940 | Ga0466971_0038928 | 3300044719 | Bacteria | 2134 |
| 941 | Ga0466959_0319402 | 3300045049 | Bacteria | 1062 |
| 942 | Ga0466958_0023945 | 3300045836 | Bacteria | 3590 |
| 943 | Ga0466967_0052631 | 3300045976 | Bacteria | 3575 |
| 944 | Ga0466967_0199837 | 3300045976 | Bacteria | 1893 |
| 945 | Ga0466967_0360972 | 3300045976 | Bacteria | 1408 |
| 946 | Ga0495592_0006726 | 3300046454 | Bacteria | 8577 |
| 947 | Ga0495592_0070841 | 3300046454 | Bacteria | 2539 |
| 948 | Ga0495592_0077669 | 3300046454 | Bacteria | 2406 |
| 949 | Ga0495603_0011113 | 3300046455 | Bacteria | 5458 |
| 950 | Ga0495638_0083735 | 3300046460 | Unclassified | 1931 |
| 951 | Ga0495641_0009978 | 3300046461 | Bacteria | 5576 |
| 952 | Ga0495651_0115472 | 3300046462 | Unclassified | 1979 |
| 953 | Ga0495651_0335036 | 3300046462 | Bacteria | 1004 |
| 954 | Ga0495580_0018560 | 3300046472 | Bacteria | 5177 |
| 955 | Ga0495580_0046636 | 3300046472 | Unclassified | 3074 |
| 956 | Ga0495580_0154508 | 3300046472 | Bacteria | 1589 |
| 957 | Ga0495580_0247342 | 3300046472 | Bacteria | 1221 |
| 958 | Ga0495580_0289280 | 3300046472 | Unclassified | 1117 |
| 959 | Ga0495582_0000742 | 3300046473 | Bacteria | 18034 |
| 960 | Ga0495582_0016027 | 3300046473 | Bacteria | 4109 |
| 961 | Ga0495582_0127094 | 3300046473 | Bacteria | 1439 |
| 962 | Ga0495605_0000116 | 3300046474 | Bacteria | 103357 |
| 963 | Ga0495639_0015091 | 3300046475 | Bacteria | 3350 |
| 964 | Ga0495662_0020144 | 3300046476 | Bacteria | 3227 |
| 965 | Ga0495584_0034106 | 3300046491 | Unclassified | 2575 |
| 966 | Ga0495585_0014925 | 3300046492 | Bacteria | 4518 |
| 967 | Ga0495585_0040936 | 3300046492 | Bacteria | 2600 |
| 968 | Ga0495585_0078024 | 3300046492 | Bacteria | 1797 |
| 969 | Ga0495594_0078587 | 3300046499 | Bacteria | 1841 |
| 970 | Ga0495594_0082134 | 3300046499 | Unclassified | 1800 |
| 971 | Ga0495596_0000078 | 3300046500 | Bacteria | 67709 |
| 972 | Ga0495607_0000057 | 3300046501 | Bacteria | 110023 |
| 973 | Ga0495607_0021836 | 3300046501 | Bacteria | 4025 |
| 974 | Ga0495607_0062293 | 3300046501 | Bacteria | 2115 |
| 975 | Ga0495608_0009055 | 3300046511 | Bacteria | 6963 |
| 976 | Ga0495608_0021672 | 3300046511 | Bacteria | 4410 |
| 977 | Ga0495616_0034297 | 3300046513 | Bacteria | 2636 |
| 978 | Ga0495616_0062383 | 3300046513 | Bacteria | 1825 |
| 979 | Ga0495618_0217909 | 3300046514 | Unclassified | 1205 |
| 980 | Ga0495628_0072665 | 3300046516 | Bacteria | 2680 |
| 981 | Ga0495628_0323700 | 3300046516 | Bacteria | 1137 |
| 982 | Ga0495630_0039488 | 3300046517 | Bacteria | 3528 |
| 983 | Ga0495632_0002942 | 3300046519 | Bacteria | 12500 |
| 984 | Ga0495632_0016297 | 3300046519 | Bacteria | 4139 |
| 985 | Ga0495637_0055645 | 3300046520 | Bacteria | 1640 |
| 986 | Ga0495643_0000347 | 3300046522 | Bacteria | 62970 |
| 987 | Ga0495643_0009518 | 3300046522 | Bacteria | 6036 |
| 988 | Ga0495643_0012675 | 3300046522 | Bacteria | 5077 |
| 989 | Ga0495643_0033848 | 3300046522 | Bacteria | 2823 |
| 990 | Ga0495644_0003021 | 3300046523 | Bacteria | 6661 |
| 991 | Ga0495642_0001005 | 3300046528 | Bacteria | 13089 |
| 992 | Ga0495642_0015247 | 3300046528 | Bacteria | 2984 |
| 993 | Ga0495652_0018819 | 3300046529 | Bacteria | 6155 |
| 994 | Ga0495652_0064227 | 3300046529 | Unclassified | 3088 |
| 995 | Ga0495652_0067287 | 3300046529 | Bacteria | 3004 |
| 996 | Ga0495652_0359748 | 3300046529 | Bacteria | 1040 |
| 997 | Ga0495665_0042159 | 3300046531 | Bacteria | 2430 |
| 998 | Ga0495640_0083054 | 3300046533 | Unclassified | 2126 |
| 999 | Ga0495587_0000558 | 3300046536 | Bacteria | 25658 |
| 1000 | Ga0495587_0001220 | 3300046536 | Bacteria | 17012 |
| 1001 | Ga0495587_0004299 | 3300046536 | Bacteria | 9405 |
| 1002 | Ga0495587_0028966 | 3300046536 | Bacteria | 3364 |
| 1003 | Ga0495587_0071106 | 3300046536 | Bacteria | 2024 |
| 1004 | Ga0495621_0080601 | 3300046539 | Bacteria | 1213 |
| 1005 | Ga0495621_0096439 | 3300046539 | Unclassified | 1121 |
| 1006 | Ga0495645_0007662 | 3300046543 | Bacteria | 7509 |
| 1007 | Ga0495645_0045560 | 3300046543 | Bacteria | 3200 |
| 1008 | Ga0495645_0267122 | 3300046543 | Bacteria | 1130 |
| 1009 | Ga0495633_0004527 | 3300046558 | Bacteria | 8787 |
| 1010 | Ga0495667_0001591 | 3300046559 | Bacteria | 15043 |
| 1011 | Ga0495667_0040259 | 3300046559 | Bacteria | 3104 |
| 1012 | Ga0495667_0049036 | 3300046559 | Bacteria | 2788 |
| 1013 | Ga0495656_0012822 | 3300046615 | Bacteria | 3104 |
| 1014 | Ga0495656_0039230 | 3300046615 | Unclassified | 1966 |
| 1015 | Ga0495668_0002736 | 3300046616 | Bacteria | 14123 |
| 1016 | Ga0495634_0024844 | 3300046642 | Bacteria | 4200 |
| 1017 | Ga0495634_0083618 | 3300046642 | Bacteria | 2083 |
| 1018 | Ga0495611_0124750 | 3300046648 | Bacteria | 1201 |
| 1019 | Ga0495625_0000014 | 3300046660 | Bacteria | 323486 |
| 1020 | Ga0495659_0014646 | 3300046664 | Bacteria | 2570 |
| 1021 | Ga0495661_0000221 | 3300046665 | Bacteria | 65361 |
| 1022 | Ga0495661_0012090 | 3300046665 | Bacteria | 5837 |
| 1023 | Ga0495661_0165978 | 3300046665 | Bacteria | 1181 |
| 1024 | Ga0495588_0039789 | 3300046674 | Bacteria | 2396 |
| 1025 | Ga0495657_0001304 | 3300046675 | Bacteria | 21715 |
| 1026 | Ga0495599_0006862 | 3300046678 | Bacteria | 6885 |
| 1027 | Ga0495599_0065895 | 3300046678 | Bacteria | 2263 |
| 1028 | Ga0495623_0048616 | 3300046679 | Unclassified | 2690 |
| 1029 | Ga0495623_0100504 | 3300046679 | Bacteria | 1762 |
| 1030 | Ga0495623_0123540 | 3300046679 | Bacteria | 1556 |
| 1031 | Ga0495646_0068769 | 3300046680 | Unclassified | 2090 |
| 1032 | Ga0495646_0095465 | 3300046680 | Unclassified | 1711 |
| 1033 | Ga0495658_0009083 | 3300046683 | Bacteria | 4943 |
| 1034 | Ga0495658_0011647 | 3300046683 | Unclassified | 4431 |
| 1035 | Ga0495658_0015511 | 3300046683 | Bacteria | 3910 |
| 1036 | Ga0495658_0084179 | 3300046683 | Unclassified | 1872 |
| 1037 | Ga0495669_0001150 | 3300046684 | Bacteria | 10977 |
| 1038 | Ga0495669_0005036 | 3300046684 | Bacteria | 5494 |
| 1039 | Ga0495613_0000428 | 3300046689 | Bacteria | 35924 |
| 1040 | Ga0495613_0013455 | 3300046689 | Bacteria | 6077 |
| 1041 | Ga0495613_0047679 | 3300046689 | Bacteria | 3165 |
| 1042 | Ga0495613_0094297 | 3300046689 | Unclassified | 2166 |
| 1043 | Ga0495613_0164428 | 3300046689 | Bacteria | 1577 |
| 1044 | Ga0495613_0178618 | 3300046689 | Unclassified | 1504 |
| 1045 | Ga0495670_0014695 | 3300046691 | Bacteria | 3851 |
| 1046 | Ga0495670_0042086 | 3300046691 | Bacteria | 2279 |
| 1047 | Ga0495649_0000205 | 3300046694 | Bacteria | 52102 |
| 1048 | Ga0495649_0025062 | 3300046694 | Bacteria | 3323 |
| 1049 | Ga0495589_0000022 | 3300046794 | Bacteria | 196021 |
| 1050 | Ga0495660_0000044 | 3300046810 | Bacteria | 150926 |
| 1051 | Ga0495581_0030525 | 3300047315 | Bacteria | 3123 |
| 1052 | Ga0495604_0087995 | 3300047317 | Unclassified | 2312 |
| 1053 | Ga0495604_0095535 | 3300047317 | Unclassified | 2195 |
| 1054 | Ga0495604_0105351 | 3300047317 | Bacteria | 2064 |
| 1055 | Ga0495604_0205571 | 3300047317 | Unclassified | 1363 |
| 1056 | Ga0495636_0017297 | 3300047318 | Bacteria | 2886 |
| 1057 | Ga0495636_0119296 | 3300047318 | Unclassified | 1166 |
| 1058 | Ga0495674_0057298 | 3300047319 | Bacteria | 3410 |
| 1059 | Ga0495674_0088288 | 3300047319 | Bacteria | 2652 |
| 1060 | Ga0495674_0172345 | 3300047319 | Bacteria | 1805 |
| 1061 | Ga0495674_0242839 | 3300047319 | Bacteria | 1484 |
| 1062 | Ga0495672_0005576 | 3300047320 | Bacteria | 9950 |
| 1063 | Ga0495672_0026596 | 3300047320 | Bacteria | 3690 |
| 1064 | Ga0495672_0097613 | 3300047320 | Bacteria | 1600 |
| 1065 | Ga0495680_0169769 | 3300047322 | Bacteria | 1580 |
| 1066 | Ga0495687_000099 | 3300047443 | Bacteria | 132139 |
| 1067 | Ga0495675_0001554 | 3300047444 | Bacteria | 13851 |
| 1068 | Ga0495677_0000419 | 3300047445 | Bacteria | 18284 |
| 1069 | Ga0495677_0004940 | 3300047445 | Bacteria | 5084 |
| 1070 | Ga0495684_0000117 | 3300047471 | Bacteria | 57879 |
| 1071 | Ga0495684_0008684 | 3300047471 | Bacteria | 7858 |
| 1072 | Ga0495684_0042205 | 3300047471 | Bacteria | 3494 |
| 1073 | Ga0495684_0114162 | 3300047471 | Bacteria | 2036 |
| 1074 | Ga0495684_0149120 | 3300047471 | Bacteria | 1749 |
| 1075 | Ga0495684_0310983 | 3300047471 | Bacteria | 1129 |
| 1076 | Ga0495602_0000454 | 3300048088 | Bacteria | 38246 |
