F492394

General Info

Members Datasets Scaffolds Average Seq Length
1269 379 1257 163

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0012732|Ga0496121_0012732_6880_7482
Length 200
Sequence MPEIRSKSSRGYGSAQIFLQPFGAALRIWDMTHASYQASRRSFLAFAGTAAVGALGWQCMKGQGAGAVAATPAPFRLSEAEWRKRLSPQAFAVLRQASTEYPFTSPLNDEHRKGRFLCAGCALPLYSSTTKFDSGTGWPSFYDHLPRAIGTSTDRSLGSKRTEVHCARCAGHLGHVFNDGPRPTGLRYCMNGVAMRFEPA

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
3 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
4 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
5 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
6 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
7 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
8 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
9 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
10 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
11 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
12 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
221 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
248 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
249 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
250 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
255 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
258 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
262 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
263 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
267 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
268 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
271 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
274 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
340 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
341 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
342 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
343 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
344 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
345 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
346 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
347 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
348 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
349 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
350 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
351 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
355 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
365 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
366 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
367 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
368 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
375 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
378 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0.55
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0.08
Rhizoplane 4.89
Rhizosphere 85.97
Stem 0
Stem Tuber 0
Unclassified 4.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002369 3300001904 Bacteria 3328
2 JGI24741J21665_1000198 3300001915 Bacteria 17758
3 JGI24741J21665_1008754 3300001915 Bacteria 1894
4 JGI24746J21847_1009583 3300001977 Bacteria 1443
5 JGI24740J21852_10001054 3300001979 Bacteria 12390
6 JGI24740J21852_10012652 3300001979 Bacteria 3175
7 JGI24739J22299_10000326 3300001989 Bacteria 16303
8 JGI24739J22299_10002070 3300001989 Bacteria 7677
9 JGI24739J22299_10012467 3300001989 Bacteria 3121
10 JGI24739J22299_10024891 3300001989 Bacteria 2108
11 JGI24739J22299_10066291 3300001989 Bacteria 1131
12 JGI24737J22298_10008900 3300001990 Bacteria 3349
13 JGI24737J22298_10021246 3300001990 Bacteria 2070
14 JGI24737J22298_10031012 3300001990 Bacteria 1670
15 JGI24737J22298_10074673 3300001990 Bacteria 1011
16 JGI24743J22301_10001225 3300001991 Bacteria 3479
17 JGI24735J21928_10001784 3300002067 Bacteria 7557
18 JGI24735J21928_10010800 3300002067 Bacteria 2901
19 JGI24738J21930_10005547 3300002075 Bacteria 3012
20 JGI24738J21930_10006206 3300002075 Bacteria 2822
21 JGI24744J21845_10010753 3300002077 Bacteria 1873
22 JGI24034J26672_10008158 3300002239 Bacteria 1527
23 rootH1_10062977 3300003316 Bacteria 2596
24 Ga0055531_10000007 3300003794 Bacteria 225289
25 Ga0055531_10077983 3300003794 Bacteria 739
26 Ga0065704_10237949 3300005289 Bacteria 1024
27 Ga0065712_10190763 3300005290 Bacteria 1150
28 Ga0065715_10237984 3300005293 Bacteria 1209
29 Ga0070658_10001316 3300005327 Bacteria 21172
30 Ga0070658_10010571 3300005327 Bacteria 7396
31 Ga0070658_10032177 3300005327 Bacteria 4217
32 Ga0070658_10039548 3300005327 Bacteria 3805
33 Ga0070658_10122886 3300005327 Bacteria 2158
34 Ga0070658_10326400 3300005327 Bacteria 1311
35 Ga0070658_10557770 3300005327 Bacteria 991
36 Ga0070658_10736055 3300005327 Bacteria 856
37 Ga0070658_10926800 3300005327 Bacteria 757
38 Ga0070676_10011298 3300005328 Bacteria 4854
39 Ga0070676_10066204 3300005328 Bacteria 2159
40 Ga0070676_10213623 3300005328 Bacteria 1270
41 Ga0070683_100128848 3300005329 Bacteria 2393
42 Ga0070683_100705988 3300005329 Bacteria 966
43 Ga0070683_100876391 3300005329 Bacteria 861
44 Ga0070670_100007872 3300005331 Bacteria 9066
45 Ga0070670_100045415 3300005331 Bacteria 3777
46 Ga0070670_100078244 3300005331 Bacteria 2841
47 Ga0070670_100111471 3300005331 Bacteria 2358
48 Ga0070670_100424901 3300005331 Bacteria 1175
49 Ga0070670_100784311 3300005331 Bacteria 860
50 Ga0070677_10008365 3300005333 Bacteria 3479
51 Ga0070677_10352652 3300005333 Bacteria 763
52 Ga0068869_100021878 3300005334 Bacteria 4401
53 Ga0068869_100063236 3300005334 Bacteria 2718
54 Ga0068869_100087708 3300005334 Bacteria 2334
55 Ga0068869_100137392 3300005334 Bacteria 1884
56 Ga0068869_100488599 3300005334 Bacteria 1026
57 Ga0068869_101008646 3300005334 Bacteria 725
58 Ga0070666_10027907 3300005335 Bacteria 3701
59 Ga0070666_10055523 3300005335 Bacteria 2674
60 Ga0070666_10095325 3300005335 Bacteria 2047
61 Ga0070666_10112091 3300005335 Bacteria 1887
62 Ga0070666_10498358 3300005335 Bacteria 883
63 Ga0070666_10584689 3300005335 Bacteria 814
64 Ga0070680_100002339 3300005336 Bacteria 14005
65 Ga0070680_100025151 3300005336 Bacteria 4757
66 Ga0070680_100068148 3300005336 Bacteria 2920
67 Ga0070680_100289392 3300005336 Bacteria 1388
68 Ga0070682_100163072 3300005337 Bacteria 1541
69 Ga0070682_100247521 3300005337 Bacteria 1283
70 Ga0070682_100987579 3300005337 Bacteria 698
71 Ga0068868_100077537 3300005338 Bacteria 2658
72 Ga0068868_100089353 3300005338 Bacteria 2480
73 Ga0070660_100000810 3300005339 Bacteria 20717
74 Ga0070660_100001368 3300005339 Bacteria 16581
75 Ga0070660_100006698 3300005339 Bacteria 7993
76 Ga0070660_100022163 3300005339 Bacteria 4694
77 Ga0070660_100029143 3300005339 Bacteria 4134
78 Ga0070660_100043339 3300005339 Bacteria 3438
79 Ga0070660_100094781 3300005339 Bacteria 2358
80 Ga0070660_100151390 3300005339 Bacteria 1865
81 Ga0070660_100244229 3300005339 Bacteria 1463
82 Ga0070660_100292407 3300005339 Bacteria 1334
83 Ga0070660_100298842 3300005339 Bacteria 1320
84 Ga0070660_100428579 3300005339 Bacteria 1096
85 Ga0070660_100508420 3300005339 Bacteria 1003
86 Ga0070660_101028960 3300005339 Bacteria 696
87 Ga0070689_100093745 3300005340 Bacteria 2370
88 Ga0070689_100327077 3300005340 Bacteria 1282
89 Ga0070687_100051653 3300005343 Bacteria 2130
90 Ga0070661_100014668 3300005344 Bacteria 5525
91 Ga0070661_100023674 3300005344 Bacteria 4404
92 Ga0070661_100029115 3300005344 Bacteria 3985
93 Ga0070661_100147868 3300005344 Bacteria 1775
94 Ga0070661_100175803 3300005344 Bacteria 1627
95 Ga0070661_100745162 3300005344 Bacteria 801
96 Ga0070661_101072004 3300005344 Bacteria 670
97 Ga0070692_10000758 3300005345 Bacteria 10578
98 Ga0070692_10005960 3300005345 Bacteria 5250
99 Ga0070692_10007127 3300005345 Bacteria 4908
100 Ga0070692_10109966 3300005345 Bacteria 1523
101 Ga0070692_10355409 3300005345 Bacteria 912
102 Ga0070668_100000096 3300005347 Bacteria 54447
103 Ga0070668_100627145 3300005347 Bacteria 943
104 Ga0070669_100017103 3300005353 Bacteria 5174
105 Ga0070669_100079658 3300005353 Bacteria 2437
106 Ga0070669_100387236 3300005353 Bacteria 1141
107 Ga0070669_100427945 3300005353 Bacteria 1087
108 Ga0070675_100004947 3300005354 Bacteria 10166
109 Ga0070675_100023824 3300005354 Bacteria 4898
110 Ga0070675_100027168 3300005354 Bacteria 4597
111 Ga0070675_100042256 3300005354 Bacteria 3725
112 Ga0070675_100060702 3300005354 Bacteria 3121
113 Ga0070675_100102630 3300005354 Bacteria 2410
114 Ga0070671_100000493 3300005355 Bacteria 27606
115 Ga0070671_100007420 3300005355 Bacteria 8763
116 Ga0070671_100011924 3300005355 Bacteria 6991
117 Ga0070671_100028992 3300005355 Bacteria 4562
118 Ga0070671_100036486 3300005355 Bacteria 4077
119 Ga0070671_100051381 3300005355 Bacteria 3428
120 Ga0070671_100052812 3300005355 Bacteria 3379
121 Ga0070671_100060503 3300005355 Bacteria 3153
122 Ga0070671_100176806 3300005355 Bacteria 1806
123 Ga0070671_100182109 3300005355 Bacteria 1779
124 Ga0070674_100002533 3300005356 Bacteria 10122
125 Ga0070674_100020697 3300005356 Bacteria 4210
126 Ga0070674_100062474 3300005356 Bacteria 2603
127 Ga0070674_100120569 3300005356 Bacteria 1941
128 Ga0070674_100515151 3300005356 Bacteria 998
129 Ga0070673_100001479 3300005364 Bacteria 13757
130 Ga0070673_100018759 3300005364 Bacteria 4953
131 Ga0070673_100053880 3300005364 Bacteria 3162
132 Ga0070673_100058751 3300005364 Bacteria 3042
133 Ga0070673_100072159 3300005364 Bacteria 2776
134 Ga0070673_100087585 3300005364 Bacteria 2538
135 Ga0070673_100115706 3300005364 Bacteria 2230
136 Ga0070673_100267108 3300005364 Bacteria 1496
137 Ga0070673_100390454 3300005364 Bacteria 1242
138 Ga0070673_100492952 3300005364 Bacteria 1107
139 Ga0070673_100923669 3300005364 Bacteria 810
140 Ga0070688_100026683 3300005365 Bacteria 3434
141 Ga0070688_100032323 3300005365 Bacteria 3154
142 Ga0070659_100013691 3300005366 Bacteria 6045
143 Ga0070659_100031984 3300005366 Bacteria 4078
144 Ga0070659_100038073 3300005366 Bacteria 3750
145 Ga0070659_100150875 3300005366 Bacteria 1896
146 Ga0070659_100169360 3300005366 Bacteria 1788
147 Ga0070659_100211196 3300005366 Bacteria 1599
148 Ga0070659_100363857 3300005366 Bacteria 1216
149 Ga0070659_100437548 3300005366 Bacteria 1107
150 Ga0070659_100697462 3300005366 Bacteria 878
151 Ga0070659_100775711 3300005366 Bacteria 833
152 Ga0070667_100004075 3300005367 Bacteria 12359
153 Ga0070667_100024677 3300005367 Bacteria 4995
154 Ga0070667_100056794 3300005367 Bacteria 3307
155 Ga0070667_100110345 3300005367 Bacteria 2385
156 Ga0070667_100606058 3300005367 Bacteria 1009
157 Ga0070667_100725938 3300005367 Bacteria 920
158 Ga0070709_10026535 3300005434 Bacteria 3435
159 Ga0070714_100113675 3300005435 Bacteria 2400
160 Ga0070714_100297734 3300005435 Bacteria 1503
161 Ga0070701_10013555 3300005438 Bacteria 3712
162 Ga0070711_100003621 3300005439 Bacteria 9023
163 Ga0070705_100003490 3300005440 Bacteria 7696
164 Ga0070700_100023664 3300005441 Bacteria 3595
165 Ga0070694_100014135 3300005444 Bacteria 4995
166 Ga0070694_100045403 3300005444 Bacteria 2944
167 Ga0070663_100001009 3300005455 Bacteria 15347
168 Ga0070663_100011479 3300005455 Bacteria 5564
169 Ga0070663_100019407 3300005455 Bacteria 4480
170 Ga0070663_100036427 3300005455 Bacteria 3419
171 Ga0070663_100050951 3300005455 Bacteria 2947
172 Ga0070663_100094329 3300005455 Bacteria 2222
173 Ga0070663_100126080 3300005455 Bacteria 1939
174 Ga0070663_100132792 3300005455 Bacteria 1892
175 Ga0070663_100194123 3300005455 Bacteria 1581
176 Ga0070663_100213363 3300005455 Bacteria 1512
177 Ga0070663_100287544 3300005455 Bacteria 1312
178 Ga0070663_100701716 3300005455 Bacteria 860
179 Ga0070678_100004475 3300005456 Bacteria 7930
180 Ga0070678_100065082 3300005456 Bacteria 2705
181 Ga0070678_100072857 3300005456 Bacteria 2576
182 Ga0070678_100436544 3300005456 Bacteria 1144
183 Ga0070678_100474351 3300005456 Bacteria 1100
184 Ga0070678_100882156 3300005456 Bacteria 817
185 Ga0070662_100025277 3300005457 Bacteria 4099
186 Ga0070662_100028671 3300005457 Bacteria 3876
187 Ga0070662_100040338 3300005457 Bacteria 3323
188 Ga0070662_100086583 3300005457 Bacteria 2344
189 Ga0070662_100110024 3300005457 Bacteria 2097
190 Ga0070662_100120089 3300005457 Bacteria 2013
191 Ga0070662_100349288 3300005457 Bacteria 1211
192 Ga0070662_100884718 3300005457 Bacteria 762
193 Ga0070662_101038675 3300005457 Bacteria 702
194 Ga0070681_10294711 3300005458 Bacteria 1532
195 Ga0070681_10489663 3300005458 Bacteria 1143
196 Ga0068867_100007257 3300005459 Bacteria 7837
197 Ga0068867_100025838 3300005459 Bacteria 4212
198 Ga0068867_100093679 3300005459 Bacteria 2283
199 Ga0070685_10554506 3300005466 Bacteria 821
200 Ga0070685_10558934 3300005466 Bacteria 818
201 Ga0070679_100062635 3300005530 Bacteria 3708
202 Ga0070679_100114649 3300005530 Bacteria 2680
203 Ga0070679_100123070 3300005530 Bacteria 2577
204 Ga0070679_100241442 3300005530 Bacteria 1764
205 Ga0070679_100654032 3300005530 Bacteria 994
206 Ga0070679_101005558 3300005530 Bacteria 778
207 Ga0070684_101132358 3300005535 Bacteria 736
208 Ga0068853_100001142 3300005539 Bacteria 18805
209 Ga0068853_100041110 3300005539 Bacteria 3947
210 Ga0068853_100061527 3300005539 Bacteria 3247
211 Ga0068853_100286277 3300005539 Bacteria 1520
212 Ga0068853_100899898 3300005539 Bacteria 850
213 Ga0068853_100942287 3300005539 Bacteria 830
214 Ga0068853_101113250 3300005539 Bacteria 762
215 Ga0070672_100001762 3300005543 Bacteria 13530
216 Ga0070672_100008727 3300005543 Bacteria 6957
217 Ga0070672_100013328 3300005543 Bacteria 5804
218 Ga0070672_100024329 3300005543 Bacteria 4473
219 Ga0070672_100077419 3300005543 Bacteria 2660
220 Ga0070672_100132471 3300005543 Bacteria 2050
221 Ga0070672_100460748 3300005543 Bacteria 1096
222 Ga0070672_100462702 3300005543 Bacteria 1093
223 Ga0070672_101246144 3300005543 Bacteria 663
224 Ga0070686_100000821 3300005544 Bacteria 17967
225 Ga0070695_100016549 3300005545 Bacteria 4465
226 Ga0070695_100238041 3300005545 Bacteria 1319
227 Ga0070695_100562207 3300005545 Bacteria 890
228 Ga0070696_100023358 3300005546 Bacteria 4203
229 Ga0070696_100675770 3300005546 Bacteria 839
230 Ga0070693_100027629 3300005547 Bacteria 3078
231 Ga0070665_100000282 3300005548 Bacteria 82407
232 Ga0070665_100005675 3300005548 Bacteria 12824
233 Ga0070665_100035049 3300005548 Bacteria 5047
234 Ga0070665_100035746 3300005548 Bacteria 4997
235 Ga0070665_100047088 3300005548 Bacteria 4328
236 Ga0070665_100787702 3300005548 Bacteria 964
237 Ga0070665_100853000 3300005548 Bacteria 924
238 Ga0070665_100973127 3300005548 Bacteria 861
239 Ga0070665_101594568 3300005548 Bacteria 661
240 Ga0070704_100013287 3300005549 Bacteria 5107
241 Ga0070704_100079864 3300005549 Bacteria 2404
242 Ga0068855_100033891 3300005563 Bacteria 6091
243 Ga0068855_100052867 3300005563 Bacteria 4780
244 Ga0068855_100057149 3300005563 Bacteria 4574
245 Ga0068855_100082562 3300005563 Bacteria 3724
246 Ga0068855_100119253 3300005563 Bacteria 3021
247 Ga0068855_100128700 3300005563 Bacteria 2893
248 Ga0068855_100395047 3300005563 Bacteria 1516
249 Ga0068855_100770774 3300005563 Bacteria 1024
250 Ga0068855_100897556 3300005563 Bacteria 936
251 Ga0068855_101816726 3300005563 Bacteria 619
252 Ga0068855_102109359 3300005563 Bacteria 567
253 Ga0070664_100074467 3300005564 Bacteria 2914
254 Ga0070664_100093815 3300005564 Bacteria 2601
255 Ga0070664_100096904 3300005564 Bacteria 2560
256 Ga0070664_100165089 3300005564 Bacteria 1961
257 Ga0070664_100169342 3300005564 Bacteria 1937
258 Ga0070664_100196755 3300005564 Bacteria 1797
259 Ga0070664_100553090 3300005564 Bacteria 1064
260 Ga0070664_100842739 3300005564 Bacteria 858
261 Ga0068857_100004484 3300005577 Bacteria 11800
262 Ga0068857_100114084 3300005577 Bacteria 2430
263 Ga0068857_100424467 3300005577 Bacteria 1240
264 Ga0068857_100952943 3300005577 Bacteria 824
265 Ga0068857_101029996 3300005577 Bacteria 793
266 Ga0068854_100001459 3300005578 Bacteria 14323
267 Ga0068854_100002485 3300005578 Bacteria 11414
268 Ga0068854_100012241 3300005578 Bacteria 5615
269 Ga0068854_100025506 3300005578 Bacteria 4057
270 Ga0068854_100044927 3300005578 Bacteria 3138
271 Ga0068854_100097579 3300005578 Bacteria 2197
272 Ga0068854_100289161 3300005578 Bacteria 1322
273 Ga0068854_100604671 3300005578 Bacteria 936
274 Ga0068854_100731882 3300005578 Bacteria 856
275 Ga0068856_100002198 3300005614 Bacteria 20238
276 Ga0068856_100004000 3300005614 Bacteria 14763
277 Ga0068856_100090552 3300005614 Bacteria 3043
278 Ga0068856_100588749 3300005614 Bacteria 1134
279 Ga0068856_100859304 3300005614 Bacteria 926
280 Ga0068856_101423024 3300005614 Bacteria 707
281 Ga0068856_101793003 3300005614 Bacteria 625
282 Ga0070702_100032280 3300005615 Bacteria 2872
283 Ga0068852_100003412 3300005616 Bacteria 11093
284 Ga0068852_100014450 3300005616 Bacteria 6080
285 Ga0068852_100041077 3300005616 Bacteria 3906
286 Ga0068852_100076004 3300005616 Bacteria 2965
287 Ga0068852_100098856 3300005616 Bacteria 2629
288 Ga0068852_100196011 3300005616 Bacteria 1909
289 Ga0068852_100499107 3300005616 Bacteria 1211
290 Ga0068852_100527199 3300005616 Bacteria 1179
291 Ga0068859_100001678 3300005617 Bacteria 22539
292 Ga0068859_100030811 3300005617 Bacteria 5383
293 Ga0068859_100042514 3300005617 Bacteria 4565
294 Ga0068859_100272780 3300005617 Bacteria 1784
295 Ga0068859_100411624 3300005617 Bacteria 1448
296 Ga0068864_100033972 3300005618 Bacteria 4336
297 Ga0068864_100079283 3300005618 Bacteria 2875
298 Ga0068864_101186866 3300005618 Bacteria 761
299 Ga0068864_101720457 3300005618 Bacteria 632
300 Ga0068864_102077298 3300005618 Unclassified 574
301 Ga0068866_10025152 3300005718 Bacteria 2796
302 Ga0068866_10025808 3300005718 Bacteria 2767
303 Ga0068866_10637535 3300005718 Bacteria 724
