F492346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1265 | 695 | 839 | 442 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0025614|Ga0496117_0025614_2719_4176 |
| Length | 480 |
| Sequence | VTITILCAKWKLRFAIFTACFCPNLLGTHNYIAPWRATLMLSIFKPAPHRPQVADDRVDPLYRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLVMGFVPWATSSIMVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWKAALYMPAFGAILIAIIAFALMRDTPQSCGLPPIEAWKNDYPPDYNEDHEQELTAKQIFMQYILPNKLLWYIALANVFVYLLRYGILDWSPTYLKEVKHFTLDKSSWAYFFYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATVVYWLNPPGNPGIDMLCMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDYFGWDGGFIVMIGGSVLAVTMVSEHKHKKQLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 4 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 7 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 8 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 9 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 10 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 11 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 12 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 13 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 14 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 15 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 16 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 17 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 18 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 19 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 20 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 21 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 22 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 23 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 24 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 25 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 26 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 27 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 28 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 29 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 30 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 31 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 32 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 33 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 34 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 35 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 36 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 37 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 38 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 39 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 40 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 41 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 42 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 43 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 44 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 45 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 46 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 47 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 48 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 49 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 50 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 51 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 52 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 53 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 54 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 55 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 56 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 57 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 58 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 59 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 60 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 61 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 62 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 63 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 64 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 65 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 66 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 67 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 68 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 69 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 70 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 71 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 72 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 73 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 74 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 75 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 76 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 77 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 78 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 79 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 80 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 81 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 82 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 83 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 84 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 85 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 86 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 87 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 88 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 89 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 90 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 91 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 92 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 93 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 94 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 95 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 96 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 97 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 98 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 99 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 100 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 101 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 102 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 103 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 104 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 105 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 106 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 107 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 108 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 109 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 110 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 111 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 112 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 113 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 114 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 115 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 116 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 117 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 118 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 119 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 120 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 121 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 122 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 123 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 124 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 125 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 126 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 127 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 128 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 129 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 130 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 131 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 132 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 133 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 134 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 135 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 136 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 137 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 138 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 139 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 140 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 141 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 142 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 143 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 144 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 145 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 146 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 147 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 148 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 149 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 150 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 151 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 152 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 153 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 154 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 155 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 156 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 157 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 158 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 159 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 160 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 161 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 162 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 163 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 164 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 165 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 166 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 167 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 168 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 169 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 170 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 171 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 172 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 173 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 174 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 175 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 176 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 177 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 178 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 179 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 180 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 181 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 182 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 183 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 184 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 185 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 186 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 187 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 188 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 189 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 190 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 191 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 192 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 193 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 194 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 195 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 196 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 197 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 198 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 199 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 200 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 201 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 202 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 203 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 204 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 205 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 206 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 207 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 208 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 209 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 210 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 211 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 212 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 213 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 214 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 215 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 216 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 217 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 218 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 219 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 220 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 221 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 222 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 223 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 224 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 225 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 226 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 227 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 228 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 229 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 230 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 231 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 232 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 233 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 234 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 235 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 236 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 237 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 238 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 239 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 240 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 241 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 242 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 243 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 