| 1077 | Ga0495602_0000669 | 3300048088 | Bacteria | 32135 |
| 1078 | Ga0495602_0004373 | 3300048088 | Bacteria | 14738 |
| 1079 | Ga0495602_0144256 | 3300048088 | Bacteria | 1881 |
| 1080 | Ga0495602_0188091 | 3300048088 | Bacteria | 1586 |
| 1081 | Ga0495602_0248140 | 3300048088 | Bacteria | 1328 |
| 1082 | Ga0495602_0389834 | 3300048088 | Unclassified | 996 |
| 1083 | Ga0495626_0000021 | 3300048091 | Bacteria | 217213 |
| 1084 | Ga0496100_0070591 | 3300048903 | Bacteria | 2329 |
| 1085 | Ga0496100_0086867 | 3300048903 | Unclassified | 2125 |
| 1086 | Ga0496100_0091451 | 3300048903 | Bacteria | 2077 |
| 1087 | Ga0496100_0092390 | 3300048903 | Bacteria | 2068 |
| 1088 | Ga0496101_0018442 | 3300048904 | Bacteria | 4745 |
| 1089 | Ga0496101_0074533 | 3300048904 | Unclassified | 2496 |
| 1090 | Ga0496101_0109219 | 3300048904 | Unclassified | 2081 |
| 1091 | Ga0496101_0149827 | 3300048904 | Bacteria | 1784 |
| 1092 | Ga0496102_0013554 | 3300048905 | Bacteria | 7065 |
| 1093 | Ga0496102_0082749 | 3300048905 | Bacteria | 2960 |
| 1094 | Ga0496102_0114287 | 3300048905 | Bacteria | 2518 |
| 1095 | Ga0496103_0005396 | 3300048906 | Bacteria | 7654 |
| 1096 | Ga0496103_0047269 | 3300048906 | Unclassified | 2659 |
| 1097 | Ga0496103_0100911 | 3300048906 | Bacteria | 1826 |
| 1098 | Ga0496104_0000406 | 3300048907 | Bacteria | 37705 |
| 1099 | Ga0496104_0009455 | 3300048907 | Bacteria | 8672 |
| 1100 | Ga0496104_0027628 | 3300048907 | Bacteria | 5253 |
| 1101 | Ga0496104_0036142 | 3300048907 | Bacteria | 4616 |
| 1102 | Ga0496104_0113400 | 3300048907 | Bacteria | 2599 |
| 1103 | Ga0496104_0115802 | 3300048907 | Bacteria | 2572 |
| 1104 | Ga0496104_0368957 | 3300048907 | Unclassified | 1348 |
| 1105 | Ga0496105_0002573 | 3300048908 | Bacteria | 13183 |
| 1106 | Ga0496105_0002868 | 3300048908 | Bacteria | 12630 |
| 1107 | Ga0496105_0017770 | 3300048908 | Bacteria | 5705 |
| 1108 | Ga0496105_0034460 | 3300048908 | Bacteria | 4164 |
| 1109 | Ga0496105_0053149 | 3300048908 | Bacteria | 3345 |
| 1110 | Ga0496106_0031605 | 3300048909 | Bacteria | 3945 |
| 1111 | Ga0496106_0085382 | 3300048909 | Bacteria | 2430 |
| 1112 | Ga0496106_0225318 | 3300048909 | Bacteria | 1496 |
| 1113 | Ga0496106_0245160 | 3300048909 | Bacteria | 1432 |
| 1114 | Ga0496107_0020257 | 3300048910 | Bacteria | 4695 |
| 1115 | Ga0496107_0068933 | 3300048910 | Bacteria | 2566 |
| 1116 | Ga0496108_0003849 | 3300048911 | Bacteria | 12043 |
| 1117 | Ga0496108_0027901 | 3300048911 | Bacteria | 4667 |
| 1118 | Ga0496108_0102265 | 3300048911 | Unclassified | 2445 |
| 1119 | Ga0496108_0216034 | 3300048911 | Bacteria | 1665 |
| 1120 | Ga0496108_0293763 | 3300048911 | Bacteria | 1415 |
| 1121 | Ga0496109_0032041 | 3300048912 | Bacteria | 4722 |
| 1122 | Ga0496109_0032874 | 3300048912 | Plasmid | 4666 |
| 1123 | Ga0496109_0048858 | 3300048912 | Bacteria | 3849 |
| 1124 | Ga0496109_0130752 | 3300048912 | Bacteria | 2343 |
| 1125 | Ga0496109_0147574 | 3300048912 | Bacteria | 2201 |
| 1126 | Ga0496109_0476035 | 3300048912 | Bacteria | 1179 |
| 1127 | Ga0496110_0015183 | 3300048913 | Bacteria | 6406 |
| 1128 | Ga0496110_0017621 | 3300048913 | Bacteria | 5970 |
| 1129 | Ga0496110_0200228 | 3300048913 | Unclassified | 1814 |
| 1130 | Ga0496111_0051025 | 3300048914 | Bacteria | 2986 |
| 1131 | Ga0496112_0002042 | 3300048915 | Bacteria | 15992 |
| 1132 | Ga0496112_0015636 | 3300048915 | Bacteria | 7088 |
| 1133 | Ga0496112_0036338 | 3300048915 | Bacteria | 4805 |
| 1134 | Ga0496112_0083923 | 3300048915 | Bacteria | 3151 |
| 1135 | Ga0496112_0145766 | 3300048915 | Unclassified | 2336 |
| 1136 | Ga0496112_0303488 | 3300048915 | Bacteria | 1542 |
| 1137 | Ga0496113_0011578 | 3300048916 | Bacteria | 5893 |
| 1138 | Ga0496113_0059654 | 3300048916 | Bacteria | 2874 |
| 1139 | Ga0496114_0028747 | 3300048917 | Bacteria | 4564 |
| 1140 | Ga0496114_0028999 | 3300048917 | Bacteria | 4546 |
| 1141 | Ga0496114_0066980 | 3300048917 | Plasmid | 3011 |
| 1142 | Ga0496114_0463203 | 3300048917 | Bacteria | 1122 |
| 1143 | Ga0496115_0005401 | 3300048918 | Bacteria | 9292 |
| 1144 | Ga0496115_0012759 | 3300048918 | Bacteria | 6334 |
| 1145 | Ga0496115_0058850 | 3300048918 | Bacteria | 3093 |
| 1146 | Ga0496115_0065587 | 3300048918 | Bacteria | 2933 |
| 1147 | Ga0496115_0149452 | 3300048918 | Unclassified | 1928 |
| 1148 | Ga0496115_0261719 | 3300048918 | Bacteria | 1422 |
| 1149 | Ga0496121_0355228 | 3300048924 | Bacteria | 975 |
| 1150 | Ga0496126_0091329 | 3300048929 | Bacteria | 2678 |
| 1151 | Ga0501298_010232 | 3300049521 | Unclassified | 1610 |
| 1152 | Ga0501034_0005118 | 3300049571 | Bacteria | 14384 |
| 1153 | Ga0501034_0019520 | 3300049571 | Bacteria | 6932 |
| 1154 | Ga0501034_0020632 | 3300049571 | Bacteria | 6730 |
| 1155 | Ga0501034_0091869 | 3300049571 | Bacteria | 3033 |
| 1156 | Ga0501036_0262139 | 3300049572 | Bacteria | 1448 |
| 1157 | Ga0501041_0081607 | 3300049577 | Bacteria | 1991 |
| 1158 | Ga0501042_0014192 | 3300049578 | Bacteria | 5434 |
| 1159 | Ga0501043_0324623 | 3300049579 | Bacteria | 1173 |
| 1160 | Ga0501046_0063906 | 3300049580 | Bacteria | 2874 |
| 1161 | Ga0501046_0355800 | 3300049580 | Bacteria | 1062 |
| 1162 | Ga0501047_0066421 | 3300049581 | Bacteria | 3477 |
| 1163 | Ga0501047_0135420 | 3300049581 | Bacteria | 2344 |
| 1164 | Ga0501047_0273771 | 3300049581 | Bacteria | 1534 |
| 1165 | Ga0501068_0133883 | 3300049584 | Bacteria | 1551 |
| 1166 | Ga0501069_0096551 | 3300049585 | Bacteria | 1675 |
| 1167 | Ga0501070_0043503 | 3300049586 | Unclassified | 3737 |
| 1168 | Ga0501070_0055626 | 3300049586 | Bacteria | 3280 |
| 1169 | Ga0501070_0064543 | 3300049586 | Bacteria | 3032 |
| 1170 | Ga0501070_0088970 | 3300049586 | Bacteria | 2556 |
| 1171 | Ga0501070_0213533 | 3300049586 | Bacteria | 1583 |
| 1172 | Ga0501071_0033438 | 3300049587 | Bacteria | 3654 |
| 1173 | Ga0501072_0063265 | 3300049588 | Bacteria | 2919 |
| 1174 | Ga0501072_0403707 | 3300049588 | Bacteria | 1084 |
| 1175 | Ga0501074_0126106 | 3300049590 | Bacteria | 1831 |
| 1176 | Ga0501075_0060558 | 3300049591 | Bacteria | 2852 |
| 1177 | Ga0501075_0068460 | 3300049591 | Bacteria | 2682 |
| 1178 | Ga0501075_0163699 | 3300049591 | Unclassified | 1697 |
| 1179 | Ga0501076_0028885 | 3300049592 | Bacteria | 4310 |
| 1180 | Ga0501079_0025243 | 3300049741 | Bacteria | 4559 |
| 1181 | Ga0501079_0315507 | 3300049741 | Unclassified | 1224 |
| 1182 | Ga0501080_0063543 | 3300049742 | Bacteria | 3436 |
| 1183 | Ga0501080_0180770 | 3300049742 | Unclassified | 1941 |
| 1184 | Ga0501081_0070318 | 3300049743 | Bacteria | 2439 |
| 1185 | Ga0501272_001824 | 3300049769 | Bacteria | 2073 |
| 1186 | Ga0501283_001260 | 3300049779 | Bacteria | 3343 |
| 1187 | Ga0501045_0060947 | 3300049824 | Bacteria | 2767 |
| 1188 | nmdc:mga03n38_7494_c1 | 3300050490 | Bacteria | 3864 |
| 1189 | nmdc:mga0yw44_153427_c1 | 3300050492 | Bacteria | 1504 |
| 1190 | nmdc:mga0yw44_2164_c1 | 3300050492 | Bacteria | 8247 |
| 1191 | nmdc:mga0yw44_55158_c1 | 3300050492 | Bacteria | 2417 |
| 1192 | nmdc:mga06z11_1143_c1 | 3300050494 | Bacteria | 7945 |
| 1193 | nmdc:mga06z11_118152_c1 | 3300050494 | Bacteria | 1476 |
| 1194 | nmdc:mga06z11_211721_c1 | 3300050494 | Bacteria | 1130 |
| 1195 | nmdc:mga06z11_22438_c1 | 3300050494 | Bacteria | 2948 |
| 1196 | nmdc:mga06z11_54001_c1 | 3300050494 | Bacteria | 2069 |
| 1197 | nmdc:mga07m45_44184_c1 | 3300050496 | Bacteria | 2499 |
| 1198 | nmdc:mga05p37_11743_c1 | 3300050507 | Bacteria | 10441 |
| 1199 | nmdc:mga05p37_16523_c1 | 3300050507 | Bacteria | 8891 |
| 1200 | nmdc:mga05p37_216107_c1 | 3300050507 | Unclassified | 2316 |
| 1201 | nmdc:mga05p37_259281_c1 | 3300050507 | Bacteria | 2081 |
| 1202 | nmdc:mga05p37_28051_c1 | 3300050507 | Bacteria | 6860 |
| 1203 | nmdc:mga05p37_35787_c1 | 3300050507 | Bacteria | 6090 |
| 1204 | nmdc:mga05p37_413989_c1 | 3300050507 | Bacteria | 1570 |
| 1205 | nmdc:mga05p37_520847_c1 | 3300050507 | Bacteria | 1360 |
| 1206 | nmdc:mga05p37_524734_c1 | 3300050507 | Bacteria | 1354 |
| 1207 | nmdc:mga05p37_55206_c1 | 3300050507 | Bacteria | 4887 |
| 1208 | nmdc:mga05p37_61022_c1 | 3300050507 | Bacteria | 4642 |
| 1209 | nmdc:mga05p37_72924_c1 | 3300050507 | Bacteria | 4225 |
| 1210 | nmdc:mga09592_14008_c1 | 3300050508 | Bacteria | 6545 |
| 1211 | nmdc:mga09592_141557_c1 | 3300050508 | Unclassified | 2074 |
| 1212 | nmdc:mga09592_212316_c1 | 3300050508 | Bacteria | 1677 |