304 Ga0068861_100045213 3300005719 Bacteria 3314
305 Ga0068861_100096910 3300005719 Bacteria 2338
306 Ga0068851_10064560 3300005834 Bacteria 1882
307 Ga0068851_10068132 3300005834 Bacteria 1836
308 Ga0068851_10167595 3300005834 Bacteria 1210
309 Ga0068851_10259166 3300005834 Bacteria 989
310 Ga0068870_10286384 3300005840 Bacteria 1035
311 Ga0068863_100000012 3300005841 Bacteria 229774
312 Ga0068863_100001789 3300005841 Bacteria 21336
313 Ga0068863_100010506 3300005841 Bacteria 8994
314 Ga0068863_100101539 3300005841 Bacteria 2735
315 Ga0068863_100110363 3300005841 Bacteria 2619
316 Ga0068863_100142731 3300005841 Bacteria 2289
317 Ga0068863_100146849 3300005841 Bacteria 2256
318 Ga0068863_100559034 3300005841 Bacteria 1130
319 Ga0068858_100017501 3300005842 Bacteria 6722
320 Ga0068858_100020727 3300005842 Bacteria 6141
321 Ga0068858_100025301 3300005842 Bacteria 5523
322 Ga0068858_101444299 3300005842 Bacteria 678
323 Ga0068860_100073854 3300005843 Bacteria 3242
324 Ga0068860_100091567 3300005843 Bacteria 2897
325 Ga0068860_100095127 3300005843 Bacteria 2839
326 Ga0068860_100098751 3300005843 Bacteria 2784
327 Ga0068860_100133052 3300005843 Bacteria 2387
328 Ga0068860_100648324 3300005843 Bacteria 1064
329 Ga0068862_100149154 3300005844 Bacteria 2080
330 Ga0068862_101930816 3300005844 Bacteria 600
331 Ga0075365_10012673 3300006038 Bacteria 5016
332 Ga0075363_100000840 3300006048 Bacteria 10684
333 Ga0075363_100004002 3300006048 Bacteria 6374
334 Ga0075364_10006860 3300006051 Bacteria 6722
335 Ga0075364_10019691 3300006051 Bacteria 4238
336 Ga0070715_10000417 3300006163 Bacteria 10851
337 Ga0070716_100002180 3300006173 Bacteria 9009
338 Ga0075362_10219519 3300006177 Bacteria 929
339 Ga0075362_10229358 3300006177 Bacteria 909
340 Ga0075367_10064390 3300006178 Bacteria 2193
341 Ga0075367_10207159 3300006178 Bacteria 1226
342 Ga0075367_10449147 3300006178 Bacteria 817
343 Ga0075369_10021338 3300006186 Bacteria 2660
344 Ga0075369_10116325 3300006186 Bacteria 1208
345 Ga0097621_100041405 3300006237 Bacteria 3708
346 Ga0097621_100057175 3300006237 Bacteria 3189
347 Ga0097621_101456608 3300006237 Bacteria 649
348 Ga0075370_10064147 3300006353 Bacteria 2095
349 Ga0075370_10110179 3300006353 Bacteria 1598
350 Ga0075370_10350594 3300006353 Bacteria 882
351 Ga0068871_100052052 3300006358 Bacteria 3315
352 Ga0068871_100063673 3300006358 Bacteria 3017
353 Ga0068871_100074530 3300006358 Bacteria 2800
354 Ga0068871_100267735 3300006358 Bacteria 1492
355 Ga0068871_100341964 3300006358 Bacteria 1321
356 Ga0068871_100575491 3300006358 Bacteria 1022
357 Ga0075431_100004203 3300006847 Bacteria 14098
358 Ga0075434_100138466 3300006871 Bacteria 2453
359 Ga0068865_100020904 3300006881 Bacteria 4250
360 Ga0068865_100062537 3300006881 Bacteria 2613
361 Ga0068865_100128532 3300006881 Bacteria 1895
362 Ga0068865_100869559 3300006881 Bacteria 782
363 Ga0075436_100980504 3300006914 Bacteria 634
364 Ga0097620_100001678 3300006931 Bacteria 22539
365 Ga0097620_100002528 3300006931 Bacteria 18563
366 Ga0097620_100030812 3300006931 Bacteria 5383
367 Ga0097620_100042515 3300006931 Bacteria 4565
368 Ga0097620_100272767 3300006931 Bacteria 1784
369 Ga0097620_100411632 3300006931 Bacteria 1448
370 Ga0105251_10065348 3300009011 Bacteria 1702
371 Ga0105240_10012918 3300009093 Bacteria 11503
372 Ga0105240_10079431 3300009093 Bacteria 4037
373 Ga0105240_10128515 3300009093 Bacteria 3042
374 Ga0105240_10157645 3300009093 Bacteria 2698
375 Ga0105240_10479211 3300009093 Bacteria 1387
376 Ga0105240_10535644 3300009093 Bacteria 1298
377 Ga0105245_10168556 3300009098 Bacteria 2083
378 Ga0105245_10428925 3300009098 Bacteria 1326
379 Ga0105245_11002402 3300009098 Bacteria 880
380 Ga0105247_10009579 3300009101 Bacteria 5878
381 Ga0105247_10093529 3300009101 Bacteria 1911
382 Ga0114129_11350623 3300009147 Bacteria 881
383 Ga0105243_10030964 3300009148 Bacteria 4123
384 Ga0105243_10136859 3300009148 Bacteria 2085
385 Ga0105243_10171628 3300009148 Bacteria 1879
386 Ga0105243_10614675 3300009148 Bacteria 1048
387 Ga0105243_11308812 3300009148 Bacteria 742
388 Ga0105241_10028104 3300009174 Bacteria 4189
389 Ga0105241_10051888 3300009174 Bacteria 3129
390 Ga0105241_10265929 3300009174 Bacteria 1459
391 Ga0105241_10283659 3300009174 Bacteria 1415
392 Ga0105242_10002410 3300009176 Bacteria 14697
393 Ga0105242_10045447 3300009176 Bacteria 3559
394 Ga0105242_10062824 3300009176 Bacteria 3057
395 Ga0105242_10344781 3300009176 Bacteria 1374
396 Ga0105242_10442072 3300009176 Bacteria 1224
397 Ga0105248_10001135 3300009177 Bacteria 29633
398 Ga0105248_10001858 3300009177 Bacteria 23422
399 Ga0105248_10002177 3300009177 Bacteria 21693
400 Ga0105248_10004891 3300009177 Bacteria 14809
401 Ga0105248_10013617 3300009177 Bacteria 8953
402 Ga0105248_10045891 3300009177 Bacteria 4898
403 Ga0105248_10086322 3300009177 Bacteria 3531
404 Ga0105248_10121318 3300009177 Bacteria 2949
405 Ga0105248_10246945 3300009177 Bacteria 2009
406 Ga0105248_10545632 3300009177 Bacteria 1308
407 Ga0105248_10566850 3300009177 Bacteria 1281
408 Ga0105248_10665866 3300009177 Bacteria 1174
409 Ga0105237_10001038 3300009545 Bacteria 37371
410 Ga0105237_10113862 3300009545 Bacteria 2697
411 Ga0105237_10401264 3300009545 Unclassified 1376
412 Ga0105238_10013551 3300009551 Bacteria 8232
413 Ga0105238_10228942 3300009551 Bacteria 1836
414 Ga0105238_10233778 3300009551 Bacteria 1815
415 Ga0105238_10462811 3300009551 Bacteria 1266
416 Ga0105238_10789861 3300009551 Bacteria 965
417 Ga0105238_11930541 3300009551 Bacteria 623
418 Ga0105249_10024852 3300009553 Bacteria 5388
419 Ga0105249_10077350 3300009553 Bacteria 3085
420 Ga0105249_10179483 3300009553 Bacteria 2059
421 Ga0105249_10231480 3300009553 Bacteria 1823
422 Ga0105249_12450828 3300009553 Bacteria 594
423 Ga0105239_10017189 3300010375 Bacteria 7996
424 Ga0105239_10074325 3300010375 Bacteria 3737
425 Ga0105239_10079404 3300010375 Bacteria 3611
426 Ga0105239_10095905 3300010375 Bacteria 3276
427 Ga0105239_10249028 3300010375 Bacteria 1995
428 Ga0105239_11648485 3300010375 Bacteria 742
429 Ga0105246_10123170 3300011119 Bacteria 1924
430 Ga0105246_10167619 3300011119 Bacteria 1679
431 Ga0105246_10564961 3300011119 Bacteria 977
432 Ga0157327_1027075 3300012512 Bacteria 690
433 Ga0157373_10074447 3300013100 Bacteria 2395
434 Ga0157373_10092129 3300013100 Bacteria 2134
435 Ga0157373_10134560 3300013100 Bacteria 1738
436 Ga0157373_10237993 3300013100 Bacteria 1287
437 Ga0157373_10297665 3300013100 Bacteria 1145
438 Ga0157371_10035547 3300013102 Bacteria 3569
439 Ga0157371_10138247 3300013102 Bacteria 1735
440 Ga0157371_10145135 3300013102 Bacteria 1691
441 Ga0157371_10312826 3300013102 Bacteria 1138
442 Ga0157371_10685344 3300013102 Bacteria 766
443 Ga0157371_10687867 3300013102 Bacteria 765
444 Ga0157371_10693457 3300013102 Bacteria 762
445 Ga0157371_10860330 3300013102 Bacteria 686
446 Ga0157371_11211259 3300013102 Bacteria 582
447 Ga0157370_10000056 3300013104 Bacteria 118279
448 Ga0157370_10038162 3300013104 Bacteria 4647
449 Ga0157370_10075245 3300013104 Bacteria 3184
450 Ga0157370_10093533 3300013104 Bacteria 2821
451 Ga0157370_10871192 3300013104 Bacteria 818
452 Ga0157369_10028034 3300013105 Bacteria 6236
453 Ga0157369_10035796 3300013105 Bacteria 5442
454 Ga0157369_10063582 3300013105 Bacteria 3975
455 Ga0157369_10113758 3300013105 Bacteria 2875
456 Ga0157369_10175007 3300013105 Bacteria 2260
457 Ga0157369_10220875 3300013105 Bacteria 1984
458 Ga0157369_10756217 3300013105 Bacteria 1000
459 Ga0157374_10002901 3300013296 Bacteria 14368
460 Ga0157374_10007217 3300013296 Bacteria 9466
461 Ga0157374_10248580 3300013296 Bacteria 1750
462 Ga0157374_10853004 3300013296 Bacteria 928
463 Ga0157378_10007678 3300013297 Bacteria 9413
464 Ga0157378_10943975 3300013297 Bacteria 895
465 Ga0157378_12316216 3300013297 Bacteria 589
466 Ga0163162_10003575 3300013306 Bacteria 14865
467 Ga0163162_10012266 3300013306 Bacteria 8364
468 Ga0163162_10032172 3300013306 Bacteria 5208
469 Ga0163162_10048924 3300013306 Bacteria 4237
470 Ga0163162_10073970 3300013306 Bacteria 3465
471 Ga0163162_10354901 3300013306 Bacteria 1599
472 Ga0157372_10270637 3300013307 Bacteria 1974
473 Ga0157372_10271833 3300013307 Bacteria 1970
474 Ga0157372_10322879 3300013307 Bacteria 1797
475 Ga0157372_10938682 3300013307 Bacteria 1003
476 Ga0157375_10003420 3300013308 Bacteria 13756
477 Ga0157375_10050187 3300013308 Bacteria 4092
478 Ga0157375_10071907 3300013308 Bacteria 3474
479 Ga0157375_10101184 3300013308 Bacteria 2964
480 Ga0157375_10676674 3300013308 Bacteria 1187
481 Ga0157375_10932143 3300013308 Bacteria 1011
482 Ga0163163_10000735 3300014325 Bacteria 27886
483 Ga0163163_10120808 3300014325 Bacteria 2654
484 Ga0163163_10149439 3300014325 Bacteria 2380
485 Ga0163163_10237298 3300014325 Bacteria 1873
486 Ga0163163_10287482 3300014325 Bacteria 1696
487 Ga0163163_10428919 3300014325 Bacteria 1381
488 Ga0163163_10450533 3300014325 Bacteria 1347
489 Ga0157380_10198224 3300014326 Bacteria 1779
490 Ga0157377_10024695 3300014745 Bacteria 3197
491 Ga0157377_10049915 3300014745 Bacteria 2354
492 Ga0157377_10383910 3300014745 Bacteria 952
493 Ga0157377_11018374 3300014745 Bacteria 628
494 Ga0157379_10009693 3300014968 Bacteria 8386
495 Ga0157379_10033972 3300014968 Bacteria 4546
496 Ga0157379_10145121 3300014968 Bacteria 2140
497 Ga0157379_10163975 3300014968 Bacteria 2006
498 Ga0157376_10002084 3300014969 Bacteria 13444
499 Ga0157376_10053358 3300014969 Bacteria 3366
500 Ga0157376_10135901 3300014969 Bacteria 2200
501 Ga0163161_10013539 3300017792 Bacteria 5679
502 Ga0163161_10070700 3300017792 Bacteria 2552
503 Ga0163161_10090171 3300017792 Bacteria 2268
504 Ga0163161_10116233 3300017792 Bacteria 2005
505 Ga0163161_10184307 3300017792 Bacteria 1602
506 Ga0163161_10269800 3300017792 Bacteria 1331
507 Ga0163161_11640777 3300017792 Bacteria 568
508 Ga0197907_11258877 3300020069 Bacteria 2043
509 Ga0206352_10907084 3300020078 Bacteria 599
510 Ga0206354_10798508 3300020081 Bacteria 1675
511 Ga0206353_10574223 3300020082 Bacteria 910
512 Ga0206353_11449045 3300020082 Bacteria 2264
513 Ga0206353_11611110 3300020082 Bacteria 1429
514 Ga0213876_10397966 3300021384 Bacteria 732
515 Ga0213875_10001474 3300021388 Bacteria 15189
516 Ga0213875_10027244 3300021388 Bacteria 2719
517 Ga0224712_10449412 3300022467 Bacteria 619
518 Ga0207427_100760 3300025231 Bacteria 14681
519 Ga0209233_1000078 3300025261 Bacteria 348118
520 Ga0209050_1001276 3300025298 Bacteria 28848
521 Ga0209050_1044257 3300025298 Bacteria 1193
522 Ga0209051_1003373 3300025303 Bacteria 10505
523 Ga0209257_1000021 3300025304 Bacteria 771986
524 Ga0209257_1044142 3300025304 Bacteria 1302
525 Ga0207697_10000532 3300025315 Bacteria 21534
526 Ga0207697_10238850 3300025315 Bacteria 803
527 Ga0207656_10049327 3300025321 Bacteria 1815
528 Ga0207656_10317901 3300025321 Bacteria 773
529 Ga0207656_10510998 3300025321 Bacteria 610
530 Ga0207713_1027757 3300025735 Bacteria 2565
531 Ga0207682_10074875 3300025893 Bacteria 1440
532 Ga0207682_10107187 3300025893 Bacteria 1227
533 Ga0207682_10175830 3300025893 Bacteria 976
534 Ga0207692_10007894 3300025898 Bacteria 4384
535 Ga0207642_10209355 3300025899 Bacteria 1082
536 Ga0207642_10264271 3300025899 Bacteria 982
537 Ga0207710_10010921 3300025900 Bacteria 3826
538 Ga0207688_10000504 3300025901 Bacteria 18809
539 Ga0207688_10001563 3300025901 Bacteria 12068
540 Ga0207688_10052965 3300025901 Bacteria 2275
541 Ga0207688_10148663 3300025901 Bacteria 1382
542 Ga0207680_10032695 3300025903 Bacteria 2960
543 Ga0207680_10062930 3300025903 Bacteria 2269
544 Ga0207680_10092556 3300025903 Bacteria 1926
545 Ga0207680_10167956 3300025903 Bacteria 1476
546 Ga0207680_10463349 3300025903 Bacteria 900
547 Ga0207680_10584150 3300025903 Bacteria 799
548 Ga0207647_10000891 3300025904 Bacteria 23141
549 Ga0207647_10013775 3300025904 Bacteria 5600
550 Ga0207647_10016493 3300025904 Bacteria 5042
551 Ga0207647_10019269 3300025904 Bacteria 4592
552 Ga0207647_10030433 3300025904 Bacteria 3482
553 Ga0207685_10002965 3300025905 Bacteria 4023
554 Ga0207645_10011301 3300025907 Bacteria 6100
555 Ga0207645_10093709 3300025907 Bacteria 1932
556 Ga0207643_10176500 3300025908 Bacteria 1291
557 Ga0207705_10000033 3300025909 Bacteria 223997
558 Ga0207705_10000369 3300025909 Bacteria 40762
559 Ga0207705_10006806 3300025909 Bacteria 8446
560 Ga0207705_10007536 3300025909 Bacteria 7996
561 Ga0207705_10036930 3300025909 Bacteria 3496
562 Ga0207705_10055686 3300025909 Bacteria 2851
563 Ga0207705_10068449 3300025909 Bacteria 2570
564 Ga0207705_10300111 3300025909 Bacteria 1232
565 Ga0207705_10516894 3300025909 Bacteria 928
566 Ga0207705_10568028 3300025909 Bacteria 882
567 Ga0207684_10229215 3300025910 Bacteria 1603
568 Ga0207654_10007510 3300025911 Bacteria 5495
569 Ga0207654_10068264 3300025911 Bacteria 2103
570 Ga0207654_10350240 3300025911 Bacteria 1017
571 Ga0207707_10355459 3300025912 Bacteria 1262
572 Ga0207707_10359758 3300025912 Bacteria 1253
573 Ga0207707_10491532 3300025912 Bacteria 1047
574 Ga0207695_10009693 3300025913 Bacteria 11858
575 Ga0207695_10011979 3300025913 Bacteria 10434
576 Ga0207695_10079369 3300025913 Bacteria 3327
577 Ga0207695_10254296 3300025913 Bacteria 1656
578 Ga0207695_10558910 3300025913 Bacteria 1026
579 Ga0207695_10653069 3300025913 Bacteria 933
580 Ga0207671_10000911 3300025914 Bacteria 37314
581 Ga0207671_10294114 3300025914 Bacteria 1283
582 Ga0207693_10003860 3300025915 Bacteria 12766
583 Ga0207663_10011821 3300025916 Bacteria 4700
584 Ga0207660_10000188 3300025917 Bacteria 39152
585 Ga0207660_10007321 3300025917 Bacteria 7142
586 Ga0207660_10334948 3300025917 Bacteria 1210
587 Ga0207662_10035911 3300025918 Bacteria 2896
588 Ga0207657_10000443 3300025919 Bacteria 43872
589 Ga0207657_10000755 3300025919 Bacteria 34349
590 Ga0207657_10009020 3300025919 Bacteria 10073
591 Ga0207657_10011691 3300025919 Bacteria 8699
592 Ga0207657_10021754 3300025919 Bacteria 6026
593 Ga0207657_10025047 3300025919 Bacteria 5511
594 Ga0207657_10027160 3300025919 Bacteria 5246
595 Ga0207657_10032955 3300025919 Bacteria 4674
596 Ga0207657_10078659 3300025919 Bacteria 2776
597 Ga0207657_10103626 3300025919 Bacteria 2358
598 Ga0207657_10291024 3300025919 Bacteria 1295
599 Ga0207657_10350715 3300025919 Bacteria 1164
600 Ga0207657_10360177 3300025919 Bacteria 1147
601 Ga0207649_10007462 3300025920 Bacteria 5945
602 Ga0207649_10027008 3300025920 Bacteria 3365
603 Ga0207649_10033321 3300025920 Bacteria 3077
604 Ga0207649_10079462 3300025920 Bacteria 2119
605 Ga0207652_10230058 3300025921 Bacteria 1671
606 Ga0207652_10371596 3300025921 Bacteria 1291
607 Ga0207652_10373149 3300025921 Bacteria 1288
608 Ga0207652_10395403 3300025921 Bacteria 1247
609 Ga0207652_10545636 3300025921 Bacteria 1042
610 Ga0207681_10086255 3300025923 Bacteria 2230
611 Ga0207681_10141842 3300025923 Bacteria 1790
612 Ga0207681_10368837 3300025923 Bacteria 1153
613 Ga0207694_10020452 3300025924 Bacteria 5008
614 Ga0207694_10055924 3300025924 Bacteria 3064
615 Ga0207694_10183450 3300025924 Bacteria 1698
616 Ga0207694_10326729 3300025924 Bacteria 1267
617 Ga0207694_10342238 3300025924 Bacteria 1237
618 Ga0207694_10545344 3300025924 Bacteria 973
619 Ga0207650_10074904 3300025925 Bacteria 2553
620 Ga0207650_10093915 3300025925 Bacteria 2297
621 Ga0207659_10008336 3300025926 Bacteria 6427
622 Ga0207659_10068606 3300025926 Bacteria 2579
623 Ga0207659_11008251 3300025926 Bacteria 716
624 Ga0207687_10048722 3300025927 Bacteria 2944
625 Ga0207687_10319992 3300025927 Bacteria 1255
626 Ga0207687_10499797 3300025927 Bacteria 1015
627 Ga0207664_10028167 3300025929 Bacteria 4267
628 Ga0207664_10029235 3300025929 Bacteria 4196
629 Ga0207644_10000070 3300025931 Bacteria 74994
630 Ga0207644_10000852 3300025931 Bacteria 19325
631 Ga0207644_10020392 3300025931 Bacteria 4507
632 Ga0207644_10024684 3300025931 Bacteria 4128
633 Ga0207644_10025748 3300025931 Bacteria 4047
634 Ga0207644_10100612 3300025931 Bacteria 2171
635 Ga0207644_10155191 3300025931 Bacteria 1774
636 Ga0207644_11156260 3300025931 Bacteria 650
637 Ga0207690_10001162 3300025932 Bacteria 16670
638 Ga0207690_10007181 3300025932 Bacteria 6618
639 Ga0207690_10019474 3300025932 Bacteria 4181
640 Ga0207690_10167353 3300025932 Bacteria 1644
641 Ga0207690_10272549 3300025932 Bacteria 1315
642 Ga0207690_10313770 3300025932 Bacteria 1230
643 Ga0207690_10404405 3300025932 Bacteria 1089
644 Ga0207690_10432868 3300025932 Bacteria 1054
645 Ga0207690_10824188 3300025932 Bacteria 767
646 Ga0207690_11326538 3300025932 Bacteria 601
647 Ga0207706_10003754 3300025933 Bacteria 14487
648 Ga0207706_10009768 3300025933 Bacteria 8806
649 Ga0207706_10037556 3300025933 Bacteria 4300
650 Ga0207706_10109253 3300025933 Bacteria 2434
651 Ga0207706_10123697 3300025933 Bacteria 2275
652 Ga0207706_10143360 3300025933 Bacteria 2102
653 Ga0207706_10148580 3300025933 Bacteria 2061
654 Ga0207706_10158402 3300025933 Bacteria 1991
655 Ga0207706_10328724 3300025933 Bacteria 1330
656 Ga0207706_10357433 3300025933 Bacteria 1269
657 Ga0207706_10885908 3300025933 Bacteria 754
658 Ga0207686_11002064 3300025934 Bacteria 678
659 Ga0207709_10216527 3300025935 Bacteria 1378
660 Ga0207709_10272346 3300025935 Bacteria 1247
661 Ga0207709_10816111 3300025935 Bacteria 754
662 Ga0207670_10023027 3300025936 Bacteria 3870
663 Ga0207670_10864161 3300025936 Bacteria 756
664 Ga0207669_10022367 3300025937 Bacteria 3358
665 Ga0207669_10048319 3300025937 Bacteria 2527
666 Ga0207669_10069201 3300025937 Bacteria 2207
667 Ga0207669_10149093 3300025937 Bacteria 1636
668 Ga0207669_11497106 3300025937 Bacteria 575
669 Ga0207704_10027411 3300025938 Bacteria 3143
670 Ga0207704_10137918 3300025938 Bacteria 1701
671 Ga0207665_10004201 3300025939 Bacteria 9582