244 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 245 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 246 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 247 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 248 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 249 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 250 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 251 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 252 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 253 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 254 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 255 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 256 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 257 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 258 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 259 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 260 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 261 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 262 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 263 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 264 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 265 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 266 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 267 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 268 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 269 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 270 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 271 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 272 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 273 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 274 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 275 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 276 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 277 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 278 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 279 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 280 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 281 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 282 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 283 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 284 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 285 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 286 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 287 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 288 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 289 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 290 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 291 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 292 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 293 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 294 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 295 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 296 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 297 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 298 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 299 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 300 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 301 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 302 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 303 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 304 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 305 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 306 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 307 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 308 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 309 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 310 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 311 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 312 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 313 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 314 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 315 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 316 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 317 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 318 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 319 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 320 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 321 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 322 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 323 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 324 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 325 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 326 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 327 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 328 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 329 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 330 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 331 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 332 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 333 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 334 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 335 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 336 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 337 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 338 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 339 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 340 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 341 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 342 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 343 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 344 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 345 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 346 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 347 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 348 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 349 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 350 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 351 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 352 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 353 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 354 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 355 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 356 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 357 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 358 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 359 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 360 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 361 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 362 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 363 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 364 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 365 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 366 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 367 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 368 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 369 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 370 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 371 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 372 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 373 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 374 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 375 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 376 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 377 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 378 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 379 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 380 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 381 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 382 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 383 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 384 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 385 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 386 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 387 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 388 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 389 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 390 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 391 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 392 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 393 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 394 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 395 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 396 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 397 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 398 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 399 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 400 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 401 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 402 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 403 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 404 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 405 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 406 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 407 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 408 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 409 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 410 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 411 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 412 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 413 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 414 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 415 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 416 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 417 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 418 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 419 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 420 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 421 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 422 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 423 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 424 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 425 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 426 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 427 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 428 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 429 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 430 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 431 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 433 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 434 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 435 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 436 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 437 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 438 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 439 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 440 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 441 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 443 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 445 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 446 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 447 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 448 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 449 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 450 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 451 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 452 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 453 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 454 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 455 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 456 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 457 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 458 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 459 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 460 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 461 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 462 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 463 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 464 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 465 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 466 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 467 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 468 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 469 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 470 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 471 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 472 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 473 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 474 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 475 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 476 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 477 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 478 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 479 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 480 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 481 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 482 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 483 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 484 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 485 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 486 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 487 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 488 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 489 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 490 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 491 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 492 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 514 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 516 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 518 