| 1213 | nmdc:mga09592_257445_c1 | 3300050508 | Unclassified | 1513 |
| 1214 | nmdc:mga09592_52344_c1 | 3300050508 | Unclassified | 3446 |
| 1215 | nmdc:mga09592_967_c1 | 3300050508 | Bacteria | 22695 |
| 1216 | nmdc:mga0qj67_136894_c1 | 3300050509 | Bacteria | 1984 |
| 1217 | nmdc:mga0qj67_15628_c1 | 3300050509 | Bacteria | 5749 |
| 1218 | nmdc:mga0qj67_16084_c1 | 3300050509 | Bacteria | 5667 |
| 1219 | nmdc:mga0qj67_201389_c1 | 3300050509 | Bacteria | 1618 |
| 1220 | nmdc:mga0qj67_293274_c1 | 3300050509 | Unclassified | 1318 |
| 1221 | nmdc:mga0qj67_86334_c1 | 3300050509 | Bacteria | 2517 |
| 1222 | nmdc:mga06r32_118689_c1 | 3300050510 | Bacteria | 2608 |
| 1223 | nmdc:mga08y16_12039_c1 | 3300050511 | Bacteria | 9089 |
| 1224 | nmdc:mga08y16_128960_c1 | 3300050511 | Bacteria | 2631 |
| 1225 | nmdc:mga08y16_1769_c1 | 3300050511 | Bacteria | 21886 |
| 1226 | nmdc:mga08y16_2215_c1 | 3300050511 | Bacteria | 19933 |
| 1227 | nmdc:mga08y16_2889_c1 | 3300050511 | Bacteria | 17675 |
| 1228 | nmdc:mga08y16_309471_c1 | 3300050511 | Bacteria | 1627 |
| 1229 | nmdc:mga08y16_317592_c1 | 3300050511 | Bacteria | 1604 |
| 1230 | nmdc:mga08y16_37188_c1 | 3300050511 | Bacteria | 5114 |
| 1231 | nmdc:mga08y16_47758_c1 | 3300050511 | Bacteria | 4480 |
| 1232 | nmdc:mga08y16_5902_c1 | 3300050511 | Bacteria | 12836 |
| 1233 | nmdc:mga08y16_63674_c1 | 3300050511 | Bacteria | 3851 |
| 1234 | nmdc:mga08y16_83338_c1 | 3300050511 | Bacteria | 3332 |
| 1235 | nmdc:mga0n895_146918_c1 | 3300050512 | Bacteria | 2387 |
| 1236 | nmdc:mga0n895_17227_c1 | 3300050512 | Bacteria | 6657 |
| 1237 | nmdc:mga0n895_443684_c1 | 3300050512 | Bacteria | 1311 |
| 1238 | nmdc:mga0n895_44481_c1 | 3300050512 | Bacteria | 4330 |
| 1239 | nmdc:mga0n895_92567_c1 | 3300050512 | Bacteria | 3026 |
| 1240 | nmdc:mga0rr50_160160_c1 | 3300050513 | Bacteria | 1826 |
| 1241 | nmdc:mga0rr50_185733_c1 | 3300050513 | Bacteria | 1701 |
| 1242 | nmdc:mga0rr50_416265_c1 | 3300050513 | Bacteria | 1136 |
| 1243 | nmdc:mga0a205_2492_c1 | 3300050515 | Bacteria | 16226 |
| 1244 | nmdc:mga0a205_332334_c1 | 3300050515 | Bacteria | 1389 |
| 1245 | nmdc:mga0a205_478306_c1 | 3300050515 | Bacteria | 1104 |
| 1246 | nmdc:mga0a205_824_c1 | 3300050515 | Bacteria | 25229 |
| 1247 | nmdc:mga0sz30_13246_c1 | 3300050516 | Bacteria | 3226 |
| 1248 | Ga0495601_0000639 | 3300053077 | Bacteria | 18674 |
| 1249 | Ga0495601_0004849 | 3300053077 | Bacteria | 7804 |
| 1250 | Ga0495601_0034498 | 3300053077 | Bacteria | 3158 |
| 1251 | Ga0495601_0048748 | 3300053077 | Bacteria | 2668 |
| 1252 | Ga0495601_0096989 | 3300053077 | Bacteria | 1902 |
| 1253 | Ga0495601_0205033 | 3300053077 | Bacteria | 1288 |
| 1254 | Ga0495601_0268441 | 3300053077 | Unclassified | 1113 |
| 1255 | Ga0495595_0002937 | 3300053084 | Bacteria | 6725 |
| 1256 | Ga0495619_0000356 | 3300053085 | Bacteria | 31805 |
| 1257 | Ga0495619_0006623 | 3300053085 | Bacteria | 7330 |
| 1258 | Ga0495619_0019614 | 3300053085 | Bacteria | 4300 |
| 1259 | Ga0495619_0100740 | 3300053085 | Bacteria | 1966 |
| 1260 | Ga0500641_0005080 | 3300053096 | Bacteria | 4663 |
| 1261 | Ga0500595_022630 | 3300053119 | Unclassified | 2221 |
| 1262 | Ga0500595_034881 | 3300053119 | Bacteria | 1661 |
| 1263 | Ga0500652_000004 | 3300053131 | Bacteria | 173428 |
| 1264 | Ga0500652_000021 | 3300053131 | Bacteria | 119100 |
| 1265 | Ga0500568_0000656 | 3300053139 | Bacteria | 24982 |
| 1266 | Ga0500568_0004824 | 3300053139 | Bacteria | 7126 |
| 1267 | Ga0500634_0010186 | 3300053161 | Bacteria | 4794 |
| 1268 | Ga0500636_0002225 | 3300053177 | Bacteria | 10748 |
| 1269 | Ga0500636_0066608 | 3300053177 | Unclassified | 2094 |
| 1270 | Ga0501084_0106166 | 3300054114 | Bacteria | 2359 |
| 1271 | Ga0501084_0343399 | 3300054114 | Bacteria | 1261 |
| 1272 | Ga0501082_0331610 | 3300060353 | Bacteria | 1326 |
| 1273 | Ga0530510_0042041 | 3300061734 | Bacteria | 3301 |
| 1274 | Ga0530510_0356859 | 3300061734 | Unclassified | 1098 |
| 1275 | 2510251177 | 2510065045 | Bacteria | 7761063 |
| 1276 | 2515685507 | 2515154122 | Bacteria | 8609520 |
| 1277 | 2719640304 | 2718217991 | Bacteria | 7829542 |
| 1278 | 2792838858 | 2791355137 | Bacteria | 9654227 |
| 1279 | 2902688269 | 2902682994 | Bacteria | 8951596 |
| 1280 | 8047678393 | 8047673197 | Bacteria | 7395230 |
| 1281 | 8055271629 | 8055266321 | Bacteria | 7999742 |
| 1282 | Ga0436361_0920430 | |||
| 1283 | JGI24744J21845_10010566 | |||
| 1284 | JGI24033J26618_1005216 | |||
| 1285 | JGI24742J22300_10000688 | |||
| 1286 | JGI25406J46586_10000393 | |||
| 1287 | JGI25406J46586_10002426 | |||
| 1288 | JGI25406J46586_10049082 | |||
| 1289 | JGI25406J46586_10054052 | |||
| 1290 | JGI25405J52794_10002066 | |||
| 1291 | Ga0065704_10138674 | |||
| 1292 | Ga0065712_10102051 | |||
| 1293 | Ga0065715_10184617 | |||
| 1294 | Ga0070658_10140404 | |||
| 1295 | Ga0070658_10228260 | |||
| 1296 | Ga0070676_10011166 | |||
| 1297 | Ga0070676_10029136 | |||
| 1298 | Ga0070676_10220658 | |||
| 1299 | Ga0070676_10227425 | |||
| 1300 | Ga0070683_100000301 | |||
| 1301 | Ga0070683_100007229 | |||
| 1302 | Ga0070683_100014020 | |||
| 1303 | Ga0070683_100050193 | |||
| 1304 | Ga0070683_100073743 | |||
| 1305 | Ga0070683_100124602 | |||
| 1306 | Ga0070683_100129398 | |||
| 1307 | Ga0070683_100251360 | |||
| 1308 | Ga0070690_100005585 | |||
| 1309 | Ga0070690_100005812 | |||
| 1310 | Ga0070690_100017529 | |||
| 1311 | Ga0070690_100026462 | |||
| 1312 | Ga0070690_100054616 | |||
| 1313 | Ga0070690_100061743 | |||
| 1314 | Ga0070690_100100883 | |||
| 1315 | Ga0070670_100000974 | |||
| 1316 | Ga0070670_100013453 | |||
| 1317 | Ga0070670_100018295 | |||
| 1318 | Ga0070670_100024356 | |||
| 1319 | Ga0070670_100048960 | |||
| 1320 | Ga0070670_100095815 | |||
| 1321 | Ga0070670_100323125 | |||
| 1322 | Ga0070677_10002771 | |||
| 1323 | Ga0070677_10008993 | |||
| 1324 | Ga0068869_100007259 | |||
| 1325 | Ga0068869_100009214 | |||
| 1326 | Ga0068869_100026931 | |||
| 1327 | Ga0068869_100035710 | |||
| 1328 | Ga0068869_100135283 | |||
| 1329 | Ga0068869_100174182 | |||
| 1330 | Ga0070666_10019084 | |||
| 1331 | Ga0070666_10030598 | |||
| 1332 | Ga0070666_10044920 | |||
| 1333 | Ga0070680_100001316 | |||
| 1334 | Ga0070680_100001335 | |||
| 1335 | Ga0070680_100009677 | |||
| 1336 | Ga0068868_100006725 | |||
| 1337 | Ga0068868_100010392 | |||
| 1338 | Ga0068868_100014330 | |||
| 1339 | Ga0068868_100029869 | |||
| 1340 | Ga0068868_100058202 | |||
| 1341 | Ga0070660_100091242 | |||
| 1342 | Ga0070660_100225540 | |||
| 1343 | Ga0070689_100012396 | |||
| 1344 | Ga0070689_100069996 | |||
| 1345 | Ga0070689_100107386 | |||
| 1346 | Ga0070689_100145963 | |||
| 1347 | Ga0070691_10000324 | |||
| 1348 | Ga0070687_100008670 | |||
| 1349 | Ga0070687_100046081 | |||
| 1350 | Ga0070687_100104374 | |||
| 1351 | Ga0070687_100178246 | |||
| 1352 | Ga0070661_100011281 | |||
| 1353 | Ga0070661_100019692 | |||
| 1354 | Ga0070661_100106930 | |||
| 1355 | Ga0070661_100150999 | |||
| 1356 | Ga0070661_100204408 | |||
| 1357 | Ga0070661_100353104 | |||
| 1358 | Ga0070692_10111871 | |||
| 1359 | Ga0070692_10200172 | |||
| 1360 | Ga0070669_100004616 | |||
| 1361 | Ga0070669_100016001 | |||
| 1362 | Ga0070669_100030914 | |||
| 1363 | Ga0070669_100278550 | |||
| 1364 | Ga0070675_100000644 | |||
| 1365 | Ga0070675_100001188 | |||
| 1366 | Ga0070675_100003309 | |||
| 1367 | Ga0070675_100027191 | |||
| 1368 | Ga0070675_100075583 | |||
| 1369 | Ga0070675_100107358 | |||
| 1370 | Ga0070675_100114732 | |||
| 1371 | Ga0070675_100328252 | |||
| 1372 | Ga0070671_100039225 | |||
| 1373 | Ga0070671_100039557 | |||
| 1374 | Ga0070671_100062326 | |||
| 1375 | Ga0070671_100122770 | |||
| 1376 | Ga0070671_100219325 | |||
| 1377 | Ga0070674_100004510 | |||
| 1378 | Ga0070674_100073938 | |||
| 1379 | Ga0070674_100090130 | |||
| 1380 | Ga0070674_100218530 | |||
| 1381 | Ga0070674_100243305 | |||
| 1382 | Ga0070674_100279285 | |||
| 1383 | Ga0070673_100020932 | |||
| 1384 | Ga0070673_100024873 | |||
| 1385 | Ga0070673_100025354 | |||
| 1386 | Ga0070673_100026223 | |||
| 1387 | Ga0070673_100132007 | |||
| 1388 | Ga0070673_100184448 | |||
| 1389 | Ga0070673_100211560 | |||
| 1390 | Ga0070688_100008145 | |||
| 1391 | Ga0070688_100013932 | |||
| 1392 | Ga0070688_100039988 | |||
| 1393 | Ga0070688_100081378 | |||