672 Ga0207691_10003343 3300025940 Bacteria 15608
673 Ga0207691_10004627 3300025940 Bacteria 13320
674 Ga0207691_10014585 3300025940 Bacteria 7491
675 Ga0207691_10020334 3300025940 Bacteria 6276
676 Ga0207691_10030464 3300025940 Bacteria 5041
677 Ga0207691_10079221 3300025940 Bacteria 2957
678 Ga0207691_10085771 3300025940 Bacteria 2826
679 Ga0207691_10160132 3300025940 Bacteria 1975
680 Ga0207691_10211588 3300025940 Bacteria 1684
681 Ga0207691_10563347 3300025940 Bacteria 966
682 Ga0207711_10000213 3300025941 Bacteria 62174
683 Ga0207711_10004658 3300025941 Bacteria 11646
684 Ga0207711_10009722 3300025941 Bacteria 8003
685 Ga0207711_10019391 3300025941 Bacteria 5664
686 Ga0207711_10118847 3300025941 Bacteria 2358
687 Ga0207711_10164630 3300025941 Bacteria 2010
688 Ga0207711_10178295 3300025941 Bacteria 1931
689 Ga0207711_10186810 3300025941 Bacteria 1887
690 Ga0207711_10250254 3300025941 Bacteria 1627
691 Ga0207711_10319290 3300025941 Bacteria 1435
692 Ga0207711_10419190 3300025941 Bacteria 1245
693 Ga0207711_11340297 3300025941 Bacteria 658
694 Ga0207689_10001274 3300025942 Bacteria 24296
695 Ga0207689_10014830 3300025942 Bacteria 6616
696 Ga0207689_10042434 3300025942 Bacteria 3763
697 Ga0207689_10224969 3300025942 Bacteria 1551
698 Ga0207689_10443675 3300025942 Bacteria 1084
699 Ga0207689_11175519 3300025942 Bacteria 646
700 Ga0207661_10112265 3300025944 Bacteria 2307
701 Ga0207679_10007531 3300025945 Bacteria 6909
702 Ga0207679_10023162 3300025945 Bacteria 4241
703 Ga0207679_10111338 3300025945 Bacteria 2161
704 Ga0207679_10159540 3300025945 Bacteria 1845
705 Ga0207679_10175104 3300025945 Bacteria 1770
706 Ga0207679_10467407 3300025945 Bacteria 1121
707 Ga0207679_11399111 3300025945 Bacteria 642
708 Ga0207667_10012561 3300025949 Bacteria 9742
709 Ga0207667_10034541 3300025949 Bacteria 5429
710 Ga0207667_10048277 3300025949 Bacteria 4502
711 Ga0207667_10073742 3300025949 Bacteria 3546
712 Ga0207667_10096934 3300025949 Bacteria 3044
713 Ga0207667_10119786 3300025949 Bacteria 2712
714 Ga0207667_10130390 3300025949 Bacteria 2590
715 Ga0207667_10137971 3300025949 Bacteria 2511
716 Ga0207667_10204948 3300025949 Bacteria 2023
717 Ga0207667_10514081 3300025949 Bacteria 1213
718 Ga0207667_10674041 3300025949 Bacteria 1038
719 Ga0207651_10021348 3300025960 Bacteria 3934
720 Ga0207651_10063361 3300025960 Bacteria 2581
721 Ga0207651_10103333 3300025960 Bacteria 2120
722 Ga0207651_10473840 3300025960 Bacteria 1078
723 Ga0207651_10630931 3300025960 Bacteria 939
724 Ga0207712_10000888 3300025961 Bacteria 21692
725 Ga0207712_10069565 3300025961 Bacteria 2526
726 Ga0207712_10079601 3300025961 Bacteria 2381
727 Ga0207712_10140240 3300025961 Bacteria 1854
728 Ga0207712_10174029 3300025961 Bacteria 1685
729 Ga0207712_10241815 3300025961 Bacteria 1454
730 Ga0207712_11310114 3300025961 Bacteria 647
731 Ga0207668_10000061 3300025972 Bacteria 89620
732 Ga0207668_10230508 3300025972 Bacteria 1493
733 Ga0207668_11035421 3300025972 Bacteria 734
734 Ga0207640_10000784 3300025981 Bacteria 18065
735 Ga0207640_10002237 3300025981 Bacteria 10416
736 Ga0207640_10004569 3300025981 Bacteria 7508
737 Ga0207640_10011781 3300025981 Bacteria 4961
738 Ga0207640_10020617 3300025981 Bacteria 3916
739 Ga0207640_10079645 3300025981 Bacteria 2233
740 Ga0207640_10086385 3300025981 Bacteria 2160
741 Ga0207640_10110205 3300025981 Bacteria 1949
742 Ga0207640_10421646 3300025981 Bacteria 1092
743 Ga0207640_10752537 3300025981 Bacteria 840
744 Ga0207658_10042624 3300025986 Bacteria 3293
745 Ga0207658_10052927 3300025986 Bacteria 2997
746 Ga0207658_10068204 3300025986 Bacteria 2682
747 Ga0207658_10173497 3300025986 Bacteria 1779
748 Ga0207658_10471381 3300025986 Bacteria 1114
749 Ga0207658_10871766 3300025986 Bacteria 819
750 Ga0207658_11394504 3300025986 Bacteria 641
751 Ga0207677_10089940 3300026023 Bacteria 2230
752 Ga0207677_10135756 3300026023 Bacteria 1875
753 Ga0207677_10896917 3300026023 Bacteria 799
754 Ga0207703_10007879 3300026035 Bacteria 8425
755 Ga0207703_10018119 3300026035 Bacteria 5500
756 Ga0207703_10078469 3300026035 Bacteria 2743
757 Ga0207703_10080256 3300026035 Bacteria 2717
758 Ga0207703_10454728 3300026035 Bacteria 1197
759 Ga0207703_10907421 3300026035 Bacteria 844
760 Ga0207639_10000815 3300026041 Bacteria 21193
761 Ga0207639_10001247 3300026041 Bacteria 17238
762 Ga0207639_10018109 3300026041 Bacteria 4999
763 Ga0207639_10188909 3300026041 Bacteria 1758
764 Ga0207639_10221693 3300026041 Bacteria 1634
765 Ga0207639_10260694 3300026041 Bacteria 1516
766 Ga0207639_10788080 3300026041 Bacteria 885
767 Ga0207639_10810959 3300026041 Bacteria 872
768 Ga0207678_10000080 3300026067 Bacteria 78553
769 Ga0207678_10008908 3300026067 Bacteria 8833
770 Ga0207678_10013112 3300026067 Bacteria 7272
771 Ga0207678_10019909 3300026067 Bacteria 5897
772 Ga0207678_10123987 3300026067 Bacteria 2205
773 Ga0207678_10160527 3300026067 Bacteria 1920
774 Ga0207678_10161425 3300026067 Bacteria 1914
775 Ga0207678_10213117 3300026067 Bacteria 1653
776 Ga0207678_10268170 3300026067 Bacteria 1464
777 Ga0207678_10272288 3300026067 Bacteria 1452
778 Ga0207708_10033599 3300026075 Bacteria 3898
779 Ga0207702_10006476 3300026078 Bacteria 10097
780 Ga0207702_10057700 3300026078 Bacteria 3301
781 Ga0207702_10059540 3300026078 Bacteria 3253
782 Ga0207702_10123094 3300026078 Bacteria 2324
783 Ga0207702_10158309 3300026078 Bacteria 2066
784 Ga0207702_11798180 3300026078 Bacteria 605
785 Ga0207641_10000024 3300026088 Bacteria 250751
786 Ga0207641_10001671 3300026088 Bacteria 21575
787 Ga0207641_10028312 3300026088 Bacteria 4629
788 Ga0207641_10132236 3300026088 Bacteria 2242
789 Ga0207641_10235524 3300026088 Bacteria 1703
790 Ga0207641_10723221 3300026088 Bacteria 981
791 Ga0207648_10003099 3300026089 Bacteria 17554
792 Ga0207648_10018534 3300026089 Bacteria 6300
793 Ga0207648_10028968 3300026089 Bacteria 4909
794 Ga0207648_10086225 3300026089 Bacteria 2739
795 Ga0207676_10016381 3300026095 Bacteria 5365
796 Ga0207676_10399574 3300026095 Bacteria 1284
797 Ga0207674_10006117 3300026116 Bacteria 14233
798 Ga0207674_10014354 3300026116 Bacteria 8752
799 Ga0207674_10022831 3300026116 Bacteria 6713
800 Ga0207674_10038491 3300026116 Bacteria 4962
801 Ga0207674_10211438 3300026116 Bacteria 1889
802 Ga0207674_10297077 3300026116 Bacteria 1564
803 Ga0207675_100008522 3300026118 Bacteria 9643
804 Ga0207675_100356654 3300026118 Bacteria 1434
805 Ga0207675_100430987 3300026118 Bacteria 1304
806 Ga0207683_10002659 3300026121 Bacteria 15607
807 Ga0207683_10007846 3300026121 Bacteria 9135
808 Ga0207683_10056986 3300026121 Bacteria 3429
809 Ga0207683_10060218 3300026121 Bacteria 3337
810 Ga0207683_10333417 3300026121 Bacteria 1390
811 Ga0207683_10789257 3300026121 Bacteria 881
812 Ga0207698_10000721 3300026142 Bacteria 19169
813 Ga0207698_10003134 3300026142 Bacteria 9909
814 Ga0207698_10021854 3300026142 Bacteria 4433
815 Ga0207698_10043344 3300026142 Bacteria 3370
816 Ga0207698_10124100 3300026142 Bacteria 2192
817 Ga0207698_10162127 3300026142 Bacteria 1957
818 Ga0207698_10303009 3300026142 Bacteria 1488
819 Ga0207698_10450187 3300026142 Bacteria 1243
820 Ga0207698_10883605 3300026142 Bacteria 900
821 Ga0207698_11066188 3300026142 Bacteria 820
822 Ga0209371_1000028 3300027312 Bacteria 429688
823 Ga0268266_10000151 3300028379 Bacteria 132529
824 Ga0268266_10004365 3300028379 Bacteria 13593
825 Ga0268266_10014267 3300028379 Bacteria 6834
826 Ga0268266_10031955 3300028379 Bacteria 4472
827 Ga0268266_10405405 3300028379 Bacteria 1290
828 Ga0268266_10581766 3300028379 Bacteria 1074
829 Ga0268265_10073184 3300028380 Bacteria 2675
830 Ga0268265_10123408 3300028380 Bacteria 2138
831 Ga0268265_10219745 3300028380 Bacteria 1662
832 Ga0268264_10002330 3300028381 Bacteria 16791
833 Ga0268264_10008206 3300028381 Bacteria 8673
834 Ga0268264_10008520 3300028381 Bacteria 8522
835 Ga0268264_10182333 3300028381 Bacteria 1908
836 Ga0268264_10278629 3300028381 Bacteria 1565
837 Ga0268264_10683531 3300028381 Bacteria 1018
838 Ga0268264_10696052 3300028381 Bacteria 1009
839 Ga0268256_1000030 3300030500 Bacteria 429688
840 Ga0316176_1187920 3300030732 Bacteria 1049
841 Ga0265339_10428626 3300031249 Bacteria 616
842 Ga0307408_100077337 3300031548 Bacteria 2477
843 Ga0307408_100166502 3300031548 Bacteria 1756
844 Ga0307408_100198506 3300031548 Bacteria 1622
845 Ga0307408_100326558 3300031548 Bacteria 1294
846 Ga0307408_100373803 3300031548 Bacteria 1216
847 Ga0307408_100452896 3300031548 Bacteria 1113
848 Ga0316575_10041092 3300031665 Bacteria 1828
849 Ga0316575_10118095 3300031665 Bacteria 1084
850 Ga0307405_10025635 3300031731 Bacteria 3388
851 Ga0307405_10048084 3300031731 Bacteria 2629
852 Ga0307405_10874004 3300031731 Bacteria 758
853 Ga0307413_10092783 3300031824 Bacteria 1971
854 Ga0307413_10096305 3300031824 Bacteria 1942
855 Ga0307413_10160903 3300031824 Bacteria 1577
856 Ga0307413_10169561 3300031824 Bacteria 1543
857 Ga0307410_10178371 3300031852 Bacteria 1606
858 Ga0307410_10205484 3300031852 Bacteria 1506
859 Ga0307410_10277349 3300031852 Bacteria 1314
860 Ga0307410_10322245 3300031852 Bacteria 1226
861 Ga0307410_10729337 3300031852 Bacteria 837
862 Ga0307406_10163641 3300031901 Bacteria 1602
863 Ga0307406_10207049 3300031901 Bacteria 1448
864 Ga0307406_10209961 3300031901 Bacteria 1439
865 Ga0307406_10273053 3300031901 Bacteria 1285
866 Ga0307406_10384126 3300031901 Bacteria 1108
867 Ga0307407_10028015 3300031903 Bacteria 3006
868 Ga0307407_10040944 3300031903 Bacteria 2587
869 Ga0307407_10053764 3300031903 Bacteria 2318
870 Ga0307407_10283826 3300031903 Bacteria 1148
871 Ga0307412_10004709 3300031911 Bacteria 7613
872 Ga0307412_10021668 3300031911 Bacteria 3928
873 Ga0307412_10062480 3300031911 Bacteria 2508
874 Ga0307412_10065914 3300031911 Bacteria 2452
875 Ga0307412_10099495 3300031911 Bacteria 2053
876 Ga0307412_10109638 3300031911 Bacteria 1968
877 Ga0307412_10122973 3300031911 Bacteria 1871
878 Ga0307412_10165901 3300031911 Bacteria 1646
879 Ga0307412_10852919 3300031911 Bacteria 795
880 Ga0307412_11035785 3300031911 Unclassified 727
881 Ga0307412_11220032 3300031911 Bacteria 674
882 Ga0307409_100137450 3300031995 Bacteria 2099
883 Ga0307409_100188235 3300031995 Bacteria 1834
884 Ga0307409_100241657 3300031995 Bacteria 1644
885 Ga0307409_100328843 3300031995 Bacteria 1433
886 Ga0307409_100377621 3300031995 Bacteria 1346
887 Ga0307409_100477125 3300031995 Bacteria 1209
888 Ga0307409_101034378 3300031995 Bacteria 840
889 Ga0307409_101509883 3300031995 Bacteria 699
890 Ga0307409_101683372 3300031995 Bacteria 663
891 Ga0307416_100102464 3300032002 Bacteria 2496
892 Ga0307416_100801378 3300032002 Bacteria 1037
893 Ga0307416_101035340 3300032002 Bacteria 924
894 Ga0307416_101847895 3300032002 Bacteria 708
895 Ga0307414_10109368 3300032004 Bacteria 2099
896 Ga0307414_10150168 3300032004 Bacteria 1837
897 Ga0307414_10220320 3300032004 Bacteria 1557
898 Ga0307414_10341599 3300032004 Bacteria 1282
899 Ga0307414_10544759 3300032004 Bacteria 1033
900 Ga0307414_10764032 3300032004 Bacteria 879
901 Ga0307414_10850819 3300032004 Bacteria 834
902 Ga0307414_10854583 3300032004 Bacteria 832
903 Ga0307414_11706977 3300032004 Bacteria 587
904 Ga0307411_10014387 3300032005 Bacteria 4399
905 Ga0307411_10049622 3300032005 Bacteria 2728
906 Ga0307411_10139112 3300032005 Bacteria 1788
907 Ga0307411_10172271 3300032005 Bacteria 1633
908 Ga0307411_10184744 3300032005 Bacteria 1586
909 Ga0307411_10345587 3300032005 Bacteria 1211
910 Ga0307411_10799315 3300032005 Bacteria 830
911 Ga0307411_11449635 3300032005 Bacteria 629
912 Ga0307415_100038932 3300032126 Bacteria 3137
913 Ga0307415_100240735 3300032126 Bacteria 1463
914 Ga0307415_100619683 3300032126 Bacteria 966
915 Ga0307415_101143030 3300032126 Bacteria 731
916 Ga0373949_0022575 3300035090 Bacteria 1452
917 Ga0373952_0231743 3300035092 Bacteria 552
918 Ga0373932_0086026 3300035112 Bacteria 1001
919 Ga0373943_0129621 3300035170 Bacteria 1349
920 Ga0373931_0130419 3300035691 Bacteria 1446
921 Ga0373931_0252374 3300035691 Bacteria 1073
922 Ga0395899_0007205 3300037312 Bacteria 8610
923 Ga0395899_0009159 3300037312 Bacteria 7604
924 Ga0395899_0012868 3300037312 Bacteria 6407
925 Ga0395899_0019172 3300037312 Bacteria 5199
926 Ga0395899_0053593 3300037312 Bacteria 2986
927 Ga0395899_0085920 3300037312 Bacteria 2285
928 Ga0395899_0114604 3300037312 Bacteria 1935
929 Ga0395899_0173102 3300037312 Bacteria 1519
930 Ga0395899_0421867 3300037312 Bacteria 879
931 Ga0395899_0626142 3300037312 Bacteria 682
932 Ga0395899_0655322 3300037312 Bacteria 663
933 Ga0395899_0666971 3300037312 Bacteria 655
934 Ga0395900_0001531 3300037418 Bacteria 27485
935 Ga0395900_0002881 3300037418 Bacteria 18746
936 Ga0395900_0003481 3300037418 Bacteria 16989
937 Ga0395900_0008716 3300037418 Bacteria 10414
938 Ga0395900_0009317 3300037418 Bacteria 10066
939 Ga0395900_0017459 3300037418 Bacteria 7326
940 Ga0395900_0020285 3300037418 Bacteria 6783
941 Ga0395900_0048515 3300037418 Bacteria 4374
942 Ga0395900_0053933 3300037418 Bacteria 4138
943 Ga0395900_0099196 3300037418 Bacteria 2992
944 Ga0395900_0171266 3300037418 Bacteria 2210
945 Ga0395900_0180293 3300037418 Bacteria 2147
946 Ga0395900_0267293 3300037418 Bacteria 1706
947 Ga0395900_0394405 3300037418 Bacteria 1349
948 Ga0395900_0448761 3300037418 Bacteria 1246
949 Ga0395900_0785958 3300037418 Bacteria 880
950 Ga0395900_0812178 3300037418 Bacteria 862
951 Ga0395900_1120548 3300037418 Bacteria 704
952 Ga0395898_0000315 3300037466 Bacteria 111811
953 Ga0395898_0014597 3300037466 Bacteria 8066
954 Ga0395898_0019648 3300037466 Bacteria 6872
955 Ga0395898_0047468 3300037466 Bacteria 4214
956 Ga0395898_0050459 3300037466 Bacteria 4071
957 Ga0395898_0061817 3300037466 Bacteria 3638
958 Ga0395898_0103681 3300037466 Bacteria 2728
959 Ga0395898_0122537 3300037466 Bacteria 2491
960 Ga0395898_0212183 3300037466 Bacteria 1847
961 Ga0395898_0343757 3300037466 Bacteria 1423
962 Ga0395898_0564529 3300037466 Bacteria 1080
963 Ga0395898_0604489 3300037466 Bacteria 1039
964 Ga0395898_0624375 3300037466 Bacteria 1020
965 Ga0395898_0929398 3300037466 Bacteria 807
966 Ga0395898_0976638 3300037466 Bacteria 783
967 Ga0395898_1522818 3300037466 Bacteria 594
968 Ga0395898_1871610 3300037466 Bacteria 520
969 Ga0395905_0000005 3300037471 Bacteria 557808
970 Ga0395905_0002453 3300037471 Bacteria 20537
971 Ga0395905_0008885 3300037471 Bacteria 9869
972 Ga0395905_0023772 3300037471 Bacteria 5786
973 Ga0395905_0070995 3300037471 Bacteria 3264
974 Ga0395905_0085572 3300037471 Bacteria 2954
975 Ga0395905_0093564 3300037471 Bacteria 2819
976 Ga0395905_0124851 3300037471 Bacteria 2420
977 Ga0395905_0125575 3300037471 Bacteria 2412
978 Ga0395905_0148872 3300037471 Bacteria 2202
979 Ga0395905_0149119 3300037471 Bacteria 2200
980 Ga0395905_0151334 3300037471 Bacteria 2183
981 Ga0395905_0161720 3300037471 Bacteria 2104
982 Ga0395905_0189851 3300037471 Bacteria 1927
983 Ga0395905_0203538 3300037471 Bacteria 1855
984 Ga0395905_0273692 3300037471 Bacteria 1574
985 Ga0395905_0275863 3300037471 Bacteria 1567
986 Ga0395905_0441962 3300037471 Bacteria 1198
987 Ga0436364_0573660 3300037853 Bacteria 25797
988 Ga0436364_0767650 3300037853 Bacteria 28654
989 Ga0436364_1182532 3300037853 Bacteria 938
990 Ga0395901_0000242 3300038443 Bacteria 68210
991 Ga0395901_0005262 3300038443 Bacteria 13071
992 Ga0395901_0019441 3300038443 Bacteria 6945
993 Ga0395901_0023055 3300038443 Bacteria 6381
994 Ga0395901_0062881 3300038443 Bacteria 3862
995 Ga0395901_0113436 3300038443 Bacteria 2846
996 Ga0395901_0137817 3300038443 Bacteria 2564
997 Ga0395901_0169674 3300038443 Bacteria 2289
998 Ga0395901_0302259 3300038443 Bacteria 1659
999 Ga0395901_0332396 3300038443 Bacteria 1571
1000 Ga0395901_0560693 3300038443 Bacteria 1157
1001 Ga0395901_0604472 3300038443 Bacteria 1105
1002 Ga0395901_0799106 3300038443 Bacteria 932
1003 Ga0395901_1658769 3300038443 Bacteria 591
1004 Ga0400485_15347 3300038735 Bacteria 1521
1005 Ga0400486_14570 3300038742 Bacteria 2610
1006 Ga0400483_149157 3300039062 Unclassified 2132
1007 Ga0400487_00860 3300039110 Bacteria 1799
1008 Ga0436365_1032337 3300039437 Bacteria 1978
1009 Ga0436363_1088079 3300039450 Bacteria 1186
1010 Ga0439436_0176419 3300041404 Bacteria 607
1011 Ga0439439_0015483 3300041406 Bacteria 1863
1012 Ga0439461_0000162 3300041410 Bacteria 9060
1013 Ga0439461_0105860 3300041410 Bacteria 689
1014 Ga0439461_0129398 3300041410 Bacteria 637
1015 Ga0439466_0044561 3300041411 Bacteria 1469
1016 Ga0439465_0023867 3300041413 Bacteria 1925
1017 Ga0451837_1770621 3300041494 Bacteria 919
1018 Ga0451851_0640169 3300041507 Bacteria 848
1019 Ga0439431_0000167 3300041997 Bacteria 12428
1020 Ga0439433_0127773 3300041999 Bacteria 644
1021 Ga0439442_013243 3300042002 Bacteria 1692
1022 Ga0439442_026192 3300042002 Bacteria 1214
1023 Ga0439445_0001476 3300042004 Bacteria 5123
1024 Ga0439445_0047881 3300042004 Bacteria 1148
1025 Ga0439448_0008105 3300042005 Bacteria 3068
1026 Ga0439432_014486 3300042006 Bacteria 2669
1027 Ga0439432_180811 3300042006 Bacteria 614
1028 Ga0439455_0013792 3300042012 Bacteria 1836
1029 Ga0439462_0013486 3300042015 Bacteria 2094
1030 Ga0439462_0049437 3300042015 Bacteria 1129
1031 Ga0439458_0000552 3300042157 Bacteria 9632
1032 Ga0439458_0000880 3300042157 Bacteria 7760
1033 Ga0439434_0003743 3300042435 Bacteria 4442
1034 Ga0439434_0029628 3300042435 Bacteria 1659
1035 Ga0439459_0100098 3300042438 Bacteria 708
1036 Ga0450901_001560 3300042533 Bacteria 2598
1037 Ga0466972_0125166 3300044658 Bacteria 1211
1038 Ga0466973_0180869 3300044659 Bacteria 1606
1039 Ga0466965_0030474 3300044683 Bacteria 2629
1040 Ga0466965_0303181 3300044683 Bacteria 867
1041 Ga0466961_0018777 3300044693 Bacteria 4448
1042 Ga0466963_0110777 3300044694 Bacteria 1884
1043 Ga0466963_0186825 3300044694 Bacteria 1447