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 519 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 520 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 521 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 522 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 523 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 524 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 525 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 526 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 527 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 528 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 529 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 530 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 531 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 532 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 533 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 534 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 535 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 536 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 537 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 538 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 539 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 540 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 541 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 542 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 543 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 544 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 545 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 546 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 547 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 548 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 549 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 550 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 551 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 552 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 553 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 554 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 555 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 556 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 557 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 558 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 559 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 560 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 561 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 562 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 620 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 621 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 622 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 623 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 624 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 625 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 626 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 627 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 628 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 629 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 630 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 631 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 632 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 633 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 634 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 635 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 638 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 639 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 640 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 641 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 642 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 643 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 644 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 645 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 646 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 647 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 648 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 649 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 650 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 651 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 652 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 653 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 654 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 655 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 656 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 657 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 658 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 659 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 660 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 661 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 662 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 663 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 664 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 665 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 666 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 667 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 668 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 669 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 670 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 671 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 672 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 673 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 674 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 675 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 676 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 677 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 678 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 679 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 680 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 681 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 682 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 683 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 684 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 685 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 686 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 687 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 688 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 689 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 690 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 691 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 692 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 693 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 694 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 695 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 66.17 |
| Metatranscriptomes | 0.16 |
| Isolates | 33.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0.08 |
| Endosphere | 7.67 |
| Nodule | 3.48 |
| Rhizoplane | 8.85 |
| Rhizosphere | 59.45 |
| Stem | 0.08 |
| Stem Tuber | 0.4 |
| Unclassified | 19.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_718 | 2124908027 | Bacteria | 55855 |
| 2 | SwRhRL2b_contig_1551154 | 2162886007 | Bacteria | 3487 |
| 3 | SwRhRL2b_contig_437820 | 2162886007 | Bacteria | 1693 |
| 4 | SwRhRL2b_contig_455968 | 2162886007 | Bacteria | 5396 |
| 5 | SwRhRL2b_contig_578990 | 2162886007 | Bacteria | 3244 |
| 6 | SwRhRL2b_contig_994871 | 2162886007 | Bacteria | 5629 |
| 7 | JGI24739J22299_10000016 | 3300001989 | Bacteria | 51238 |
| 8 | JGI25162J39368_1000116 | 3300002737 | Bacteria | 87942 |
| 9 | JGI25162J39368_1001123 | 3300002737 | Bacteria | 16116 |
| 10 | JGI25163J39215_1000099 | 3300002771 | Bacteria | 35819 |
| 11 | JGI25163J39215_1001049 | 3300002771 | Bacteria | 5909 |
| 12 | JGI25164J39214_1000095 | 3300002772 | Bacteria | 87499 |
| 13 | JGI25164J39214_1000593 | 3300002772 | Bacteria | 16116 |
| 14 | JGI25152J39213_1000056 | 3300002773 | Bacteria | 75516 |
| 15 | JGI25152J39213_1000339 | 3300002773 | Bacteria | 29759 |
| 16 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 17 | JGI25159J45721_1006060 | 3300002987 | Bacteria | 3677 |
| 18 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 19 | JGI25151J46595_10000035 | 3300003187 | Bacteria | 191977 |
| 20 | JGI25151J46595_10000945 | 3300003187 | Bacteria | 22468 |
| 21 | JGI25151J46595_10006233 | 3300003187 | Bacteria | 6032 |
| 22 | JGI25151J46595_10028999 | 3300003187 | Bacteria | 2198 |
| 23 | JGI25165J46597_1001173 | 3300003214 | Bacteria | 16116 |
| 24 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 25 | rootH2_10023223 | 3300003320 | Bacteria | 7261 |
| 26 | Ga0006562J51391_1000535 | 3300003578 | Bacteria | 11920 |
| 27 | Ga0006562J51391_1015515 | 3300003578 | Bacteria | 2620 |
| 28 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 29 | Ga0055538_1000077 | 3300003751 | Bacteria | 87507 |
| 30 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 31 | Ga0055539_1000114 | 3300003752 | Bacteria | 89618 |
| 32 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 33 | Ga0055533_1000122 | 3300003756 | Bacteria | 89163 |
| 34 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 35 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 36 | Ga0055525_1000155 | 3300003759 | Bacteria | 91530 |
| 37 | Ga0055535_1004747 | 3300003761 | Bacteria | 3194 |
| 38 | Ga0055536_1001844 | 3300003781 | Bacteria | 12389 |
| 39 | Ga0055536_1004928 | 3300003781 | Bacteria | 6653 |
| 40 | Ga0055536_1005802 | 3300003781 | Bacteria | 5943 |
| 41 | Ga0055530_10001310 | 3300003791 | Bacteria | 18721 |
| 42 | Ga0055530_10001782 | 3300003791 | Bacteria | 14972 |
| 43 | Ga0055530_10002801 | 3300003791 | Bacteria | 10727 |
| 44 | Ga0055540_1000960 | 3300003792 | Bacteria | 18721 |
| 45 | Ga0055540_1001320 | 3300003792 | Bacteria | 14972 |
| 46 | Ga0055540_1002155 | 3300003792 | Bacteria | 10727 |
| 47 | Ga0055531_10000404 | 3300003794 | Bacteria | 41520 |
| 48 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 49 | Ga0055541_1000078 | 3300003841 | Bacteria | 88505 |
| 50 | Ga0058692_1000145 | 3300003856 | Bacteria | 44977 |
| 51 | Ga0058692_1000179 | 3300003856 | Bacteria | 38966 |
| 52 | Ga0058692_1000253 | 3300003856 | Bacteria | 29276 |
| 53 | Ga0058692_1000280 | 3300003856 | Bacteria | 27042 |
| 54 | Ga0058692_1000310 | 3300003856 | Bacteria | 24410 |
| 55 | Ga0058692_1001395 | 3300003856 | Bacteria | 8928 |
| 56 | Ga0058692_1001400 | 3300003856 | Bacteria | 8913 |
| 57 | Ga0058692_1006561 | 3300003856 | Bacteria | 3174 |
| 58 | Ga0058692_1010808 | 3300003856 | Bacteria | 2240 |
| 59 | Ga0065714_10002460 | 3300005288 | Bacteria | 16953 |
| 60 | Ga0065714_10005031 | 3300005288 | Bacteria | 6556 |
| 61 | Ga0065714_10022596 | 3300005288 | Bacteria | 1445 |
| 62 | Ga0065714_10065075 | 3300005288 | Bacteria | 13216 |
| 63 | Ga0065714_10073013 | 3300005288 | Bacteria | 3259 |
| 64 | Ga0065714_10089184 | 3300005288 | Bacteria | 1989 |
| 65 | Ga0065704_10000343 | 3300005289 | Bacteria | 29340 |
| 66 | Ga0065704_10001316 | 3300005289 | Bacteria | 16704 |
| 67 | Ga0065704_10001437 | 3300005289 | Bacteria | 28307 |
| 68 | Ga0065704_10003028 | 3300005289 | Bacteria | 4934 |
| 69 | Ga0065704_10070757 | 3300005289 | Bacteria | 16643 |
| 70 | Ga0065712_10002401 | 3300005290 | Bacteria | 6922 |
| 71 | Ga0065712_10067900 | 3300005290 | Bacteria | 22102 |
| 72 | Ga0070683_100005759 | 3300005329 | Bacteria | 10355 |
| 73 | Ga0070670_100003472 | 3300005331 | Bacteria | 13080 |
| 74 | Ga0070680_100220304 | 3300005336 | Bacteria | 1602 |
| 75 | Ga0070661_100000126 | 3300005344 | Bacteria | 63357 |
| 76 | Ga0070668_100027375 | 3300005347 | Bacteria | 4328 |
| 77 | Ga0070669_100001006 | 3300005353 | Bacteria | 20540 |
| 78 | Ga0070669_100080329 | 3300005353 | Bacteria | 2427 |
| 79 | Ga0070659_100111356 | 3300005366 | Bacteria | 2210 |
| 80 | Ga0070662_100000101 | 3300005457 | Bacteria | 47097 |
| 81 | Ga0070662_100052936 | 3300005457 | Bacteria | 2937 |
| 82 | Ga0070681_10128269 | 3300005458 | Bacteria | 2469 |
| 83 | Ga0068853_100000372 | 3300005539 | Bacteria | 30828 |
| 84 | Ga0070665_100000276 | 3300005548 | Bacteria | 84448 |
| 85 | Ga0070665_100000467 | 3300005548 | Bacteria | 58613 |
| 86 | Ga0070665_100013985 | 3300005548 | Bacteria | 8071 |
| 87 | Ga0070665_100185969 | 3300005548 | Bacteria | 2078 |
| 88 | Ga0070665_100233546 | 3300005548 | Bacteria | 1839 |
| 89 | Ga0070704_100042282 | 3300005549 | Bacteria | 3151 |
| 90 | Ga0070664_100001357 | 3300005564 | Bacteria | 19532 |
| 91 | Ga0068857_100000064 | 3300005577 | Bacteria | 59060 |
| 92 | Ga0068857_100042383 | 3300005577 | Bacteria | 4038 |
| 93 | Ga0068854_100021339 | 3300005578 | Bacteria | 4394 |
| 94 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 95 | Ga0068851_10013386 | 3300005834 | Bacteria | 3883 |
| 96 | Ga0068858_100052783 | 3300005842 | Bacteria | 3761 |
| 97 | Ga0075364_10009444 | 3300006051 | Bacteria | 5853 |
| 98 | Ga0075364_10033974 | 3300006051 | Bacteria | 3287 |
| 99 | Ga0075432_10001293 | 3300006058 | Bacteria | 8077 |
| 100 | Ga0075432_10011785 | 3300006058 | Bacteria | 2971 |
| 101 | Ga0075366_10038054 | 3300006195 | Bacteria | 2841 |
| 102 | Ga0097621_100029319 | 3300006237 | Bacteria | 4345 |
| 103 | Ga0075428_100018591 | 3300006844 | Bacteria | 7680 |
| 104 | Ga0075433_10001141 | 3300006852 | Bacteria | 19255 |
| 105 | Ga0075434_100002344 | 3300006871 | Bacteria | 16581 |
| 106 | Ga0079104_1000018 | 3300006946 | Bacteria | 271088 |
| 107 | Ga0079104_1000135 | 3300006946 | Bacteria | 103632 |
| 108 | Ga0079104_1000424 | 3300006946 | Bacteria | 48276 |
| 109 | Ga0079104_1000487 | 3300006946 | Bacteria | 43465 |
| 110 | Ga0079104_1000686 | 3300006946 | Bacteria | 31211 |
| 111 | Ga0079104_1000822 | 3300006946 | Bacteria | 25893 |
| 112 | Ga0079104_1001947 | 3300006946 | Bacteria | 12253 |
| 113 | Ga0079104_1002354 | 3300006946 | Bacteria | 10339 |
| 114 | Ga0079104_1002560 | 3300006946 | Bacteria | 9590 |
| 115 | Ga0079104_1003027 | 3300006946 | Bacteria | 8251 |
| 116 | Ga0099826_10050979 | 3300006948 | Bacteria | 2779 |
| 117 | Ga0105251_10000386 | 3300009011 | Bacteria | 43038 |
| 118 | Ga0105251_10000533 | 3300009011 | Bacteria | 35947 |
| 119 | Ga0105251_10000749 | 3300009011 | Bacteria | 29646 |
| 120 | Ga0105251_10001420 | 3300009011 | Bacteria | 20643 |