| 1394 | Ga0070688_100094296 | |||
| 1395 | Ga0070659_100008560 | |||
| 1396 | Ga0070659_100060974 | |||
| 1397 | Ga0070659_100133583 | |||
| 1398 | Ga0070659_100303077 | |||
| 1399 | Ga0070659_100314517 | |||
| 1400 | Ga0070667_100008209 | |||
| 1401 | Ga0070667_100011865 | |||
| 1402 | Ga0070667_100020877 | |||
| 1403 | Ga0070667_100048372 | |||
| 1404 | Ga0070667_100429441 | |||
| 1405 | Ga0070709_10141420 | |||
| 1406 | Ga0070714_100044338 | |||
| 1407 | Ga0070714_100138874 | |||
| 1408 | Ga0070714_100385438 | |||
| 1409 | Ga0070714_100441605 | |||
| 1410 | Ga0070714_100529998 | |||
| 1411 | Ga0070713_100018211 | |||
| 1412 | Ga0070713_100030488 | |||
| 1413 | Ga0070713_100039332 | |||
| 1414 | Ga0070713_100049632 | |||
| 1415 | Ga0070713_100069174 | |||
| 1416 | Ga0070713_100291034 | |||
| 1417 | Ga0070713_100462597 | |||
| 1418 | Ga0070701_10008881 | |||
| 1419 | Ga0070701_10013651 | |||
| 1420 | Ga0070701_10161672 | |||
| 1421 | Ga0070711_100101480 | |||
| 1422 | Ga0070711_100219847 | |||
| 1423 | Ga0070711_100251435 | |||
| 1424 | Ga0070705_100079777 | |||
| 1425 | Ga0070705_100195361 | |||
| 1426 | Ga0070700_100017507 | |||
| 1427 | Ga0070700_100023549 | |||
| 1428 | Ga0070700_100085121 | |||
| 1429 | Ga0070700_100333858 | |||
| 1430 | Ga0070708_100467645 | |||
| 1431 | Ga0070678_100033289 | |||
| 1432 | Ga0070678_100078695 | |||
| 1433 | Ga0070678_100082787 | |||
| 1434 | Ga0070678_100138521 | |||
| 1435 | Ga0070678_100304707 | |||
| 1436 | Ga0070662_100014432 | |||
| 1437 | Ga0070662_100044895 | |||
| 1438 | Ga0070662_100070282 | |||
| 1439 | Ga0070662_100108085 | |||
| 1440 | Ga0070681_10008296 | |||
| 1441 | Ga0070681_10009631 | |||
| 1442 | Ga0070681_10022535 | |||
| 1443 | Ga0070681_10032405 | |||
| 1444 | Ga0070681_10066078 | |||
| 1445 | Ga0070681_10076173 | |||
| 1446 | Ga0070681_10094217 | |||
| 1447 | Ga0070681_10172389 | |||
| 1448 | Ga0070681_10228249 | |||
| 1449 | Ga0070681_10275489 | |||
| 1450 | Ga0068867_100034640 | |||
| 1451 | Ga0068867_100037213 | |||
| 1452 | Ga0068867_100336738 | |||
| 1453 | Ga0070685_10221747 | |||
| 1454 | Ga0070698_100083468 | |||
| 1455 | Ga0070698_100342720 | |||
| 1456 | Ga0070699_100070838 | |||
| 1457 | Ga0070699_100105534 | |||
| 1458 | Ga0070679_100004740 | |||
| 1459 | Ga0070679_100015693 | |||
| 1460 | Ga0070679_100017008 | |||
| 1461 | Ga0070679_100021451 | |||
| 1462 | Ga0070679_100112724 | |||
| 1463 | Ga0070679_100210601 | |||
| 1464 | Ga0070684_100001680 | |||
| 1465 | Ga0070684_100007348 | |||
| 1466 | Ga0070684_100012682 | |||
| 1467 | Ga0070684_100076402 | |||
| 1468 | Ga0070684_100113031 | |||
| 1469 | Ga0070684_100321308 | |||
| 1470 | Ga0070697_100468662 | |||
| 1471 | Ga0068853_100013038 | |||
| 1472 | Ga0068853_100024105 | |||
| 1473 | Ga0068853_100075555 | |||
| 1474 | Ga0068853_100092275 | |||
| 1475 | Ga0068853_100154957 | |||
| 1476 | Ga0068853_100197011 | |||
| 1477 | Ga0070672_100011068 | |||
| 1478 | Ga0070672_100018764 | |||
| 1479 | Ga0070672_100023131 | |||
| 1480 | Ga0070672_100046934 | |||
| 1481 | Ga0070672_100139048 | |||
| 1482 | Ga0070672_100261424 | |||
| 1483 | Ga0070686_100009770 | |||
| 1484 | Ga0070686_100013446 | |||
| 1485 | Ga0070686_100023771 | |||
| 1486 | Ga0070686_100037728 | |||
| 1487 | Ga0070686_100122391 | |||
| 1488 | Ga0070695_100197823 | |||
| 1489 | Ga0070696_100260870 | |||
| 1490 | Ga0070693_100023319 | |||
| 1491 | Ga0070665_100008439 | |||
| 1492 | Ga0070665_100056481 | |||
| 1493 | Ga0070665_100076361 | |||
| 1494 | Ga0070665_100166516 | |||
| 1495 | Ga0070665_100263670 | |||
| 1496 | Ga0070704_100092750 | |||
| 1497 | Ga0068855_100002819 | |||
| 1498 | Ga0068855_100005925 | |||
| 1499 | Ga0068855_100040045 | |||
| 1500 | Ga0068855_100081259 | |||
| 1501 | Ga0068855_100115545 | |||
| 1502 | Ga0068855_100164037 | |||
| 1503 | Ga0068855_100188262 | |||
| 1504 | Ga0070664_100014604 | |||
| 1505 | Ga0070664_100022987 | |||
| 1506 | Ga0070664_100033721 | |||
| 1507 | Ga0070664_100216439 | |||
| 1508 | Ga0068857_100015291 | |||
| 1509 | Ga0068857_100015475 | |||
| 1510 | Ga0068857_100035161 | |||
| 1511 | Ga0068857_100126450 | |||
| 1512 | Ga0068857_100126977 | |||
| 1513 | Ga0068857_100241378 | |||
| 1514 | Ga0068857_100319395 | |||
| 1515 | Ga0068854_100237622 | |||
| 1516 | Ga0068856_100001168 | |||
| 1517 | Ga0068856_100014581 | |||
| 1518 | Ga0068856_100019448 | |||
| 1519 | Ga0068856_100026599 | |||
| 1520 | Ga0068856_100142501 | |||
| 1521 | Ga0068856_100167929 | |||
| 1522 | Ga0068856_100341959 | |||
| 1523 | Ga0070702_100008723 | |||
| 1524 | Ga0070702_100101337 | |||
| 1525 | Ga0068852_100009496 | |||
| 1526 | Ga0068852_100021458 | |||
| 1527 | Ga0068852_100146475 | |||
| 1528 | Ga0068852_100324058 | |||
| 1529 | Ga0068852_100451881 | |||
| 1530 | Ga0068859_100014354 | |||
| 1531 | Ga0068859_100078422 | |||
| 1532 | Ga0068859_100082514 | |||
| 1533 | Ga0068859_100092226 | |||
| 1534 | Ga0068859_100113609 | |||
| 1535 | Ga0068859_100132726 | |||
| 1536 | Ga0068859_100199251 | |||
| 1537 | Ga0068859_100305576 | |||
| 1538 | Ga0068859_100333227 | |||
| 1539 | Ga0068859_100391398 | |||
| 1540 | Ga0068864_100002489 | |||
| 1541 | Ga0068864_100047520 | |||
| 1542 | Ga0068864_100061335 | |||
| 1543 | Ga0068864_100119949 | |||
| 1544 | Ga0068864_100235155 | |||
| 1545 | Ga0068861_100135391 | |||
| 1546 | Ga0068861_100144878 | |||
| 1547 | Ga0068851_10083405 | |||
| 1548 | Ga0068870_10001158 | |||
| 1549 | Ga0068870_10004289 | |||
| 1550 | Ga0068870_10007546 | |||
| 1551 | Ga0068870_10099422 | |||
| 1552 | Ga0068870_10159685 | |||
| 1553 | Ga0068863_100014331 | |||
| 1554 | Ga0068863_100016886 | |||
| 1555 | Ga0068863_100023491 | |||
| 1556 | Ga0068863_100190271 | |||
| 1557 | Ga0068858_100028766 | |||
| 1558 | Ga0068858_100031181 | |||
| 1559 | Ga0068858_100041156 | |||
| 1560 | Ga0068858_100042373 | |||
| 1561 | Ga0068858_100054060 | |||
| 1562 | Ga0068860_100010576 | |||
| 1563 | Ga0068860_100018643 | |||
| 1564 | Ga0068860_100051204 | |||
| 1565 | Ga0068860_100086035 | |||
| 1566 | Ga0068860_100142556 | |||
| 1567 | Ga0068862_100020187 | |||
| 1568 | Ga0068862_100071365 | |||
| 1569 | Ga0068862_100231099 | |||
| 1570 | Ga0081455_10000840 | |||
| 1571 | Ga0081455_10021104 | |||
| 1572 | Ga0081455_10034725 | |||
| 1573 | Ga0081538_10027048 | |||
| 1574 | Ga0081539_10000047 | |||
| 1575 | Ga0081539_10002846 | |||
| 1576 | Ga0081539_10004786 | |||
| 1577 | Ga0081539_10014737 | |||
| 1578 | Ga0075365_10003122 | |||
| 1579 | Ga0075365_10010200 | |||
| 1580 | Ga0075365_10074434 | |||
| 1581 | Ga0075365_10099906 | |||
| 1582 | Ga0075364_10020903 | |||
| 1583 | Ga0070715_10099109 | |||
| 1584 | Ga0070712_100022120 | |||
| 1585 | Ga0070712_100043331 | |||
| 1586 | Ga0070712_100451848 | |||
| 1587 | Ga0075362_10043835 | |||
| 1588 | Ga0075362_10054401 | |||
| 1589 | Ga0075367_10014301 | |||
| 1590 | Ga0075367_10080533 | |||
| 1591 | Ga0075367_10106252 | |||
| 1592 | Ga0075367_10211142 | |||
| 1593 | Ga0075427_10006826 | |||
| 1594 | Ga0075366_10022922 | |||
| 1595 | Ga0097621_100012607 | |||
| 1596 | Ga0097621_100032737 | |||
| 1597 | Ga0097621_100033878 | |||
| 1598 | Ga0097621_100053281 | |||
| 1599 | Ga0097621_100074759 | |||
| 1600 | Ga0097621_100181121 | |||
| 1601 | Ga0097621_100235576 | |||
| 1602 | Ga0097621_100235787 | |||
| 1603 | Ga0097621_100277356 | |||
| 1604 | Ga0097621_100476508 | |||
| 1605 | Ga0068871_100014427 | |||
| 1606 | Ga0068871_100020640 | |||
| 1607 | Ga0068871_100079316 | |||
| 1608 | Ga0068871_100083862 | |||
| 1609 | Ga0068871_100270691 | |||
| 1610 | Ga0075428_100005211 | |||
| 1611 | Ga0075428_100034588 | |||
| 1612 | Ga0075428_100052788 | |||
| 1613 | Ga0075428_100070527 | |||
| 1614 | Ga0075428_100077794 | |||
| 1615 | Ga0075428_100095292 | |||
| 1616 | Ga0075428_100113329 | |||
| 1617 | Ga0075428_100138885 | |||
| 1618 | Ga0075428_100230447 | |||
| 1619 | Ga0075428_100304665 | |||
| 1620 | Ga0075430_100002643 | |||
| 1621 | Ga0075430_100013828 | |||
| 1622 | Ga0075430_100039729 | |||
| 1623 | Ga0075430_100056531 | |||
| 1624 | Ga0075430_100078529 | |||
| 1625 | Ga0075430_100132101 | |||
| 1626 | Ga0075431_100000646 | |||
| 1627 | Ga0075431_100031593 | |||
| 1628 | Ga0075431_100106227 | |||
| 1629 | Ga0075431_100194412 | |||
| 1630 | Ga0075431_100523971 | |||
| 1631 | Ga0075433_10000460 | |||
| 1632 | Ga0075433_10001289 | |||