1044 Ga0466964_0031179 3300044706 Bacteria 2113
1045 Ga0466970_0076683 3300044765 Bacteria 1801
1046 Ga0466970_0110556 3300044765 Bacteria 1500
1047 Ga0466957_0026451 3300044842 Bacteria 3442
1048 Ga0466958_0002060 3300045836 Bacteria 9938
1049 Ga0466958_0029469 3300045836 Bacteria 3257
1050 Ga0466967_0042363 3300045976 Bacteria 3933
1051 Ga0466967_0109550 3300045976 Bacteria 2535
1052 Ga0466967_0139487 3300045976 Bacteria 2257
1053 Ga0466967_1257094 3300045976 Bacteria 737
1054 Ga0495629_0182170 3300046459 Bacteria 1456
1055 Ga0495606_0066190 3300046507 Bacteria 2293
1056 Ga0495610_0044356 3300046512 Bacteria 2207
1057 Ga0495616_0105846 3300046513 Bacteria 1313
1058 Ga0495632_0251029 3300046519 Bacteria 793
1059 Ga0495643_0001671 3300046522 Bacteria 19427
1060 Ga0495663_0006580 3300046525 Bacteria 3207
1061 Ga0495663_0041459 3300046525 Bacteria 1400
1062 Ga0495663_0152258 3300046525 Bacteria 790
1063 Ga0495663_0215993 3300046525 Bacteria 673
1064 Ga0495642_0092479 3300046528 Bacteria 1281
1065 Ga0495598_0000546 3300046537 Bacteria 7021
1066 Ga0495609_0104816 3300046538 Bacteria 1223
1067 Ga0495621_0009087 3300046539 Bacteria 3005
1068 Ga0495621_0019849 3300046539 Bacteria 2199
1069 Ga0495633_0001102 3300046558 Bacteria 21787
1070 Ga0495633_0056991 3300046558 Bacteria 1836
1071 Ga0495668_0089733 3300046616 Unclassified 1684
1072 Ga0495659_0112788 3300046664 Bacteria 1063
1073 Ga0495669_0001409 3300046684 Bacteria 9893
1074 Ga0495669_0007632 3300046684 Bacteria 4539
1075 Ga0495669_0018746 3300046684 Bacteria 2978
1076 Ga0495669_0347194 3300046684 Bacteria 717
1077 Ga0495670_0050266 3300046691 Bacteria 2087
1078 Ga0495671_0022704 3300046692 Bacteria 3285
1079 Ga0495660_0031312 3300046810 Bacteria 2991
1080 Ga0495672_0130487 3300047320 Bacteria 1323
1081 Ga0495677_0274875 3300047445 Bacteria 660
1082 Ga0495673_0106654 3300047469 Bacteria 1125
1083 Ga0495686_0000182 3300047472 Bacteria 119682
1084 Ga0496100_0022766 3300048903 Bacteria 3795
1085 Ga0496100_0115292 3300048903 Bacteria 1873
1086 Ga0496100_0289007 3300048903 Bacteria 1224
1087 Ga0496100_0395209 3300048903 Bacteria 1052
1088 Ga0496101_0008931 3300048904 Bacteria 6568
1089 Ga0496101_0084589 3300048904 Bacteria 2349
1090 Ga0496101_0091546 3300048904 Bacteria 2263
1091 Ga0496101_0343853 3300048904 Bacteria 1172
1092 Ga0496102_0000117 3300048905 Bacteria 114037
1093 Ga0496102_0152576 3300048905 Bacteria 2171
1094 Ga0496102_0195888 3300048905 Bacteria 1904
1095 Ga0496103_0000076 3300048906 Bacteria 113209
1096 Ga0496103_0007977 3300048906 Bacteria 6288
1097 Ga0496103_0055727 3300048906 Bacteria 2452
1098 Ga0496104_0058968 3300048907 Bacteria 3634
1099 Ga0496104_0263078 3300048907 Bacteria 1637
1100 Ga0496105_0033490 3300048908 Bacteria 4219
1101 Ga0496105_0042309 3300048908 Bacteria 3755
1102 Ga0496106_0016091 3300048909 Bacteria 5531
1103 Ga0496106_0334335 3300048909 Bacteria 1216
1104 Ga0496106_0813755 3300048909 Bacteria 741
1105 Ga0496107_0024288 3300048910 Bacteria 4288
1106 Ga0496107_0026245 3300048910 Bacteria 4128
1107 Ga0496107_0128724 3300048910 Bacteria 1868
1108 Ga0496107_0176294 3300048910 Bacteria 1587
1109 Ga0496108_0000705 3300048911 Bacteria 25934
1110 Ga0496108_0000985 3300048911 Bacteria 22155
1111 Ga0496108_0003893 3300048911 Bacteria 11988
1112 Ga0496108_0019582 3300048911 Bacteria 5558
1113 Ga0496108_0022862 3300048911 Bacteria 5145
1114 Ga0496109_0008171 3300048912 Bacteria 8876
1115 Ga0496109_0052104 3300048912 Bacteria 3729
1116 Ga0496109_0105003 3300048912 Bacteria 2623
1117 Ga0496109_0263880 3300048912 Bacteria 1622
1118 Ga0496109_0289851 3300048912 Bacteria 1543
1119 Ga0496109_1474879 3300048912 Bacteria 615
1120 Ga0496110_0010169 3300048913 Bacteria 7643
1121 Ga0496110_0048100 3300048913 Bacteria 3738
1122 Ga0496110_0626004 3300048913 Bacteria 975
1123 Ga0496110_0754149 3300048913 Bacteria 877
1124 Ga0496110_0831396 3300048913 Bacteria 828
1125 Ga0496111_0136229 3300048914 Bacteria 1819
1126 Ga0496111_0183977 3300048914 Bacteria 1553
1127 Ga0496111_0258570 3300048914 Bacteria 1292
1128 Ga0496112_0006460 3300048915 Bacteria 10292
1129 Ga0496112_0021502 3300048915 Bacteria 6137
1130 Ga0496112_0027706 3300048915 Bacteria 5464
1131 Ga0496112_0055502 3300048915 Bacteria 3895
1132 Ga0496112_0064872 3300048915 Bacteria 3604
1133 Ga0496112_0085819 3300048915 Bacteria 3114
1134 Ga0496113_0022451 3300048916 Bacteria 4464
1135 Ga0496113_0026017 3300048916 Bacteria 4180
1136 Ga0496113_0047704 3300048916 Bacteria 3184
1137 Ga0496113_0293585 3300048916 Bacteria 1301
1138 Ga0496113_0348254 3300048916 Bacteria 1188
1139 Ga0496114_0018007 3300048917 Bacteria 5707
1140 Ga0496114_0050702 3300048917 Bacteria 3455
1141 Ga0496114_0086426 3300048917 Bacteria 2658
1142 Ga0496114_0475886 3300048917 Bacteria 1105
1143 Ga0496114_1264719 3300048917 Bacteria 624
1144 Ga0496115_0003443 3300048918 Bacteria 11369
1145 Ga0496115_1072005 3300048918 Bacteria 612
1146 Ga0496116_0000888 3300048919 Bacteria 37285
1147 Ga0496117_0000201 3300048920 Bacteria 117679
1148 Ga0496117_0010280 3300048920 Bacteria 8559
1149 Ga0496117_0045944 3300048920 Bacteria 3147
1150 Ga0496117_0149760 3300048920 Bacteria 1383
1151 Ga0496117_0295150 3300048920 Bacteria 861
1152 Ga0496118_0000097 3300048921 Bacteria 160837
1153 Ga0496118_0005641 3300048921 Bacteria 14116
1154 Ga0496118_0009455 3300048921 Bacteria 9842
1155 Ga0496118_0019696 3300048921 Bacteria 6020
1156 Ga0496118_0486632 3300048921 Bacteria 617
1157 Ga0496119_0403795 3300048922 Bacteria 651
1158 Ga0496120_0063048 3300048923 Bacteria 2064
1159 Ga0496120_0148060 3300048923 Bacteria 1183
1160 Ga0496120_0260189 3300048923 Bacteria 810
1161 Ga0496121_0000653 3300048924 Bacteria 64947
1162 Ga0496121_0002948 3300048924 Bacteria 24844
1163 Ga0496121_0007529 3300048924 Bacteria 13129
1164 Ga0496121_0012732 3300048924 Bacteria 9119
1165 Ga0496122_0003385 3300048925 Bacteria 20991
1166 Ga0496122_0009525 3300048925 Bacteria 10210
1167 Ga0496122_0041427 3300048925 Bacteria 3641
1168 Ga0496123_0002800 3300048926 Bacteria 20715
1169 Ga0496123_0010676 3300048926 Bacteria 8082
1170 Ga0496124_0000202 3300048927 Bacteria 117650
1171 Ga0496124_0042334 3300048927 Bacteria 3922
1172 Ga0496124_0390408 3300048927 Bacteria 970
1173 Ga0496125_0014951 3300048928 Bacteria 7537
1174 Ga0496125_0027074 3300048928 Bacteria 5206
1175 Ga0496125_0040851 3300048928 Bacteria 3973
1176 Ga0496125_0045544 3300048928 Bacteria 3690
1177 Ga0496125_0276631 3300048928 Bacteria 1043
1178 Ga0496126_0007544 3300048929 Bacteria 11904
1179 Ga0496126_0008100 3300048929 Bacteria 11382
1180 Ga0496126_0015817 3300048929 Bacteria 7577
1181 Ga0496126_0094403 3300048929 Bacteria 2625
1182 Ga0501031_0160281 3300049568 Bacteria 1471
1183 Ga0501037_0050525 3300049573 Bacteria 3043
1184 Ga0501039_0399841 3300049575 Bacteria 1079
1185 Ga0501043_0109819 3300049579 Bacteria 2166
1186 Ga0501043_0415977 3300049579 Bacteria 1014
1187 Ga0501043_0729779 3300049579 Bacteria 722
1188 Ga0501046_0086443 3300049580 Bacteria 2417
1189 Ga0501046_0256333 3300049580 Bacteria 1286
1190 Ga0501047_0013752 3300049581 Bacteria 7685
1191 Ga0501047_0022460 3300049581 Bacteria 6059
1192 Ga0501047_0025752 3300049581 Bacteria 5657
1193 Ga0501047_0813370 3300049581 Bacteria 749
1194 Ga0501048_0009955 3300049582 Bacteria 7119
1195 Ga0501048_0287105 3300049582 Bacteria 1170
1196 Ga0501070_0132733 3300049586 Bacteria 2057
1197 Ga0501070_0359785 3300049586 Bacteria 1181
1198 Ga0501070_0861822 3300049586 Bacteria 708
1199 Ga0501223_006239 3300049663 Bacteria 2472
1200 Ga0501236_030261 3300049670 Bacteria 853
1201 Ga0501247_008578 3300049677 Bacteria 1195
1202 Ga0501251_006845 3300049681 Bacteria 1252
1203 Ga0501257_046610 3300049686 Bacteria 1074
1204 Ga0501258_002636 3300049687 Bacteria 1591
1205 Ga0501221_017815 3300049704 Bacteria 1360
1206 Ga0501225_0068086 3300049705 Bacteria 1009
1207 Ga0501245_035368 3300049708 Bacteria 841
1208 Ga0501266_025108 3300049763 Bacteria 830
1209 Ga0501270_007045 3300049767 Bacteria 1376
1210 Ga0501273_003217 3300049770 Bacteria 1716
1211 Ga0501283_012549 3300049779 Bacteria 1275
1212 Ga0501035_0012722 3300049822 Bacteria 7777
1213 Ga0501035_0186745 3300049822 Bacteria 1784
1214 Ga0501035_0246744 3300049822 Bacteria 1517
1215 Ga0501044_0001772 3300049823 Bacteria 25250
1216 Ga0501044_0013636 3300049823 Bacteria 8784
1217 Ga0501044_0031326 3300049823 Bacteria 5598
1218 Ga0501044_0184924 3300049823 Bacteria 2049
1219 Ga0501044_0206794 3300049823 Bacteria 1919
1220 Ga0501044_0401571 3300049823 Bacteria 1283
1221 Ga0501044_0504775 3300049823 Bacteria 1110
1222 Ga0501212_051903 3300049851 Bacteria 696
1223 nmdc:mga03683_246554_c1 3300050489 Bacteria 829
1224 nmdc:mga03683_75981_c1 3300050489 Bacteria 1052
1225 nmdc:mga03n38_27796_c1 3300050490 Bacteria 2351
1226 nmdc:mga03n38_38757_c1 3300050490 Bacteria 2063
1227 nmdc:mga03n38_5866_c1 3300050490 Bacteria 4221
1228 nmdc:mga00v17_10690_c1 3300050491 Bacteria 5023
1229 nmdc:mga00v17_711155_c1 3300050491 Bacteria 643
1230 nmdc:mga00v17_7667_c1 3300050491 Bacteria 5773
1231 nmdc:mga0yw44_13680_c1 3300050492 Bacteria 4281
1232 nmdc:mga06z11_202281_c1 3300050494 Bacteria 1154
1233 nmdc:mga07m45_15784_c1 3300050496 Bacteria 4036
1234 nmdc:mga07m45_1959_c1 3300050496 Bacteria 9525
1235 nmdc:mga07m45_73853_c1 3300050496 Bacteria 1942
1236 nmdc:mga06r32_4438_c1 3300050510 Bacteria 12558
1237 nmdc:mga0n895_834482_c1 3300050512 Bacteria 910
1238 nmdc:mga0sz30_16968_c1 3300050516 Bacteria 2898
1239 Ga0500643_000344 3300053087 Bacteria 36909
1240 Ga0500646_0014909 3300053090 Bacteria 2020
1241 Ga0500566_0105181 3300053094 Bacteria 1542
1242 Ga0500562_039263 3300053108 Bacteria 1258
1243 Ga0500594_0019464 3300053118 Bacteria 1683
1244 Ga0500595_000982 3300053119 Bacteria 16008
1245 Ga0500608_251959 3300053122 Bacteria 688
1246 Ga0500559_0033443 3300053136 Bacteria 2213
1247 Ga0500564_083228 3300053138 Bacteria 1432
1248 Ga0500568_0002995 3300053139 Bacteria 9664
1249 Ga0500573_0488750 3300053140 Bacteria 559
1250 Ga0500604_0000019 3300053151 Bacteria 78330
1251 Ga0500604_0086357 3300053151 Bacteria 1020
1252 Ga0500616_0000326 3300053153 Bacteria 68250
1253 Ga0500645_004012 3300053730 Bacteria 5787
1254 Ga0500645_095271 3300053730 Bacteria 842
1255 Ga0500661_000385 3300055283 Bacteria 8135
1256 Ga0466962_0038278 3300061719 Bacteria 2297
1257 Ga0466962_0047216 3300061719 Bacteria 2058

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0092479 Ga0495642_0092479_155_562 128
2 3300005334 Ga0068869_100488599 Ga0068869_1004885992 130
3 3300005355 Ga0070671_100028992 Ga0070671_1000289923 130
4 3300005367 Ga0070667_100024677 Ga0070667_1000246774 130
5 3300005543 Ga0070672_100132471 Ga0070672_1001324712 130
6 3300005617 Ga0068859_100001678 Ga0068859_10000167828 130
7 3300005618 Ga0068864_100033972 Ga0068864_1000339723 130
8 3300005841 Ga0068863_100001789 Ga0068863_10000178911 130
9 3300005842 Ga0068858_100017501 Ga0068858_1000175014 130
10 3300005843 Ga0068860_100073854 Ga0068860_1000738543 130
11 3300005844 Ga0068862_100149154 Ga0068862_1001491541 130
12 3300006931 Ga0097620_100001678 Ga0097620_10000167828 130
13 3300009101 Ga0105247_10093529 Ga0105247_100935292 130
14 3300009177 Ga0105248_10001135 Ga0105248_1000113538 130
15 3300009553 Ga0105249_10024852 Ga0105249_100248521 130
16 3300011119 Ga0105246_10167619 Ga0105246_101676192 130
17 3300013306 Ga0163162_10048924 Ga0163162_100489245 130
18 3300013308 Ga0157375_10050187 Ga0157375_100501872 130
19 3300014325 Ga0163163_10000735 Ga0163163_100007358 130
20 3300014968 Ga0157379_10033972 Ga0157379_100339723 130
21 3300021388 Ga0213875_10001474 Ga0213875_100014743 130
22 3300025923 Ga0207681_10086255 Ga0207681_100862552 130
23 3300025926 Ga0207659_11008251 Ga0207659_110082511 130
24 3300025931 Ga0207644_10025748 Ga0207644_100257483 130
25 3300025941 Ga0207711_10000213 Ga0207711_1000021332 130
26 3300025942 Ga0207689_10224969 Ga0207689_102249692 130
27 3300025961 Ga0207712_10069565 Ga0207712_100695654 130
28 3300025986 Ga0207658_10042624 Ga0207658_100426243 130
29 3300026035 Ga0207703_10007879 Ga0207703_100078799 130
30 3300026088 Ga0207641_10001671 Ga0207641_100016715 130
31 3300028380 Ga0268265_10123408 Ga0268265_101234082 130
32 3300028381 Ga0268264_10002330 Ga0268264_1000233020 130
33 3300037853 Ga0436364_0573660 Ga0436364_0573660_24647_25114 130
34 3300048912 Ga0496109_1474879 Ga0496109_1474879_77_556 130
35 3300005563 Ga0068855_101816726 Ga0068855_1018167261 133
36 3300031665 Ga0316575_10041092 Ga0316575_100410922 142
37 3300031665 Ga0316575_10118095 Ga0316575_101180952 142
38 3300009148 Ga0105243_11308812 Ga0105243_113088122 143
39 3300031852 Ga0307410_10729337 Ga0307410_107293371 144
40 3300031995 Ga0307409_101509883 Ga0307409_1015098831 144
41 3300037312 Ga0395899_0053593 Ga0395899_0053593_1084_1533 144
42 3300037418 Ga0395900_0099196 Ga0395900_0099196_1599_2048 144
43 3300037466 Ga0395898_0343757 Ga0395898_0343757_232_681 144
44 3300037471 Ga0395905_0002453 Ga0395905_0002453_14467_14916 144
45 3300038443 Ga0395901_0113436 Ga0395901_0113436_1149_1598 144
46 3300025986 Ga0207658_10871766 Ga0207658_108717661 145
47 3300048911 Ga0496108_0000705 Ga0496108_0000705_8129_8593 145
48 3300048912 Ga0496109_0289851 Ga0496109_0289851_687_1142 145
49 3300048915 Ga0496112_0085819 Ga0496112_0085819_1973_2428 145
50 3300032004 Ga0307414_10854583 Ga0307414_108545831 146
51 3300009177 Ga0105248_10013617 Ga0105248_100136177 147
52 3300025941 Ga0207711_10009722 Ga0207711_100097226 147
53 3300013104 Ga0157370_10038162 Ga0157370_100381623 148
54 3300021384 Ga0213876_10397966 Ga0213876_103979661 148
55 3300032004 Ga0307414_10150168 Ga0307414_101501681 148
56 3300037312 Ga0395899_0666971 Ga0395899_0666971_19_483 148
57 3300037418 Ga0395900_0394405 Ga0395900_0394405_464_928 148
58 3300037466 Ga0395898_0061817 Ga0395898_0061817_1647_2111 148
59 3300037466 Ga0395898_1871610 Ga0395898_1871610_23_487 148
60 3300037471 Ga0395905_0125575 Ga0395905_0125575_38_502 148
61 3300038443 Ga0395901_0062881 Ga0395901_0062881_173_637 148
62 3300039437 Ga0436365_1032337 Ga0436365_1032337_744_1232 148
63 3300042533 Ga0450901_001560 Ga0450901_001560_1615_2202 148
64 3300046525 Ga0495663_0006580 Ga0495663_0006580_1191_1778 149
65 3300046525 Ga0495663_0152258 Ga0495663_0152258_118_600 149
66 3300046558 Ga0495633_0001102 Ga0495633_0001102_12653_13240 149
67 3300005367 Ga0070667_100056794 Ga0070667_1000567942 150
68 3300005841 Ga0068863_100142731 Ga0068863_1001427312 150
69 3300005843 Ga0068860_100133052 Ga0068860_1001330523 150
70 3300006881 Ga0068865_100869559 Ga0068865_1008695592 150
71 3300009177 Ga0105248_10045891 Ga0105248_100458915 150
72 3300010375 Ga0105239_10017189 Ga0105239_100171895 150
73 3300012512 Ga0157327_1027075 Ga0157327_10270752 150
74 3300014968 Ga0157379_10163975 Ga0157379_101639753 150
75 3300017792 Ga0163161_11640777 Ga0163161_116407771 150
76 3300025931 Ga0207644_10100612 Ga0207644_101006124 150
77 3300025941 Ga0207711_10250254 Ga0207711_102502542 150
78 3300025986 Ga0207658_10052927 Ga0207658_100529273 150
79 3300026035 Ga0207703_10454728 Ga0207703_104547281 150
80 3300026088 Ga0207641_10235524 Ga0207641_102355243 150
81 3300028381 Ga0268264_10696052 Ga0268264_106960522 150
82 3300041494 Ga0451837_1770621 Ga0451837_1770621_414_890 150
83 3300041507 Ga0451851_0640169 Ga0451851_0640169_138_614 150
84 3300049573 Ga0501037_0050525 Ga0501037_0050525_2379_2879 150
85 3300049580 Ga0501046_0086443 Ga0501046_0086443_933_1433 150
86 3300049581 Ga0501047_0013752 Ga0501047_0013752_4586_5086 150
87 3300049582 Ga0501048_0287105 Ga0501048_0287105_214_714 150
88 3300049822 Ga0501035_0012722 Ga0501035_0012722_885_1385 150
89 3300049823 Ga0501044_0001772 Ga0501044_0001772_17402_17920 150
90 3300049823 Ga0501044_0013636 Ga0501044_0013636_3246_3746 150
91 3300005328 Ga0070676_10011298 Ga0070676_100112983 151
92 3300005331 Ga0070670_100045415 Ga0070670_1000454154 151
93 3300005331 Ga0070670_100111471 Ga0070670_1001114712 151
94 3300005333 Ga0070677_10352652 Ga0070677_103526521 151
95 3300005334 Ga0068869_100021878 Ga0068869_1000218783 151
96 3300005335 Ga0070666_10095325 Ga0070666_100953252 151
97 3300005344 Ga0070661_100023674 Ga0070661_1000236741 151
98 3300005354 Ga0070675_100023824 Ga0070675_1000238243 151
99 3300005355 Ga0070671_100036486 Ga0070671_1000364862 151
100 3300005355 Ga0070671_100060503 Ga0070671_1000605032 151
101 3300005364 Ga0070673_100072159 Ga0070673_1000721592 151
102 3300005367 Ga0070667_100004075 Ga0070667_10000407514 151
103 3300005456 Ga0070678_100072857 Ga0070678_1000728572 151
104 3300005457 Ga0070662_100028671 Ga0070662_1000286714 151
105 3300005459 Ga0068867_100025838 Ga0068867_1000258382 151
106 3300005543 Ga0070672_100008727 Ga0070672_1000087274 151
107 3300005840 Ga0068870_10286384 Ga0068870_102863841 151
108 3300005842 Ga0068858_100025301 Ga0068858_1000253012 151
109 3300006177 Ga0075362_10219519 Ga0075362_102195192 151
110 3300006358 Ga0068871_100267735 Ga0068871_1002677352 151
111 3300009148 Ga0105243_10614675 Ga0105243_106146752 151
112 3300011119 Ga0105246_10564961 Ga0105246_105649612 151
113 3300013306 Ga0163162_10354901 Ga0163162_103549013 151
114 3300025893 Ga0207682_10175830 Ga0207682_101758302 151
115 3300025907 Ga0207645_10011301 Ga0207645_100113014 151
116 3300025908 Ga0207643_10176500 Ga0207643_101765002 151
117 3300025910 Ga0207684_10229215 Ga0207684_102292152 151
118 3300025925 Ga0207650_10093915 Ga0207650_100939152 151
119 3300025927 Ga0207687_10319992 Ga0207687_103199922 151
120 3300025931 Ga0207644_10020392 Ga0207644_100203923 151
121 3300025933 Ga0207706_10148580 Ga0207706_101485802 151
122 3300025935 Ga0207709_10216527 Ga0207709_102165273 151
123 3300025940 Ga0207691_10014585 Ga0207691_100145855 151
124 3300025942 Ga0207689_10014830 Ga0207689_100148302 151