| 121 | Ga0105251_10001635 | 3300009011 | Bacteria | 18974 |
| 122 | Ga0105251_10001765 | 3300009011 | Bacteria | 18003 |
| 123 | Ga0105251_10001772 | 3300009011 | Bacteria | 17958 |
| 124 | Ga0105251_10003712 | 3300009011 | Bacteria | 10951 |
| 125 | Ga0105251_10008923 | 3300009011 | Bacteria | 5995 |
| 126 | Ga0105251_10009501 | 3300009011 | Bacteria | 5740 |
| 127 | Ga0105251_10010285 | 3300009011 | Bacteria | 5440 |
| 128 | Ga0105251_10014212 | 3300009011 | Bacteria | 4416 |
| 129 | Ga0105251_10037172 | 3300009011 | Bacteria | 2391 |
| 130 | Ga0105251_10042042 | 3300009011 | Bacteria | 2221 |
| 131 | Ga0105244_10000119 | 3300009036 | Bacteria | 83366 |
| 132 | Ga0105244_10000198 | 3300009036 | Bacteria | 61281 |
| 133 | Ga0105244_10000551 | 3300009036 | Bacteria | 33478 |
| 134 | Ga0105244_10000566 | 3300009036 | Bacteria | 33080 |
| 135 | Ga0105244_10000588 | 3300009036 | Bacteria | 32617 |
| 136 | Ga0105244_10001453 | 3300009036 | Bacteria | 19179 |
| 137 | Ga0105244_10002581 | 3300009036 | Bacteria | 13605 |
| 138 | Ga0105244_10003769 | 3300009036 | Bacteria | 10700 |
| 139 | Ga0105244_10004028 | 3300009036 | Bacteria | 10262 |
| 140 | Ga0105244_10006059 | 3300009036 | Bacteria | 7918 |
| 141 | Ga0105244_10008686 | 3300009036 | Bacteria | 6321 |
| 142 | Ga0105244_10010258 | 3300009036 | Bacteria | 5689 |
| 143 | Ga0105244_10012531 | 3300009036 | Bacteria | 5003 |
| 144 | Ga0105244_10018552 | 3300009036 | Bacteria | 3900 |
| 145 | Ga0105244_10020188 | 3300009036 | Bacteria | 3704 |
| 146 | Ga0105244_10022097 | 3300009036 | Bacteria | 3506 |
| 147 | Ga0105244_10027916 | 3300009036 | Bacteria | 3035 |
| 148 | Ga0105244_10052855 | 3300009036 | Bacteria | 2067 |
| 149 | Ga0105244_10083730 | 3300009036 | Bacteria | 1576 |
| 150 | Ga0105250_10000018 | 3300009092 | Bacteria | 246692 |
| 151 | Ga0105250_10000742 | 3300009092 | Bacteria | 19871 |
| 152 | Ga0105250_10000844 | 3300009092 | Bacteria | 18167 |
| 153 | Ga0105250_10000981 | 3300009092 | Bacteria | 16625 |
| 154 | Ga0105250_10001000 | 3300009092 | Bacteria | 16414 |
| 155 | Ga0105250_10001145 | 3300009092 | Bacteria | 14916 |
| 156 | Ga0105250_10005913 | 3300009092 | Bacteria | 5411 |
| 157 | Ga0105250_10007623 | 3300009092 | Bacteria | 4638 |
| 158 | Ga0105250_10010031 | 3300009092 | Bacteria | 3963 |
| 159 | Ga0105250_10014050 | 3300009092 | Bacteria | 3296 |
| 160 | Ga0105240_10073931 | 3300009093 | Bacteria | 4208 |
| 161 | Ga0105240_10153427 | 3300009093 | Bacteria | 2741 |
| 162 | Ga0111539_10007585 | 3300009094 | Bacteria | 13862 |
| 163 | Ga0111539_10042148 | 3300009094 | Bacteria | 5485 |
| 164 | Ga0111539_10112156 | 3300009094 | Bacteria | 3199 |
| 165 | Ga0105247_10008979 | 3300009101 | Bacteria | 6092 |
| 166 | Ga0114129_10096618 | 3300009147 | Bacteria | 4090 |
| 167 | Ga0105243_10009208 | 3300009148 | Bacteria | 7538 |
| 168 | Ga0105243_10010014 | 3300009148 | Bacteria | 7208 |
| 169 | Ga0105243_10028970 | 3300009148 | Bacteria | 4255 |
| 170 | Ga0105243_10074567 | 3300009148 | Bacteria | 2752 |
| 171 | Ga0105243_10252811 | 3300009148 | Bacteria | 1574 |
| 172 | Ga0105243_10313400 | 3300009148 | Bacteria | 1426 |
| 173 | Ga0105241_10000010 | 3300009174 | Bacteria | 253836 |
| 174 | Ga0105242_10003232 | 3300009176 | Bacteria | 12701 |
| 175 | Ga0105248_10075012 | 3300009177 | Bacteria | 3801 |
| 176 | Ga0105237_10003007 | 3300009545 | Bacteria | 20351 |
| 177 | Ga0105237_10123033 | 3300009545 | Bacteria | 2589 |
| 178 | Ga0105237_10364905 | 3300009545 | Bacteria | 1449 |
| 179 | Ga0105246_10001513 | 3300011119 | Bacteria | 13785 |
| 180 | Ga0105246_10004667 | 3300011119 | Bacteria | 8340 |
| 181 | Ga0105246_10012052 | 3300011119 | Bacteria | 5386 |
| 182 | Ga0105246_10019537 | 3300011119 | Bacteria | 4331 |
| 183 | Ga0105246_10023518 | 3300011119 | Bacteria | 3988 |
| 184 | Ga0105246_10182328 | 3300011119 | Bacteria | 1618 |
| 185 | Ga0157345_1000367 | 3300012498 | Bacteria | 5092 |
| 186 | Ga0157373_10000114 | 3300013100 | Bacteria | 63657 |
| 187 | Ga0157373_10003979 | 3300013100 | Bacteria | 11145 |
| 188 | Ga0157373_10004112 | 3300013100 | Bacteria | 10971 |
| 189 | Ga0157373_10006121 | 3300013100 | Bacteria | 8998 |
| 190 | Ga0157373_10013471 | 3300013100 | Bacteria | 5999 |
| 191 | Ga0157373_10023741 | 3300013100 | Bacteria | 4444 |
| 192 | Ga0157373_10049600 | 3300013100 | Bacteria | 2991 |
| 193 | Ga0157373_10098682 | 3300013100 | Bacteria | 2056 |
| 194 | Ga0157373_10100142 | 3300013100 | Bacteria | 2039 |
| 195 | Ga0157371_10000102 | 3300013102 | Bacteria | 129057 |
| 196 | Ga0157371_10000245 | 3300013102 | Bacteria | 77139 |
| 197 | Ga0157371_10000554 | 3300013102 | Bacteria | 44435 |
| 198 | Ga0157371_10000577 | 3300013102 | Bacteria | 43493 |
| 199 | Ga0157371_10000835 | 3300013102 | Bacteria | 35218 |
| 200 | Ga0157371_10004029 | 3300013102 | Bacteria | 13002 |
| 201 | Ga0157371_10013824 | 3300013102 | Bacteria | 6115 |
| 202 | Ga0157371_10015950 | 3300013102 | Bacteria | 5621 |
| 203 | Ga0157371_10075932 | 3300013102 | Bacteria | 2380 |
| 204 | Ga0157371_10102009 | 3300013102 | Bacteria | 2035 |
| 205 | Ga0157371_10123392 | 3300013102 | Bacteria | 1842 |
| 206 | Ga0157370_10000444 | 3300013104 | Bacteria | 51739 |
| 207 | Ga0157370_10002220 | 3300013104 | Bacteria | 23680 |
| 208 | Ga0157370_10072395 | 3300013104 | Bacteria | 3252 |
| 209 | Ga0157370_10135121 | 3300013104 | Bacteria | 2299 |
| 210 | Ga0157369_10000375 | 3300013105 | Bacteria | 59272 |
| 211 | Ga0157369_10002994 | 3300013105 | Bacteria | 20216 |
| 212 | Ga0157369_10025810 | 3300013105 | Bacteria | 6517 |
| 213 | Ga0157369_10078363 | 3300013105 | Bacteria | 3540 |
| 214 | Ga0163162_10013860 | 3300013306 | Bacteria | 7875 |
| 215 | Ga0163162_10016516 | 3300013306 | Bacteria | 7213 |
| 216 | Ga0163162_10413907 | 3300013306 | Bacteria | 1480 |
| 217 | Ga0157372_10002660 | 3300013307 | Bacteria | 19360 |
| 218 | Ga0157372_10009383 | 3300013307 | Bacteria | 10409 |
| 219 | Ga0157372_10020816 | 3300013307 | Bacteria | 7083 |
| 220 | Ga0157372_10023100 | 3300013307 | Bacteria | 6739 |
| 221 | Ga0157372_10065898 | 3300013307 | Bacteria | 4068 |
| 222 | Ga0157372_10105263 | 3300013307 | Bacteria | 3227 |
| 223 | Ga0182008_10005323 | 3300014497 | Bacteria | 7350 |
| 224 | Ga0182008_10008883 | 3300014497 | Bacteria | 5451 |
| 225 | Ga0182008_10010865 | 3300014497 | Bacteria | 4858 |
| 226 | Ga0157379_10231696 | 3300014968 | Bacteria | 1674 |
| 227 | Ga0157379_10244193 | 3300014968 | Bacteria | 1629 |
| 228 | Ga0182006_1000018 | 3300015261 | Bacteria | 299376 |
| 229 | Ga0182006_1001964 | 3300015261 | Bacteria | 11646 |
| 230 | Ga0182006_1002621 | 3300015261 | Bacteria | 9719 |
| 231 | Ga0182006_1014858 | 3300015261 | Bacteria | 3348 |
| 232 | Ga0182006_1015427 | 3300015261 | Bacteria | 3275 |
| 233 | Ga0182006_1023329 | 3300015261 | Bacteria | 2563 |
| 234 | Ga0182007_10003484 | 3300015262 | Bacteria | 7408 |
| 235 | Ga0182005_1015617 | 3300015265 | Bacteria | 2116 |
| 236 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 237 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 238 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 239 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 240 | Ga0163161_10000006 | 3300017792 | Bacteria | 302708 |
| 241 | Ga0163161_10018448 | 3300017792 | Bacteria | 4890 |
| 242 | Ga0163161_10034235 | 3300017792 | Bacteria | 3633 |
| 243 | Ga0163161_10197136 | 3300017792 | Bacteria | 1550 |
| 244 | Ga0163161_10220152 | 3300017792 | Bacteria | 1470 |
| 245 | Ga0213876_10000023 | 3300021384 | Bacteria | 255370 |
| 246 | Ga0209435_100558 | 3300025206 | Bacteria | 7035 |
| 247 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 248 | Ga0209760_100066 | 3300025207 | Bacteria | 88259 |
| 249 | Ga0209760_102616 | 3300025207 | Bacteria | 1667 |
| 250 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 251 | Ga0209784_100064 | 3300025224 | Bacteria | 158058 |
| 252 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 253 | Ga0209566_100079 | 3300025225 | Bacteria | 158058 |
| 254 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 255 | Ga0209674_100159 | 3300025226 | Bacteria | 88259 |
| 256 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 257 | Ga0209147_101055 | 3300025229 | Bacteria | 11643 |
| 258 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 259 | Ga0209563_100135 | 3300025230 | Bacteria | 88259 |
| 260 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 261 | Ga0207427_100136 | 3300025231 | Bacteria | 88259 |
| 262 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 263 | Ga0209437_100092 | 3300025233 | Bacteria | 240044 |
| 264 | Ga0209437_100149 | 3300025233 | Bacteria | 158058 |
| 265 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 266 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 267 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 268 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 269 | Ga0209677_100110 | 3300025253 | Bacteria | 88259 |
| 270 | Ga0209759_1003625 | 3300025256 | Bacteria | 6077 |
| 271 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 272 | Ga0209129_1000037 | 3300025258 | Bacteria | 326534 |
| 273 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 274 | Ga0209233_1002353 | 3300025261 | Bacteria | 7032 |
| 275 | Ga0209130_1000293 | 3300025284 | Bacteria | 60879 |
| 276 | Ga0209675_1000989 | 3300025291 | Bacteria | 17959 |
| 277 | Ga0209675_1017451 | 3300025291 | Bacteria | 2049 |
| 278 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 279 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 280 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 281 | Ga0209676_1004747 | 3300025292 | Bacteria | 7428 |
| 282 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 283 | Ga0209025_1000031 | 3300025294 | Bacteria | 422015 |
| 284 | Ga0209025_1001280 | 3300025294 | Bacteria | 34557 |
| 285 | Ga0209025_1001433 | 3300025294 | Bacteria | 31455 |
| 286 | Ga0209025_1001685 | 3300025294 | Bacteria | 27007 |
| 287 | Ga0209025_1002689 | 3300025294 | Bacteria | 18126 |
| 288 | Ga0209025_1014973 | 3300025294 | Bacteria | 4719 |
| 289 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 290 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 291 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 292 | Ga0209050_1000518 | 3300025298 | Bacteria | 64332 |
| 293 | Ga0209050_1002563 | 3300025298 | Bacteria | 15157 |
| 294 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 295 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 296 | Ga0209051_1001294 | 3300025303 | Bacteria | 22056 |
| 297 | Ga0209051_1010681 | 3300025303 | Bacteria | 4605 |
| 298 | Ga0209257_1002874 | 3300025304 | Bacteria | 16040 |
| 299 | Ga0209257_1004425 | 3300025304 | Bacteria | 10900 |
| 300 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 301 | Ga0207696_1000013 | 3300025711 | Bacteria | 524881 |
| 302 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 303 | Ga0207696_1000046 | 3300025711 | Bacteria | 291327 |
| 304 | Ga0207696_1000067 | 3300025711 | Bacteria | 228478 |
| 305 | Ga0207696_1000100 | 3300025711 | Bacteria | 171029 |
| 306 | Ga0207696_1000357 | 3300025711 | Bacteria | 46078 |
| 307 | Ga0207696_1000404 | 3300025711 | Bacteria | 40294 |
| 308 | Ga0207696_1000434 | 3300025711 | Bacteria | 37870 |
| 309 | Ga0207696_1000820 | 3300025711 | Bacteria | 20003 |
| 310 | Ga0207696_1001144 | 3300025711 | Bacteria | 15249 |
| 311 | Ga0207696_1001207 | 3300025711 | Bacteria | 14700 |
| 312 | Ga0207696_1003421 | 3300025711 | Bacteria | 7245 |
| 313 | Ga0207696_1008529 | 3300025711 | Bacteria | 3906 |
| 314 | Ga0207696_1021488 | 3300025711 | Bacteria | 2066 |
| 315 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 316 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 317 | Ga0207655_1000036 | 3300025728 | Bacteria | 356747 |
| 318 | Ga0207655_1000111 | 3300025728 | Bacteria | 170772 |
| 319 | Ga0207655_1000115 | 3300025728 | Bacteria | 162114 |
| 320 | Ga0207655_1000170 | 3300025728 | Bacteria | 119267 |
| 321 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 322 | Ga0207655_1000208 | 3300025728 | Bacteria | 102775 |
| 323 | Ga0207655_1000284 | 3300025728 | Bacteria | 77444 |
| 324 | Ga0207655_1000388 | 3300025728 | Bacteria | 61513 |
| 325 | Ga0207655_1001163 | 3300025728 | Bacteria | 25594 |
| 326 | Ga0207655_1003418 | 3300025728 | Bacteria | 11839 |
| 327 | Ga0207655_1004304 | 3300025728 | Bacteria | 10174 |
| 328 | Ga0207655_1005474 | 3300025728 | Bacteria | 8620 |
| 329 | Ga0207655_1008224 | 3300025728 | Bacteria | 6650 |
| 330 | Ga0207655_1008594 | 3300025728 | Bacteria | 6460 |
| 331 | Ga0207655_1008819 | 3300025728 | Bacteria | 6344 |
| 332 | Ga0207655_1010707 | 3300025728 | Bacteria | 5540 |
| 333 | Ga0207655_1010965 | 3300025728 | Bacteria | 5445 |
| 334 | Ga0207655_1011441 | 3300025728 | Bacteria | 5284 |
| 335 | Ga0207655_1011686 | 3300025728 | Bacteria | 5200 |
| 336 | Ga0207655_1016389 | 3300025728 | Bacteria | 4055 |
| 337 | Ga0207655_1042728 | 3300025728 | Bacteria | 1926 |
| 338 | Ga0207713_1000045 | 3300025735 | Bacteria | 235202 |
| 339 | Ga0207713_1000047 | 3300025735 | Bacteria | 229463 |
| 340 | Ga0207713_1000056 | 3300025735 | Bacteria | 217615 |
| 341 | Ga0207713_1000075 | 3300025735 | Bacteria | 179242 |
| 342 | Ga0207713_1000079 | 3300025735 | Bacteria | 172274 |
| 343 | Ga0207713_1000083 | 3300025735 | Bacteria | 160973 |
| 344 | Ga0207713_1000613 | 3300025735 | Bacteria | 35114 |
| 345 | Ga0207713_1000659 | 3300025735 | Bacteria | 32880 |
| 346 | Ga0207713_1000837 | 3300025735 | Bacteria | 28361 |
| 347 | Ga0207713_1000881 | 3300025735 | Bacteria | 27355 |
| 348 | Ga0207713_1001328 | 3300025735 | Bacteria | 20264 |
| 349 | Ga0207713_1001352 | 3300025735 | Bacteria | 19999 |
| 350 | Ga0207713_1001441 | 3300025735 | Bacteria | 18998 |
| 351 | Ga0207713_1002574 | 3300025735 | Bacteria | 13101 |
| 352 | Ga0207713_1003273 | 3300025735 | Bacteria | 11149 |
| 353 | Ga0207713_1004380 | 3300025735 | Bacteria | 9174 |
| 354 | Ga0207713_1004600 | 3300025735 | Bacteria | 8915 |
| 355 | Ga0207713_1005089 | 3300025735 | Bacteria | 8343 |
| 356 | Ga0207713_1006514 | 3300025735 | Bacteria | 7100 |
| 357 | Ga0207713_1007461 | 3300025735 | Bacteria | 6449 |
| 358 | Ga0207713_1014577 | 3300025735 | Bacteria | 4076 |
| 359 | Ga0207713_1032998 | 3300025735 | Bacteria | 2266 |
| 360 | Ga0207713_1041473 | 3300025735 | Bacteria | 1920 |
| 361 | Ga0207710_10000024 | 3300025900 | Bacteria | 319633 |