| 1633 | Ga0075433_10001670 | |||
| 1634 | Ga0075433_10209782 | |||
| 1635 | Ga0075434_100003682 | |||
| 1636 | Ga0075434_100016390 | |||
| 1637 | Ga0075434_100065432 | |||
| 1638 | Ga0075434_100283137 | |||
| 1639 | Ga0075434_100323868 | |||
| 1640 | Ga0075429_100001853 | |||
| 1641 | Ga0075429_100251220 | |||
| 1642 | Ga0075429_100271027 | |||
| 1643 | Ga0068865_100003824 | |||
| 1644 | Ga0068865_100080632 | |||
| 1645 | Ga0068865_100108285 | |||
| 1646 | Ga0068865_100326202 | |||
| 1647 | Ga0097620_100014354 | |||
| 1648 | Ga0097620_100078423 | |||
| 1649 | Ga0097620_100082515 | |||
| 1650 | Ga0097620_100092224 | |||
| 1651 | Ga0097620_100113612 | |||
| 1652 | Ga0097620_100132726 | |||
| 1653 | Ga0097620_100199255 | |||
| 1654 | Ga0097620_100305547 | |||
| 1655 | Ga0097620_100333204 | |||
| 1656 | Ga0097620_100391354 | |||
| 1657 | Ga0075435_100295006 | |||
| 1658 | Ga0099795_10046363 | |||
| 1659 | Ga0105240_10007648 | |||
| 1660 | Ga0105240_10022565 | |||
| 1661 | Ga0105240_10032830 | |||
| 1662 | Ga0105240_10034115 | |||
| 1663 | Ga0105240_10060448 | |||
| 1664 | Ga0105240_10095953 | |||
| 1665 | Ga0105240_10497798 | |||
| 1666 | Ga0111539_10000151 | |||
| 1667 | Ga0111539_10000562 | |||
| 1668 | Ga0111539_10002437 | |||
| 1669 | Ga0111539_10002719 | |||
| 1670 | Ga0111539_10003382 | |||
| 1671 | Ga0111539_10015153 | |||
| 1672 | Ga0111539_10021998 | |||
| 1673 | Ga0111539_10039106 | |||
| 1674 | Ga0111539_10050957 | |||
| 1675 | Ga0111539_10150753 | |||
| 1676 | Ga0111539_10251357 | |||
| 1677 | Ga0111539_10285962 | |||
| 1678 | Ga0111539_10348270 | |||
| 1679 | Ga0105245_10001655 | |||
| 1680 | Ga0105245_10004216 | |||
| 1681 | Ga0105245_10008681 | |||
| 1682 | Ga0105245_10016334 | |||
| 1683 | Ga0105245_10036311 | |||
| 1684 | Ga0105247_10007255 | |||
| 1685 | Ga0105247_10022228 | |||
| 1686 | Ga0105247_10022256 | |||
| 1687 | Ga0114129_10000797 | |||
| 1688 | Ga0114129_10002798 | |||
| 1689 | Ga0114129_10004770 | |||
| 1690 | Ga0114129_10078064 | |||
| 1691 | Ga0114129_10119066 | |||
| 1692 | Ga0114129_10126143 | |||
| 1693 | Ga0114129_10167684 | |||
| 1694 | Ga0114129_10266178 | |||
| 1695 | Ga0114129_10314380 | |||
| 1696 | Ga0114129_10340973 | |||
| 1697 | Ga0114129_10655453 | |||
| 1698 | Ga0105243_10073902 | |||
| 1699 | Ga0105243_10079238 | |||
| 1700 | Ga0105243_10261055 | |||
| 1701 | Ga0105243_10406941 | |||
| 1702 | Ga0105241_10001682 | |||
| 1703 | Ga0105241_10157116 | |||
| 1704 | Ga0105241_10158844 | |||
| 1705 | Ga0105242_10039911 | |||
| 1706 | Ga0105242_10074931 | |||
| 1707 | Ga0105242_10224243 | |||
| 1708 | Ga0105242_10463875 | |||
| 1709 | Ga0105248_10000804 | |||
| 1710 | Ga0105248_10003271 | |||
| 1711 | Ga0105248_10004514 | |||
| 1712 | Ga0105248_10006795 | |||
| 1713 | Ga0105248_10007062 | |||
| 1714 | Ga0105248_10012815 | |||
| 1715 | Ga0105248_10023319 | |||
| 1716 | Ga0105248_10027991 | |||
| 1717 | Ga0105248_10031282 | |||
| 1718 | Ga0105248_10035718 | |||
| 1719 | Ga0105248_10074816 | |||
| 1720 | Ga0105248_10424526 | |||
| 1721 | Ga0105248_10561737 | |||
| 1722 | Ga0105237_10003677 | |||
| 1723 | Ga0105237_10004000 | |||
| 1724 | Ga0105237_10121241 | |||
| 1725 | Ga0105237_10125623 | |||
| 1726 | Ga0105237_10141258 | |||
| 1727 | Ga0105237_10210358 | |||
| 1728 | Ga0105237_10261983 | |||
| 1729 | Ga0105237_10433556 | |||
| 1730 | Ga0105238_10004133 | |||
| 1731 | Ga0105238_10010800 | |||
| 1732 | Ga0105238_10027156 | |||
| 1733 | Ga0105238_10041666 | |||
| 1734 | Ga0105238_10054351 | |||
| 1735 | Ga0105238_10107500 | |||
| 1736 | Ga0105238_10147305 | |||
| 1737 | Ga0105238_10213291 | |||
| 1738 | Ga0105238_10245752 | |||
| 1739 | Ga0105238_10253308 | |||
| 1740 | Ga0105238_10490031 | |||
| 1741 | Ga0105249_10016531 | |||
| 1742 | Ga0105249_10034356 | |||
| 1743 | Ga0105249_10037423 | |||
| 1744 | Ga0105249_10169053 | |||
| 1745 | Ga0105249_10276991 | |||
| 1746 | Ga0105249_10669541 | |||
| 1747 | Ga0105239_10003090 | |||
| 1748 | Ga0105239_10029968 | |||
| 1749 | Ga0105239_10032820 | |||
| 1750 | Ga0105246_10005632 | |||
| 1751 | Ga0105246_10012119 | |||
| 1752 | Ga0105246_10018044 | |||
| 1753 | Ga0105246_10088512 | |||
| 1754 | Ga0157371_10046819 | |||
| 1755 | Ga0157370_10005689 | |||
| 1756 | Ga0157370_10024535 | |||
| 1757 | Ga0157370_10037770 | |||
| 1758 | Ga0157370_10053386 | |||
| 1759 | Ga0157370_10076945 | |||
| 1760 | Ga0157370_10088466 | |||
| 1761 | Ga0157370_10131762 | |||
| 1762 | Ga0157369_10005817 | |||
| 1763 | Ga0157369_10006422 | |||
| 1764 | Ga0157369_10008198 | |||
| 1765 | Ga0157369_10017939 | |||
| 1766 | Ga0157369_10024815 | |||
| 1767 | Ga0157369_10026929 | |||
| 1768 | Ga0157369_10030918 | |||
| 1769 | Ga0157369_10200327 | |||
| 1770 | Ga0157374_10048689 | |||
| 1771 | Ga0157374_10110136 | |||
| 1772 | Ga0157374_10110381 | |||
| 1773 | Ga0157374_10146220 | |||
| 1774 | Ga0157374_10171620 | |||
| 1775 | Ga0157374_10285780 | |||
| 1776 | Ga0157374_10295616 | |||
| 1777 | Ga0157374_10402242 | |||
| 1778 | Ga0157378_10000433 | |||
| 1779 | Ga0157378_10018216 | |||
| 1780 | Ga0157378_10026213 | |||
| 1781 | Ga0157378_10037138 | |||
| 1782 | Ga0163162_10000523 | |||
| 1783 | Ga0163162_10001473 | |||
| 1784 | Ga0163162_10010532 | |||
| 1785 | Ga0163162_10101430 | |||
| 1786 | Ga0163162_10190517 | |||
| 1787 | Ga0157372_10008964 | |||
| 1788 | Ga0157372_10009357 | |||
| 1789 | Ga0157372_10050473 | |||
| 1790 | Ga0157372_10151249 | |||
| 1791 | Ga0157372_10321529 | |||
| 1792 | Ga0157372_10643624 | |||
| 1793 | Ga0157375_10000096 | |||
| 1794 | Ga0157375_10001100 | |||
| 1795 | Ga0157375_10002834 | |||
| 1796 | Ga0157375_10032745 | |||
| 1797 | Ga0157375_10274087 | |||
| 1798 | Ga0157375_10489292 | |||
| 1799 | Ga0157375_10630701 | |||
| 1800 | Ga0163163_10000519 | |||
| 1801 | Ga0163163_10005836 | |||
| 1802 | Ga0163163_10011623 | |||
| 1803 | Ga0163163_10019966 | |||
| 1804 | Ga0163163_10024867 | |||
| 1805 | Ga0163163_10029198 | |||
| 1806 | Ga0163163_10036959 | |||
| 1807 | Ga0163163_10050921 | |||
| 1808 | Ga0163163_10053175 | |||
| 1809 | Ga0163163_10075777 | |||
| 1810 | Ga0163163_10083082 | |||
| 1811 | Ga0163163_10145301 | |||
| 1812 | Ga0163163_10281701 | |||
| 1813 | Ga0163163_10545038 | |||
| 1814 | Ga0157380_10009740 | |||
| 1815 | Ga0157380_10031353 | |||
| 1816 | Ga0157380_10182923 | |||
| 1817 | Ga0157380_10259762 | |||
| 1818 | Ga0157380_10405032 | |||
| 1819 | Ga0182008_10038596 | |||
| 1820 | Ga0182008_10058613 | |||
| 1821 | Ga0157377_10005753 | |||
| 1822 | Ga0157377_10047133 | |||
| 1823 | Ga0157379_10000048 | |||
| 1824 | Ga0157379_10028278 | |||
| 1825 | Ga0157379_10034446 | |||
| 1826 | Ga0157379_10092480 | |||
| 1827 | Ga0157379_10202954 | |||
| 1828 | Ga0157379_10210969 | |||
| 1829 | Ga0157379_10338164 | |||
| 1830 | Ga0157379_10417020 | |||
| 1831 | Ga0157376_10015271 | |||
| 1832 | Ga0157376_10131823 | |||
| 1833 | Ga0157376_10142625 | |||
| 1834 | Ga0157376_10156728 | |||
| 1835 | Ga0157376_10192888 | |||
| 1836 | Ga0157376_10216788 | |||
| 1837 | Ga0163161_10009974 | |||
| 1838 | Ga0163161_10017593 | |||
| 1839 | Ga0163161_10039091 | |||
| 1840 | Ga0163161_10106956 | |||
| 1841 | Ga0197907_10850651 | |||
| 1842 | Ga0206356_11897132 | |||
| 1843 | Ga0206350_10155620 | |||
| 1844 | Ga0213873_10010289 | |||
| 1845 | Ga0213872_10083289 | |||
| 1846 | Ga0213876_10046150 | |||
| 1847 | Ga0213875_10006251 | |||
| 1848 | Ga0213875_10049184 | |||
| 1849 | Ga0213875_10059169 | |||
| 1850 | Ga0224712_10042923 | |||
| 1851 | Ga0224712_10126744 | |||
| 1852 | Ga0207697_10039759 | |||
| 1853 | Ga0207656_10055051 | |||
| 1854 | Ga0207682_10000836 | |||
| 1855 | Ga0207682_10004927 | |||
| 1856 | Ga0207682_10015461 | |||
| 1857 | Ga0207682_10036173 | |||
| 1858 | Ga0207692_10076430 | |||
| 1859 | Ga0207642_10037706 | |||
| 1860 | Ga0207642_10217829 | |||
| 1861 | Ga0207688_10000186 | |||
| 1862 | Ga0207688_10020244 | |||
| 1863 | Ga0207688_10159776 | |||
| 1864 | Ga0207680_10023341 | |||
| 1865 | Ga0207680_10121120 | |||
| 1866 | Ga0207647_10049677 | |||
| 1867 | Ga0207645_10001480 | |||
| 1868 | Ga0207645_10028334 | |||
| 1869 | Ga0207645_10080038 | |||
| 1870 | Ga0207645_10127347 | |||
| 1871 | Ga0207643_10000951 | |||
| 1872 | Ga0207643_10001949 | |||
| 1873 | Ga0207643_10010366 | |||
| 1874 | Ga0207705_10115587 | |||
| 1875 | Ga0207705_10312776 | |||