125 3300025960 Ga0207651_10103333 Ga0207651_101033333 151
126 3300026023 Ga0207677_10089940 Ga0207677_100899402 151
127 3300026089 Ga0207648_10003099 Ga0207648_1000309916 151
128 3300026116 Ga0207674_10022831 Ga0207674_100228312 151
129 3300031548 Ga0307408_100166502 Ga0307408_1001665022 151
130 3300031911 Ga0307412_11035785 Ga0307412_110357852 151
131 3300031911 Ga0307412_11220032 Ga0307412_112200321 151
132 3300031995 Ga0307409_100188235 Ga0307409_1001882352 151
133 3300032005 Ga0307411_10172271 Ga0307411_101722712 151
134 3300032005 Ga0307411_10799315 Ga0307411_107993152 151
135 3300037471 Ga0395905_0151334 Ga0395905_0151334_517_1014 151
136 3300038735 Ga0400485_15347 Ga0400485_15347_584_1078 151
137 3300038742 Ga0400486_14570 Ga0400486_14570_1585_2079 151
138 3300039062 Ga0400483_149157 Ga0400483_149157_834_1328 151
139 3300039110 Ga0400487_00860 Ga0400487_00860_790_1284 151
140 3300005334 Ga0068869_101008646 Ga0068869_1010086461 152
141 3300005337 Ga0070682_100247521 Ga0070682_1002475212 152
142 3300005340 Ga0070689_100093745 Ga0070689_1000937451 152
143 3300005355 Ga0070671_100052812 Ga0070671_1000528122 152
144 3300005355 Ga0070671_100176806 Ga0070671_1001768062 152
145 3300005364 Ga0070673_100058751 Ga0070673_1000587512 152
146 3300005364 Ga0070673_100115706 Ga0070673_1001157062 152
147 3300005365 Ga0070688_100032323 Ga0070688_1000323233 152
148 3300005366 Ga0070659_100775711 Ga0070659_1007757111 152
149 3300005456 Ga0070678_100065082 Ga0070678_1000650822 152
150 3300005543 Ga0070672_100001762 Ga0070672_10000176213 152
151 3300005548 Ga0070665_100973127 Ga0070665_1009731271 152
152 3300005564 Ga0070664_100165089 Ga0070664_1001650892 152
153 3300005614 Ga0068856_100090552 Ga0068856_1000905522 152
154 3300005616 Ga0068852_100196011 Ga0068852_1001960111 152
155 3300005617 Ga0068859_100272780 Ga0068859_1002727803 152
156 3300005618 Ga0068864_101186866 Ga0068864_1011868662 152
157 3300005618 Ga0068864_102077298 Ga0068864_1020772981 152
158 3300005718 Ga0068866_10637535 Ga0068866_106375351 152
159 3300005834 Ga0068851_10259166 Ga0068851_102591662 152
160 3300005841 Ga0068863_100101539 Ga0068863_1001015394 152
161 3300005843 Ga0068860_100648324 Ga0068860_1006483242 152
162 3300006178 Ga0075367_10449147 Ga0075367_104491472 152
163 3300006237 Ga0097621_100041405 Ga0097621_1000414052 152
164 3300006358 Ga0068871_100074530 Ga0068871_1000745302 152
165 3300006358 Ga0068871_100341964 Ga0068871_1003419641 152
166 3300006881 Ga0068865_100128532 Ga0068865_1001285323 152
167 3300006931 Ga0097620_100272767 Ga0097620_1002727673 152
168 3300009101 Ga0105247_10009579 Ga0105247_100095793 152
169 3300009176 Ga0105242_10045447 Ga0105242_100454474 152
170 3300009176 Ga0105242_10344781 Ga0105242_103447813 152
171 3300009177 Ga0105248_10001858 Ga0105248_100018582 152
172 3300009177 Ga0105248_10002177 Ga0105248_100021772 152
173 3300009177 Ga0105248_10086322 Ga0105248_100863223 152
174 3300009177 Ga0105248_10246945 Ga0105248_102469454 152
175 3300010375 Ga0105239_10095905 Ga0105239_100959052 152
176 3300013102 Ga0157371_11211259 Ga0157371_112112591 152
177 3300013296 Ga0157374_10248580 Ga0157374_102485802 152
178 3300013297 Ga0157378_10007678 Ga0157378_100076789 152
179 3300013306 Ga0163162_10032172 Ga0163162_100321724 152
180 3300013308 Ga0157375_10003420 Ga0157375_100034205 152
181 3300013308 Ga0157375_10071907 Ga0157375_100719072 152
182 3300014325 Ga0163163_10120808 Ga0163163_101208082 152
183 3300014325 Ga0163163_10428919 Ga0163163_104289192 152
184 3300014968 Ga0157379_10009693 Ga0157379_100096936 152
185 3300014969 Ga0157376_10002084 Ga0157376_100020849 152
186 3300017792 Ga0163161_10184307 Ga0163161_101843072 152
187 3300025321 Ga0207656_10317901 Ga0207656_103179012 152
188 3300025899 Ga0207642_10209355 Ga0207642_102093551 152
189 3300025900 Ga0207710_10010921 Ga0207710_100109214 152
190 3300025903 Ga0207680_10092556 Ga0207680_100925562 152
191 3300025931 Ga0207644_10024684 Ga0207644_100246842 152
192 3300025931 Ga0207644_10155191 Ga0207644_101551912 152
193 3300025932 Ga0207690_11326538 Ga0207690_113265381 152
194 3300025933 Ga0207706_10003754 Ga0207706_100037549 152
195 3300025936 Ga0207670_10023027 Ga0207670_100230272 152
196 3300025940 Ga0207691_10004627 Ga0207691_1000462713 152
197 3300025941 Ga0207711_10019391 Ga0207711_100193915 152
198 3300025941 Ga0207711_10118847 Ga0207711_101188472 152
199 3300025941 Ga0207711_10178295 Ga0207711_101782953 152
200 3300025941 Ga0207711_10419190 Ga0207711_104191902 152
201 3300025960 Ga0207651_10063361 Ga0207651_100633612 152
202 3300025960 Ga0207651_10630931 Ga0207651_106309312 152
203 3300025981 Ga0207640_10110205 Ga0207640_101102052 152
204 3300025986 Ga0207658_10173497 Ga0207658_101734972 152
205 3300026035 Ga0207703_10078469 Ga0207703_100784691 152
206 3300026078 Ga0207702_10123094 Ga0207702_101230942 152
207 3300026088 Ga0207641_10723221 Ga0207641_107232212 152
208 3300026089 Ga0207648_10086225 Ga0207648_100862252 152
209 3300026095 Ga0207676_10016381 Ga0207676_100163814 152
210 3300026121 Ga0207683_10060218 Ga0207683_100602183 152
211 3300026142 Ga0207698_10124100 Ga0207698_101241001 152
212 3300028381 Ga0268264_10683531 Ga0268264_106835312 152
213 3300032004 Ga0307414_10850819 Ga0307414_108508192 152
214 3300037312 Ga0395899_0421867 Ga0395899_0421867_233_712 152
215 3300037418 Ga0395900_0020285 Ga0395900_0020285_2116_2595 152
216 3300037466 Ga0395898_0564529 Ga0395898_0564529_194_673 152
217 3300037471 Ga0395905_0148872 Ga0395905_0148872_925_1404 152
218 3300038443 Ga0395901_0604472 Ga0395901_0604472_404_883 152
219 3300041404 Ga0439436_0176419 Ga0439436_0176419_94_585 152
220 3300041406 Ga0439439_0015483 Ga0439439_0015483_85_576 152
221 3300041410 Ga0439461_0000162 Ga0439461_0000162_60_542 152
222 3300041413 Ga0439465_0023867 Ga0439465_0023867_1370_1852 152
223 3300041997 Ga0439431_0000167 Ga0439431_0000167_2854_3336 152
224 3300041999 Ga0439433_0127773 Ga0439433_0127773_62_553 152
225 3300042002 Ga0439442_013243 Ga0439442_013243_119_601 152
226 3300042002 Ga0439442_026192 Ga0439442_026192_658_1149 152
227 3300042004 Ga0439445_0001476 Ga0439445_0001476_4575_5057 152
228 3300042004 Ga0439445_0047881 Ga0439445_0047881_30_512 152
229 3300042006 Ga0439432_014486 Ga0439432_014486_1137_1616 152
230 3300042015 Ga0439462_0013486 Ga0439462_0013486_1099_1581 152
231 3300042015 Ga0439462_0049437 Ga0439462_0049437_622_1113 152
232 3300042435 Ga0439434_0003743 Ga0439434_0003743_1886_2377 152
233 3300042435 Ga0439434_0029628 Ga0439434_0029628_1111_1593 152
234 3300044659 Ga0466973_0180869 Ga0466973_0180869_87_572 152
235 3300046519 Ga0495632_0251029 Ga0495632_0251029_211_711 152
236 3300046522 Ga0495643_0001671 Ga0495643_0001671_17634_18134 152
237 3300046684 Ga0495669_0347194 Ga0495669_0347194_28_513 152
238 3300046810 Ga0495660_0031312 Ga0495660_0031312_587_1084 152
239 3300048903 Ga0496100_0022766 Ga0496100_0022766_2836_3333 152
240 3300048903 Ga0496100_0289007 Ga0496100_0289007_389_892 152
241 3300048904 Ga0496101_0008931 Ga0496101_0008931_1476_1979 152
242 3300048904 Ga0496101_0084589 Ga0496101_0084589_223_720 152
243 3300048906 Ga0496103_0055727 Ga0496103_0055727_173_670 152
244 3300048907 Ga0496104_0263078 Ga0496104_0263078_630_1127 152
245 3300048908 Ga0496105_0033490 Ga0496105_0033490_553_1050 152
246 3300048909 Ga0496106_0016091 Ga0496106_0016091_36_533 152
247 3300048910 Ga0496107_0026245 Ga0496107_0026245_3357_3854 152
248 3300048910 Ga0496107_0128724 Ga0496107_0128724_483_986 152
249 3300048911 Ga0496108_0019582 Ga0496108_0019582_4206_4709 152
250 3300048912 Ga0496109_0105003 Ga0496109_0105003_1851_2354 152
251 3300048914 Ga0496111_0136229 Ga0496111_0136229_1083_1580 152
252 3300048914 Ga0496111_0183977 Ga0496111_0183977_455_958 152
253 3300048915 Ga0496112_0021502 Ga0496112_0021502_1088_1591 152
254 3300048915 Ga0496112_0055502 Ga0496112_0055502_1245_1742 152
255 3300048916 Ga0496113_0022451 Ga0496113_0022451_84_587 152
256 3300048917 Ga0496114_0018007 Ga0496114_0018007_5059_5556 152
257 3300048917 Ga0496114_1264719 Ga0496114_1264719_10_513 152
258 3300048918 Ga0496115_0003443 Ga0496115_0003443_5860_6357 152
259 3300049579 Ga0501043_0729779 Ga0501043_0729779_85_567 152
260 3300049580 Ga0501046_0256333 Ga0501046_0256333_144_635 152
261 3300049581 Ga0501047_0022460 Ga0501047_0022460_1566_2048 152
262 3300049581 Ga0501047_0813370 Ga0501047_0813370_202_708 152
263 3300049582 Ga0501048_0009955 Ga0501048_0009955_2196_2681 152
264 3300049822 Ga0501035_0246744 Ga0501035_0246744_204_686 152
265 3300049823 Ga0501044_0031326 Ga0501044_0031326_3036_3518 152
266 3300001989 JGI24739J22299_10012467 JGI24739J22299_100124673 153
267 3300001989 JGI24739J22299_10024891 JGI24739J22299_100248911 153
268 3300001989 JGI24739J22299_10066291 JGI24739J22299_100662912 153
269 3300001990 JGI24737J22298_10031012 JGI24737J22298_100310122 153
270 3300002067 JGI24735J21928_10001784 JGI24735J21928_100017848 153
271 3300002075 JGI24738J21930_10006206 JGI24738J21930_100062062 153
272 3300005327 Ga0070658_10001316 Ga0070658_1000131611 153
273 3300005327 Ga0070658_10010571 Ga0070658_100105715 153
274 3300005327 Ga0070658_10039548 Ga0070658_100395482 153
275 3300005335 Ga0070666_10498358 Ga0070666_104983582 153
276 3300005339 Ga0070660_100001368 Ga0070660_1000013687 153
277 3300005339 Ga0070660_100244229 Ga0070660_1002442292 153
278 3300005347 Ga0070668_100627145 Ga0070668_1006271452 153
279 3300005353 Ga0070669_100387236 Ga0070669_1003872361 153
280 3300005354 Ga0070675_100060702 Ga0070675_1000607026 153
281 3300005355 Ga0070671_100182109 Ga0070671_1001821092 153
282 3300005356 Ga0070674_100020697 Ga0070674_1000206971 153
283 3300005364 Ga0070673_100087585 Ga0070673_1000875851 153
284 3300005364 Ga0070673_100492952 Ga0070673_1004929522 153
285 3300005434 Ga0070709_10026535 Ga0070709_100265353 153
286 3300005438 Ga0070701_10013555 Ga0070701_100135554 153
287 3300005439 Ga0070711_100003621 Ga0070711_1000036214 153
288 3300005440 Ga0070705_100003490 Ga0070705_1000034902 153
289 3300005444 Ga0070694_100014135 Ga0070694_1000141353 153
290 3300005455 Ga0070663_100132792 Ga0070663_1001327922 153
291 3300005457 Ga0070662_100120089 Ga0070662_1001200892 153
292 3300005457 Ga0070662_100884718 Ga0070662_1008847181 153
293 3300005459 Ga0068867_100007257 Ga0068867_1000072574 153
294 3300005543 Ga0070672_100024329 Ga0070672_1000243293 153
295 3300005546 Ga0070696_100023358 Ga0070696_1000233582 153
296 3300005547 Ga0070693_100027629 Ga0070693_1000276292 153
297 3300005548 Ga0070665_100035049 Ga0070665_1000350493 153
298 3300005548 Ga0070665_100787702 Ga0070665_1007877023 153
299 3300005549 Ga0070704_100013287 Ga0070704_1000132876 153
300 3300005563 Ga0068855_100119253 Ga0068855_1001192532 153
301 3300005564 Ga0070664_100842739 Ga0070664_1008427392 153
302 3300005577 Ga0068857_101029996 Ga0068857_1010299962 153
303 3300005578 Ga0068854_100012241 Ga0068854_1000122414 153
304 3300005578 Ga0068854_100025506 Ga0068854_1000255064 153
305 3300005614 Ga0068856_100002198 Ga0068856_10000219813 153
306 3300005615 Ga0070702_100032280 Ga0070702_1000322802 153
307 3300005616 Ga0068852_100041077 Ga0068852_1000410773 153
308 3300005841 Ga0068863_100146849 Ga0068863_1001468492 153
309 3300006173 Ga0070716_100002180 Ga0070716_1000021804 153
310 3300006237 Ga0097621_100057175 Ga0097621_1000571751 153
311 3300006358 Ga0068871_100063673 Ga0068871_1000636732 153
312 3300006847 Ga0075431_100004203 Ga0075431_1000042037 153
313 3300006881 Ga0068865_100062537 Ga0068865_1000625372 153
314 3300009093 Ga0105240_10128515 Ga0105240_101285151 153
315 3300009174 Ga0105241_10028104 Ga0105241_100281042 153
316 3300009551 Ga0105238_10233778 Ga0105238_102337782 153
317 3300010375 Ga0105239_10074325 Ga0105239_100743252 153
318 3300010375 Ga0105239_10249028 Ga0105239_102490282 153
319 3300013104 Ga0157370_10000056 Ga0157370_1000005651 153
320 3300013105 Ga0157369_10063582 Ga0157369_100635824 153
321 3300013105 Ga0157369_10175007 Ga0157369_101750072 153
322 3300013105 Ga0157369_10220875 Ga0157369_102208751 153
323 3300013307 Ga0157372_10271833 Ga0157372_102718332 153
324 3300013307 Ga0157372_10322879 Ga0157372_103228792 153
325 3300013307 Ga0157372_10938682 Ga0157372_109386822 153
326 3300013308 Ga0157375_10932143 Ga0157375_109321432 153
327 3300014968 Ga0157379_10145121 Ga0157379_101451213 153
328 3300014969 Ga0157376_10053358 Ga0157376_100533582 153
329 3300017792 Ga0163161_10090171 Ga0163161_100901713 153
330 3300021388 Ga0213875_10027244 Ga0213875_100272441 153
331 3300025231 Ga0207427_100760 Ga0207427_10076015 153
332 3300025261 Ga0209233_1000078 Ga0209233_1000078199 153
333 3300025315 Ga0207697_10238850 Ga0207697_102388502 153
334 3300025898 Ga0207692_10007894 Ga0207692_100078944 153
335 3300025904 Ga0207647_10030433 Ga0207647_100304333 153
336 3300025907 Ga0207645_10093709 Ga0207645_100937093 153
337 3300025909 Ga0207705_10000369 Ga0207705_1000036932 153
338 3300025909 Ga0207705_10036930 Ga0207705_100369302 153
339 3300025911 Ga0207654_10068264 Ga0207654_100682642 153
340 3300025913 Ga0207695_10558910 Ga0207695_105589102 153
341 3300025915 Ga0207693_10003860 Ga0207693_1000386010 153
342 3300025916 Ga0207663_10011821 Ga0207663_100118212 153
343 3300025919 Ga0207657_10000755 Ga0207657_1000075513 153
344 3300025919 Ga0207657_10291024 Ga0207657_102910241 153
345 3300025924 Ga0207694_10183450 Ga0207694_101834502 153
346 3300025924 Ga0207694_10342238 Ga0207694_103422382 153
347 3300025932 Ga0207690_10167353 Ga0207690_101673532 153
348 3300025932 Ga0207690_10272549 Ga0207690_102725492 153
349 3300025933 Ga0207706_10009768 Ga0207706_100097684 153
350 3300025933 Ga0207706_10037556 Ga0207706_100375563 153
351 3300025938 Ga0207704_10137918 Ga0207704_101379181 153
352 3300025939 Ga0207665_10004201 Ga0207665_1000420111 153
353 3300025940 Ga0207691_10030464 Ga0207691_100304642 153
354 3300025949 Ga0207667_10096934 Ga0207667_100969342 153
355 3300025949 Ga0207667_10204948 Ga0207667_102049482 153
356 3300025960 Ga0207651_10473840 Ga0207651_104738401 153
357 3300025961 Ga0207712_10174029 Ga0207712_101740292 153
358 3300025972 Ga0207668_11035421 Ga0207668_110354211 153
359 3300025981 Ga0207640_10000784 Ga0207640_100007844 153
360 3300026041 Ga0207639_10018109 Ga0207639_100181094 153
361 3300026067 Ga0207678_10008908 Ga0207678_100089086 153
362 3300026067 Ga0207678_10013112 Ga0207678_100131123 153
363 3300026075 Ga0207708_10033599 Ga0207708_100335992 153
364 3300026078 Ga0207702_10006476 Ga0207702_1000647610 153
365 3300026078 Ga0207702_10057700 Ga0207702_100577004 153
366 3300026089 Ga0207648_10018534 Ga0207648_100185343 153
367 3300026116 Ga0207674_10038491 Ga0207674_100384913 153
368 3300026118 Ga0207675_100008522 Ga0207675_1000085224 153
369 3300026142 Ga0207698_10003134 Ga0207698_100031342 153
370 3300028379 Ga0268266_10014267 Ga0268266_100142674 153
371 3300028381 Ga0268264_10278629 Ga0268264_102786291 153
372 3300031249 Ga0265339_10428626 Ga0265339_104286261 153
373 3300035092 Ga0373952_0231743 Ga0373952_0231743_44_538 153
374 3300035112 Ga0373932_0086026 Ga0373932_0086026_25_507 153
375 3300035691 Ga0373931_0130419 Ga0373931_0130419_258_770 153
376 3300035691 Ga0373931_0252374 Ga0373931_0252374_167_655 153
377 3300037312 Ga0395899_0009159 Ga0395899_0009159_2969_3457 153
378 3300037312 Ga0395899_0085920 Ga0395899_0085920_1343_1822 153
379 3300037418 Ga0395900_0048515 Ga0395900_0048515_1496_1984 153
380 3300037853 Ga0436364_0767650 Ga0436364_0767650_14869_15354 153
381 3300042005 Ga0439448_0008105 Ga0439448_0008105_689_1177 153
382 3300042012 Ga0439455_0013792 Ga0439455_0013792_561_1049 153
383 3300042157 Ga0439458_0000552 Ga0439458_0000552_4408_4896 153
384 3300044683 Ga0466965_0030474 Ga0466965_0030474_39_545 153
385 3300044693 Ga0466961_0018777 Ga0466961_0018777_2176_2718 153
386 3300044765 Ga0466970_0076683 Ga0466970_0076683_167_709 153
387 3300045836 Ga0466958_0029469 Ga0466958_0029469_163_669 153
388 3300046513 Ga0495616_0105846 Ga0495616_0105846_185_706 153
389 3300046684 Ga0495669_0007632 Ga0495669_0007632_2916_3410 153
390 3300046692 Ga0495671_0022704 Ga0495671_0022704_2083_2580 153
391 3300048903 Ga0496100_0115292 Ga0496100_0115292_1317_1829 153
392 3300048904 Ga0496101_0091546 Ga0496101_0091546_1502_2014 153
393 3300048909 Ga0496106_0334335 Ga0496106_0334335_452_964 153
394 3300048912 Ga0496109_0263880 Ga0496109_0263880_171_650 153
395 3300048913 Ga0496110_0626004 Ga0496110_0626004_146_625 153
396 3300048917 Ga0496114_0086426 Ga0496114_0086426_1759_2271 153
397 3300048921 Ga0496118_0486632 Ga0496118_0486632_70_579 153
398 3300048924 Ga0496121_0007529 Ga0496121_0007529_7031_7540 153
399 3300048925 Ga0496122_0009525 Ga0496122_0009525_9632_10141 153
400 3300048926 Ga0496123_0010676 Ga0496123_0010676_673_1182 153
401 3300048927 Ga0496124_0390408 Ga0496124_0390408_133_642 153
402 3300050510 nmdc:mga06r32_4438_c1 nmdc:mga06r32_4438_c1_2154_2654 153
403 3300053118 Ga0500594_0019464 Ga0500594_0019464_416_913 153
404 3300061719 Ga0466962_0047216 Ga0466962_0047216_1479_2021 153
405 iso_pu_bacteria 2547132130 2547502147 153
406 iso_pu_bacteria 2816332141 2816519278 153
407 iso_pu_bacteria 2842391507 2842392504 153
408 iso_pu_bacteria 2842757796 2842761393 153
409 iso_pu_bacteria 2874220319 2874224359 153
410 iso_pu_bacteria 2919089067 2919091959 153
411 iso_pu_bacteria 2928496128 2928499504 153
412 iso_pu_bacteria 2931380184 2931382237 153
413 iso_pu_bacteria 2939626828 2939630309 153
414 iso_pu_bacteria 2961047084 2961051123 153
415 iso_pu_bacteria 2961064222 2961065422 153
416 iso_pu_bacteria 2987605356 2987605685 153
417 3300001990 JGI24737J22298_10021246 JGI24737J22298_100212463 154
418 3300005290 Ga0065712_10190763 Ga0065712_101907631 154
419 3300005293 Ga0065715_10237984 Ga0065715_102379842 154
420 3300005327 Ga0070658_10557770 Ga0070658_105577701 154