| 362 | Ga0207654_10000010 | 3300025911 | Bacteria | 304367 |
| 363 | Ga0207707_10049888 | 3300025912 | Bacteria | 3646 |
| 364 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 365 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 366 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 367 | Ga0207681_10003495 | 3300025923 | Bacteria | 9785 |
| 368 | Ga0207650_10000338 | 3300025925 | Bacteria | 45436 |
| 369 | Ga0207650_10000564 | 3300025925 | Bacteria | 30060 |
| 370 | Ga0207706_10006159 | 3300025933 | Bacteria | 11140 |
| 371 | Ga0207706_10009041 | 3300025933 | Bacteria | 9165 |
| 372 | Ga0207709_10000248 | 3300025935 | Bacteria | 66465 |
| 373 | Ga0207709_10002118 | 3300025935 | Bacteria | 12768 |
| 374 | Ga0207709_10005277 | 3300025935 | Bacteria | 7348 |
| 375 | Ga0207709_10061385 | 3300025935 | Bacteria | 2349 |
| 376 | Ga0207661_10072049 | 3300025944 | Bacteria | 2826 |
| 377 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 378 | Ga0207651_10070235 | 3300025960 | Bacteria | 2477 |
| 379 | Ga0207640_10026125 | 3300025981 | Bacteria | 3542 |
| 380 | Ga0207639_10000286 | 3300026041 | Bacteria | 36062 |
| 381 | Ga0207708_10050675 | 3300026075 | Bacteria | 3160 |
| 382 | Ga0207648_10015778 | 3300026089 | Bacteria | 6928 |
| 383 | Ga0207674_10001883 | 3300026116 | Bacteria | 26719 |
| 384 | Ga0207674_10242856 | 3300026116 | Bacteria | 1748 |
| 385 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 386 | Ga0209281_1000006 | 3300027111 | Bacteria | 1170244 |
| 387 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 388 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 389 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 390 | Ga0209281_1000095 | 3300027111 | Bacteria | 238108 |
| 391 | Ga0209281_1000139 | 3300027111 | Bacteria | 179588 |
| 392 | Ga0209281_1000219 | 3300027111 | Bacteria | 123456 |
| 393 | Ga0209281_1000464 | 3300027111 | Bacteria | 57109 |
| 394 | Ga0209281_1000773 | 3300027111 | Bacteria | 30470 |
| 395 | Ga0209281_1000932 | 3300027111 | Bacteria | 24037 |
| 396 | Ga0209281_1001284 | 3300027111 | Bacteria | 16106 |
| 397 | Ga0209281_1003259 | 3300027111 | Bacteria | 5511 |
| 398 | Ga0209281_1010043 | 3300027111 | Bacteria | 2190 |
| 399 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 400 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 401 | Ga0209371_1000063 | 3300027312 | Bacteria | 218863 |
| 402 | Ga0209371_1000068 | 3300027312 | Bacteria | 209008 |
| 403 | Ga0209371_1000071 | 3300027312 | Bacteria | 200748 |
| 404 | Ga0209371_1000244 | 3300027312 | Bacteria | 67486 |
| 405 | Ga0209371_1000331 | 3300027312 | Bacteria | 51486 |
| 406 | Ga0209371_1000429 | 3300027312 | Bacteria | 42773 |
| 407 | Ga0209371_1000617 | 3300027312 | Bacteria | 31694 |
| 408 | Ga0209371_1000980 | 3300027312 | Bacteria | 22005 |
| 409 | Ga0209371_1001170 | 3300027312 | Bacteria | 19177 |
| 410 | Ga0209371_1001783 | 3300027312 | Bacteria | 13490 |
| 411 | Ga0209371_1002443 | 3300027312 | Bacteria | 10418 |
| 412 | Ga0209371_1004020 | 3300027312 | Bacteria | 6667 |
| 413 | Ga0209371_1004846 | 3300027312 | Bacteria | 5637 |
| 414 | Ga0209371_1006649 | 3300027312 | Bacteria | 4225 |
| 415 | Ga0207428_10022610 | 3300027907 | Bacteria | 5303 |
| 416 | Ga0207428_10055895 | 3300027907 | Bacteria | 3137 |
| 417 | Ga0207428_10094654 | 3300027907 | Bacteria | 2315 |
| 418 | Ga0207428_10099304 | 3300027907 | Bacteria | 2251 |
| 419 | Ga0207428_10100480 | 3300027907 | Bacteria | 2236 |
| 420 | Ga0207428_10148203 | 3300027907 | Bacteria | 1788 |
| 421 | Ga0268266_10000502 | 3300028379 | Bacteria | 55965 |
| 422 | Ga0268266_10017876 | 3300028379 | Bacteria | 6041 |
| 423 | Ga0268266_10036568 | 3300028379 | Bacteria | 4180 |
| 424 | Ga0307515_10097159 | 3300028794 | Bacteria | 3603 |
| 425 | Ga0237817_10004 | 3300030083 | Bacteria | 96242 |
| 426 | Ga0237817_10086 | 3300030083 | Bacteria | 28492 |
| 427 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 428 | Ga0268256_1000018 | 3300030500 | Bacteria | 594572 |
| 429 | Ga0268256_1000060 | 3300030500 | Bacteria | 218807 |
| 430 | Ga0268256_1000064 | 3300030500 | Bacteria | 210320 |
| 431 | Ga0268256_1000070 | 3300030500 | Bacteria | 189040 |
| 432 | Ga0268256_1000203 | 3300030500 | Bacteria | 67486 |
| 433 | Ga0268256_1000235 | 3300030500 | Bacteria | 58166 |
| 434 | Ga0268256_1000386 | 3300030500 | Bacteria | 40664 |
| 435 | Ga0268256_1000683 | 3300030500 | Bacteria | 25530 |
| 436 | Ga0268256_1000701 | 3300030500 | Bacteria | 25071 |
| 437 | Ga0268256_1001241 | 3300030500 | Bacteria | 15979 |
| 438 | Ga0268256_1002164 | 3300030500 | Bacteria | 10438 |
| 439 | Ga0268256_1003013 | 3300030500 | Bacteria | 7954 |
| 440 | Ga0268256_1003334 | 3300030500 | Bacteria | 7334 |
| 441 | Ga0268256_1005134 | 3300030500 | Bacteria | 5211 |
| 442 | Ga0268256_1006726 | 3300030500 | Bacteria | 4225 |
| 443 | Ga0268256_1008842 | 3300030500 | Bacteria | 3410 |
| 444 | Ga0316179_1074380 | 3300030734 | Bacteria | 3589 |
| 445 | Ga0316178_1051183 | 3300030735 | Bacteria | 40899 |
| 446 | Ga0316183_1004754 | 3300030742 | Bacteria | 7110 |
| 447 | Ga0265332_10004540 | 3300031238 | Bacteria | 6503 |
| 448 | Ga0265331_10042006 | 3300031250 | Bacteria | 2219 |
| 449 | Ga0307408_100008555 | 3300031548 | Bacteria | 6759 |
| 450 | Ga0307408_100025199 | 3300031548 | Bacteria | 4071 |
| 451 | Ga0307408_100030100 | 3300031548 | Bacteria | 3767 |
| 452 | Ga0265313_10009476 | 3300031595 | Bacteria | 6319 |
| 453 | Ga0265342_10002801 | 3300031712 | Bacteria | 14757 |
| 454 | Ga0307405_10003779 | 3300031731 | Bacteria | 7033 |
| 455 | Ga0307405_10009015 | 3300031731 | Bacteria | 5095 |
| 456 | Ga0307405_10024955 | 3300031731 | Bacteria | 3424 |
| 457 | Ga0307413_10020637 | 3300031824 | Bacteria | 3509 |
| 458 | Ga0307406_10063957 | 3300031901 | Bacteria | 2385 |
| 459 | Ga0307412_10003115 | 3300031911 | Bacteria | 9212 |
| 460 | Ga0307412_10006197 | 3300031911 | Bacteria | 6744 |
| 461 | Ga0307412_10008593 | 3300031911 | Bacteria | 5836 |
| 462 | Ga0307409_100026540 | 3300031995 | Bacteria | 4086 |
| 463 | Ga0307416_100154504 | 3300032002 | Unclassified | 2110 |
| 464 | Ga0307414_10028695 | 3300032004 | Bacteria | 3612 |
| 465 | Ga0307414_10061738 | 3300032004 | Bacteria | 2656 |
| 466 | Ga0307414_10093451 | 3300032004 | Bacteria | 2242 |
| 467 | Ga0307414_10102815 | 3300032004 | Bacteria | 2154 |
| 468 | Ga0307414_10117922 | 3300032004 | Bacteria | 2035 |
| 469 | Ga0307414_10212616 | 3300032004 | Bacteria | 1582 |
| 470 | Ga0307411_10007691 | 3300032005 | Bacteria | 5516 |
| 471 | Ga0395898_0026066 | 3300037466 | Bacteria | 5886 |
| 472 | Ga0395905_0011690 | 3300037471 | Bacteria | 8475 |
| 473 | Ga0237819_00136 | 3300038705 | Bacteria | 27619 |
| 474 | Ga0237819_00899 | 3300038705 | Bacteria | 9223 |
| 475 | Ga0237819_01191 | 3300038705 | Bacteria | 7310 |
| 476 | Ga0400490_02503 | 3300038726 | Bacteria | 40089 |
| 477 | Ga0400489_18894 | 3300039093 | Bacteria | 4958 |
| 478 | Ga0436365_0965775 | 3300039437 | Bacteria | 470291 |
| 479 | Ga0439438_000014 | 3300041405 | Bacteria | 130876 |
| 480 | Ga0439438_003322 | 3300041405 | Bacteria | 6539 |
| 481 | Ga0439438_003720 | 3300041405 | Bacteria | 6060 |
| 482 | Ga0439438_003853 | 3300041405 | Bacteria | 5916 |
| 483 | Ga0439438_005789 | 3300041405 | Bacteria | 4487 |
| 484 | Ga0439438_007455 | 3300041405 | Bacteria | 3739 |
| 485 | Ga0439438_007874 | 3300041405 | Bacteria | 3593 |
| 486 | Ga0439447_003919 | 3300041407 | Bacteria | 5213 |
| 487 | Ga0439447_004242 | 3300041407 | Bacteria | 4967 |
| 488 | Ga0439447_005799 | 3300041407 | Bacteria | 4073 |
| 489 | Ga0439447_008267 | 3300041407 | Bacteria | 3233 |
| 490 | Ga0439466_0000008 | 3300041411 | Bacteria | 246721 |
| 491 | Ga0451853_2848169 | 3300041512 | Bacteria | 4112 |
| 492 | Ga0439432_000624 | 3300042006 | Bacteria | 13327 |
| 493 | Ga0439432_000659 | 3300042006 | Bacteria | 12908 |
| 494 | Ga0439432_003130 | 3300042006 | Bacteria | 6157 |
| 495 | Ga0439432_005623 | 3300042006 | Bacteria | 4507 |
| 496 | Ga0439432_022443 | 3300042006 | Bacteria | 2084 |
| 497 | Ga0439451_017439 | 3300042009 | Bacteria | 1447 |
| 498 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 499 | Ga0439452_000020 | 3300042010 | Bacteria | 309345 |
| 500 | Ga0439452_000023 | 3300042010 | Bacteria | 232427 |
| 501 | Ga0439452_000112 | 3300042010 | Bacteria | 64831 |
| 502 | Ga0439452_000370 | 3300042010 | Bacteria | 27188 |
| 503 | Ga0439452_003394 | 3300042010 | Bacteria | 5585 |
| 504 | Ga0439452_003587 | 3300042010 | Bacteria | 5407 |
| 505 | Ga0439463_000362 | 3300042016 | Bacteria | 12623 |
| 506 | Ga0439463_008252 | 3300042016 | Bacteria | 2566 |
| 507 | Ga0450911_002076 | 3300042115 | Bacteria | 4114 |
| 508 | Ga0450920_001025 | 3300042122 | Bacteria | 4574 |
| 509 | Ga0450890_001315 | 3300042127 | Bacteria | 3588 |
| 510 | Ga0450903_003208 | 3300042138 | Bacteria | 2845 |
| 511 | Ga0450906_001093 | 3300042145 | Bacteria | 5991 |
| 512 | Ga0450907_000030 | 3300042146 | Bacteria | 68375 |
| 513 | Ga0450907_001550 | 3300042146 | Bacteria | 4895 |
| 514 | Ga0450907_007918 | 3300042146 | Bacteria | 1769 |
| 515 | Ga0439446_0033311 | 3300042156 | Bacteria | 1496 |
| 516 | Ga0439440_0003394 | 3300042993 | Bacteria | 3069 |
| 517 | Ga0466981_0000013 | 3300044669 | Bacteria | 129274 |
| 518 | Ga0453684_0001338 | 3300044712 | Bacteria | 72311 |
| 519 | Ga0453684_0001761 | 3300044712 | Bacteria | 57844 |
| 520 | Ga0453684_0025986 | 3300044712 | Bacteria | 8479 |
| 521 | Ga0451576_0000051 | 3300045051 | Bacteria | 313453 |
| 522 | Ga0451576_0000696 | 3300045051 | Bacteria | 68242 |
| 523 | Ga0451576_0005481 | 3300045051 | Bacteria | 15882 |
| 524 | Ga0451576_0100909 | 3300045051 | Bacteria | 3001 |
| 525 | Ga0466967_0000405 | 3300045976 | Bacteria | 20295 |
| 526 | Ga0495617_001747 | 3300046452 | Bacteria | 9281 |
| 527 | Ga0495627_000240 | 3300046453 | Bacteria | 57483 |
| 528 | Ga0495590_0007182 | 3300046457 | Bacteria | 4308 |
| 529 | Ga0495590_0033417 | 3300046457 | Bacteria | 1798 |
| 530 | Ga0495591_000031 | 3300046458 | Bacteria | 177747 |
| 531 | Ga0495591_000113 | 3300046458 | Bacteria | 93452 |
| 532 | Ga0495591_000294 | 3300046458 | Bacteria | 45588 |
| 533 | Ga0495591_000539 | 3300046458 | Bacteria | 29095 |
| 534 | Ga0495591_003979 | 3300046458 | Bacteria | 7406 |
| 535 | Ga0495591_010554 | 3300046458 | Bacteria | 3571 |
| 536 | Ga0495653_0007201 | 3300046463 | Bacteria | 9116 |
| 537 | Ga0495650_0000047 | 3300046471 | Bacteria | 335136 |
| 538 | Ga0495650_0000199 | 3300046471 | Bacteria | 130411 |
| 539 | Ga0495650_0000360 | 3300046471 | Bacteria | 80145 |
| 540 | Ga0495650_0000623 | 3300046471 | Bacteria | 47691 |
| 541 | Ga0495650_0004070 | 3300046471 | Bacteria | 10227 |
| 542 | Ga0495650_0011199 | 3300046471 | Bacteria | 4935 |
| 543 | Ga0495650_0031114 | 3300046471 | Bacteria | 2406 |
| 544 | Ga0495580_0000209 | 3300046472 | Bacteria | 45294 |
| 545 | Ga0495605_0000100 | 3300046474 | Bacteria | 109002 |
| 546 | Ga0495605_0000122 | 3300046474 | Bacteria | 101994 |
| 547 | Ga0495605_0000720 | 3300046474 | Bacteria | 24370 |
| 548 | Ga0495605_0010155 | 3300046474 | Bacteria | 5272 |
| 549 | Ga0495605_0016621 | 3300046474 | Bacteria | 3980 |
| 550 | Ga0495639_0003206 | 3300046475 | Bacteria | 7110 |
| 551 | Ga0495584_0008007 | 3300046491 | Bacteria | 5492 |
| 552 | Ga0495584_0008818 | 3300046491 | Bacteria | 5214 |
| 553 | Ga0495584_0011877 | 3300046491 | Bacteria | 4453 |
| 554 | Ga0495585_0016562 | 3300046492 | Bacteria | 4271 |
| 555 | Ga0495585_0023700 | 3300046492 | Bacteria | 3521 |
| 556 | Ga0495585_0033759 | 3300046492 | Bacteria | 2894 |
| 557 | Ga0495596_0023127 | 3300046500 | Bacteria | 2523 |
| 558 | Ga0495607_0002708 | 3300046501 | Bacteria | 14140 |
| 559 | Ga0495607_0005213 | 3300046501 | Bacteria | 9350 |
| 560 | Ga0495607_0005252 | 3300046501 | Bacteria | 9319 |
| 561 | Ga0495607_0007508 | 3300046501 | Bacteria | 7531 |
| 562 | Ga0495607_0014541 | 3300046501 | Bacteria | 5118 |
| 563 | Ga0495607_0020817 | 3300046501 | Bacteria | 4138 |
| 564 | Ga0495583_0000174 | 3300046506 | Bacteria | 109079 |
| 565 | Ga0495583_0001423 | 3300046506 | Bacteria | 24377 |
| 566 | Ga0495583_0003451 | 3300046506 | Bacteria | 12018 |
| 567 | Ga0495583_0004441 | 3300046506 | Bacteria | 10036 |
| 568 | Ga0495583_0007528 | 3300046506 | Bacteria | 6815 |
| 569 | Ga0495583_0010934 | 3300046506 | Bacteria | 5242 |
| 570 | Ga0495606_0000541 | 3300046507 | Bacteria | 60650 |
| 571 | Ga0495606_0002133 | 3300046507 | Bacteria | 23878 |
| 572 | Ga0495606_0135995 | 3300046507 | Bacteria | 1455 |
| 573 | Ga0495610_0009567 | 3300046512 | Bacteria | 6112 |
| 574 | Ga0495610_0031458 | 3300046512 | Bacteria | 2768 |
| 575 | Ga0495616_0011485 | 3300046513 | Bacteria | 5070 |
| 576 | Ga0495616_0058159 | 3300046513 | Bacteria | 1904 |
| 577 | Ga0495620_0000416 | 3300046515 | Bacteria | 28487 |
| 578 | Ga0495620_0007001 | 3300046515 | Bacteria | 6154 |
| 579 | Ga0495631_0003022 | 3300046518 | Bacteria | 9311 |
| 580 | Ga0495632_0000855 | 3300046519 | Bacteria | 26752 |
| 581 | Ga0495632_0010624 | 3300046519 | Bacteria | 5433 |
| 582 | Ga0495632_0037589 | 3300046519 | Bacteria | 2455 |
| 583 | Ga0495632_0048273 | 3300046519 | Bacteria | 2108 |
| 584 | Ga0495637_0000045 | 3300046520 | Bacteria | 108215 |
| 585 | Ga0495637_0001490 | 3300046520 | Bacteria | 13729 |
| 586 | Ga0495637_0008188 | 3300046520 | Bacteria | 5144 |
| 587 | Ga0495637_0016425 | 3300046520 | Bacteria | 3459 |
| 588 | Ga0495637_0042148 | 3300046520 | Bacteria | 1954 |
| 589 | Ga0495637_0048225 | 3300046520 | Bacteria | 1794 |
| 590 | Ga0495637_0069479 | 3300046520 | Bacteria | 1425 |
| 591 | Ga0495644_0011465 | 3300046523 | Bacteria | 3413 |
| 592 | Ga0495648_0083880 | 3300046524 | Bacteria | 1804 |
| 593 | Ga0495642_0001762 | 3300046528 | Bacteria | 9324 |
| 594 | Ga0495642_0009839 | 3300046528 | Bacteria | 3662 |
| 595 | Ga0495654_0000040 | 3300046530 | Bacteria | 184580 |
| 596 | Ga0495654_0000519 | 3300046530 | Bacteria | 31360 |
| 597 | Ga0495654_0002898 | 3300046530 | Bacteria | 10753 |
| 598 | Ga0495654_0010746 | 3300046530 | Bacteria | 4972 |
| 599 | Ga0495654_0012988 | 3300046530 | Bacteria | 4462 |
| 600 | Ga0495654_0013134 | 3300046530 | Bacteria | 4435 |
| 601 | Ga0495654_0032482 | 3300046530 | Bacteria | 2646 |
| 602 | Ga0495654_0051859 | 3300046530 | Bacteria | 2000 |
| 603 | Ga0495654_0062000 | 3300046530 | Bacteria | 1793 |
| 604 | Ga0495587_0051785 | 3300046536 | Bacteria | 2425 |