| 1876 | Ga0207654_10016475 | |||
| 1877 | Ga0207654_10081629 | |||
| 1878 | Ga0207707_10000565 | |||
| 1879 | Ga0207707_10001148 | |||
| 1880 | Ga0207707_10008127 | |||
| 1881 | Ga0207707_10008357 | |||
| 1882 | Ga0207707_10008871 | |||
| 1883 | Ga0207707_10112729 | |||
| 1884 | Ga0207707_10163477 | |||
| 1885 | Ga0207695_10001854 | |||
| 1886 | Ga0207695_10004549 | |||
| 1887 | Ga0207695_10031205 | |||
| 1888 | Ga0207695_10047903 | |||
| 1889 | Ga0207695_10067034 | |||
| 1890 | Ga0207695_10084497 | |||
| 1891 | Ga0207695_10491629 | |||
| 1892 | Ga0207671_10078097 | |||
| 1893 | Ga0207671_10200627 | |||
| 1894 | Ga0207671_10235597 | |||
| 1895 | Ga0207693_10002478 | |||
| 1896 | Ga0207693_10058496 | |||
| 1897 | Ga0207693_10149479 | |||
| 1898 | Ga0207663_10227981 | |||
| 1899 | Ga0207660_10009726 | |||
| 1900 | Ga0207660_10018474 | |||
| 1901 | Ga0207660_10036917 | |||
| 1902 | Ga0207662_10007393 | |||
| 1903 | Ga0207662_10067296 | |||
| 1904 | Ga0207662_10122402 | |||
| 1905 | Ga0207657_10074316 | |||
| 1906 | Ga0207657_10124458 | |||
| 1907 | Ga0207649_10100403 | |||
| 1908 | Ga0207649_10130722 | |||
| 1909 | Ga0207649_10266490 | |||
| 1910 | Ga0207652_10002881 | |||
| 1911 | Ga0207652_10003929 | |||
| 1912 | Ga0207652_10114221 | |||
| 1913 | Ga0207652_10173941 | |||
| 1914 | Ga0207652_10199713 | |||
| 1915 | Ga0207652_10263411 | |||
| 1916 | Ga0207646_10001462 | |||
| 1917 | Ga0207681_10037459 | |||
| 1918 | Ga0207681_10058154 | |||
| 1919 | Ga0207681_10308466 | |||
| 1920 | Ga0207694_10000738 | |||
| 1921 | Ga0207694_10003104 | |||
| 1922 | Ga0207694_10025390 | |||
| 1923 | Ga0207694_10034277 | |||
| 1924 | Ga0207694_10067555 | |||
| 1925 | Ga0207694_10117646 | |||
| 1926 | Ga0207694_10143418 | |||
| 1927 | Ga0207650_10000510 | |||
| 1928 | Ga0207650_10006456 | |||
| 1929 | Ga0207650_10048603 | |||
| 1930 | Ga0207659_10000797 | |||
| 1931 | Ga0207659_10008431 | |||
| 1932 | Ga0207659_10019281 | |||
| 1933 | Ga0207659_10035142 | |||
| 1934 | Ga0207659_10054824 | |||
| 1935 | Ga0207659_10082916 | |||
| 1936 | Ga0207659_10110241 | |||
| 1937 | Ga0207659_10446663 | |||
| 1938 | Ga0207687_10003947 | |||
| 1939 | Ga0207687_10004393 | |||
| 1940 | Ga0207687_10010486 | |||
| 1941 | Ga0207687_10035423 | |||
| 1942 | Ga0207700_10029586 | |||
| 1943 | Ga0207700_10052950 | |||
| 1944 | Ga0207700_10123810 | |||
| 1945 | Ga0207700_10174898 | |||
| 1946 | Ga0207700_10336643 | |||
| 1947 | Ga0207664_10214974 | |||
| 1948 | Ga0207644_10027675 | |||
| 1949 | Ga0207644_10047399 | |||
| 1950 | Ga0207644_10066118 | |||
| 1951 | Ga0207644_10068049 | |||
| 1952 | Ga0207644_10139841 | |||
| 1953 | Ga0207690_10077757 | |||
| 1954 | Ga0207690_10126248 | |||
| 1955 | Ga0207706_10004052 | |||
| 1956 | Ga0207706_10101855 | |||
| 1957 | Ga0207706_10105691 | |||
| 1958 | Ga0207686_10002608 | |||
| 1959 | Ga0207686_10027803 | |||
| 1960 | Ga0207686_10075955 | |||
| 1961 | Ga0207686_10115462 | |||
| 1962 | Ga0207686_10284969 | |||
| 1963 | Ga0207709_10010381 | |||
| 1964 | Ga0207709_10150281 | |||
| 1965 | Ga0207670_10015421 | |||
| 1966 | Ga0207670_10332910 | |||
| 1967 | Ga0207669_10006302 | |||
| 1968 | Ga0207669_10009677 | |||
| 1969 | Ga0207669_10092463 | |||
| 1970 | Ga0207704_10006585 | |||
| 1971 | Ga0207704_10011867 | |||
| 1972 | Ga0207704_10012447 | |||
| 1973 | Ga0207704_10079710 | |||
| 1974 | Ga0207704_10176114 | |||
| 1975 | Ga0207691_10012333 | |||
| 1976 | Ga0207691_10013158 | |||
| 1977 | Ga0207691_10019418 | |||
| 1978 | Ga0207691_10053281 | |||
| 1979 | Ga0207691_10136640 | |||
| 1980 | Ga0207691_10237820 | |||
| 1981 | Ga0207711_10000641 | |||
| 1982 | Ga0207711_10000804 | |||
| 1983 | Ga0207711_10000883 | |||
| 1984 | Ga0207711_10013257 | |||
| 1985 | Ga0207711_10013402 | |||
| 1986 | Ga0207711_10017416 | |||
| 1987 | Ga0207711_10060014 | |||
| 1988 | Ga0207711_10087121 | |||
| 1989 | Ga0207711_10119103 | |||
| 1990 | Ga0207689_10002411 | |||
| 1991 | Ga0207689_10015797 | |||
| 1992 | Ga0207689_10016668 | |||
| 1993 | Ga0207689_10033221 | |||
| 1994 | Ga0207689_10247746 | |||
| 1995 | Ga0207689_10360542 | |||
| 1996 | Ga0207661_10002990 | |||
| 1997 | Ga0207661_10007186 | |||
| 1998 | Ga0207661_10013583 | |||
| 1999 | Ga0207661_10017976 | |||
| 2000 | Ga0207661_10096187 | |||
| 2001 | Ga0207661_10118433 | |||
| 2002 | Ga0207661_10141359 | |||
| 2003 | Ga0207679_10004577 | |||
| 2004 | Ga0207679_10013618 | |||
| 2005 | Ga0207679_10025369 | |||
| 2006 | Ga0207679_10126137 | |||
| 2007 | Ga0207667_10000636 | |||
| 2008 | Ga0207667_10001683 | |||
| 2009 | Ga0207667_10005002 | |||
| 2010 | Ga0207667_10005718 | |||
| 2011 | Ga0207667_10027397 | |||
| 2012 | Ga0207667_10139209 | |||
| 2013 | Ga0207667_10463835 | |||
| 2014 | Ga0207651_10009725 | |||
| 2015 | Ga0207651_10021241 | |||
| 2016 | Ga0207651_10026193 | |||
| 2017 | Ga0207712_10017934 | |||
| 2018 | Ga0207712_10033299 | |||
| 2019 | Ga0207712_10042765 | |||
| 2020 | Ga0207668_10100612 | |||
| 2021 | Ga0207640_10055008 | |||
| 2022 | Ga0207658_10015567 | |||
| 2023 | Ga0207658_10020306 | |||
| 2024 | Ga0207658_10042015 | |||
| 2025 | Ga0207658_10172427 | |||
| 2026 | Ga0207677_10027359 | |||
| 2027 | Ga0207677_10046628 | |||
| 2028 | Ga0207677_10053414 | |||
| 2029 | Ga0207677_10219672 | |||
| 2030 | Ga0207703_10009226 | |||
| 2031 | Ga0207703_10014205 | |||
| 2032 | Ga0207703_10026582 | |||
| 2033 | Ga0207703_10061983 | |||
| 2034 | Ga0207703_10102676 | |||
| 2035 | Ga0207703_10104988 | |||
| 2036 | Ga0207703_10122406 | |||
| 2037 | Ga0207703_10196686 | |||
| 2038 | Ga0207703_10310306 | |||
| 2039 | Ga0207703_10402314 | |||
| 2040 | Ga0207703_10423033 | |||
| 2041 | Ga0207639_10064912 | |||
| 2042 | Ga0207639_10064932 | |||
| 2043 | Ga0207639_10278501 | |||
| 2044 | Ga0207678_10032096 | |||
| 2045 | Ga0207678_10056416 | |||
| 2046 | Ga0207678_10281630 | |||
| 2047 | Ga0207708_10020707 | |||
| 2048 | Ga0207708_10041022 | |||
| 2049 | Ga0207702_10009053 | |||
| 2050 | Ga0207702_10021939 | |||
| 2051 | Ga0207702_10029649 | |||
| 2052 | Ga0207702_10084483 | |||
| 2053 | Ga0207702_10109864 | |||
| 2054 | Ga0207702_10175373 | |||
| 2055 | Ga0207641_10002077 | |||
| 2056 | Ga0207641_10014597 | |||
| 2057 | Ga0207641_10034849 | |||
| 2058 | Ga0207641_10036386 | |||
| 2059 | Ga0207641_10177398 | |||
| 2060 | Ga0207641_10186174 | |||
| 2061 | Ga0207641_10197671 | |||
| 2062 | Ga0207648_10006827 | |||
| 2063 | Ga0207648_10006985 | |||
| 2064 | Ga0207648_10013242 | |||
| 2065 | Ga0207648_10071445 | |||
| 2066 | Ga0207648_10210077 | |||
| 2067 | Ga0207648_10220578 | |||
| 2068 | Ga0207676_10010042 | |||
| 2069 | Ga0207676_10473124 | |||
| 2070 | Ga0207676_10476901 | |||
| 2071 | Ga0207674_10000166 | |||
| 2072 | Ga0207674_10003310 | |||
| 2073 | Ga0207674_10004029 | |||
| 2074 | Ga0207674_10026232 | |||
| 2075 | Ga0207674_10091119 | |||
| 2076 | Ga0207674_10101423 | |||
| 2077 | Ga0207674_10146177 | |||
| 2078 | Ga0207674_10181479 | |||
| 2079 | Ga0207674_10249624 | |||
| 2080 | Ga0207675_100004439 | |||
| 2081 | Ga0207675_100008362 | |||
| 2082 | Ga0207675_100116686 | |||
| 2083 | Ga0207675_100146237 | |||
| 2084 | Ga0207675_100400906 | |||
| 2085 | Ga0207683_10047440 | |||
| 2086 | Ga0207683_10057250 | |||
| 2087 | Ga0207683_10091143 | |||
| 2088 | Ga0207683_10106952 | |||
| 2089 | Ga0207683_10112561 | |||
| 2090 | Ga0207683_10353071 | |||
| 2091 | Ga0207698_10011187 | |||
| 2092 | Ga0207698_10098854 | |||
| 2093 | Ga0207698_10191770 | |||
| 2094 | Ga0207698_10203476 | |||
| 2095 | Ga0207698_10408586 | |||
| 2096 | Ga0207428_10000144 | |||
| 2097 | Ga0207428_10000643 | |||
| 2098 | Ga0207428_10005048 | |||
| 2099 | Ga0207428_10019680 | |||
| 2100 | Ga0207428_10067349 | |||
| 2101 | Ga0207428_10076601 | |||
| 2102 | Ga0207428_10079218 | |||
| 2103 | Ga0268266_10058015 | |||
| 2104 | Ga0268266_10159670 | |||
| 2105 | Ga0268266_10355052 | |||
| 2106 | Ga0268265_10005432 | |||
| 2107 | Ga0268265_10012385 | |||
| 2108 | Ga0268265_10103021 | |||
| 2109 | Ga0268264_10006882 | |||
| 2110 | Ga0268264_10017518 | |||
| 2111 | Ga0268264_10020797 | |||
| 2112 | Ga0268264_10026845 | |||
| 2113 | Ga0268264_10037903 | |||
| 2114 | Ga0268264_10275649 | |||
| 2115 | Ga0265338_10019045 | |||
| 2116 | Ga0265338_10056036 | |||
| 2117 | Ga0265332_10022094 | |||
| 2118 | Ga0265325_10001345 | |||
| 2119 | Ga0265340_10067748 | |||
| 2120 | Ga0265327_10042200 | |||