421 3300005327 Ga0070658_10736055 Ga0070658_107360552 154
422 3300005328 Ga0070676_10213623 Ga0070676_102136232 154
423 3300005329 Ga0070683_100128848 Ga0070683_1001288482 154
424 3300005331 Ga0070670_100078244 Ga0070670_1000782442 154
425 3300005334 Ga0068869_100137392 Ga0068869_1001373922 154
426 3300005335 Ga0070666_10584689 Ga0070666_105846891 154
427 3300005336 Ga0070680_100002339 Ga0070680_10000233918 154
428 3300005336 Ga0070680_100025151 Ga0070680_1000251513 154
429 3300005336 Ga0070680_100068148 Ga0070680_1000681483 154
430 3300005336 Ga0070680_100289392 Ga0070680_1002893922 154
431 3300005338 Ga0068868_100077537 Ga0068868_1000775374 154
432 3300005339 Ga0070660_100000810 Ga0070660_10000081023 154
433 3300005339 Ga0070660_100508420 Ga0070660_1005084202 154
434 3300005344 Ga0070661_100147868 Ga0070661_1001478681 154
435 3300005344 Ga0070661_101072004 Ga0070661_1010720041 154
436 3300005345 Ga0070692_10000758 Ga0070692_100007587 154
437 3300005345 Ga0070692_10005960 Ga0070692_100059604 154
438 3300005345 Ga0070692_10109966 Ga0070692_101099662 154
439 3300005345 Ga0070692_10355409 Ga0070692_103554092 154
440 3300005353 Ga0070669_100427945 Ga0070669_1004279452 154
441 3300005356 Ga0070674_100515151 Ga0070674_1005151511 154
442 3300005364 Ga0070673_100390454 Ga0070673_1003904541 154
443 3300005366 Ga0070659_100013691 Ga0070659_10001369110 154
444 3300005366 Ga0070659_100150875 Ga0070659_1001508752 154
445 3300005366 Ga0070659_100211196 Ga0070659_1002111962 154
446 3300005366 Ga0070659_100363857 Ga0070659_1003638572 154
447 3300005435 Ga0070714_100113675 Ga0070714_1001136752 154
448 3300005444 Ga0070694_100045403 Ga0070694_1000454032 154
449 3300005455 Ga0070663_100011479 Ga0070663_1000114791 154
450 3300005455 Ga0070663_100287544 Ga0070663_1002875442 154
451 3300005456 Ga0070678_100474351 Ga0070678_1004743511 154
452 3300005457 Ga0070662_101038675 Ga0070662_1010386751 154
453 3300005458 Ga0070681_10489663 Ga0070681_104896632 154
454 3300005530 Ga0070679_100062635 Ga0070679_1000626351 154
455 3300005530 Ga0070679_100114649 Ga0070679_1001146493 154
456 3300005530 Ga0070679_100123070 Ga0070679_1001230704 154
457 3300005530 Ga0070679_100654032 Ga0070679_1006540322 154
458 3300005530 Ga0070679_101005558 Ga0070679_1010055582 154
459 3300005535 Ga0070684_101132358 Ga0070684_1011323581 154
460 3300005543 Ga0070672_100013328 Ga0070672_1000133287 154
461 3300005543 Ga0070672_100462702 Ga0070672_1004627022 154
462 3300005543 Ga0070672_101246144 Ga0070672_1012461442 154
463 3300005545 Ga0070695_100238041 Ga0070695_1002380412 154
464 3300005545 Ga0070695_100562207 Ga0070695_1005622071 154
465 3300005546 Ga0070696_100675770 Ga0070696_1006757701 154
466 3300005548 Ga0070665_100005675 Ga0070665_1000056759 154
467 3300005548 Ga0070665_100853000 Ga0070665_1008530002 154
468 3300005548 Ga0070665_101594568 Ga0070665_1015945681 154
469 3300005549 Ga0070704_100079864 Ga0070704_1000798643 154
470 3300005563 Ga0068855_100033891 Ga0068855_1000338912 154
471 3300005563 Ga0068855_100128700 Ga0068855_1001287003 154
472 3300005563 Ga0068855_100395047 Ga0068855_1003950471 154
473 3300005563 Ga0068855_102109359 Ga0068855_1021093591 154
474 3300005564 Ga0070664_100093815 Ga0070664_1000938154 154
475 3300005564 Ga0070664_100169342 Ga0070664_1001693422 154
476 3300005577 Ga0068857_100424467 Ga0068857_1004244672 154
477 3300005577 Ga0068857_100952943 Ga0068857_1009529432 154
478 3300005578 Ga0068854_100002485 Ga0068854_1000024856 154
479 3300005578 Ga0068854_100097579 Ga0068854_1000975793 154
480 3300005578 Ga0068854_100289161 Ga0068854_1002891612 154
481 3300005614 Ga0068856_101423024 Ga0068856_1014230242 154
482 3300005614 Ga0068856_101793003 Ga0068856_1017930031 154
483 3300005616 Ga0068852_100003412 Ga0068852_1000034124 154
484 3300005616 Ga0068852_100014450 Ga0068852_1000144508 154
485 3300005616 Ga0068852_100076004 Ga0068852_1000760042 154
486 3300005616 Ga0068852_100527199 Ga0068852_1005271992 154
487 3300005617 Ga0068859_100042514 Ga0068859_1000425143 154
488 3300005719 Ga0068861_100096910 Ga0068861_1000969101 154
489 3300005834 Ga0068851_10167595 Ga0068851_101675952 154
490 3300005842 Ga0068858_100020727 Ga0068858_1000207275 154
491 3300005843 Ga0068860_100095127 Ga0068860_1000951274 154
492 3300005844 Ga0068862_101930816 Ga0068862_1019308161 154
493 3300006048 Ga0075363_100004002 Ga0075363_1000040025 154
494 3300006178 Ga0075367_10064390 Ga0075367_100643902 154
495 3300006186 Ga0075369_10116325 Ga0075369_101163252 154
496 3300006237 Ga0097621_101456608 Ga0097621_1014566081 154
497 3300006353 Ga0075370_10064147 Ga0075370_100641472 154
498 3300006914 Ga0075436_100980504 Ga0075436_1009805041 154
499 3300006931 Ga0097620_100002528 Ga0097620_10000252816 154
500 3300006931 Ga0097620_100042515 Ga0097620_1000425153 154
501 3300009093 Ga0105240_10012918 Ga0105240_100129188 154
502 3300009093 Ga0105240_10079431 Ga0105240_100794314 154
503 3300009093 Ga0105240_10157645 Ga0105240_101576455 154
504 3300009098 Ga0105245_11002402 Ga0105245_110024021 154
505 3300009148 Ga0105243_10171628 Ga0105243_101716282 154
506 3300009174 Ga0105241_10265929 Ga0105241_102659291 154
507 3300009176 Ga0105242_10062824 Ga0105242_100628245 154
508 3300009177 Ga0105248_10004891 Ga0105248_100048918 154
509 3300009177 Ga0105248_10665866 Ga0105248_106658662 154
510 3300009545 Ga0105237_10401264 Ga0105237_104012643 154
511 3300009551 Ga0105238_10789861 Ga0105238_107898612 154
512 3300009553 Ga0105249_10179483 Ga0105249_101794831 154
513 3300009553 Ga0105249_12450828 Ga0105249_124508281 154
514 3300010375 Ga0105239_10079404 Ga0105239_100794045 154
515 3300013100 Ga0157373_10074447 Ga0157373_100744475 154
516 3300013100 Ga0157373_10134560 Ga0157373_101345602 154
517 3300013102 Ga0157371_10035547 Ga0157371_100355475 154
518 3300013102 Ga0157371_10145135 Ga0157371_101451353 154
519 3300013102 Ga0157371_10312826 Ga0157371_103128262 154
520 3300013102 Ga0157371_10685344 Ga0157371_106853442 154
521 3300013102 Ga0157371_10693457 Ga0157371_106934571 154
522 3300013104 Ga0157370_10075245 Ga0157370_100752453 154
523 3300013104 Ga0157370_10871192 Ga0157370_108711922 154
524 3300013105 Ga0157369_10028034 Ga0157369_100280348 154
525 3300013105 Ga0157369_10035796 Ga0157369_100357964 154
526 3300013105 Ga0157369_10113758 Ga0157369_101137584 154
527 3300013307 Ga0157372_10270637 Ga0157372_102706373 154
528 3300013308 Ga0157375_10676674 Ga0157375_106766742 154
529 3300014325 Ga0163163_10149439 Ga0163163_101494393 154
530 3300017792 Ga0163161_10269800 Ga0163161_102698001 154
531 3300020069 Ga0197907_11258877 Ga0197907_112588773 154
532 3300020081 Ga0206354_10798508 Ga0206354_107985084 154
533 3300020082 Ga0206353_10574223 Ga0206353_105742232 154
534 3300020082 Ga0206353_11449045 Ga0206353_114490453 154
535 3300020082 Ga0206353_11611110 Ga0206353_116111102 154
536 3300025315 Ga0207697_10000532 Ga0207697_1000053213 154
537 3300025901 Ga0207688_10001563 Ga0207688_100015636 154
538 3300025901 Ga0207688_10052965 Ga0207688_100529655 154
539 3300025903 Ga0207680_10584150 Ga0207680_105841501 154
540 3300025904 Ga0207647_10000891 Ga0207647_1000089111 154
541 3300025909 Ga0207705_10055686 Ga0207705_100556864 154
542 3300025911 Ga0207654_10350240 Ga0207654_103502402 154
543 3300025912 Ga0207707_10359758 Ga0207707_103597582 154
544 3300025913 Ga0207695_10009693 Ga0207695_100096934 154
545 3300025913 Ga0207695_10254296 Ga0207695_102542964 154
546 3300025913 Ga0207695_10653069 Ga0207695_106530692 154
547 3300025917 Ga0207660_10000188 Ga0207660_1000018815 154
548 3300025917 Ga0207660_10007321 Ga0207660_100073214 154
549 3300025917 Ga0207660_10334948 Ga0207660_103349482 154
550 3300025919 Ga0207657_10000443 Ga0207657_1000044336 154
551 3300025919 Ga0207657_10032955 Ga0207657_100329553 154
552 3300025919 Ga0207657_10350715 Ga0207657_103507152 154
553 3300025919 Ga0207657_10360177 Ga0207657_103601772 154
554 3300025921 Ga0207652_10230058 Ga0207652_102300582 154
555 3300025921 Ga0207652_10371596 Ga0207652_103715961 154
556 3300025921 Ga0207652_10395403 Ga0207652_103954033 154
557 3300025921 Ga0207652_10545636 Ga0207652_105456362 154
558 3300025924 Ga0207694_10545344 Ga0207694_105453441 154
559 3300025925 Ga0207650_10074904 Ga0207650_100749042 154
560 3300025927 Ga0207687_10499797 Ga0207687_104997972 154
561 3300025929 Ga0207664_10029235 Ga0207664_100292356 154
562 3300025932 Ga0207690_10001162 Ga0207690_1000116213 154
563 3300025932 Ga0207690_10313770 Ga0207690_103137702 154
564 3300025933 Ga0207706_10143360 Ga0207706_101433601 154
565 3300025933 Ga0207706_10357433 Ga0207706_103574332 154
566 3300025933 Ga0207706_10885908 Ga0207706_108859082 154
567 3300025935 Ga0207709_10816111 Ga0207709_108161112 154
568 3300025937 Ga0207669_10048319 Ga0207669_100483192 154
569 3300025940 Ga0207691_10211588 Ga0207691_102115883 154
570 3300025940 Ga0207691_10563347 Ga0207691_105633472 154
571 3300025941 Ga0207711_10004658 Ga0207711_100046587 154
572 3300025941 Ga0207711_11340297 Ga0207711_113402971 154
573 3300025942 Ga0207689_11175519 Ga0207689_111755192 154
574 3300025944 Ga0207661_10112265 Ga0207661_101122652 154
575 3300025945 Ga0207679_10111338 Ga0207679_101113382 154
576 3300025949 Ga0207667_10048277 Ga0207667_100482773 154
577 3300025949 Ga0207667_10119786 Ga0207667_101197863 154
578 3300025949 Ga0207667_10130390 Ga0207667_101303902 154
579 3300025949 Ga0207667_10137971 Ga0207667_101379712 154
580 3300025961 Ga0207712_10000888 Ga0207712_1000088830 154
581 3300025961 Ga0207712_11310114 Ga0207712_113101142 154
582 3300025981 Ga0207640_10002237 Ga0207640_100022378 154
583 3300025981 Ga0207640_10020617 Ga0207640_100206177 154
584 3300026035 Ga0207703_10018119 Ga0207703_100181196 154
585 3300026067 Ga0207678_10123987 Ga0207678_101239871 154
586 3300026067 Ga0207678_10268170 Ga0207678_102681702 154
587 3300026067 Ga0207678_10272288 Ga0207678_102722882 154
588 3300026078 Ga0207702_11798180 Ga0207702_117981801 154
589 3300026095 Ga0207676_10399574 Ga0207676_103995741 154
590 3300026116 Ga0207674_10211438 Ga0207674_102114382 154
591 3300026118 Ga0207675_100430987 Ga0207675_1004309871 154
592 3300026121 Ga0207683_10333417 Ga0207683_103334172 154
593 3300026142 Ga0207698_10000721 Ga0207698_1000072110 154
594 3300026142 Ga0207698_10043344 Ga0207698_100433445 154
595 3300026142 Ga0207698_10450187 Ga0207698_104501872 154
596 3300026142 Ga0207698_10883605 Ga0207698_108836051 154
597 3300028379 Ga0268266_10004365 Ga0268266_100043659 154
598 3300028379 Ga0268266_10031955 Ga0268266_100319554 154
599 3300028379 Ga0268266_10405405 Ga0268266_104054051 154
600 3300028380 Ga0268265_10073184 Ga0268265_100731843 154
601 3300028381 Ga0268264_10008520 Ga0268264_1000852010 154
602 3300031824 Ga0307413_10096305 Ga0307413_100963052 154
603 3300031852 Ga0307410_10205484 Ga0307410_102054841 154
604 3300031903 Ga0307407_10040944 Ga0307407_100409442 154
605 3300031903 Ga0307407_10283826 Ga0307407_102838262 154
606 3300031911 Ga0307412_10109638 Ga0307412_101096382 154
607 3300031995 Ga0307409_100477125 Ga0307409_1004771252 154
608 3300037312 Ga0395899_0019172 Ga0395899_0019172_3869_4351 154
609 3300037312 Ga0395899_0114604 Ga0395899_0114604_1187_1672 154
610 3300037312 Ga0395899_0173102 Ga0395899_0173102_397_879 154
611 3300037418 Ga0395900_0008716 Ga0395900_0008716_1040_1525 154
612 3300037418 Ga0395900_0017459 Ga0395900_0017459_539_1021 154
613 3300037418 Ga0395900_0785958 Ga0395900_0785958_102_587 154
614 3300037418 Ga0395900_1120548 Ga0395900_1120548_155_637 154
615 3300037466 Ga0395898_0019648 Ga0395898_0019648_3194_3676 154
616 3300037466 Ga0395898_0047468 Ga0395898_0047468_1669_2154 154
617 3300037466 Ga0395898_0103681 Ga0395898_0103681_673_1158 154
618 3300037466 Ga0395898_0212183 Ga0395898_0212183_1260_1742 154
619 3300037466 Ga0395898_0604489 Ga0395898_0604489_395_880 154
620 3300037471 Ga0395905_0189851 Ga0395905_0189851_815_1300 154
621 3300037471 Ga0395905_0273692 Ga0395905_0273692_988_1473 154
622 3300037471 Ga0395905_0275863 Ga0395905_0275863_413_895 154
623 3300038443 Ga0395901_0169674 Ga0395901_0169674_874_1359 154
624 3300038443 Ga0395901_0302259 Ga0395901_0302259_202_684 154
625 3300038443 Ga0395901_1658769 Ga0395901_1658769_37_522 154
626 3300041410 Ga0439461_0129398 Ga0439461_0129398_15_527 154
627 3300041411 Ga0439466_0044561 Ga0439466_0044561_865_1377 154
628 3300044658 Ga0466972_0125166 Ga0466972_0125166_485_967 154
629 3300044683 Ga0466965_0303181 Ga0466965_0303181_16_501 154
630 3300044694 Ga0466963_0186825 Ga0466963_0186825_166_648 154
631 3300044706 Ga0466964_0031179 Ga0466964_0031179_38_520 154
632 3300044765 Ga0466970_0110556 Ga0466970_0110556_219_701 154
633 3300045976 Ga0466967_0109550 Ga0466967_0109550_870_1352 154
634 3300045976 Ga0466967_1257094 Ga0466967_1257094_40_531 154
635 3300046664 Ga0495659_0112788 Ga0495659_0112788_29_529 154
636 3300047320 Ga0495672_0130487 Ga0495672_0130487_764_1267 154
637 3300048903 Ga0496100_0395209 Ga0496100_0395209_72_554 154
638 3300048905 Ga0496102_0000117 Ga0496102_0000117_24589_25074 154
639 3300048906 Ga0496103_0000076 Ga0496103_0000076_24596_25081 154
640 3300048911 Ga0496108_0022862 Ga0496108_0022862_3144_3647 154
641 3300048912 Ga0496109_0052104 Ga0496109_0052104_1878_2381 154
642 3300048913 Ga0496110_0048100 Ga0496110_0048100_1112_1615 154
643 3300048913 Ga0496110_0754149 Ga0496110_0754149_250_771 154
644 3300048914 Ga0496111_0258570 Ga0496111_0258570_714_1217 154
645 3300048915 Ga0496112_0006460 Ga0496112_0006460_7318_7821 154
646 3300048917 Ga0496114_0475886 Ga0496114_0475886_335_838 154
647 3300048919 Ga0496116_0000888 Ga0496116_0000888_15270_15755 154
648 3300048920 Ga0496117_0000201 Ga0496117_0000201_24403_24888 154
649 3300048921 Ga0496118_0000097 Ga0496118_0000097_92792_93277 154
650 3300048923 Ga0496120_0148060 Ga0496120_0148060_78_563 154
651 3300048927 Ga0496124_0000202 Ga0496124_0000202_24374_24859 154
652 3300049581 Ga0501047_0025752 Ga0501047_0025752_3331_3816 154
653 3300050490 nmdc:mga03n38_38757_c1 nmdc:mga03n38_38757_c1_313_816 154
654 3300050491 nmdc:mga00v17_711155_c1 nmdc:mga00v17_711155_c1_117_620 154
655 3300050496 nmdc:mga07m45_15784_c1 nmdc:mga07m45_15784_c1_1537_2031 154
656 3300050512 nmdc:mga0n895_834482_c1 nmdc:mga0n895_834482_c1_155_637 154
657 3300050516 nmdc:mga0sz30_16968_c1 nmdc:mga0sz30_16968_c1_1181_1675 154
658 3300053119 Ga0500595_000982 Ga0500595_000982_1581_2072 154
659 3300053140 Ga0500573_0488750 Ga0500573_0488750_55_543 154
660 3300053730 Ga0500645_004012 Ga0500645_004012_4009_4497 154
661 3300002239 JGI24034J26672_10008158 JGI24034J26672_100081581 155
662 3300003794 Ga0055531_10000007 Ga0055531_1000000716 155
663 3300003794 Ga0055531_10077983 Ga0055531_100779831 155
664 3300005327 Ga0070658_10326400 Ga0070658_103264002 155
665 3300005329 Ga0070683_100705988 Ga0070683_1007059882 155
666 3300005331 Ga0070670_100007872 Ga0070670_1000078728 155
667 3300005331 Ga0070670_100424901 Ga0070670_1004249012 155
668 3300005331 Ga0070670_100784311 Ga0070670_1007843112 155
669 3300005333 Ga0070677_10008365 Ga0070677_100083654 155
670 3300005335 Ga0070666_10112091 Ga0070666_101120911 155
671 3300005339 Ga0070660_100006698 Ga0070660_1000066986 155
672 3300005339 Ga0070660_100094781 Ga0070660_1000947812 155
673 3300005339 Ga0070660_100298842 Ga0070660_1002988423 155
674 3300005339 Ga0070660_100428579 Ga0070660_1004285791 155
675 3300005339 Ga0070660_101028960 Ga0070660_1010289602 155
676 3300005344 Ga0070661_100029115 Ga0070661_1000291153 155
677 3300005345 Ga0070692_10007127 Ga0070692_100071272 155
678 3300005347 Ga0070668_100000096 Ga0070668_1000000963 155
679 3300005353 Ga0070669_100017103 Ga0070669_1000171033 155
680 3300005353 Ga0070669_100079658 Ga0070669_1000796582 155
681 3300005354 Ga0070675_100004947 Ga0070675_1000049477 155
682 3300005354 Ga0070675_100042256 Ga0070675_1000422562 155
683 3300005355 Ga0070671_100000493 Ga0070671_10000049324 155
684 3300005355 Ga0070671_100011924 Ga0070671_1000119246 155
685 3300005356 Ga0070674_100062474 Ga0070674_1000624742 155
686 3300005364 Ga0070673_100001479 Ga0070673_10000147913 155
687 3300005364 Ga0070673_100923669 Ga0070673_1009236691 155
688 3300005366 Ga0070659_100697462 Ga0070659_1006974622 155
689 3300005367 Ga0070667_100110345 Ga0070667_1001103453 155
690 3300005367 Ga0070667_100725938 Ga0070667_1007259382 155
691 3300005435 Ga0070714_100297734 Ga0070714_1002977342 155
692 3300005455 Ga0070663_100036427 Ga0070663_1000364274 155
693 3300005455 Ga0070663_100094329 Ga0070663_1000943293 155
694 3300005455 Ga0070663_100194123 Ga0070663_1001941232 155
695 3300005455 Ga0070663_100701716 Ga0070663_1007017162 155
696 3300005456 Ga0070678_100436544 Ga0070678_1004365442 155
697 3300005457 Ga0070662_100025277 Ga0070662_1000252773 155
698 3300005457 Ga0070662_100110024 Ga0070662_1001100241 155
699 3300005530 Ga0070679_100241442 Ga0070679_1002414423 155
700 3300005539 Ga0068853_100942287 Ga0068853_1009422872 155
701 3300005543 Ga0070672_100460748 Ga0070672_1004607481 155
702 3300005544 Ga0070686_100000821 Ga0070686_1000008216 155
703 3300005563 Ga0068855_100057149 Ga0068855_1000571495 155
704 3300005564 Ga0070664_100196755 Ga0070664_1001967552 155
705 3300005617 Ga0068859_100411624 Ga0068859_1004116242 155
706 3300005618 Ga0068864_101720457 Ga0068864_1017204572 155
707 3300005841 Ga0068863_100000012 Ga0068863_100000012102 155
708 3300005841 Ga0068863_100010506 Ga0068863_1000105068 155
709 3300005843 Ga0068860_100098751 Ga0068860_1000987514 155
710 3300006038 Ga0075365_10012673 Ga0075365_100126733 155
711 3300006051 Ga0075364_10019691 Ga0075364_100196912 155
712 3300006353 Ga0075370_10350594 Ga0075370_103505942 155
713 3300006871 Ga0075434_100138466 Ga0075434_1001384662 155
714 3300006881 Ga0068865_100020904 Ga0068865_1000209046 155
715 3300006931 Ga0097620_100411632 Ga0097620_1004116322 155