| 605 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 606 | Ga0495609_0000088 | 3300046538 | Bacteria | 109269 |
| 607 | Ga0495609_0000132 | 3300046538 | Bacteria | 80926 |
| 608 | Ga0495609_0017630 | 3300046538 | Bacteria | 3314 |
| 609 | Ga0495609_0057145 | 3300046538 | Bacteria | 1727 |
| 610 | Ga0495597_0000240 | 3300046542 | Bacteria | 49641 |
| 611 | Ga0495597_0003419 | 3300046542 | Bacteria | 9274 |
| 612 | Ga0495597_0046301 | 3300046542 | Bacteria | 1927 |
| 613 | Ga0495597_0053024 | 3300046542 | Bacteria | 1784 |
| 614 | Ga0495622_0006401 | 3300046557 | Bacteria | 5466 |
| 615 | Ga0495633_0000777 | 3300046558 | Bacteria | 28543 |
| 616 | Ga0495633_0032126 | 3300046558 | Bacteria | 2537 |
| 617 | Ga0495656_0008683 | 3300046615 | Bacteria | 3635 |
| 618 | Ga0495656_0040629 | 3300046615 | Bacteria | 1939 |
| 619 | Ga0495668_0004362 | 3300046616 | Bacteria | 10095 |
| 620 | Ga0495668_0005152 | 3300046616 | Bacteria | 8974 |
| 621 | Ga0495668_0025862 | 3300046616 | Bacteria | 3333 |
| 622 | Ga0495634_0029979 | 3300046642 | Bacteria | 3761 |
| 623 | Ga0495611_0004481 | 3300046648 | Bacteria | 6048 |
| 624 | Ga0495611_0013263 | 3300046648 | Bacteria | 3506 |
| 625 | Ga0495625_0000061 | 3300046660 | Bacteria | 179140 |
| 626 | Ga0495625_0006163 | 3300046660 | Bacteria | 10742 |
| 627 | Ga0495625_0027918 | 3300046660 | Bacteria | 4238 |
| 628 | Ga0495635_0031677 | 3300046663 | Bacteria | 3669 |
| 629 | Ga0495659_0002272 | 3300046664 | Bacteria | 6233 |
| 630 | Ga0495661_0000060 | 3300046665 | Bacteria | 131162 |
| 631 | Ga0495661_0000072 | 3300046665 | Bacteria | 120743 |
| 632 | Ga0495661_0000841 | 3300046665 | Bacteria | 28595 |
| 633 | Ga0495661_0030018 | 3300046665 | Bacteria | 3464 |
| 634 | Ga0495623_0029954 | 3300046679 | Bacteria | 3502 |
| 635 | Ga0495669_0022243 | 3300046684 | Bacteria | 2753 |
| 636 | Ga0495624_0005415 | 3300046690 | Bacteria | 9200 |
| 637 | Ga0495670_0016631 | 3300046691 | Bacteria | 3617 |
| 638 | Ga0495670_0018111 | 3300046691 | Bacteria | 3469 |
| 639 | Ga0495670_0102119 | 3300046691 | Bacteria | 1477 |
| 640 | Ga0495671_0011769 | 3300046692 | Bacteria | 4796 |
| 641 | Ga0495671_0012410 | 3300046692 | Bacteria | 4655 |
| 642 | Ga0495671_0013286 | 3300046692 | Bacteria | 4466 |
| 643 | Ga0495671_0029446 | 3300046692 | Bacteria | 2819 |
| 644 | Ga0495671_0030945 | 3300046692 | Bacteria | 2738 |
| 645 | Ga0495649_0001082 | 3300046694 | Bacteria | 21260 |
| 646 | Ga0495649_0001630 | 3300046694 | Bacteria | 16705 |
| 647 | Ga0495649_0004431 | 3300046694 | Bacteria | 9174 |
| 648 | Ga0495649_0006493 | 3300046694 | Bacteria | 7278 |
| 649 | Ga0495649_0015624 | 3300046694 | Bacteria | 4316 |
| 650 | Ga0495649_0022169 | 3300046694 | Bacteria | 3553 |
| 651 | Ga0495649_0023816 | 3300046694 | Bacteria | 3418 |
| 652 | Ga0495589_0002988 | 3300046794 | Bacteria | 9315 |
| 653 | Ga0495589_0004351 | 3300046794 | Bacteria | 7554 |
| 654 | Ga0495589_0057788 | 3300046794 | Bacteria | 1907 |
| 655 | Ga0495660_0000045 | 3300046810 | Bacteria | 150303 |
| 656 | Ga0495660_0000134 | 3300046810 | Bacteria | 80417 |
| 657 | Ga0495660_0004806 | 3300046810 | Bacteria | 8152 |
| 658 | Ga0495660_0020584 | 3300046810 | Bacteria | 3781 |
| 659 | Ga0495604_0012472 | 3300047317 | Bacteria | 6759 |
| 660 | Ga0495604_0043272 | 3300047317 | Bacteria | 3526 |
| 661 | Ga0495672_0000070 | 3300047320 | Bacteria | 184471 |
| 662 | Ga0495672_0000083 | 3300047320 | Bacteria | 158118 |
| 663 | Ga0495672_0000224 | 3300047320 | Bacteria | 80413 |
| 664 | Ga0495672_0004169 | 3300047320 | Bacteria | 11998 |
| 665 | Ga0495672_0004529 | 3300047320 | Bacteria | 11335 |
| 666 | Ga0495672_0006578 | 3300047320 | Bacteria | 8952 |
| 667 | Ga0495672_0017583 | 3300047320 | Bacteria | 4779 |
| 668 | Ga0495672_0018934 | 3300047320 | Bacteria | 4556 |
| 669 | Ga0495672_0029790 | 3300047320 | Bacteria | 3431 |
| 670 | Ga0495676_0000011 | 3300047321 | Bacteria | 242612 |
| 671 | Ga0495676_0007808 | 3300047321 | Bacteria | 9815 |
| 672 | Ga0495676_0039201 | 3300047321 | Bacteria | 3926 |
| 673 | Ga0495680_0014189 | 3300047322 | Bacteria | 6912 |
| 674 | Ga0495683_0000070 | 3300047323 | Bacteria | 108186 |
| 675 | Ga0495683_0000362 | 3300047323 | Bacteria | 37471 |
| 676 | Ga0495683_0009052 | 3300047323 | Bacteria | 5307 |
| 677 | Ga0495683_0013020 | 3300047323 | Bacteria | 4355 |
| 678 | Ga0495683_0022696 | 3300047323 | Bacteria | 3226 |
| 679 | Ga0495683_0061129 | 3300047323 | Bacteria | 1865 |
| 680 | Ga0495687_011045 | 3300047443 | Bacteria | 4889 |
| 681 | Ga0495687_031458 | 3300047443 | Bacteria | 2434 |
| 682 | Ga0495677_0007419 | 3300047445 | Bacteria | 4099 |
| 683 | Ga0495679_000021 | 3300047446 | Bacteria | 226183 |
| 684 | Ga0495679_000028 | 3300047446 | Bacteria | 192300 |
| 685 | Ga0495679_000867 | 3300047446 | Bacteria | 19100 |
| 686 | Ga0495679_003543 | 3300047446 | Bacteria | 7461 |
| 687 | Ga0495673_0000114 | 3300047469 | Bacteria | 159048 |
| 688 | Ga0495673_0000622 | 3300047469 | Bacteria | 34841 |
| 689 | Ga0495673_0002493 | 3300047469 | Bacteria | 12887 |
| 690 | Ga0495673_0002965 | 3300047469 | Bacteria | 11438 |
| 691 | Ga0495673_0003291 | 3300047469 | Bacteria | 10722 |
| 692 | Ga0495673_0003710 | 3300047469 | Bacteria | 9931 |
| 693 | Ga0495673_0004185 | 3300047469 | Bacteria | 9113 |
| 694 | Ga0495673_0004320 | 3300047469 | Bacteria | 8946 |
| 695 | Ga0495673_0012251 | 3300047469 | Bacteria | 4559 |
| 696 | Ga0495673_0012739 | 3300047469 | Bacteria | 4441 |
| 697 | Ga0495681_0004600 | 3300047470 | Bacteria | 9385 |
| 698 | Ga0495681_0010607 | 3300047470 | Bacteria | 5569 |
| 699 | Ga0495681_0010847 | 3300047470 | Bacteria | 5482 |
| 700 | Ga0495626_0009113 | 3300048091 | Bacteria | 5381 |
| 701 | Ga0495626_0013014 | 3300048091 | Bacteria | 4337 |
| 702 | Ga0495626_0036221 | 3300048091 | Bacteria | 2351 |
| 703 | Ga0496101_0000119 | 3300048904 | Bacteria | 77119 |
| 704 | Ga0496102_0012189 | 3300048905 | Bacteria | 7432 |
| 705 | Ga0496102_0048468 | 3300048905 | Bacteria | 3862 |
| 706 | Ga0496103_0007163 | 3300048906 | Bacteria | 6652 |
| 707 | Ga0496104_0005440 | 3300048907 | Bacteria | 11145 |
| 708 | Ga0496105_0066793 | 3300048908 | Bacteria | 2969 |
| 709 | Ga0496116_0000058 | 3300048919 | Bacteria | 279767 |
| 710 | Ga0496116_0000282 | 3300048919 | Bacteria | 87438 |
| 711 | Ga0496116_0000521 | 3300048919 | Bacteria | 51818 |
| 712 | Ga0496116_0001110 | 3300048919 | Bacteria | 32241 |
| 713 | Ga0496116_0001287 | 3300048919 | Bacteria | 28859 |
| 714 | Ga0496116_0014450 | 3300048919 | Bacteria | 6303 |
| 715 | Ga0496116_0020828 | 3300048919 | Bacteria | 4966 |
| 716 | Ga0496116_0020959 | 3300048919 | Bacteria | 4944 |
| 717 | Ga0496116_0033523 | 3300048919 | Bacteria | 3643 |
| 718 | Ga0496116_0034975 | 3300048919 | Bacteria | 3535 |
| 719 | Ga0496116_0036842 | 3300048919 | Bacteria | 3418 |
| 720 | Ga0496116_0037302 | 3300048919 | Bacteria | 3390 |
| 721 | Ga0496117_0000450 | 3300048920 | Bacteria | 68428 |
| 722 | Ga0496117_0000470 | 3300048920 | Bacteria | 66974 |
| 723 | Ga0496117_0001133 | 3300048920 | Bacteria | 40208 |
| 724 | Ga0496117_0001270 | 3300048920 | Bacteria | 37430 |
| 725 | Ga0496117_0002802 | 3300048920 | Bacteria | 21283 |
| 726 | Ga0496117_0005202 | 3300048920 | Bacteria | 13842 |
| 727 | Ga0496117_0007574 | 3300048920 | Bacteria | 10566 |
| 728 | Ga0496117_0014495 | 3300048920 | Bacteria | 6785 |
| 729 | Ga0496117_0017576 | 3300048920 | Bacteria | 5967 |
| 730 | Ga0496117_0025614 | 3300048920 | Bacteria | 4634 |
| 731 | Ga0496117_0037276 | 3300048920 | Bacteria | 3624 |
| 732 | Ga0496117_0047865 | 3300048920 | Bacteria | 3061 |
| 733 | Ga0496118_0000490 | 3300048921 | Bacteria | 65592 |
| 734 | Ga0496118_0002301 | 3300048921 | Bacteria | 25935 |
| 735 | Ga0496118_0002440 | 3300048921 | Bacteria | 25026 |
| 736 | Ga0496118_0003453 | 3300048921 | Bacteria | 19890 |
| 737 | Ga0496118_0004790 | 3300048921 | Bacteria | 15801 |
| 738 | Ga0496118_0006664 | 3300048921 | Bacteria | 12600 |
| 739 | Ga0496118_0014636 | 3300048921 | Bacteria | 7331 |
| 740 | Ga0496118_0082265 | 3300048921 | Bacteria | 2257 |
| 741 | Ga0496118_0153835 | 3300048921 | Bacteria | 1434 |
| 742 | Ga0496119_0000194 | 3300048922 | Bacteria | 85475 |
| 743 | Ga0496119_0000219 | 3300048922 | Bacteria | 81203 |
| 744 | Ga0496119_0000490 | 3300048922 | Bacteria | 53979 |
| 745 | Ga0496119_0000680 | 3300048922 | Bacteria | 45409 |
| 746 | Ga0496119_0000706 | 3300048922 | Bacteria | 44781 |
| 747 | Ga0496119_0001325 | 3300048922 | Bacteria | 30443 |
| 748 | Ga0496119_0003360 | 3300048922 | Bacteria | 16657 |
| 749 | Ga0496119_0006499 | 3300048922 | Bacteria | 10795 |
| 750 | Ga0496119_0006577 | 3300048922 | Bacteria | 10713 |
| 751 | Ga0496119_0012834 | 3300048922 | Bacteria | 6756 |
| 752 | Ga0496119_0025897 | 3300048922 | Bacteria | 4083 |
| 753 | Ga0496119_0041728 | 3300048922 | Bacteria | 2917 |
| 754 | Ga0496120_0000108 | 3300048923 | Bacteria | 138566 |
| 755 | Ga0496120_0000279 | 3300048923 | Bacteria | 85805 |
| 756 | Ga0496120_0000301 | 3300048923 | Bacteria | 82406 |
| 757 | Ga0496120_0000476 | 3300048923 | Bacteria | 62924 |
| 758 | Ga0496120_0000813 | 3300048923 | Bacteria | 44710 |
| 759 | Ga0496120_0001708 | 3300048923 | Bacteria | 25110 |
| 760 | Ga0496120_0001730 | 3300048923 | Bacteria | 24837 |
| 761 | Ga0496120_0002311 | 3300048923 | Bacteria | 19699 |
| 762 | Ga0496120_0003918 | 3300048923 | Bacteria | 12988 |
| 763 | Ga0496120_0009747 | 3300048923 | Bacteria | 6774 |
| 764 | Ga0496120_0010365 | 3300048923 | Bacteria | 6509 |
| 765 | Ga0496120_0091791 | 3300048923 | Bacteria | 1620 |
| 766 | Ga0496121_0000074 | 3300048924 | Bacteria | 243022 |
| 767 | Ga0496121_0002538 | 3300048924 | Bacteria | 27667 |
| 768 | Ga0496121_0003070 | 3300048924 | Bacteria | 24190 |
| 769 | Ga0496121_0004761 | 3300048924 | Bacteria | 17911 |
| 770 | Ga0496121_0006595 | 3300048924 | Bacteria | 14318 |
| 771 | Ga0496121_0031698 | 3300048924 | Bacteria | 4823 |
| 772 | Ga0496121_0048053 | 3300048924 | Bacteria | 3634 |
| 773 | Ga0496121_0055202 | 3300048924 | Bacteria | 3311 |
| 774 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 775 | Ga0496122_0000398 | 3300048925 | Bacteria | 92491 |
| 776 | Ga0496122_0000607 | 3300048925 | Bacteria | 73586 |
| 777 | Ga0496122_0002360 | 3300048925 | Bacteria | 27157 |
| 778 | Ga0496122_0003475 | 3300048925 | Bacteria | 20727 |
| 779 | Ga0496122_0003481 | 3300048925 | Bacteria | 20706 |
| 780 | Ga0496122_0007269 | 3300048925 | Bacteria | 12382 |
| 781 | Ga0496122_0033526 | 3300048925 | Bacteria | 4221 |
| 782 | Ga0496122_0088199 | 3300048925 | Bacteria | 2127 |
| 783 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 784 | Ga0496123_0000302 | 3300048926 | Bacteria | 95750 |
| 785 | Ga0496123_0000451 | 3300048926 | Bacteria | 73603 |
| 786 | Ga0496123_0001246 | 3300048926 | Bacteria | 36873 |
| 787 | Ga0496123_0002061 | 3300048926 | Bacteria | 25933 |
| 788 | Ga0496123_0002802 | 3300048926 | Bacteria | 20706 |
| 789 | Ga0496123_0008055 | 3300048926 | Bacteria | 9749 |
| 790 | Ga0496123_0009458 | 3300048926 | Bacteria | 8774 |
| 791 | Ga0496123_0064996 | 3300048926 | Bacteria | 2321 |
| 792 | Ga0496123_0067544 | 3300048926 | Bacteria | 2257 |
| 793 | Ga0496123_0080135 | 3300048926 | Bacteria | 1991 |
| 794 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 795 | Ga0496124_0000165 | 3300048927 | Bacteria | 134661 |
| 796 | Ga0496124_0000304 | 3300048927 | Bacteria | 90806 |
| 797 | Ga0496124_0000379 | 3300048927 | Bacteria | 81086 |
| 798 | Ga0496124_0001441 | 3300048927 | Bacteria | 35169 |
| 799 | Ga0496124_0009646 | 3300048927 | Bacteria | 9888 |
| 800 | Ga0496124_0011464 | 3300048927 | Bacteria | 8861 |
| 801 | Ga0496124_0021157 | 3300048927 | Bacteria | 5996 |
| 802 | Ga0496124_0021548 | 3300048927 | Bacteria | 5937 |
| 803 | Ga0496124_0026575 | 3300048927 | Bacteria | 5216 |
| 804 | Ga0496124_0050341 | 3300048927 | Bacteria | 3550 |
| 805 | Ga0496124_0059496 | 3300048927 | Bacteria | 3209 |
| 806 | Ga0496125_0000091 | 3300048928 | Bacteria | 212668 |
| 807 | Ga0496125_0001589 | 3300048928 | Bacteria | 32202 |
| 808 | Ga0496125_0013508 | 3300048928 | Bacteria | 8022 |
| 809 | Ga0496125_0016893 | 3300048928 | Bacteria | 6985 |
| 810 | Ga0496125_0027923 | 3300048928 | Bacteria | 5104 |
| 811 | Ga0496126_0003284 | 3300048929 | Bacteria | 20622 |
| 812 | Ga0496126_0004579 | 3300048929 | Bacteria | 16401 |
| 813 | Ga0496126_0024800 | 3300048929 | Bacteria | 5782 |
| 814 | Ga0496126_0079929 | 3300048929 | Bacteria | 2893 |
| 815 | Ga0496126_0238728 | 3300048929 | Bacteria | 1519 |
| 816 | Ga0495678_000325 | 3300049459 | Bacteria | 50656 |
| 817 | Ga0495678_000337 | 3300049459 | Bacteria | 49208 |
| 818 | Ga0495678_000692 | 3300049459 | Bacteria | 30773 |
| 819 | Ga0495678_007952 | 3300049459 | Bacteria | 5429 |
| 820 | Ga0495678_011303 | 3300049459 | Bacteria | 4280 |
| 821 | Ga0495678_023888 | 3300049459 | Bacteria | 2648 |
| 822 | Ga0495678_046604 | 3300049459 | Bacteria | 1702 |
| 823 | Ga0495682_0000139 | 3300049460 | Bacteria | 62814 |
| 824 | Ga0495682_0000607 | 3300049460 | Bacteria | 24172 |
| 825 | Ga0501033_0020049 | 3300049570 | Bacteria | 5055 |
| 826 | Ga0501068_0009844 | 3300049584 | Bacteria | 5354 |
| 827 | Ga0501076_0081564 | 3300049592 | Bacteria | 2597 |
| 828 | Ga0501217_032818 | 3300049661 | Bacteria | 1286 |
| 829 | Ga0501223_000540 | 3300049663 | Bacteria | 9116 |
| 830 | Ga0501259_000748 | 3300049688 | Bacteria | 5311 |
| 831 | Ga0501221_004019 | 3300049704 | Unclassified | 2430 |
| 832 | Ga0501225_0005805 | 3300049705 | Bacteria | 3615 |
| 833 | Ga0501241_003383 | 3300049758 | Bacteria | 3010 |
| 834 | nmdc:mga0k408_12604_c2 | 3300050493 | Bacteria | 2331 |
| 835 | nmdc:mga08y16_124914_c1 | 3300050511 | Bacteria | 2677 |
| 836 | nmdc:mga08y16_171893_c1 | 3300050511 | Bacteria | 2251 |
| 837 | nmdc:mga0a205_2066_c1 | 3300050515 | Bacteria | 17562 |
| 838 | Ga0500618_007715 | 3300053125 | Bacteria | 3047 |
| 839 | Ga0500621_000018 | 3300053126 | Bacteria | 80374 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048921 | Ga0496118_0153835 | Ga0496118_0153835_29_1228 | 366 |
| 2 | 3300048922 | Ga0496119_0006577 | Ga0496119_0006577_97_1467 | 367 |
| 3 | 3300049661 | Ga0501217_032818 | Ga0501217_032818_50_1246 | 397 |
| 4 | 3300031238 | Ga0265332_10004540 | Ga0265332_100045406 | 401 |
| 5 | 3300031712 | Ga0265342_10002801 | Ga0265342_1000280112 | 401 |