| 2121 | Ga0307408_100004306 | |||
| 2122 | Ga0265313_10003580 | |||
| 2123 | Ga0265313_10005853 | |||
| 2124 | Ga0265314_10000282 | |||
| 2125 | Ga0265314_10005473 | |||
| 2126 | Ga0307405_10004173 | |||
| 2127 | Ga0307410_10004522 | |||
| 2128 | Ga0307407_10038224 | |||
| 2129 | Ga0307412_10033419 | |||
| 2130 | Ga0307416_100005845 | |||
| 2131 | Ga0307416_100281571 | |||
| 2132 | Ga0307414_10001278 | |||
| 2133 | Ga0307411_10043665 | |||
| 2134 | Ga0373934_0003589 | |||
| 2135 | Ga0373934_0015265 | |||
| 2136 | Ga0373934_0024847 | |||
| 2137 | Ga0373952_0005495 | |||
| 2138 | Ga0373923_0036905 | |||
| 2139 | Ga0373923_0105874 | |||
| 2140 | Ga0373936_0069032 | |||
| 2141 | Ga0373936_0120286 | |||
| 2142 | Ga0373941_0011829 | |||
| 2143 | Ga0373945_0015626 | |||
| 2144 | Ga0373945_0020436 | |||
| 2145 | Ga0373954_0004540 | |||
| 2146 | Ga0373954_0012448 | |||
| 2147 | Ga0373954_0013095 | |||
| 2148 | Ga0373956_0053978 | |||
| 2149 | Ga0373946_0050300 | |||
| 2150 | Ga0373946_0081907 | |||
| 2151 | Ga0373955_0022908 | |||
| 2152 | Ga0373955_0024402 | |||
| 2153 | Ga0373955_0037499 | |||
| 2154 | Ga0373955_0055064 | |||
| 2155 | Ga0373955_0066247 | |||
| 2156 | Ga0373955_0086923 | |||
| 2157 | Ga0373955_0090386 | |||
| 2158 | Ga0373955_0174685 | |||
| 2159 | Ga0373924_0003596 | |||
| 2160 | Ga0373931_0002400 | |||
| 2161 | Ga0373931_0013157 | |||
| 2162 | Ga0373931_0022597 | |||
| 2163 | Ga0373935_0012614 | |||
| 2164 | Ga0373935_0132807 | |||
| 2165 | Ga0373935_0161721 | |||
| 2166 | Ga0373927_0011148 | |||
| 2167 | Ga0373927_0062708 | |||
| 2168 | Ga0373927_0090628 | |||
| 2169 | Ga0373933_0002707 | |||
| 2170 | Ga0373933_0006335 | |||
| 2171 | Ga0373933_0016000 | |||
| 2172 | Ga0373933_0038756 | |||
| 2173 | Ga0373933_0046795 | |||
| 2174 | Ga0373933_0049454 | |||
| 2175 | Ga0373947_0238739 | |||
| 2176 | Ga0373937_0000238 | |||
| 2177 | Ga0373937_0000744 | |||
| 2178 | Ga0373937_0000994 | |||
| 2179 | Ga0373937_0007751 | |||
| 2180 | Ga0373937_0013713 | |||
| 2181 | Ga0373937_0015199 | |||
| 2182 | Ga0373937_0019061 | |||
| 2183 | Ga0373937_0019271 | |||
| 2184 | Ga0373937_0021816 | |||
| 2185 | Ga0373937_0031015 | |||
| 2186 | Ga0373937_0035309 | |||
| 2187 | Ga0373937_0099881 | |||
| 2188 | Ga0373937_0228427 | |||
| 2189 | Ga0373937_0277680 | |||
| 2190 | Ga0373937_0340528 | |||
| 2191 | Ga0373925_0035321 | |||
| 2192 | Ga0373925_0078134 | |||
| 2193 | Ga0373925_0089525 | |||
| 2194 | Ga0373925_0107792 | |||
| 2195 | Ga0373925_0286724 | |||
| 2196 | Ga0395899_0023273 | |||
| 2197 | Ga0395900_0327319 | |||
| 2198 | Ga0395900_0414458 | |||
| 2199 | Ga0395905_0307899 | |||
| 2200 | Ga0436364_0112721 | |||
| 2201 | Ga0436364_0249501 | |||
| 2202 | Ga0436365_0017926 | |||
| 2203 | Ga0436365_0568945 | |||
| 2204 | Ga0436365_0801801 | |||
| 2205 | Ga0436365_1426598 | |||
| 2206 | Ga0436365_1432540 | |||
| 2207 | Ga0436365_1776714 | |||
| 2208 | Ga0436361_0232929 | |||
| 2209 | Ga0436361_0539861 | |||
| 2210 | Ga0436361_0909974 | |||
| 2211 | Ga0436361_1062872 | |||
| 2212 | Ga0436362_0945639 | |||
| 2213 | Ga0439453_0017209 | |||
| 2214 | Ga0451853_2651878 | |||
| 2215 | Ga0439435_0001937 | |||
| 2216 | Ga0451577_0378157 | |||
| 2217 | Ga0466969_0056832 | |||
| 2218 | Ga0466969_0085459 | |||
| 2219 | Ga0466977_0000756 | |||
| 2220 | Ga0466966_0020782 | |||
| 2221 | Ga0466971_0038928 | |||
| 2222 | Ga0466959_0319402 | |||
| 2223 | Ga0466958_0023945 | |||
| 2224 | Ga0466967_0052631 | |||
| 2225 | Ga0466967_0199837 | |||
| 2226 | Ga0466967_0360972 | |||
| 2227 | Ga0495592_0006726 | |||
| 2228 | Ga0495592_0070841 | |||
| 2229 | Ga0495592_0077669 | |||
| 2230 | Ga0495603_0011113 | |||
| 2231 | Ga0495638_0083735 | |||
| 2232 | Ga0495641_0009978 | |||
| 2233 | Ga0495651_0115472 | |||
| 2234 | Ga0495651_0335036 | |||
| 2235 | Ga0495580_0018560 | |||
| 2236 | Ga0495580_0046636 | |||
| 2237 | Ga0495580_0154508 | |||
| 2238 | Ga0495580_0247342 | |||
| 2239 | Ga0495580_0289280 | |||
| 2240 | Ga0495582_0000742 | |||
| 2241 | Ga0495582_0016027 | |||
| 2242 | Ga0495582_0127094 | |||
| 2243 | Ga0495605_0000116 | |||
| 2244 | Ga0495639_0015091 | |||
| 2245 | Ga0495662_0020144 | |||
| 2246 | Ga0495584_0034106 | |||
| 2247 | Ga0495585_0014925 | |||
| 2248 | Ga0495585_0040936 | |||
| 2249 | Ga0495585_0078024 | |||
| 2250 | Ga0495594_0078587 | |||
| 2251 | Ga0495594_0082134 | |||
| 2252 | Ga0495596_0000078 | |||
| 2253 | Ga0495607_0000057 | |||
| 2254 | Ga0495607_0021836 | |||
| 2255 | Ga0495607_0062293 | |||
| 2256 | Ga0495608_0009055 | |||
| 2257 | Ga0495608_0021672 | |||
| 2258 | Ga0495616_0034297 | |||
| 2259 | Ga0495616_0062383 | |||
| 2260 | Ga0495618_0217909 | |||
| 2261 | Ga0495628_0072665 | |||
| 2262 | Ga0495628_0323700 | |||
| 2263 | Ga0495630_0039488 | |||
| 2264 | Ga0495632_0002942 | |||
| 2265 | Ga0495632_0016297 | |||
| 2266 | Ga0495637_0055645 | |||
| 2267 | Ga0495643_0000347 | |||
| 2268 | Ga0495643_0009518 | |||
| 2269 | Ga0495643_0012675 | |||
| 2270 | Ga0495643_0033848 | |||
| 2271 | Ga0495644_0003021 | |||
| 2272 | Ga0495642_0001005 | |||
| 2273 | Ga0495642_0015247 | |||
| 2274 | Ga0495652_0018819 | |||
| 2275 | Ga0495652_0064227 | |||
| 2276 | Ga0495652_0067287 | |||
| 2277 | Ga0495652_0359748 | |||
| 2278 | Ga0495665_0042159 | |||
| 2279 | Ga0495640_0083054 | |||
| 2280 | Ga0495587_0000558 | |||
| 2281 | Ga0495587_0001220 | |||
| 2282 | Ga0495587_0004299 | |||
| 2283 | Ga0495587_0028966 | |||
| 2284 | Ga0495587_0071106 | |||
| 2285 | Ga0495621_0080601 | |||
| 2286 | Ga0495621_0096439 | |||
| 2287 | Ga0495645_0007662 | |||
| 2288 | Ga0495645_0045560 | |||
| 2289 | Ga0495645_0267122 | |||
| 2290 | Ga0495633_0004527 | |||
| 2291 | Ga0495667_0001591 | |||
| 2292 | Ga0495667_0040259 | |||
| 2293 | Ga0495667_0049036 | |||
| 2294 | Ga0495656_0012822 | |||
| 2295 | Ga0495656_0039230 | |||
| 2296 | Ga0495668_0002736 | |||
| 2297 | Ga0495634_0024844 | |||
| 2298 | Ga0495634_0083618 | |||
| 2299 | Ga0495611_0124750 | |||
| 2300 | Ga0495625_0000014 | |||
| 2301 | Ga0495659_0014646 | |||
| 2302 | Ga0495661_0000221 | |||
| 2303 | Ga0495661_0012090 | |||
| 2304 | Ga0495661_0165978 | |||
| 2305 | Ga0495588_0039789 | |||
| 2306 | Ga0495657_0001304 | |||
| 2307 | Ga0495599_0006862 | |||
| 2308 | Ga0495599_0065895 | |||
| 2309 | Ga0495623_0048616 | |||
| 2310 | Ga0495623_0100504 | |||
| 2311 | Ga0495623_0123540 | |||
| 2312 | Ga0495646_0068769 | |||
| 2313 | Ga0495646_0095465 | |||
| 2314 | Ga0495658_0009083 | |||
| 2315 | Ga0495658_0011647 | |||
| 2316 | Ga0495658_0015511 | |||
| 2317 | Ga0495658_0084179 | |||
| 2318 | Ga0495669_0001150 | |||
| 2319 | Ga0495669_0005036 | |||
| 2320 | Ga0495613_0000428 | |||
| 2321 | Ga0495613_0013455 | |||
| 2322 | Ga0495613_0047679 | |||
| 2323 | Ga0495613_0094297 | |||
| 2324 | Ga0495613_0164428 | |||
| 2325 | Ga0495613_0178618 | |||
| 2326 | Ga0495670_0014695 | |||
| 2327 | Ga0495670_0042086 | |||
| 2328 | Ga0495649_0000205 | |||
| 2329 | Ga0495649_0025062 | |||
| 2330 | Ga0495589_0000022 | |||
| 2331 | Ga0495660_0000044 | |||
| 2332 | Ga0495581_0030525 | |||
| 2333 | Ga0495604_0087995 | |||
| 2334 | Ga0495604_0095535 | |||
| 2335 | Ga0495604_0105351 | |||
| 2336 | Ga0495604_0205571 | |||
| 2337 | Ga0495636_0017297 | |||
| 2338 | Ga0495636_0119296 | |||
| 2339 | Ga0495674_0057298 | |||
| 2340 | Ga0495674_0088288 | |||
| 2341 | Ga0495674_0172345 | |||
| 2342 | Ga0495674_0242839 | |||
| 2343 | Ga0495672_0005576 | |||
| 2344 | Ga0495672_0026596 | |||
| 2345 | Ga0495672_0097613 | |||
| 2346 | Ga0495680_0169769 | |||
| 2347 | Ga0495687_000099 | |||
| 2348 | Ga0495675_0001554 | |||
| 2349 | Ga0495677_0000419 | |||
| 2350 | Ga0495677_0004940 | |||
| 2351 | Ga0495684_0000117 | |||
| 2352 | Ga0495684_0008684 | |||
| 2353 | Ga0495684_0042205 | |||
| 2354 | Ga0495684_0114162 | |||
| 2355 | Ga0495684_0149120 | |||
| 2356 | Ga0495684_0310983 | |||
| 2357 | Ga0495602_0000454 | |||
| 2358 | Ga0495602_0000669 | |||
| 2359 | Ga0495602_0004373 | |||
| 2360 | Ga0495602_0144256 | |||
| 2361 | Ga0495602_0188091 | |||
| 2362 | Ga0495602_0248140 | |||
| 2363 | Ga0495602_0389834 | |||
| 2364 | Ga0495626_0000021 | |||
| 2365 | Ga0496100_0070591 | |||
| 2366 | Ga0496100_0086867 | |||
| 2367 | Ga0496100_0091451 | |||
| 2368 | Ga0496100_0092390 | |||
| 2369 | Ga0496101_0018442 | |||
| 2370 | Ga0496101_0074533 | |||
| 2371 | Ga0496101_0109219 | |||