716 3300009147 Ga0114129_11350623 Ga0114129_113506232 155
717 3300009177 Ga0105248_10121318 Ga0105248_101213185 155
718 3300009545 Ga0105237_10001038 Ga0105237_1000103836 155
719 3300009551 Ga0105238_11930541 Ga0105238_119305411 155
720 3300009553 Ga0105249_10231480 Ga0105249_102314801 155
721 3300010375 Ga0105239_11648485 Ga0105239_116484852 155
722 3300013102 Ga0157371_10687867 Ga0157371_106878671 155
723 3300013102 Ga0157371_10860330 Ga0157371_108603302 155
724 3300013306 Ga0163162_10073970 Ga0163162_100739703 155
725 3300014325 Ga0163163_10450533 Ga0163163_104505332 155
726 3300014745 Ga0157377_11018374 Ga0157377_110183741 155
727 3300017792 Ga0163161_10116233 Ga0163161_101162331 155
728 3300025298 Ga0209050_1001276 Ga0209050_100127625 155
729 3300025303 Ga0209051_1003373 Ga0209051_10033735 155
730 3300025304 Ga0209257_1000021 Ga0209257_1000021213 155
731 3300025304 Ga0209257_1044142 Ga0209257_10441422 155
732 3300025893 Ga0207682_10074875 Ga0207682_100748752 155
733 3300025901 Ga0207688_10148663 Ga0207688_101486632 155
734 3300025903 Ga0207680_10167956 Ga0207680_101679561 155
735 3300025909 Ga0207705_10006806 Ga0207705_100068064 155
736 3300025909 Ga0207705_10068449 Ga0207705_100684494 155
737 3300025909 Ga0207705_10300111 Ga0207705_103001112 155
738 3300025913 Ga0207695_10079369 Ga0207695_100793693 155
739 3300025914 Ga0207671_10000911 Ga0207671_1000091136 155
740 3300025919 Ga0207657_10025047 Ga0207657_100250474 155
741 3300025919 Ga0207657_10078659 Ga0207657_100786594 155
742 3300025920 Ga0207649_10027008 Ga0207649_100270082 155
743 3300025921 Ga0207652_10373149 Ga0207652_103731492 155
744 3300025923 Ga0207681_10141842 Ga0207681_101418424 155
745 3300025926 Ga0207659_10008336 Ga0207659_100083365 155
746 3300025929 Ga0207664_10028167 Ga0207664_100281672 155
747 3300025931 Ga0207644_10000070 Ga0207644_1000007058 155
748 3300025932 Ga0207690_10824188 Ga0207690_108241882 155
749 3300025933 Ga0207706_10123697 Ga0207706_101236974 155
750 3300025936 Ga0207670_10864161 Ga0207670_108641612 155
751 3300025937 Ga0207669_11497106 Ga0207669_114971061 155
752 3300025938 Ga0207704_10027411 Ga0207704_100274114 155
753 3300025940 Ga0207691_10003343 Ga0207691_100033437 155
754 3300025940 Ga0207691_10160132 Ga0207691_101601322 155
755 3300025941 Ga0207711_10319290 Ga0207711_103192902 155
756 3300025942 Ga0207689_10443675 Ga0207689_104436752 155
757 3300025945 Ga0207679_10007531 Ga0207679_100075312 155
758 3300025945 Ga0207679_10159540 Ga0207679_101595403 155
759 3300025945 Ga0207679_11399111 Ga0207679_113991112 155
760 3300025949 Ga0207667_10514081 Ga0207667_105140811 155
761 3300025961 Ga0207712_10079601 Ga0207712_100796012 155
762 3300025972 Ga0207668_10000061 Ga0207668_1000006117 155
763 3300026023 Ga0207677_10896917 Ga0207677_108969172 155
764 3300026041 Ga0207639_10221693 Ga0207639_102216932 155
765 3300026067 Ga0207678_10161425 Ga0207678_101614252 155
766 3300026067 Ga0207678_10213117 Ga0207678_102131171 155
767 3300026088 Ga0207641_10000024 Ga0207641_10000024121 155
768 3300026088 Ga0207641_10028312 Ga0207641_100283125 155
769 3300026121 Ga0207683_10789257 Ga0207683_107892571 155
770 3300026142 Ga0207698_11066188 Ga0207698_110661881 155
771 3300028380 Ga0268265_10219745 Ga0268265_102197453 155
772 3300028381 Ga0268264_10008206 Ga0268264_100082063 155
773 3300031548 Ga0307408_100326558 Ga0307408_1003265583 155
774 3300031731 Ga0307405_10048084 Ga0307405_100480842 155
775 3300031824 Ga0307413_10092783 Ga0307413_100927834 155
776 3300031824 Ga0307413_10160903 Ga0307413_101609032 155
777 3300031901 Ga0307406_10207049 Ga0307406_102070492 155
778 3300031901 Ga0307406_10384126 Ga0307406_103841262 155
779 3300031911 Ga0307412_10065914 Ga0307412_100659143 155
780 3300031995 Ga0307409_100137450 Ga0307409_1001374502 155
781 3300031995 Ga0307409_100241657 Ga0307409_1002416572 155
782 3300032002 Ga0307416_100801378 Ga0307416_1008013782 155
783 3300032004 Ga0307414_10109368 Ga0307414_101093684 155
784 3300032004 Ga0307414_10544759 Ga0307414_105447591 155
785 3300032005 Ga0307411_10014387 Ga0307411_100143871 155
786 3300032005 Ga0307411_10184744 Ga0307411_101847442 155
787 3300032126 Ga0307415_100240735 Ga0307415_1002407353 155
788 3300032126 Ga0307415_100619683 Ga0307415_1006196831 155
789 3300037418 Ga0395900_0001531 Ga0395900_0001531_2399_2884 155
790 3300037418 Ga0395900_0180293 Ga0395900_0180293_1153_1641 155
791 3300037418 Ga0395900_0267293 Ga0395900_0267293_1049_1534 155
792 3300037466 Ga0395898_0000315 Ga0395898_0000315_56385_56870 155
793 3300037466 Ga0395898_0929398 Ga0395898_0929398_24_509 155
794 3300037471 Ga0395905_0000005 Ga0395905_0000005_417159_417644 155
795 3300037471 Ga0395905_0085572 Ga0395905_0085572_188_673 155
796 3300037471 Ga0395905_0093564 Ga0395905_0093564_2144_2629 155
797 3300037471 Ga0395905_0441962 Ga0395905_0441962_432_917 155
798 3300037853 Ga0436364_1182532 Ga0436364_1182532_354_839 155
799 3300038443 Ga0395901_0000242 Ga0395901_0000242_54376_54861 155
800 3300039450 Ga0436363_1088079 Ga0436363_1088079_178_678 155
801 3300041410 Ga0439461_0105860 Ga0439461_0105860_80_622 155
802 3300042157 Ga0439458_0000880 Ga0439458_0000880_131_616 155
803 3300042438 Ga0439459_0100098 Ga0439459_0100098_13_504 155
804 3300045976 Ga0466967_0139487 Ga0466967_0139487_1710_2195 155
805 3300046525 Ga0495663_0041459 Ga0495663_0041459_787_1272 155
806 3300046525 Ga0495663_0215993 Ga0495663_0215993_51_539 155
807 3300046539 Ga0495621_0019849 Ga0495621_0019849_230_715 155
808 3300046684 Ga0495669_0001409 Ga0495669_0001409_1270_1755 155
809 3300046684 Ga0495669_0018746 Ga0495669_0018746_308_796 155
810 3300046691 Ga0495670_0050266 Ga0495670_0050266_410_898 155
811 3300047445 Ga0495677_0274875 Ga0495677_0274875_139_624 155
812 3300048913 Ga0496110_0010169 Ga0496110_0010169_2451_2939 155
813 3300048916 Ga0496113_0293585 Ga0496113_0293585_646_1134 155
814 3300048917 Ga0496114_0050702 Ga0496114_0050702_2273_2761 155
815 3300048920 Ga0496117_0045944 Ga0496117_0045944_840_1346 155
816 3300048920 Ga0496117_0295150 Ga0496117_0295150_85_582 155
817 3300048921 Ga0496118_0009455 Ga0496118_0009455_9248_9745 155
818 3300048921 Ga0496118_0019696 Ga0496118_0019696_1059_1565 155
819 3300048922 Ga0496119_0403795 Ga0496119_0403795_131_628 155
820 3300048928 Ga0496125_0045544 Ga0496125_0045544_936_1430 155
821 3300049663 Ga0501223_006239 Ga0501223_006239_513_998 155
822 3300049670 Ga0501236_030261 Ga0501236_030261_162_647 155
823 3300049677 Ga0501247_008578 Ga0501247_008578_178_663 155
824 3300049681 Ga0501251_006845 Ga0501251_006845_637_1122 155
825 3300049686 Ga0501257_046610 Ga0501257_046610_562_1047 155
826 3300049687 Ga0501258_002636 Ga0501258_002636_1004_1489 155
827 3300049704 Ga0501221_017815 Ga0501221_017815_90_575 155
828 3300049705 Ga0501225_0068086 Ga0501225_0068086_434_919 155
829 3300049708 Ga0501245_035368 Ga0501245_035368_193_678 155
830 3300049763 Ga0501266_025108 Ga0501266_025108_168_653 155
831 3300049767 Ga0501270_007045 Ga0501270_007045_757_1242 155
832 3300049770 Ga0501273_003217 Ga0501273_003217_1040_1525 155
833 3300049779 Ga0501283_012549 Ga0501283_012549_483_968 155
834 3300049851 Ga0501212_051903 Ga0501212_051903_100_585 155
835 3300050489 nmdc:mga03683_246554_c1 nmdc:mga03683_246554_c1_292_783 155
836 3300050490 nmdc:mga03n38_5866_c1 nmdc:mga03n38_5866_c1_2273_2764 155
837 3300050491 nmdc:mga00v17_10690_c1 nmdc:mga00v17_10690_c1_1022_1513 155
838 3300050492 nmdc:mga0yw44_13680_c1 nmdc:mga0yw44_13680_c1_3514_4005 155
839 3300053090 Ga0500646_0014909 Ga0500646_0014909_102_608 155
840 3300053139 Ga0500568_0002995 Ga0500568_0002995_6328_6834 155
841 3300053151 Ga0500604_0000019 Ga0500604_0000019_38303_38809 155
842 3300053153 Ga0500616_0000326 Ga0500616_0000326_25161_25667 155
843 3300053730 Ga0500645_095271 Ga0500645_095271_248_778 155
844 3300001915 JGI24741J21665_1008754 JGI24741J21665_10087542 156
845 3300001977 JGI24746J21847_1009583 JGI24746J21847_10095832 156
846 3300001979 JGI24740J21852_10012652 JGI24740J21852_100126524 156
847 3300001989 JGI24739J22299_10000326 JGI24739J22299_100003264 156
848 3300001990 JGI24737J22298_10074673 JGI24737J22298_100746731 156
849 3300001991 JGI24743J22301_10001225 JGI24743J22301_100012253 156
850 3300005327 Ga0070658_10926800 Ga0070658_109268001 156
851 3300005328 Ga0070676_10066204 Ga0070676_100662043 156
852 3300005329 Ga0070683_100876391 Ga0070683_1008763912 156
853 3300005334 Ga0068869_100087708 Ga0068869_1000877082 156
854 3300005335 Ga0070666_10027907 Ga0070666_100279072 156
855 3300005337 Ga0070682_100163072 Ga0070682_1001630722 156
856 3300005339 Ga0070660_100029143 Ga0070660_1000291433 156
857 3300005339 Ga0070660_100151390 Ga0070660_1001513903 156
858 3300005340 Ga0070689_100327077 Ga0070689_1003270772 156
859 3300005344 Ga0070661_100014668 Ga0070661_1000146684 156
860 3300005344 Ga0070661_100745162 Ga0070661_1007451621 156
861 3300005354 Ga0070675_100102630 Ga0070675_1001026302 156
862 3300005355 Ga0070671_100007420 Ga0070671_1000074204 156
863 3300005355 Ga0070671_100051381 Ga0070671_1000513813 156
864 3300005364 Ga0070673_100053880 Ga0070673_1000538803 156
865 3300005365 Ga0070688_100026683 Ga0070688_1000266832 156
866 3300005366 Ga0070659_100031984 Ga0070659_1000319841 156
867 3300005366 Ga0070659_100038073 Ga0070659_1000380733 156
868 3300005367 Ga0070667_100606058 Ga0070667_1006060581 156
869 3300005441 Ga0070700_100023664 Ga0070700_1000236643 156
870 3300005455 Ga0070663_100019407 Ga0070663_1000194074 156
871 3300005455 Ga0070663_100126080 Ga0070663_1001260803 156
872 3300005455 Ga0070663_100213363 Ga0070663_1002133631 156
873 3300005456 Ga0070678_100004475 Ga0070678_1000044752 156
874 3300005457 Ga0070662_100086583 Ga0070662_1000865834 156
875 3300005458 Ga0070681_10294711 Ga0070681_102947111 156
876 3300005466 Ga0070685_10554506 Ga0070685_105545061 156
877 3300005539 Ga0068853_100001142 Ga0068853_10000114219 156
878 3300005539 Ga0068853_100041110 Ga0068853_1000411103 156
879 3300005539 Ga0068853_100286277 Ga0068853_1002862772 156
880 3300005539 Ga0068853_100899898 Ga0068853_1008998982 156
881 3300005545 Ga0070695_100016549 Ga0070695_1000165491 156
882 3300005548 Ga0070665_100047088 Ga0070665_1000470882 156
883 3300005563 Ga0068855_100052867 Ga0068855_1000528675 156
884 3300005563 Ga0068855_100770774 Ga0068855_1007707741 156
885 3300005563 Ga0068855_100897556 Ga0068855_1008975562 156
886 3300005564 Ga0070664_100096904 Ga0070664_1000969043 156
887 3300005564 Ga0070664_100553090 Ga0070664_1005530902 156
888 3300005577 Ga0068857_100004484 Ga0068857_10000448410 156
889 3300005578 Ga0068854_100001459 Ga0068854_1000014599 156
890 3300005578 Ga0068854_100604671 Ga0068854_1006046712 156
891 3300005614 Ga0068856_100588749 Ga0068856_1005887492 156
892 3300005614 Ga0068856_100859304 Ga0068856_1008593042 156
893 3300005616 Ga0068852_100499107 Ga0068852_1004991072 156
894 3300005617 Ga0068859_100030811 Ga0068859_1000308115 156
895 3300005618 Ga0068864_100079283 Ga0068864_1000792832 156
896 3300005718 Ga0068866_10025808 Ga0068866_100258081 156
897 3300005719 Ga0068861_100045213 Ga0068861_1000452132 156
898 3300005834 Ga0068851_10064560 Ga0068851_100645602 156
899 3300005841 Ga0068863_100110363 Ga0068863_1001103631 156
900 3300005841 Ga0068863_100559034 Ga0068863_1005590342 156
901 3300005843 Ga0068860_100091567 Ga0068860_1000915673 156
902 3300006048 Ga0075363_100000840 Ga0075363_10000084011 156
903 3300006051 Ga0075364_10006860 Ga0075364_100068607 156
904 3300006163 Ga0070715_10000417 Ga0070715_100004178 156
905 3300006177 Ga0075362_10229358 Ga0075362_102293582 156
906 3300006178 Ga0075367_10207159 Ga0075367_102071592 156
907 3300006186 Ga0075369_10021338 Ga0075369_100213383 156
908 3300006353 Ga0075370_10110179 Ga0075370_101101792 156
909 3300006358 Ga0068871_100052052 Ga0068871_1000520526 156
910 3300006931 Ga0097620_100030812 Ga0097620_1000308122 156
911 3300009011 Ga0105251_10065348 Ga0105251_100653482 156
912 3300009093 Ga0105240_10479211 Ga0105240_104792112 156
913 3300009098 Ga0105245_10428925 Ga0105245_104289252 156
914 3300009148 Ga0105243_10030964 Ga0105243_100309643 156
915 3300009174 Ga0105241_10051888 Ga0105241_100518883 156
916 3300009174 Ga0105241_10283659 Ga0105241_102836592 156
917 3300009176 Ga0105242_10002410 Ga0105242_100024104 156
918 3300009177 Ga0105248_10545632 Ga0105248_105456322 156
919 3300009545 Ga0105237_10113862 Ga0105237_101138621 156
920 3300009551 Ga0105238_10013551 Ga0105238_1001355113 156
921 3300009551 Ga0105238_10228942 Ga0105238_102289421 156
922 3300009551 Ga0105238_10462811 Ga0105238_104628112 156
923 3300009553 Ga0105249_10077350 Ga0105249_100773502 156
924 3300013100 Ga0157373_10237993 Ga0157373_102379932 156
925 3300013102 Ga0157371_10138247 Ga0157371_101382473 156
926 3300013104 Ga0157370_10093533 Ga0157370_100935332 156
927 3300013105 Ga0157369_10756217 Ga0157369_107562172 156
928 3300013296 Ga0157374_10002901 Ga0157374_100029019 156
929 3300013297 Ga0157378_12316216 Ga0157378_123162161 156
930 3300013306 Ga0163162_10003575 Ga0163162_100035751 156
931 3300014325 Ga0163163_10287482 Ga0163163_102874822 156
932 3300014326 Ga0157380_10198224 Ga0157380_101982242 156
933 3300014745 Ga0157377_10024695 Ga0157377_100246952 156
934 3300014745 Ga0157377_10049915 Ga0157377_100499152 156
935 3300017792 Ga0163161_10070700 Ga0163161_100707001 156
936 3300020078 Ga0206352_10907084 Ga0206352_109070841 156
937 3300025321 Ga0207656_10049327 Ga0207656_100493272 156
938 3300025899 Ga0207642_10264271 Ga0207642_102642712 156
939 3300025901 Ga0207688_10000504 Ga0207688_1000050413 156
940 3300025903 Ga0207680_10032695 Ga0207680_100326952 156
941 3300025904 Ga0207647_10016493 Ga0207647_100164934 156
942 3300025904 Ga0207647_10019269 Ga0207647_100192693 156
943 3300025905 Ga0207685_10002965 Ga0207685_100029652 156
944 3300025909 Ga0207705_10000033 Ga0207705_100000337 156
945 3300025909 Ga0207705_10007536 Ga0207705_100075364 156
946 3300025909 Ga0207705_10516894 Ga0207705_105168942 156
947 3300025912 Ga0207707_10355459 Ga0207707_103554592 156
948 3300025913 Ga0207695_10011979 Ga0207695_100119794 156
949 3300025919 Ga0207657_10009020 Ga0207657_100090205 156
950 3300025919 Ga0207657_10103626 Ga0207657_101036262 156
951 3300025920 Ga0207649_10007462 Ga0207649_100074625 156
952 3300025923 Ga0207681_10368837 Ga0207681_103688372 156
953 3300025924 Ga0207694_10055924 Ga0207694_100559243 156
954 3300025924 Ga0207694_10326729 Ga0207694_103267292 156
955 3300025927 Ga0207687_10048722 Ga0207687_100487223 156
956 3300025931 Ga0207644_10000852 Ga0207644_1000085212 156
957 3300025932 Ga0207690_10019474 Ga0207690_100194743 156
958 3300025933 Ga0207706_10328724 Ga0207706_103287242 156
959 3300025935 Ga0207709_10272346 Ga0207709_102723462 156
960 3300025937 Ga0207669_10022367 Ga0207669_100223672 156
961 3300025940 Ga0207691_10079221 Ga0207691_100792213 156
962 3300025941 Ga0207711_10164630 Ga0207711_101646302 156
963 3300025941 Ga0207711_10186810 Ga0207711_101868103 156
964 3300025942 Ga0207689_10001274 Ga0207689_1000127415 156
965 3300025945 Ga0207679_10023162 Ga0207679_100231623 156
966 3300025945 Ga0207679_10467407 Ga0207679_104674072 156
967 3300025949 Ga0207667_10012561 Ga0207667_1001256111 156
968 3300025949 Ga0207667_10073742 Ga0207667_100737422 156
969 3300025949 Ga0207667_10674041 Ga0207667_106740412 156
970 3300025960 Ga0207651_10021348 Ga0207651_100213487 156
971 3300025961 Ga0207712_10140240 Ga0207712_101402401 156
972 3300025981 Ga0207640_10011781 Ga0207640_100117816 156
973 3300025981 Ga0207640_10079645 Ga0207640_100796453 156
974 3300025981 Ga0207640_10086385 Ga0207640_100863853 156
975 3300025986 Ga0207658_10068204 Ga0207658_100682042 156
976 3300025986 Ga0207658_10471381 Ga0207658_104713812 156
977 3300025986 Ga0207658_11394504 Ga0207658_113945042 156
978 3300026035 Ga0207703_10080256 Ga0207703_100802562 156
979 3300026041 Ga0207639_10001247 Ga0207639_1000124719 156
980 3300026041 Ga0207639_10188909 Ga0207639_101889093 156
981 3300026041 Ga0207639_10788080 Ga0207639_107880802 156
982 3300026041 Ga0207639_10810959 Ga0207639_108109591 156
983 3300026067 Ga0207678_10019909 Ga0207678_100199094 156
984 3300026067 Ga0207678_10160527 Ga0207678_101605273 156
985 3300026078 Ga0207702_10059540 Ga0207702_100595402 156
986 3300026088 Ga0207641_10132236 Ga0207641_101322362 156
987 3300026116 Ga0207674_10006117 Ga0207674_100061179 156
988 3300026116 Ga0207674_10297077 Ga0207674_102970773 156
989 3300026121 Ga0207683_10002659 Ga0207683_1000265912 156
990 3300026121 Ga0207683_10007846 Ga0207683_100078466 156
991 3300026142 Ga0207698_10021854 Ga0207698_100218544 156
992 3300028381 Ga0268264_10182333 Ga0268264_101823331 156
993 3300031548 Ga0307408_100198506 Ga0307408_1001985062 156
994 3300031548 Ga0307408_100373803 Ga0307408_1003738031 156
995 3300031548 Ga0307408_100452896 Ga0307408_1004528961 156
996 3300031731 Ga0307405_10025635 Ga0307405_100256353 156
997 3300031731 Ga0307405_10874004 Ga0307405_108740041 156
998 3300031824 Ga0307413_10169561 Ga0307413_101695612 156
999 3300031852 Ga0307410_10178371 Ga0307410_101783712 156
1000 3300031852 Ga0307410_10277349 Ga0307410_102773492 156
1001 3300031901 Ga0307406_10163641 Ga0307406_101636412 156
1002 3300031901 Ga0307406_10273053 Ga0307406_102730532 156
1003 3300031903 Ga0307407_10053764 Ga0307407_100537641 156
1004 3300031911 Ga0307412_10004709 Ga0307412_100047092 156
1005 3300031911 Ga0307412_10099495 Ga0307412_100994952 156
1006 3300031911 Ga0307412_10165901 Ga0307412_101659012 156
1007 3300031995 Ga0307409_100377621 Ga0307409_1003776212 156
1008 3300032002 Ga0307416_100102464 Ga0307416_1001024643 156
1009 3300032002 Ga0307416_101035340 Ga0307416_1010353402 156
1010 3300032002 Ga0307416_101847895 Ga0307416_1018478951 156
1011 3300032004 Ga0307414_10341599 Ga0307414_103415992 156