| 6 | 3300045051 | Ga0451576_0005481 | Ga0451576_0005481_1611_2918 | 404 |
| 7 | 3300005289 | Ga0065704_10001316 | Ga0065704_1000131615 | 409 |
| 8 | 3300005548 | Ga0070665_100185969 | Ga0070665_1001859691 | 409 |
| 9 | 3300006852 | Ga0075433_10001141 | Ga0075433_100011412 | 409 |
| 10 | 3300006871 | Ga0075434_100002344 | Ga0075434_1000023448 | 409 |
| 11 | 3300009011 | Ga0105251_10000749 | Ga0105251_1000074920 | 409 |
| 12 | 3300009011 | Ga0105251_10037172 | Ga0105251_100371722 | 409 |
| 13 | 3300009036 | Ga0105244_10004028 | Ga0105244_100040287 | 409 |
| 14 | 3300025735 | Ga0207713_1000047 | Ga0207713_1000047171 | 409 |
| 15 | 3300025735 | Ga0207713_1032998 | Ga0207713_10329981 | 409 |
| 16 | 3300048929 | Ga0496126_0238728 | Ga0496126_0238728_80_1426 | 409 |
| 17 | 3300050511 | nmdc:mga08y16_124914_c1 | nmdc:mga08y16_124914_c1_368_1714 | 409 |
| 18 | 3300050515 | nmdc:mga0a205_2066_c1 | nmdc:mga0a205_2066_c1_11032_12378 | 409 |
| 19 | 2162886007 | SwRhRL2b_contig_1551154 | SwRhRL2b_0251.00004660 | 410 |
| 20 | 2162886007 | SwRhRL2b_contig_994871 | SwRhRL2b_0799.00008010 | 410 |
| 21 | 3300005289 | Ga0065704_10003028 | Ga0065704_100030283 | 410 |
| 22 | 3300009092 | Ga0105250_10000844 | Ga0105250_100008442 | 410 |
| 23 | 3300025711 | Ga0207696_1001144 | Ga0207696_10011449 | 410 |
| 24 | 3300025728 | Ga0207655_1000036 | Ga0207655_1000036319 | 410 |
| 25 | 3300025735 | Ga0207713_1041473 | Ga0207713_10414731 | 410 |
| 26 | 3300027111 | Ga0209281_1000464 | Ga0209281_100046436 | 410 |
| 27 | 3300027312 | Ga0209371_1000244 | Ga0209371_100024429 | 410 |
| 28 | 3300030500 | Ga0268256_1000203 | Ga0268256_100020332 | 410 |
| 29 | 3300048919 | Ga0496116_0033523 | Ga0496116_0033523_1914_3284 | 410 |
| 30 | 3300048924 | Ga0496121_0004761 | Ga0496121_0004761_785_2155 | 410 |
| 31 | 3300048925 | Ga0496122_0000003 | Ga0496122_0000003_459249_460619 | 410 |
| 32 | 3300048926 | Ga0496123_0000012 | Ga0496123_0000012_214432_215802 | 410 |
| 33 | 3300048922 | Ga0496119_0001325 | Ga0496119_0001325_25155_26501 | 411 |
| 34 | 3300048923 | Ga0496120_0001730 | Ga0496120_0001730_21997_23343 | 411 |
| 35 | 3300003856 | Ga0058692_1000280 | Ga0058692_10002806 | 412 |
| 36 | 3300006946 | Ga0079104_1000487 | Ga0079104_100048735 | 412 |
| 37 | 3300027312 | Ga0209371_1002443 | Ga0209371_10024437 | 412 |
| 38 | 3300030500 | Ga0268256_1002164 | Ga0268256_10021647 | 412 |
| 39 | 3300027111 | Ga0209281_1000219 | Ga0209281_1000219109 | 413 |
| 40 | 3300030500 | Ga0268256_1000235 | Ga0268256_100023528 | 413 |
| 41 | 3300006946 | Ga0079104_1000686 | Ga0079104_10006867 | 414 |
| 42 | 3300013307 | Ga0157372_10023100 | Ga0157372_100231005 | 414 |
| 43 | 3300027111 | Ga0209281_1000006 | Ga0209281_100000628 | 414 |
| 44 | 3300027312 | Ga0209371_1004846 | Ga0209371_10048462 | 414 |
| 45 | 3300030500 | Ga0268256_1005134 | Ga0268256_10051344 | 414 |
| 46 | 2162886007 | SwRhRL2b_contig_455968 | SwRhRL2b_0692.00000630 | 415 |
| 47 | 3300005289 | Ga0065704_10000343 | Ga0065704_100003435 | 415 |
| 48 | 3300005548 | Ga0070665_100000276 | Ga0070665_10000027646 | 415 |
| 49 | 3300006051 | Ga0075364_10009444 | Ga0075364_100094445 | 415 |
| 50 | 3300013100 | Ga0157373_10023741 | Ga0157373_100237412 | 415 |
| 51 | 3300013102 | Ga0157371_10102009 | Ga0157371_101020092 | 415 |
| 52 | 3300013104 | Ga0157370_10002220 | Ga0157370_1000222010 | 415 |
| 53 | 3300025728 | Ga0207655_1000002 | Ga0207655_1000002291 | 415 |
| 54 | 3300025735 | Ga0207713_1004600 | Ga0207713_10046003 | 415 |
| 55 | 3300028379 | Ga0268266_10000502 | Ga0268266_1000050221 | 415 |
| 56 | 3300041512 | Ga0451853_2848169 | Ga0451853_2848169_1965_3317 | 415 |
| 57 | 3300042010 | Ga0439452_000112 | Ga0439452_000112_31469_32821 | 415 |
| 58 | 3300046471 | Ga0495650_0000047 | Ga0495650_0000047_95590_96942 | 415 |
| 59 | 3300048919 | Ga0496116_0001287 | Ga0496116_0001287_4530_5882 | 415 |
| 60 | 3300048920 | Ga0496117_0002802 | Ga0496117_0002802_7540_8892 | 415 |
| 61 | 3300048921 | Ga0496118_0003453 | Ga0496118_0003453_10999_12351 | 415 |
| 62 | 3300048922 | Ga0496119_0003360 | Ga0496119_0003360_13521_14873 | 415 |
| 63 | 3300048923 | Ga0496120_0010365 | Ga0496120_0010365_3485_4837 | 415 |
| 64 | 3300048924 | Ga0496121_0003070 | Ga0496121_0003070_4530_5882 | 415 |
| 65 | 3300048925 | Ga0496122_0003481 | Ga0496122_0003481_14819_16171 | 415 |
| 66 | 3300048926 | Ga0496123_0002802 | Ga0496123_0002802_14819_16171 | 415 |
| 67 | 3300048927 | Ga0496124_0021548 | Ga0496124_0021548_1397_2749 | 415 |
| 68 | 3300002773 | JGI25152J39213_1000339 | JGI25152J39213_10003395 | 416 |
| 69 | 3300003320 | rootH2_10023223 | rootH2_100232235 | 416 |
| 70 | 3300006946 | Ga0079104_1002560 | Ga0079104_10025604 | 416 |
| 71 | 3300009011 | Ga0105251_10001635 | Ga0105251_100016353 | 416 |
| 72 | 3300013105 | Ga0157369_10000375 | Ga0157369_1000037532 | 416 |
| 73 | 3300013307 | Ga0157372_10002660 | Ga0157372_1000266012 | 416 |
| 74 | 3300025258 | Ga0209129_1000037 | Ga0209129_1000037216 | 416 |
| 75 | 3300025735 | Ga0207713_1000083 | Ga0207713_1000083145 | 416 |
| 76 | 3300027111 | Ga0209281_1001284 | Ga0209281_10012849 | 416 |
| 77 | 3300027312 | Ga0209371_1000015 | Ga0209371_1000015267 | 416 |
| 78 | 3300027312 | Ga0209371_1006649 | Ga0209371_10066492 | 416 |
| 79 | 3300030500 | Ga0268256_1000018 | Ga0268256_1000018357 | 416 |
| 80 | 3300030500 | Ga0268256_1003334 | Ga0268256_10033344 | 416 |
| 81 | 3300030500 | Ga0268256_1006726 | Ga0268256_10067263 | 416 |
| 82 | 3300042010 | Ga0439452_000020 | Ga0439452_000020_56294_57646 | 416 |
| 83 | 3300042010 | Ga0439452_000370 | Ga0439452_000370_3231_4583 | 416 |
| 84 | 3300044669 | Ga0466981_0000013 | Ga0466981_0000013_121221_122573 | 416 |
| 85 | 3300048920 | Ga0496117_0005202 | Ga0496117_0005202_2481_3833 | 416 |
| 86 | 3300048922 | Ga0496119_0000194 | Ga0496119_0000194_28057_29409 | 416 |
| 87 | 3300048923 | Ga0496120_0002311 | Ga0496120_0002311_10110_11462 | 416 |
| 88 | 3300048926 | Ga0496123_0001246 | Ga0496123_0001246_948_2300 | 416 |
| 89 | 3300048926 | Ga0496123_0009458 | Ga0496123_0009458_4206_5558 | 416 |
| 90 | 3300048927 | Ga0496124_0001441 | Ga0496124_0001441_33777_35129 | 416 |
| 91 | 3300048928 | Ga0496125_0027923 | Ga0496125_0027923_825_2177 | 416 |
| 92 | 3300048929 | Ga0496126_0024800 | Ga0496126_0024800_3320_4672 | 416 |
| 93 | 3300003856 | Ga0058692_1001395 | Ga0058692_10013955 | 417 |
| 94 | 3300005577 | Ga0068857_100000064 | Ga0068857_1000000643 | 417 |
| 95 | 3300005834 | Ga0068851_10013386 | Ga0068851_100133863 | 417 |
| 96 | 3300006946 | Ga0079104_1000822 | Ga0079104_10008224 | 417 |
| 97 | 3300006946 | Ga0079104_1002354 | Ga0079104_10023542 | 417 |
| 98 | 3300009036 | Ga0105244_10020188 | Ga0105244_100201882 | 417 |
| 99 | 3300009092 | Ga0105250_10000018 | Ga0105250_10000018108 | 417 |
| 100 | 3300009148 | Ga0105243_10074567 | Ga0105243_100745671 | 417 |
| 101 | 3300015679 | Ga0183366_1001 | Ga0183366_10012355 | 417 |
| 102 | 3300015680 | Ga0183370_1001 | Ga0183370_10012355 | 417 |
| 103 | 3300015685 | Ga0183369_1001 | Ga0183369_10012356 | 417 |
| 104 | 3300015687 | Ga0183368_1001 | Ga0183368_10012355 | 417 |
| 105 | 3300025711 | Ga0207696_1000013 | Ga0207696_1000013300 | 417 |
| 106 | 3300026116 | Ga0207674_10001883 | Ga0207674_1000188317 | 417 |
| 107 | 3300027111 | Ga0209281_1000004 | Ga0209281_1000004244 | 417 |
| 108 | 3300027111 | Ga0209281_1000773 | Ga0209281_10007736 | 417 |
| 109 | 3300027111 | Ga0209281_1000932 | Ga0209281_10009325 | 417 |
| 110 | 3300027312 | Ga0209371_1001170 | Ga0209371_10011704 | 417 |
| 111 | 3300030500 | Ga0268256_1000701 | Ga0268256_100070117 | 417 |
| 112 | 3300042006 | Ga0439432_022443 | Ga0439432_022443_366_1718 | 417 |
| 113 | 3300044712 | Ga0453684_0025986 | Ga0453684_0025986_1608_2948 | 417 |
| 114 | 3300046458 | Ga0495591_000294 | Ga0495591_000294_2808_4178 | 417 |
| 115 | 3300047320 | Ga0495672_0000070 | Ga0495672_0000070_85227_86579 | 417 |
| 116 | 3300047469 | Ga0495673_0000114 | Ga0495673_0000114_4443_5813 | 417 |
| 117 | 3300048920 | Ga0496117_0014495 | Ga0496117_0014495_2199_3551 | 417 |
| 118 | 3300048922 | Ga0496119_0025897 | Ga0496119_0025897_1333_2685 | 417 |
| 119 | 3300048922 | Ga0496119_0041728 | Ga0496119_0041728_675_2027 | 417 |
| 120 | 3300048923 | Ga0496120_0091791 | Ga0496120_0091791_112_1464 | 417 |
| 121 | 3300048924 | Ga0496121_0031698 | Ga0496121_0031698_1270_2622 | 417 |
| 122 | 3300048924 | Ga0496121_0055202 | Ga0496121_0055202_183_1535 | 417 |
| 123 | 3300048925 | Ga0496122_0007269 | Ga0496122_0007269_4060_5412 | 417 |
| 124 | 3300048925 | Ga0496122_0088199 | Ga0496122_0088199_744_2096 | 417 |
| 125 | 3300048926 | Ga0496123_0067544 | Ga0496123_0067544_289_1641 | 417 |
| 126 | 3300048927 | Ga0496124_0011464 | Ga0496124_0011464_6832_8184 | 417 |
| 127 | 3300048929 | Ga0496126_0004579 | Ga0496126_0004579_11921_13273 | 417 |
| 128 | 3300003856 | Ga0058692_1001400 | Ga0058692_10014004 | 418 |
| 129 | 3300006195 | Ga0075366_10038054 | Ga0075366_100380542 | 418 |
| 130 | 3300009011 | Ga0105251_10003712 | Ga0105251_100037124 | 418 |
| 131 | 3300015261 | Ga0182006_1000018 | Ga0182006_1000018256 | 418 |
| 132 | 3300025728 | Ga0207655_1001163 | Ga0207655_10011634 | 418 |
| 133 | 3300025735 | Ga0207713_1001328 | Ga0207713_100132817 | 418 |
| 134 | 3300025735 | Ga0207713_1006514 | Ga0207713_10065142 | 418 |
| 135 | 3300025935 | Ga0207709_10061385 | Ga0207709_100613851 | 418 |
| 136 | 3300027312 | Ga0209371_1000001 | Ga0209371_10000012347 | 418 |
| 137 | 3300030500 | Ga0268256_1000001 | Ga0268256_1000001293 | 418 |
| 138 | 3300048907 | Ga0496104_0005440 | Ga0496104_0005440_3778_5130 | 418 |
| 139 | 3300048908 | Ga0496105_0066793 | Ga0496105_0066793_39_1391 | 418 |
| 140 | 3300048923 | Ga0496120_0009747 | Ga0496120_0009747_2656_4008 | 418 |
| 141 | 3300048924 | Ga0496121_0048053 | Ga0496121_0048053_1919_3271 | 418 |
| 142 | 3300048928 | Ga0496125_0016893 | Ga0496125_0016893_2748_4100 | 418 |
| 143 | 3300048929 | Ga0496126_0079929 | Ga0496126_0079929_149_1501 | 418 |
| 144 | 3300050493 | nmdc:mga0k408_12604_c2 | nmdc:mga0k408_12604_c2_873_2225 | 418 |
| 145 | 3300042010 | Ga0439452_000002 | Ga0439452_000002_283211_284563 | 419 |
| 146 | 3300003578 | Ga0006562J51391_1015515 | Ga0006562J51391_10155151 | 420 |
| 147 | 3300009036 | Ga0105244_10000566 | Ga0105244_1000056627 | 420 |
| 148 | 3300025728 | Ga0207655_1000208 | Ga0207655_100020861 | 420 |
| 149 | 3300025735 | Ga0207713_1000613 | Ga0207713_100061321 | 420 |
| 150 | 3300032004 | Ga0307414_10102815 | Ga0307414_101028152 | 420 |
| 151 | 3300049688 | Ga0501259_000748 | Ga0501259_000748_2916_4190 | 421 |
| 152 | 3300045051 | Ga0451576_0000051 | Ga0451576_0000051_171899_173278 | 422 |
| 153 | 3300009011 | Ga0105251_10000386 | Ga0105251_1000038618 | 423 |
| 154 | 3300009174 | Ga0105241_10000010 | Ga0105241_10000010208 | 423 |
| 155 | 3300013100 | Ga0157373_10006121 | Ga0157373_100061214 | 423 |
| 156 | 3300025735 | Ga0207713_1000075 | Ga0207713_1000075123 | 423 |
| 157 | 3300025911 | Ga0207654_10000010 | Ga0207654_10000010209 | 423 |
| 158 | 3300027111 | Ga0209281_1000139 | Ga0209281_100013993 | 423 |
| 159 | 3300046660 | Ga0495625_0006163 | Ga0495625_0006163_8250_9605 | 423 |
| 160 | 3300009092 | Ga0105250_10001000 | Ga0105250_100010004 | 424 |
| 161 | 3300047446 | Ga0495679_000021 | Ga0495679_000021_123439_124797 | 424 |
| 162 | 3300048922 | Ga0496119_0006499 | Ga0496119_0006499_97_1449 | 424 |
| 163 | 3300048923 | Ga0496120_0001708 | Ga0496120_0001708_17280_18632 | 424 |
| 164 | 3300048927 | Ga0496124_0000304 | Ga0496124_0000304_64802_66154 | 424 |
| 165 | 3300009011 | Ga0105251_10009501 | Ga0105251_100095013 | 425 |
| 166 | 3300009092 | Ga0105250_10000742 | Ga0105250_1000074212 | 425 |
| 167 | 3300025711 | Ga0207696_1000067 | Ga0207696_100006739 | 425 |
| 168 | 3300025711 | Ga0207696_1000100 | Ga0207696_1000100101 | 425 |
| 169 | 3300048928 | Ga0496125_0000091 | Ga0496125_0000091_45042_46427 | 425 |
| 170 | 3300006946 | Ga0079104_1000018 | Ga0079104_1000018206 | 426 |
| 171 | 3300006946 | Ga0079104_1003027 | Ga0079104_10030275 | 426 |
| 172 | 3300027111 | Ga0209281_1000014 | Ga0209281_1000014416 | 426 |
| 173 | 3300027111 | Ga0209281_1003259 | Ga0209281_10032594 | 426 |
| 174 | 3300046694 | Ga0495649_0001630 | Ga0495649_0001630_1021_2376 | 426 |
| 175 | 3300046694 | Ga0495649_0006493 | Ga0495649_0006493_5262_6617 | 426 |
| 176 | 3300047446 | Ga0495679_000867 | Ga0495679_000867_15188_16543 | 426 |
| 177 | 3300005344 | Ga0070661_100000126 | Ga0070661_10000012641 | 427 |
| 178 | 3300005564 | Ga0070664_100001357 | Ga0070664_1000013578 | 427 |
| 179 | 3300005577 | Ga0068857_100042383 | Ga0068857_1000423834 | 427 |
| 180 | 3300009036 | Ga0105244_10003769 | Ga0105244_100037691 | 427 |
| 181 | 3300009176 | Ga0105242_10003232 | Ga0105242_100032324 | 427 |
| 182 | 3300009545 | Ga0105237_10003007 | Ga0105237_1000300711 | 427 |
| 183 | 3300013100 | Ga0157373_10049600 | Ga0157373_100496002 | 427 |
| 184 | 3300013104 | Ga0157370_10072395 | Ga0157370_100723953 | 427 |
| 185 | 3300025728 | Ga0207655_1000388 | Ga0207655_10003888 | 427 |
| 186 | 3300025914 | Ga0207671_10000131 | Ga0207671_1000013173 | 427 |
| 187 | 3300025920 | Ga0207649_10000012 | Ga0207649_10000012138 | 427 |
| 188 | 3300025945 | Ga0207679_10000015 | Ga0207679_10000015138 | 427 |
| 189 | 3300049592 | Ga0501076_0081564 | Ga0501076_0081564_864_2153 | 427 |
| 190 | 3300009036 | Ga0105244_10000198 | Ga0105244_1000019827 | 428 |
| 191 | 3300021384 | Ga0213876_10000023 | Ga0213876_10000023100 | 428 |
| 192 | 3300025728 | Ga0207655_1000115 | Ga0207655_100011526 | 428 |
| 193 | 3300039437 | Ga0436365_0965775 | Ga0436365_0965775_116892_118244 | 428 |
| 194 | 3300048927 | Ga0496124_0000165 | Ga0496124_0000165_60322_61698 | 428 |
| 195 | 3300009011 | Ga0105251_10042042 | Ga0105251_100420423 | 429 |
| 196 | 3300009092 | Ga0105250_10010031 | Ga0105250_100100314 | 429 |
| 197 | 3300009101 | Ga0105247_10008979 | Ga0105247_100089795 | 429 |
| 198 | 3300017792 | Ga0163161_10000006 | Ga0163161_1000000662 | 429 |
| 199 | 3300025711 | Ga0207696_1000046 | Ga0207696_100004664 | 429 |
| 200 | 3300025735 | Ga0207713_1000056 | Ga0207713_100005664 | 429 |
| 201 | 3300025900 | Ga0207710_10000024 | Ga0207710_10000024229 | 429 |
| 202 | 3300048919 | Ga0496116_0000058 | Ga0496116_0000058_213317_214672 | 429 |
| 203 | 3300048920 | Ga0496117_0000450 | Ga0496117_0000450_26096_27451 | 429 |
| 204 | 3300048921 | Ga0496118_0006664 | Ga0496118_0006664_1254_2609 | 429 |