| 2372 | Ga0496101_0149827 | |||
| 2373 | Ga0496102_0013554 | |||
| 2374 | Ga0496102_0082749 | |||
| 2375 | Ga0496102_0114287 | |||
| 2376 | Ga0496103_0005396 | |||
| 2377 | Ga0496103_0047269 | |||
| 2378 | Ga0496103_0100911 | |||
| 2379 | Ga0496104_0000406 | |||
| 2380 | Ga0496104_0009455 | |||
| 2381 | Ga0496104_0027628 | |||
| 2382 | Ga0496104_0036142 | |||
| 2383 | Ga0496104_0113400 | |||
| 2384 | Ga0496104_0115802 | |||
| 2385 | Ga0496104_0368957 | |||
| 2386 | Ga0496105_0002573 | |||
| 2387 | Ga0496105_0002868 | |||
| 2388 | Ga0496105_0017770 | |||
| 2389 | Ga0496105_0034460 | |||
| 2390 | Ga0496105_0053149 | |||
| 2391 | Ga0496106_0031605 | |||
| 2392 | Ga0496106_0085382 | |||
| 2393 | Ga0496106_0225318 | |||
| 2394 | Ga0496106_0245160 | |||
| 2395 | Ga0496107_0020257 | |||
| 2396 | Ga0496107_0068933 | |||
| 2397 | Ga0496108_0003849 | |||
| 2398 | Ga0496108_0027901 | |||
| 2399 | Ga0496108_0102265 | |||
| 2400 | Ga0496108_0216034 | |||
| 2401 | Ga0496108_0293763 | |||
| 2402 | Ga0496109_0032041 | |||
| 2403 | Ga0496109_0032874 | |||
| 2404 | Ga0496109_0048858 | |||
| 2405 | Ga0496109_0130752 | |||
| 2406 | Ga0496109_0147574 | |||
| 2407 | Ga0496109_0476035 | |||
| 2408 | Ga0496110_0015183 | |||
| 2409 | Ga0496110_0017621 | |||
| 2410 | Ga0496110_0200228 | |||
| 2411 | Ga0496111_0051025 | |||
| 2412 | Ga0496112_0002042 | |||
| 2413 | Ga0496112_0015636 | |||
| 2414 | Ga0496112_0036338 | |||
| 2415 | Ga0496112_0083923 | |||
| 2416 | Ga0496112_0145766 | |||
| 2417 | Ga0496112_0303488 | |||
| 2418 | Ga0496113_0011578 | |||
| 2419 | Ga0496113_0059654 | |||
| 2420 | Ga0496114_0028747 | |||
| 2421 | Ga0496114_0028999 | |||
| 2422 | Ga0496114_0066980 | |||
| 2423 | Ga0496114_0463203 | |||
| 2424 | Ga0496115_0005401 | |||
| 2425 | Ga0496115_0012759 | |||
| 2426 | Ga0496115_0058850 | |||
| 2427 | Ga0496115_0065587 | |||
| 2428 | Ga0496115_0149452 | |||
| 2429 | Ga0496115_0261719 | |||
| 2430 | Ga0496121_0355228 | |||
| 2431 | Ga0496126_0091329 | |||
| 2432 | Ga0501298_010232 | |||
| 2433 | Ga0501034_0005118 | |||
| 2434 | Ga0501034_0019520 | |||
| 2435 | Ga0501034_0020632 | |||
| 2436 | Ga0501034_0091869 | |||
| 2437 | Ga0501036_0262139 | |||
| 2438 | Ga0501041_0081607 | |||
| 2439 | Ga0501042_0014192 | |||
| 2440 | Ga0501043_0324623 | |||
| 2441 | Ga0501046_0063906 | |||
| 2442 | Ga0501046_0355800 | |||
| 2443 | Ga0501047_0066421 | |||
| 2444 | Ga0501047_0135420 | |||
| 2445 | Ga0501047_0273771 | |||
| 2446 | Ga0501068_0133883 | |||
| 2447 | Ga0501069_0096551 | |||
| 2448 | Ga0501070_0043503 | |||
| 2449 | Ga0501070_0055626 | |||
| 2450 | Ga0501070_0064543 | |||
| 2451 | Ga0501070_0088970 | |||
| 2452 | Ga0501070_0213533 | |||
| 2453 | Ga0501071_0033438 | |||
| 2454 | Ga0501072_0063265 | |||
| 2455 | Ga0501072_0403707 | |||
| 2456 | Ga0501074_0126106 | |||
| 2457 | Ga0501075_0060558 | |||
| 2458 | Ga0501075_0068460 | |||
| 2459 | Ga0501075_0163699 | |||
| 2460 | Ga0501076_0028885 | |||
| 2461 | Ga0501079_0025243 | |||
| 2462 | Ga0501079_0315507 | |||
| 2463 | Ga0501080_0063543 | |||
| 2464 | Ga0501080_0180770 | |||
| 2465 | Ga0501081_0070318 | |||
| 2466 | Ga0501272_001824 | |||
| 2467 | Ga0501283_001260 | |||
| 2468 | Ga0501045_0060947 | |||
| 2469 | nmdc:mga03n38_7494_c1 | |||
| 2470 | nmdc:mga0yw44_153427_c1 | |||
| 2471 | nmdc:mga0yw44_2164_c1 | |||
| 2472 | nmdc:mga0yw44_55158_c1 | |||
| 2473 | nmdc:mga06z11_1143_c1 | |||
| 2474 | nmdc:mga06z11_118152_c1 | |||
| 2475 | nmdc:mga06z11_211721_c1 | |||
| 2476 | nmdc:mga06z11_22438_c1 | |||
| 2477 | nmdc:mga06z11_54001_c1 | |||
| 2478 | nmdc:mga07m45_44184_c1 | |||
| 2479 | nmdc:mga05p37_11743_c1 | |||
| 2480 | nmdc:mga05p37_16523_c1 | |||
| 2481 | nmdc:mga05p37_216107_c1 | |||
| 2482 | nmdc:mga05p37_259281_c1 | |||
| 2483 | nmdc:mga05p37_28051_c1 | |||
| 2484 | nmdc:mga05p37_35787_c1 | |||
| 2485 | nmdc:mga05p37_413989_c1 | |||
| 2486 | nmdc:mga05p37_520847_c1 | |||
| 2487 | nmdc:mga05p37_524734_c1 | |||
| 2488 | nmdc:mga05p37_55206_c1 | |||
| 2489 | nmdc:mga05p37_61022_c1 | |||
| 2490 | nmdc:mga05p37_72924_c1 | |||
| 2491 | nmdc:mga09592_14008_c1 | |||
| 2492 | nmdc:mga09592_141557_c1 | |||
| 2493 | nmdc:mga09592_212316_c1 | |||
| 2494 | nmdc:mga09592_257445_c1 | |||
| 2495 | nmdc:mga09592_52344_c1 | |||
| 2496 | nmdc:mga09592_967_c1 | |||
| 2497 | nmdc:mga0qj67_136894_c1 | |||
| 2498 | nmdc:mga0qj67_15628_c1 | |||
| 2499 | nmdc:mga0qj67_16084_c1 | |||
| 2500 | nmdc:mga0qj67_201389_c1 | |||
| 2501 | nmdc:mga0qj67_293274_c1 | |||
| 2502 | nmdc:mga0qj67_86334_c1 | |||
| 2503 | nmdc:mga06r32_118689_c1 | |||
| 2504 | nmdc:mga08y16_12039_c1 | |||
| 2505 | nmdc:mga08y16_128960_c1 | |||
| 2506 | nmdc:mga08y16_1769_c1 | |||
| 2507 | nmdc:mga08y16_2215_c1 | |||
| 2508 | nmdc:mga08y16_2889_c1 | |||
| 2509 | nmdc:mga08y16_309471_c1 | |||
| 2510 | nmdc:mga08y16_317592_c1 | |||
| 2511 | nmdc:mga08y16_37188_c1 | |||
| 2512 | nmdc:mga08y16_47758_c1 | |||
| 2513 | nmdc:mga08y16_5902_c1 | |||
| 2514 | nmdc:mga08y16_63674_c1 | |||
| 2515 | nmdc:mga08y16_83338_c1 | |||
| 2516 | nmdc:mga0n895_146918_c1 | |||
| 2517 | nmdc:mga0n895_17227_c1 | |||
| 2518 | nmdc:mga0n895_443684_c1 | |||
| 2519 | nmdc:mga0n895_44481_c1 | |||
| 2520 | nmdc:mga0n895_92567_c1 | |||
| 2521 | nmdc:mga0rr50_160160_c1 | |||
| 2522 | nmdc:mga0rr50_185733_c1 | |||
| 2523 | nmdc:mga0rr50_416265_c1 | |||
| 2524 | nmdc:mga0a205_2492_c1 | |||
| 2525 | nmdc:mga0a205_332334_c1 | |||
| 2526 | nmdc:mga0a205_478306_c1 | |||
| 2527 | nmdc:mga0a205_824_c1 | |||
| 2528 | nmdc:mga0sz30_13246_c1 | |||
| 2529 | Ga0495601_0000639 | |||
| 2530 | Ga0495601_0004849 | |||
| 2531 | Ga0495601_0034498 | |||
| 2532 | Ga0495601_0048748 | |||
| 2533 | Ga0495601_0096989 | |||
| 2534 | Ga0495601_0205033 | |||
| 2535 | Ga0495601_0268441 | |||
| 2536 | Ga0495595_0002937 | |||
| 2537 | Ga0495619_0000356 | |||
| 2538 | Ga0495619_0006623 | |||
| 2539 | Ga0495619_0019614 | |||
| 2540 | Ga0495619_0100740 | |||
| 2541 | Ga0500641_0005080 | |||
| 2542 | Ga0500595_022630 | |||
| 2543 | Ga0500595_034881 | |||
| 2544 | Ga0500652_000004 | |||
| 2545 | Ga0500652_000021 | |||
| 2546 | Ga0500568_0000656 | |||
| 2547 | Ga0500568_0004824 | |||
| 2548 | Ga0500634_0010186 | |||
| 2549 | Ga0500636_0002225 | |||
| 2550 | Ga0500636_0066608 | |||
| 2551 | Ga0501084_0106166 | |||
| 2552 | Ga0501084_0343399 | |||
| 2553 | Ga0501082_0331610 | |||
| 2554 | Ga0530510_0042041 | |||
| 2555 | Ga0530510_0356859 | |||
| 2556 | 2510251177 | |||
| 2557 | 2515685507 | |||
| 2558 | 2719640304 | |||
| 2559 | 2792838858 | |||
| 2560 | 2902688269 | |||
| 2561 | 8047678393 | |||
| 2562 | 8055271629 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wrc-assembly1.cif.gz_A | crystal structure of the anaerobic desb-protocatechuate (pca) complex | 0.7759 | 3 | 336 |
| 1bou-assembly1.cif.gz_D | three-dimensional structure of ligab | 0.7757 | 3 | 334 |
| 8iq8-assembly1.cif.gz_D | crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii | 0.7394 | 3 | 336 |
| 7txy-assembly2.cif.gz_E | crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria | 0.7312 | 3 | 336 |
| 8iq8-assembly1.cif.gz_D | crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii | 0.7255 | 3 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3wrcA01 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.7759 | 3 | 336 | 3.40.830.10 |
| 1bouB00 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.7658 | 3 | 334 | 3.40.830.10 |
| 1bouB00 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.7109 | 3 | 334 | 3.40.830.10 |
| 3vsgD00 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.7105 | 3 | 336 | 3.40.830.10 |
| 3wrcA01 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.6984 | 3 | 336 | 3.40.830.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X4JDN2-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.9849 | 1 | 337 |
GO:0008198
GO:0019489 GO:0051213 |
| AF-A0A7X4JDN2-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.982 | 1 | 337 |
GO:0008198
GO:0019489 GO:0051213 |
| AF-A0A2V7E7F6-F1-model_v4 | Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein | 0.9819 | 214 | 337 |
GO:0008198
GO:0016491 |
| AF-A0A1D2UK10-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.9803 | 1 | 337 |
GO:0008198
GO:0019489 GO:0051213 |
| AF-A0A2V8JNL5-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.9802 | 224 | 337 |
GO:0008198
GO:0051213 |