1012 3300032004 Ga0307414_10764032 Ga0307414_107640321 156
1013 3300032004 Ga0307414_11706977 Ga0307414_117069771 156
1014 3300032005 Ga0307411_10049622 Ga0307411_100496222 156
1015 3300032005 Ga0307411_10139112 Ga0307411_101391122 156
1016 3300032005 Ga0307411_10345587 Ga0307411_103455872 156
1017 3300032126 Ga0307415_100038932 Ga0307415_1000389322 156
1018 3300032126 Ga0307415_101143030 Ga0307415_1011430301 156
1019 3300035090 Ga0373949_0022575 Ga0373949_0022575_371_883 156
1020 3300037312 Ga0395899_0007205 Ga0395899_0007205_1539_2027 156
1021 3300037312 Ga0395899_0012868 Ga0395899_0012868_2770_3258 156
1022 3300037418 Ga0395900_0002881 Ga0395900_0002881_7890_8378 156
1023 3300037418 Ga0395900_0003481 Ga0395900_0003481_6332_6820 156
1024 3300037418 Ga0395900_0171266 Ga0395900_0171266_1315_1806 156
1025 3300037418 Ga0395900_0812178 Ga0395900_0812178_210_698 156
1026 3300037466 Ga0395898_0014597 Ga0395898_0014597_165_653 156
1027 3300037466 Ga0395898_0122537 Ga0395898_0122537_1578_2066 156
1028 3300037466 Ga0395898_0624375 Ga0395898_0624375_77_565 156
1029 3300037466 Ga0395898_0976638 Ga0395898_0976638_216_707 156
1030 3300037471 Ga0395905_0008885 Ga0395905_0008885_8091_8579 156
1031 3300037471 Ga0395905_0070995 Ga0395905_0070995_1443_1934 156
1032 3300037471 Ga0395905_0161720 Ga0395905_0161720_1558_2046 156
1033 3300037471 Ga0395905_0203538 Ga0395905_0203538_1253_1741 156
1034 3300038443 Ga0395901_0005262 Ga0395901_0005262_10368_10856 156
1035 3300038443 Ga0395901_0019441 Ga0395901_0019441_2485_2973 156
1036 3300038443 Ga0395901_0023055 Ga0395901_0023055_1854_2345 156
1037 3300038443 Ga0395901_0799106 Ga0395901_0799106_165_653 156
1038 3300042006 Ga0439432_180811 Ga0439432_180811_25_519 156
1039 3300046616 Ga0495668_0089733 Ga0495668_0089733_1057_1548 156
1040 3300048904 Ga0496101_0343853 Ga0496101_0343853_426_926 156
1041 3300048905 Ga0496102_0152576 Ga0496102_0152576_94_606 156
1042 3300048906 Ga0496103_0007977 Ga0496103_0007977_1644_2138 156
1043 3300048907 Ga0496104_0058968 Ga0496104_0058968_513_1007 156
1044 3300048908 Ga0496105_0042309 Ga0496105_0042309_2619_3107 156
1045 3300048910 Ga0496107_0024288 Ga0496107_0024288_3706_4218 156
1046 3300048910 Ga0496107_0176294 Ga0496107_0176294_1069_1572 156
1047 3300048911 Ga0496108_0000985 Ga0496108_0000985_4152_4646 156
1048 3300048912 Ga0496109_0008171 Ga0496109_0008171_4142_4636 156
1049 3300048913 Ga0496110_0831396 Ga0496110_0831396_264_758 156
1050 3300048915 Ga0496112_0027706 Ga0496112_0027706_4769_5263 156
1051 3300048915 Ga0496112_0064872 Ga0496112_0064872_701_1195 156
1052 3300048916 Ga0496113_0026017 Ga0496113_0026017_2435_2935 156
1053 3300048916 Ga0496113_0047704 Ga0496113_0047704_846_1340 156
1054 3300048916 Ga0496113_0348254 Ga0496113_0348254_101_595 156
1055 3300048918 Ga0496115_1072005 Ga0496115_1072005_34_528 156
1056 3300048920 Ga0496117_0149760 Ga0496117_0149760_367_885 156
1057 3300048921 Ga0496118_0005641 Ga0496118_0005641_675_1193 156
1058 3300048923 Ga0496120_0063048 Ga0496120_0063048_1166_1684 156
1059 3300048924 Ga0496121_0000653 Ga0496121_0000653_45750_46256 156
1060 3300048924 Ga0496121_0002948 Ga0496121_0002948_21851_22354 156
1061 3300048925 Ga0496122_0041427 Ga0496122_0041427_2691_3191 156
1062 3300048928 Ga0496125_0040851 Ga0496125_0040851_842_1360 156
1063 3300048928 Ga0496125_0276631 Ga0496125_0276631_508_1008 156
1064 3300048929 Ga0496126_0007544 Ga0496126_0007544_8939_9439 156
1065 3300048929 Ga0496126_0008100 Ga0496126_0008100_2224_2727 156
1066 3300048929 Ga0496126_0094403 Ga0496126_0094403_111_614 156
1067 3300049568 Ga0501031_0160281 Ga0501031_0160281_268_759 156
1068 3300049575 Ga0501039_0399841 Ga0501039_0399841_56_559 156
1069 3300049579 Ga0501043_0109819 Ga0501043_0109819_841_1344 156
1070 3300049579 Ga0501043_0415977 Ga0501043_0415977_506_994 156
1071 3300049586 Ga0501070_0132733 Ga0501070_0132733_1218_1721 156
1072 3300049586 Ga0501070_0359785 Ga0501070_0359785_598_1101 156
1073 3300049586 Ga0501070_0861822 Ga0501070_0861822_35_547 156
1074 3300049822 Ga0501035_0186745 Ga0501035_0186745_471_974 156
1075 3300049823 Ga0501044_0206794 Ga0501044_0206794_510_1013 156
1076 3300049823 Ga0501044_0401571 Ga0501044_0401571_520_1023 156
1077 3300049823 Ga0501044_0504775 Ga0501044_0504775_383_871 156
1078 3300050489 nmdc:mga03683_75981_c1 nmdc:mga03683_75981_c1_90_584 156
1079 3300050490 nmdc:mga03n38_27796_c1 nmdc:mga03n38_27796_c1_337_831 156
1080 3300050491 nmdc:mga00v17_7667_c1 nmdc:mga00v17_7667_c1_1260_1754 156
1081 3300050494 nmdc:mga06z11_202281_c1 nmdc:mga06z11_202281_c1_382_876 156
1082 3300050496 nmdc:mga07m45_1959_c1 nmdc:mga07m45_1959_c1_608_1102 156
1083 3300050496 nmdc:mga07m45_73853_c1 nmdc:mga07m45_73853_c1_1299_1793 156
1084 3300053087 Ga0500643_000344 Ga0500643_000344_14202_14696 156
1085 3300053136 Ga0500559_0033443 Ga0500559_0033443_1671_2165 156
1086 3300055283 Ga0500661_000385 Ga0500661_000385_1789_2280 156
1087 3300002077 JGI24744J21845_10010753 JGI24744J21845_100107533 157
1088 3300003316 rootH1_10062977 rootH1_100629772 157
1089 3300005327 Ga0070658_10122886 Ga0070658_101228862 157
1090 3300005334 Ga0068869_100063236 Ga0068869_1000632363 157
1091 3300005335 Ga0070666_10055523 Ga0070666_100555234 157
1092 3300005338 Ga0068868_100089353 Ga0068868_1000893532 157
1093 3300005339 Ga0070660_100043339 Ga0070660_1000433392 157
1094 3300005339 Ga0070660_100292407 Ga0070660_1002924071 157
1095 3300005343 Ga0070687_100051653 Ga0070687_1000516532 157
1096 3300005354 Ga0070675_100027168 Ga0070675_1000271683 157
1097 3300005356 Ga0070674_100002533 Ga0070674_1000025334 157
1098 3300005356 Ga0070674_100120569 Ga0070674_1001205693 157
1099 3300005364 Ga0070673_100018759 Ga0070673_1000187593 157
1100 3300005364 Ga0070673_100267108 Ga0070673_1002671082 157
1101 3300005366 Ga0070659_100437548 Ga0070659_1004375482 157
1102 3300005455 Ga0070663_100050951 Ga0070663_1000509511 157
1103 3300005456 Ga0070678_100882156 Ga0070678_1008821562 157
1104 3300005457 Ga0070662_100040338 Ga0070662_1000403383 157
1105 3300005459 Ga0068867_100093679 Ga0068867_1000936792 157
1106 3300005466 Ga0070685_10558934 Ga0070685_105589342 157
1107 3300005539 Ga0068853_100061527 Ga0068853_1000615274 157
1108 3300005539 Ga0068853_101113250 Ga0068853_1011132502 157
1109 3300005543 Ga0070672_100077419 Ga0070672_1000774192 157
1110 3300005548 Ga0070665_100000282 Ga0070665_10000028283 157
1111 3300005548 Ga0070665_100035746 Ga0070665_1000357463 157
1112 3300005577 Ga0068857_100114084 Ga0068857_1001140842 157
1113 3300005578 Ga0068854_100044927 Ga0068854_1000449274 157
1114 3300005616 Ga0068852_100098856 Ga0068852_1000988562 157
1115 3300005718 Ga0068866_10025152 Ga0068866_100251522 157
1116 3300005842 Ga0068858_101444299 Ga0068858_1014442992 157
1117 3300006358 Ga0068871_100575491 Ga0068871_1005754911 157
1118 3300009093 Ga0105240_10535644 Ga0105240_105356442 157
1119 3300009098 Ga0105245_10168556 Ga0105245_101685563 157
1120 3300009148 Ga0105243_10136859 Ga0105243_101368593 157
1121 3300009176 Ga0105242_10442072 Ga0105242_104420722 157
1122 3300009177 Ga0105248_10566850 Ga0105248_105668503 157
1123 3300011119 Ga0105246_10123170 Ga0105246_101231702 157
1124 3300013100 Ga0157373_10092129 Ga0157373_100921293 157
1125 3300013100 Ga0157373_10297665 Ga0157373_102976652 157
1126 3300013296 Ga0157374_10007217 Ga0157374_100072176 157
1127 3300013296 Ga0157374_10853004 Ga0157374_108530042 157
1128 3300013297 Ga0157378_10943975 Ga0157378_109439752 157
1129 3300013306 Ga0163162_10012266 Ga0163162_100122664 157
1130 3300013308 Ga0157375_10101184 Ga0157375_101011844 157
1131 3300014325 Ga0163163_10237298 Ga0163163_102372981 157
1132 3300014745 Ga0157377_10383910 Ga0157377_103839101 157
1133 3300014969 Ga0157376_10135901 Ga0157376_101359013 157
1134 3300025298 Ga0209050_1044257 Ga0209050_10442572 157
1135 3300025893 Ga0207682_10107187 Ga0207682_101071872 157
1136 3300025903 Ga0207680_10062930 Ga0207680_100629302 157
1137 3300025903 Ga0207680_10463349 Ga0207680_104633492 157
1138 3300025909 Ga0207705_10568028 Ga0207705_105680282 157
1139 3300025912 Ga0207707_10491532 Ga0207707_104915321 157
1140 3300025918 Ga0207662_10035911 Ga0207662_100359112 157
1141 3300025919 Ga0207657_10011691 Ga0207657_100116919 157
1142 3300025919 Ga0207657_10027160 Ga0207657_100271603 157
1143 3300025920 Ga0207649_10079462 Ga0207649_100794622 157
1144 3300025926 Ga0207659_10068606 Ga0207659_100686063 157
1145 3300025931 Ga0207644_11156260 Ga0207644_111562601 157
1146 3300025932 Ga0207690_10007181 Ga0207690_100071813 157
1147 3300025932 Ga0207690_10404405 Ga0207690_104044052 157
1148 3300025932 Ga0207690_10432868 Ga0207690_104328682 157
1149 3300025933 Ga0207706_10109253 Ga0207706_101092533 157
1150 3300025934 Ga0207686_11002064 Ga0207686_110020641 157
1151 3300025937 Ga0207669_10069201 Ga0207669_100692012 157
1152 3300025937 Ga0207669_10149093 Ga0207669_101490932 157
1153 3300025940 Ga0207691_10020334 Ga0207691_100203345 157
1154 3300025940 Ga0207691_10085771 Ga0207691_100857712 157
1155 3300025942 Ga0207689_10042434 Ga0207689_100424345 157
1156 3300025972 Ga0207668_10230508 Ga0207668_102305082 157
1157 3300025981 Ga0207640_10421646 Ga0207640_104216461 157
1158 3300025981 Ga0207640_10752537 Ga0207640_107525372 157
1159 3300026023 Ga0207677_10135756 Ga0207677_101357561 157
1160 3300026035 Ga0207703_10907421 Ga0207703_109074211 157
1161 3300026041 Ga0207639_10260694 Ga0207639_102606942 157
1162 3300026089 Ga0207648_10028968 Ga0207648_100289684 157
1163 3300026118 Ga0207675_100356654 Ga0207675_1003566542 157
1164 3300026121 Ga0207683_10056986 Ga0207683_100569863 157
1165 3300026142 Ga0207698_10162127 Ga0207698_101621272 157
1166 3300027312 Ga0209371_1000028 Ga0209371_1000028147 157
1167 3300028379 Ga0268266_10000151 Ga0268266_1000015163 157
1168 3300028379 Ga0268266_10581766 Ga0268266_105817663 157
1169 3300030500 Ga0268256_1000030 Ga0268256_1000030247 157
1170 3300030732 Ga0316176_1187920 Ga0316176_11879202 157
1171 3300031911 Ga0307412_10062480 Ga0307412_100624802 157
1172 3300031995 Ga0307409_101683372 Ga0307409_1016833721 157
1173 3300032004 Ga0307414_10220320 Ga0307414_102203202 157
1174 3300035170 Ga0373943_0129621 Ga0373943_0129621_337_846 157
1175 3300037312 Ga0395899_0626142 Ga0395899_0626142_165_659 157
1176 3300037312 Ga0395899_0655322 Ga0395899_0655322_110_604 157
1177 3300037418 Ga0395900_0009317 Ga0395900_0009317_8715_9209 157
1178 3300037418 Ga0395900_0053933 Ga0395900_0053933_1879_2373 157
1179 3300037418 Ga0395900_0448761 Ga0395900_0448761_636_1130 157
1180 3300037466 Ga0395898_0050459 Ga0395898_0050459_533_1027 157
1181 3300037466 Ga0395898_1522818 Ga0395898_1522818_15_512 157
1182 3300037471 Ga0395905_0023772 Ga0395905_0023772_2935_3429 157
1183 3300037471 Ga0395905_0124851 Ga0395905_0124851_1568_2113 157
1184 3300037471 Ga0395905_0149119 Ga0395905_0149119_877_1371 157
1185 3300038443 Ga0395901_0137817 Ga0395901_0137817_1755_2249 157
1186 3300038443 Ga0395901_0332396 Ga0395901_0332396_991_1485 157
1187 3300038443 Ga0395901_0560693 Ga0395901_0560693_434_979 157
1188 3300044694 Ga0466963_0110777 Ga0466963_0110777_496_993 157
1189 3300044842 Ga0466957_0026451 Ga0466957_0026451_2016_2513 157
1190 3300045836 Ga0466958_0002060 Ga0466958_0002060_8841_9338 157
1191 3300045976 Ga0466967_0042363 Ga0466967_0042363_1950_2447 157
1192 3300046507 Ga0495606_0066190 Ga0495606_0066190_430_942 157
1193 3300046512 Ga0495610_0044356 Ga0495610_0044356_817_1329 157
1194 3300046538 Ga0495609_0104816 Ga0495609_0104816_125_682 157
1195 3300046558 Ga0495633_0056991 Ga0495633_0056991_397_900 157
1196 3300047469 Ga0495673_0106654 Ga0495673_0106654_488_1003 157
1197 3300047472 Ga0495686_0000182 Ga0495686_0000182_112430_112945 157
1198 3300048905 Ga0496102_0195888 Ga0496102_0195888_907_1398 157
1199 3300048909 Ga0496106_0813755 Ga0496106_0813755_88_579 157
1200 3300048911 Ga0496108_0003893 Ga0496108_0003893_4064_4576 157
1201 3300048920 Ga0496117_0010280 Ga0496117_0010280_290_802 157
1202 3300048923 Ga0496120_0260189 Ga0496120_0260189_37_558 157
1203 3300048924 Ga0496121_0012732 Ga0496121_0012732_6880_7482 157
1204 3300048925 Ga0496122_0003385 Ga0496122_0003385_9097_9600 157
1205 3300048926 Ga0496123_0002800 Ga0496123_0002800_11361_11864 157
1206 3300048927 Ga0496124_0042334 Ga0496124_0042334_1301_1813 157
1207 3300048928 Ga0496125_0014951 Ga0496125_0014951_5044_5547 157
1208 3300048928 Ga0496125_0027074 Ga0496125_0027074_3414_3926 157
1209 3300048929 Ga0496126_0015817 Ga0496126_0015817_4422_4934 157
1210 3300049823 Ga0501044_0184924 Ga0501044_0184924_257_778 157
1211 3300053094 Ga0500566_0105181 Ga0500566_0105181_210_722 157
1212 3300053122 Ga0500608_251959 Ga0500608_251959_86_598 157
1213 3300061719 Ga0466962_0038278 Ga0466962_0038278_359_856 157
1214 3300031995 Ga0307409_101034378 Ga0307409_1010343781 158
1215 3300046459 Ga0495629_0182170 Ga0495629_0182170_896_1396 158
1216 3300053108 Ga0500562_039263 Ga0500562_039263_460_957 161
1217 3300053151 Ga0500604_0086357 Ga0500604_0086357_467_964 161
1218 3300001904 JGI24736J21556_1002369 JGI24736J21556_10023692 162
1219 3300001915 JGI24741J21665_1000198 JGI24741J21665_100019818 162
1220 3300001979 JGI24740J21852_10001054 JGI24740J21852_1000105411 162
1221 3300001989 JGI24739J22299_10002070 JGI24739J22299_100020702 162
1222 3300001990 JGI24737J22298_10008900 JGI24737J22298_100089002 162
1223 3300002067 JGI24735J21928_10010800 JGI24735J21928_100108003 162
1224 3300002075 JGI24738J21930_10005547 JGI24738J21930_100055473 162
1225 3300005289 Ga0065704_10237949 Ga0065704_102379491 162
1226 3300005327 Ga0070658_10032177 Ga0070658_100321774 162
1227 3300005337 Ga0070682_100987579 Ga0070682_1009875792 162
1228 3300005339 Ga0070660_100022163 Ga0070660_1000221634 162
1229 3300005344 Ga0070661_100175803 Ga0070661_1001758032 162
1230 3300005366 Ga0070659_100169360 Ga0070659_1001693602 162
1231 3300005455 Ga0070663_100001009 Ga0070663_1000010098 162
1232 3300005457 Ga0070662_100349288 Ga0070662_1003492882 162
1233 3300005563 Ga0068855_100082562 Ga0068855_1000825624 162
1234 3300005564 Ga0070664_100074467 Ga0070664_1000744673 162
1235 3300005578 Ga0068854_100731882 Ga0068854_1007318822 162
1236 3300005614 Ga0068856_100004000 Ga0068856_1000040004 162
1237 3300005834 Ga0068851_10068132 Ga0068851_100681322 162
1238 3300017792 Ga0163161_10013539 Ga0163161_100135394 162
1239 3300022467 Ga0224712_10449412 Ga0224712_104494122 162
1240 3300025321 Ga0207656_10510998 Ga0207656_105109981 162
1241 3300025735 Ga0207713_1027757 Ga0207713_10277573 162
1242 3300025904 Ga0207647_10013775 Ga0207647_100137753 162
1243 3300025911 Ga0207654_10007510 Ga0207654_100075104 162
1244 3300025914 Ga0207671_10294114 Ga0207671_102941142 162
1245 3300025919 Ga0207657_10021754 Ga0207657_100217542 162
1246 3300025920 Ga0207649_10033321 Ga0207649_100333213 162
1247 3300025924 Ga0207694_10020452 Ga0207694_100204522 162
1248 3300025933 Ga0207706_10158402 Ga0207706_101584022 162
1249 3300025945 Ga0207679_10175104 Ga0207679_101751042 162
1250 3300025949 Ga0207667_10034541 Ga0207667_100345413 162
1251 3300025961 Ga0207712_10241815 Ga0207712_102418152 162
1252 3300025981 Ga0207640_10004569 Ga0207640_100045692 162
1253 3300026041 Ga0207639_10000815 Ga0207639_1000081517 162
1254 3300026067 Ga0207678_10000080 Ga0207678_1000008014 162
1255 3300026078 Ga0207702_10158309 Ga0207702_101583092 162
1256 3300026116 Ga0207674_10014354 Ga0207674_100143546 162
1257 3300026142 Ga0207698_10303009 Ga0207698_103030092 162
1258 3300031548 Ga0307408_100077337 Ga0307408_1000773372 162
1259 3300031852 Ga0307410_10322245 Ga0307410_103222452 162
1260 3300031901 Ga0307406_10209961 Ga0307406_102099612 162
1261 3300031903 Ga0307407_10028015 Ga0307407_100280152 162
1262 3300031911 Ga0307412_10021668 Ga0307412_100216682 162
1263 3300031911 Ga0307412_10122973 Ga0307412_101229732 162
1264 3300031911 Ga0307412_10852919 Ga0307412_108529191 162
1265 3300031995 Ga0307409_100328843 Ga0307409_1003288432 162
1266 3300032005 Ga0307411_11449635 Ga0307411_114496352 162
1267 3300046537 Ga0495598_0000546 Ga0495598_0000546_541_1041 162
1268 3300046539 Ga0495621_0009087 Ga0495621_0009087_330_830 162
1269 3300053138 Ga0500564_083228 Ga0500564_083228_579_1073 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

81

199

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hch-assembly1.cif.gz_A structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.9759 38 161
3cxk-assembly1.cif.gz_A 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. 0.9715 35 162
6q9v-assembly1.cif.gz_A msrb3 0.9698 34 162
6q9v-assembly2.cif.gz_B msrb3 0.9686 35 161
7cto-assembly1.cif.gz_A staphylococcus aureus msrb 0.9674 48 161
ID Description Score Start End Superfamily
af_P34436_5_152_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9883 39 162 2.170.150.20
af_Q78J03_33_175_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.987 39 162 2.170.150.20
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9808 32 161 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9742 35 162 2.170.150.20
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9733 34 162 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A0W1II67-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 1.004 39 162 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A1E4JIP6-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 1.004 39 162 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A3S1RGZ6-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 1.002 62 162 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A1Q3UPU9-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 1.001 39 162 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-F7UEF1-F1-model_v4 deleted 1.001 39 162

Feature Viewer

pLDDT pTM Quality
85.96 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map