| 205 | 3300005549 | Ga0070704_100042282 | Ga0070704_1000422823 | 430 |
| 206 | 3300027312 | Ga0209371_1000429 | Ga0209371_100042923 | 430 |
| 207 | 3300030500 | Ga0268256_1003013 | Ga0268256_10030133 | 430 |
| 208 | 3300009094 | Ga0111539_10007585 | Ga0111539_100075853 | 431 |
| 209 | 3300009147 | Ga0114129_10096618 | Ga0114129_100966182 | 431 |
| 210 | 3300027907 | Ga0207428_10022610 | Ga0207428_100226103 | 431 |
| 211 | 3300006946 | Ga0079104_1000135 | Ga0079104_100013521 | 432 |
| 212 | 3300017792 | Ga0163161_10034235 | Ga0163161_100342353 | 432 |
| 213 | 3300026116 | Ga0207674_10242856 | Ga0207674_102428562 | 432 |
| 214 | 3300027111 | Ga0209281_1000095 | Ga0209281_1000095217 | 432 |
| 215 | 3300046513 | Ga0495616_0058159 | Ga0495616_0058159_518_1867 | 432 |
| 216 | 3300046810 | Ga0495660_0020584 | Ga0495660_0020584_1147_2499 | 432 |
| 217 | 3300003856 | Ga0058692_1000145 | Ga0058692_100014518 | 433 |
| 218 | 3300013100 | Ga0157373_10100142 | Ga0157373_101001422 | 433 |
| 219 | 3300013102 | Ga0157371_10000835 | Ga0157371_100008359 | 433 |
| 220 | 3300013307 | Ga0157372_10065898 | Ga0157372_100658981 | 433 |
| 221 | 3300027312 | Ga0209371_1000068 | Ga0209371_100006825 | 433 |
| 222 | 3300030500 | Ga0268256_1000064 | Ga0268256_1000064166 | 433 |
| 223 | 3300041405 | Ga0439438_000014 | Ga0439438_000014_26654_27997 | 433 |
| 224 | 3300041407 | Ga0439447_003919 | Ga0439447_003919_3212_4555 | 433 |
| 225 | 3300003781 | Ga0055536_1001844 | Ga0055536_100184410 | 434 |
| 226 | 3300003791 | Ga0055530_10001782 | Ga0055530_1000178210 | 434 |
| 227 | 3300003792 | Ga0055540_1001320 | Ga0055540_10013205 | 434 |
| 228 | 3300003856 | Ga0058692_1000310 | Ga0058692_100031018 | 434 |
| 229 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030303 | 434 |
| 230 | 3300025298 | Ga0209050_1002563 | Ga0209050_100256311 | 434 |
| 231 | 3300025303 | Ga0209051_1001294 | Ga0209051_100129411 | 434 |
| 232 | 3300014497 | Ga0182008_10005323 | Ga0182008_100053233 | 435 |
| 233 | 3300015262 | Ga0182007_10003484 | Ga0182007_100034843 | 435 |
| 234 | iso_pu_bacteria | 2952252522 | 2952253580 | 435 |
| 235 | 3300014968 | Ga0157379_10244193 | Ga0157379_102441931 | 436 |
| 236 | 3300015265 | Ga0182005_1015617 | Ga0182005_10156172 | 436 |
| 237 | 3300037466 | Ga0395898_0026066 | Ga0395898_0026066_2162_3520 | 436 |
| 238 | 3300038705 | Ga0237819_01191 | Ga0237819_01191_4564_5874 | 436 |
| 239 | 3300044712 | Ga0453684_0001338 | Ga0453684_0001338_16643_18016 | 436 |
| 240 | 3300044712 | Ga0453684_0001761 | Ga0453684_0001761_17929_19293 | 436 |
| 241 | 3300045051 | Ga0451576_0000696 | Ga0451576_0000696_2602_3999 | 436 |
| 242 | 3300045051 | Ga0451576_0100909 | Ga0451576_0100909_1507_2847 | 436 |
| 243 | 3300046458 | Ga0495591_000031 | Ga0495591_000031_27762_29102 | 436 |
| 244 | 3300046463 | Ga0495653_0007201 | Ga0495653_0007201_2410_3720 | 436 |
| 245 | 3300046472 | Ga0495580_0000209 | Ga0495580_0000209_12227_13576 | 436 |
| 246 | 3300046524 | Ga0495648_0083880 | Ga0495648_0083880_30_1343 | 436 |
| 247 | 3300046530 | Ga0495654_0000040 | Ga0495654_0000040_155325_156665 | 436 |
| 248 | 3300046558 | Ga0495633_0032126 | Ga0495633_0032126_22_1332 | 436 |
| 249 | 3300047322 | Ga0495680_0014189 | Ga0495680_0014189_182_1492 | 436 |
| 250 | 3300049570 | Ga0501033_0020049 | Ga0501033_0020049_1863_3182 | 436 |
| 251 | 3300001989 | JGI24739J22299_10000016 | JGI24739J22299_1000001625 | 437 |
| 252 | 3300005336 | Ga0070680_100220304 | Ga0070680_1002203041 | 437 |
| 253 | 3300009011 | Ga0105251_10000533 | Ga0105251_1000053312 | 437 |
| 254 | 3300009036 | Ga0105244_10000551 | Ga0105244_100005519 | 437 |
| 255 | 3300009036 | Ga0105244_10012531 | Ga0105244_100125313 | 437 |
| 256 | 3300009036 | Ga0105244_10022097 | Ga0105244_100220972 | 437 |
| 257 | 3300009093 | Ga0105240_10073931 | Ga0105240_100739314 | 437 |
| 258 | 3300009094 | Ga0111539_10042148 | Ga0111539_100421481 | 437 |
| 259 | 3300011119 | Ga0105246_10012052 | Ga0105246_100120524 | 437 |
| 260 | 3300013100 | Ga0157373_10000114 | Ga0157373_1000011451 | 437 |
| 261 | 3300013102 | Ga0157371_10000554 | Ga0157371_1000055424 | 437 |
| 262 | 3300013102 | Ga0157371_10000577 | Ga0157371_1000057743 | 437 |
| 263 | 3300013104 | Ga0157370_10000444 | Ga0157370_1000044426 | 437 |
| 264 | 3300025711 | Ga0207696_1000404 | Ga0207696_100040412 | 437 |
| 265 | 3300025728 | Ga0207655_1008224 | Ga0207655_10082245 | 437 |
| 266 | 3300025728 | Ga0207655_1016389 | Ga0207655_10163894 | 437 |
| 267 | 3300025735 | Ga0207713_1003273 | Ga0207713_10032732 | 437 |
| 268 | 3300025960 | Ga0207651_10070235 | Ga0207651_100702351 | 437 |
| 269 | 3300026075 | Ga0207708_10050675 | Ga0207708_100506752 | 437 |
| 270 | 3300026089 | Ga0207648_10015778 | Ga0207648_100157784 | 437 |
| 271 | 3300027907 | Ga0207428_10099304 | Ga0207428_100993041 | 437 |
| 272 | 3300042006 | Ga0439432_000659 | Ga0439432_000659_673_2013 | 437 |
| 273 | 3300042010 | Ga0439452_000023 | Ga0439452_000023_25429_26769 | 437 |
| 274 | 3300048904 | Ga0496101_0000119 | Ga0496101_0000119_48260_49600 | 437 |
| 275 | 3300048919 | Ga0496116_0000521 | Ga0496116_0000521_25009_26349 | 437 |
| 276 | 3300048920 | Ga0496117_0001270 | Ga0496117_0001270_11439_12779 | 437 |
| 277 | 3300048920 | Ga0496117_0025614 | Ga0496117_0025614_2719_4176 | 437 |
| 278 | 3300048921 | Ga0496118_0014636 | Ga0496118_0014636_4176_5516 | 437 |
| 279 | 3300048923 | Ga0496120_0003918 | Ga0496120_0003918_5635_7092 | 437 |
| 280 | 3300048925 | Ga0496122_0002360 | Ga0496122_0002360_8959_10416 | 437 |
| 281 | 3300048926 | Ga0496123_0008055 | Ga0496123_0008055_3723_5063 | 437 |
| 282 | 3300048927 | Ga0496124_0026575 | Ga0496124_0026575_2456_3913 | 437 |
| 283 | 3300048927 | Ga0496124_0059496 | Ga0496124_0059496_625_1965 | 437 |
| 284 | 3300050511 | nmdc:mga08y16_171893_c1 | nmdc:mga08y16_171893_c1_786_2105 | 437 |
| 285 | 3300025735 | Ga0207713_1005089 | Ga0207713_10050896 | 438 |
| 286 | 3300031595 | Ga0265313_10009476 | Ga0265313_100094762 | 438 |
| 287 | iso_pu_bacteria | 2511231035 | 2511435574 | 438 |
| 288 | iso_pu_bacteria | 2511231119 | 2511698114 | 438 |
| 289 | iso_pu_bacteria | 2540341094 | 2540605325 | 438 |
| 290 | iso_pu_bacteria | 2545555800 | 2545558946 | 438 |
| 291 | iso_pu_bacteria | 2554235283 | 2555469421 | 438 |
| 292 | iso_pu_bacteria | 2576861599 | 2578933398 | 438 |
| 293 | iso_pu_bacteria | 2599185299 | 2599925156 | 438 |
| 294 | iso_pu_bacteria | 2608642108 | 2608671357 | 438 |
| 295 | iso_pu_bacteria | 2643221735 | 2644741784 | 438 |
| 296 | iso_pu_bacteria | 2648501693 | 2650897281 | 438 |
| 297 | iso_pu_bacteria | 2648501850 | 2651529754 | 438 |
| 298 | iso_pu_bacteria | 2671180844 | 2674421020 | 438 |
| 299 | iso_pu_bacteria | 2684622997 | 2686356229 | 438 |
| 300 | iso_pu_bacteria | 2684623153 | 2686995424 | 438 |
| 301 | iso_pu_bacteria | 2687453109 | 2687496667 | 438 |
| 302 | iso_pu_bacteria | 2695420354 | 2695630026 | 438 |
| 303 | iso_pu_bacteria | 2716884898 | 2717918072 | 438 |
| 304 | iso_pu_bacteria | 2808606399 | 2809055506 | 438 |
| 305 | iso_pu_bacteria | 2808606414 | 2809126604 | 438 |
| 306 | iso_pu_bacteria | 2811994870 | 2812314561 | 438 |
| 307 | iso_pu_bacteria | 2816332295 | 2817482315 | 438 |
| 308 | iso_pu_bacteria | 2818991468 | 2819725791 | 438 |
| 309 | iso_pu_bacteria | 2823526263 | 2823526525 | 438 |
| 310 | iso_pu_bacteria | 2844528606 | 2844531913 | 438 |
| 311 | iso_pu_bacteria | 2847797336 | 2847801891 | 438 |
| 312 | iso_pu_bacteria | 2860837431 | 2860837689 | 438 |
| 313 | iso_pu_bacteria | 2865014394 | 2865018701 | 438 |
| 314 | iso_pu_bacteria | 2876601092 | 2876603386 | 438 |
| 315 | iso_pu_bacteria | 2877768649 | 2877768904 | 438 |
| 316 | iso_pu_bacteria | 2880169592 | 2880169846 | 438 |
| 317 | iso_pu_bacteria | 2881609920 | 2881611516 | 438 |
| 318 | iso_pu_bacteria | 2897109615 | 2897109874 | 438 |
| 319 | iso_pu_bacteria | 2904560550 | 2904562362 | 438 |
| 320 | iso_pu_bacteria | 2908665501 | 2908668605 | 438 |
| 321 | iso_pu_bacteria | 2919093281 | 2919096673 | 438 |
| 322 | iso_pu_bacteria | 2919726948 | 2919729849 | 438 |
| 323 | iso_pu_bacteria | 2939602548 | 2939605103 | 438 |
| 324 | iso_pu_bacteria | 2945951305 | 2945954773 | 438 |
| 325 | iso_pu_bacteria | 2962290636 | 2962290983 | 438 |
| 326 | iso_pu_bacteria | 2969136845 | 2969137115 | 438 |
| 327 | iso_pu_bacteria | 2969141011 | 2969141276 | 438 |
| 328 | iso_pu_bacteria | 2969765954 | 2969770311 | 438 |
| 329 | iso_pu_bacteria | 2969770375 | 2969773994 | 438 |
| 330 | iso_pu_bacteria | 2971893375 | 2971893642 | 438 |
| 331 | iso_pu_bacteria | 2978975091 | 2978977263 | 438 |
| 332 | iso_pu_bacteria | 2980492589 | 2980492860 | 438 |
| 333 | iso_pu_bacteria | 2984494565 | 2984498655 | 438 |
| 334 | iso_pu_bacteria | 2990261002 | 2990264140 | 438 |
| 335 | iso_pu_bacteria | 3006858327 | 3006862745 | 438 |
| 336 | iso_pu_bacteria | 3006879489 | 3006881781 | 438 |
| 337 | iso_pu_bacteria | 8016733728 | 8016737727 | 438 |
| 338 | iso_pu_bacteria | 8019499862 | 8019503553 | 438 |
| 339 | iso_pu_bacteria | 8022630665 | 8022634363 | 438 |
| 340 | iso_pu_bacteria | 8022653035 | 8022653185 | 438 |
| 341 | iso_pu_bacteria | 8051952484 | 8051956083 | 438 |
| 342 | iso_pu_bacteria | 8052174270 | 8052177574 | 438 |
| 343 | iso_pu_bacteria | 2512564013 | 2512638797 | 439 |
| 344 | iso_pu_bacteria | 2857460504 | 2857463445 | 439 |
| 345 | iso_pu_bacteria | 2896317667 | 2896320010 | 439 |
| 346 | iso_pu_bacteria | 2896344016 | 2896344653 | 439 |
| 347 | iso_pu_bacteria | 2929183550 | 2929183931 | 439 |
| 348 | 3300003187 | JGI25151J46595_10000035 | JGI25151J46595_10000035157 | 440 |
| 349 | 3300003578 | Ga0006562J51391_1000535 | Ga0006562J51391_100053510 | 440 |
| 350 | 3300006844 | Ga0075428_100018591 | Ga0075428_1000185913 | 440 |
| 351 | 3300009036 | Ga0105244_10052855 | Ga0105244_100528552 | 440 |
| 352 | 3300009545 | Ga0105237_10364905 | Ga0105237_103649051 | 440 |
| 353 | 3300013102 | Ga0157371_10004029 | Ga0157371_100040297 | 440 |
| 354 | 3300013307 | Ga0157372_10009383 | Ga0157372_100093832 | 440 |
| 355 | 3300013307 | Ga0157372_10020816 | Ga0157372_100208162 | 440 |
| 356 | 3300025294 | Ga0209025_1000031 | Ga0209025_1000031356 | 440 |
| 357 | 3300048919 | Ga0496116_0034975 | Ga0496116_0034975_296_1630 | 440 |
| 358 | iso_pu_bacteria | 2599185169 | 2599411294 | 440 |
| 359 | iso_pu_bacteria | 2600255254 | 2601524289 | 440 |
| 360 | iso_pu_bacteria | 2600255255 | 2601529443 | 440 |
| 361 | iso_pu_bacteria | 2600255280 | 2601616277 | 440 |
| 362 | iso_pu_bacteria | 2600255281 | 2601620999 | 440 |
| 363 | iso_pu_bacteria | 2600255287 | 2601644346 | 440 |
| 364 | iso_pu_bacteria | 2600255288 | 2601649396 | 440 |
| 365 | iso_pu_bacteria | 2600255289 | 2601654323 | 440 |
| 366 | iso_pu_bacteria | 2600255290 | 2601659745 | 440 |
| 367 | iso_pu_bacteria | 2600255291 | 2601664168 | 440 |
| 368 | iso_pu_bacteria | 2600255298 | 2601697128 | 440 |
| 369 | iso_pu_bacteria | 2600255299 | 2601702174 | 440 |
| 370 | iso_pu_bacteria | 2600255300 | 2601707067 | 440 |
| 371 | iso_pu_bacteria | 2600255301 | 2601711981 | 440 |
| 372 | iso_pu_bacteria | 2600255302 | 2601717584 | 440 |
| 373 | iso_pu_bacteria | 2600255303 | 2601722146 | 440 |
| 374 | iso_pu_bacteria | 2600255304 | 2601727512 | 440 |
| 375 | iso_pu_bacteria | 2600255305 | 2601732423 | 440 |
| 376 | iso_pu_bacteria | 2600255306 | 2601737062 | 440 |
| 377 | iso_pu_bacteria | 2600255307 | 2601741344 | 440 |
| 378 | iso_pu_bacteria | 2600255309 | 2601752402 | 440 |
| 379 | iso_pu_bacteria | 2600255392 | 2602019243 | 440 |
| 380 | iso_pu_bacteria | 2602042052 | 2603662331 | 440 |
| 381 | iso_pu_bacteria | 2602042053 | 2603667227 | 440 |
| 382 | iso_pu_bacteria | 2602042103 | 2603839936 | 440 |
| 383 | iso_pu_bacteria | 2602042104 | 2603845013 | 440 |
| 384 | iso_pu_bacteria | 2602042105 | 2603849983 | 440 |
| 385 | iso_pu_bacteria | 2602042106 | 2603855154 | 440 |
| 386 | iso_pu_bacteria | 2602042109 | 2603867966 | 440 |
| 387 | iso_pu_bacteria | 2602042110 | 2603872734 | 440 |
| 388 | iso_pu_bacteria | 2602042111 | 2603878038 | 440 |
| 389 | iso_pu_bacteria | 2603880178 | 2606049809 | 440 |
| 390 | iso_pu_bacteria | 2603880184 | 2606071469 | 440 |
| 391 | iso_pu_bacteria | 2603880202 | 2606147598 | 440 |
| 392 | iso_pu_bacteria | 2603880211 | 2606177698 | 440 |
| 393 | iso_pu_bacteria | 2636415599 | 2637224106 | 440 |
| 394 | iso_pu_bacteria | 2671180694 | 2673821444 | 440 |
| 395 | iso_pu_bacteria | 2675903046 | 2676405519 | 440 |
| 396 | iso_pu_bacteria | 2775507074 | 2777020921 | 440 |
| 397 | iso_pu_bacteria | 2847085930 | 2847089597 | 440 |
| 398 | iso_pu_bacteria | 2890737413 | 2890738104 | 440 |
| 399 | iso_pu_bacteria | 2898713307 | 2898715179 | 440 |
| 400 | iso_pu_bacteria | 2904513164 | 2904515420 | 440 |
| 401 | iso_pu_bacteria | 2908669403 | 2908674550 | 440 |
| 402 | iso_pu_bacteria | 2915597211 | 2915598809 | 440 |
| 403 | iso_pu_bacteria | 2919108558 | 2919110920 | 440 |
| 404 | iso_pu_bacteria | 2969079654 | 2969081140 | 440 |
| 405 | iso_pu_bacteria | 2984559226 | 2984563598 | 440 |
| 406 | iso_pu_bacteria | 3000376612 | 3000378382 | 440 |
| 407 | iso_pu_bacteria | 8057160832 | 8057163052 | 440 |
| 408 | iso_pu_bacteria | 2537561728 | 2538425115 | 441 |
| 409 | iso_pu_bacteria | 2551306519 | 2553394168 | 441 |
| 410 | iso_pu_bacteria | 2565956521 | 2566038327 | 441 |
| 411 | iso_pu_bacteria | 2585427591 | 2585829035 | 441 |
| 412 | iso_pu_bacteria | 2585427592 | 2585833807 | 441 |
| 413 | iso_pu_bacteria | 2597489888 | 2597866660 | 441 |
| 414 | iso_pu_bacteria | 2597489889 | 2597872518 | 441 |
| 415 | iso_pu_bacteria | 2599185167 | 2599400507 | 441 |
| 416 | iso_pu_bacteria | 2599185179 | 2599449831 | 441 |
| 417 | iso_pu_bacteria | 2599185189 | 2599505781 | 441 |
| 418 | iso_pu_bacteria | 2599185190 | 2599511905 | 441 |
| 419 | iso_pu_bacteria | 2599185191 | 2599516889 | 441 |
| 420 | iso_pu_bacteria | 2599185288 | 2599879069 | 441 |
| 421 | iso_pu_bacteria | 2599185290 | 2599892733 | 441 |
| 422 | iso_pu_bacteria | 2599185303 | 2599951483 | 441 |
| 423 | iso_pu_bacteria | 2599185324 | 2600071902 | 441 |
| 424 | iso_pu_bacteria | 2600255296 | 2601693415 | 441 |
| 425 | iso_pu_bacteria | 2643221571 | 2643872296 | 441 |
| 426 | iso_pu_bacteria | 2643221713 | 2644624737 | 441 |
| 427 | iso_pu_bacteria | 2643221729 | 2644708319 | 441 |
| 428 | iso_pu_bacteria | 2643221730 | 2644714917 | 441 |
| 429 | iso_pu_bacteria | 2667528173 | 2671110329 | 441 |
| 430 | iso_pu_bacteria | 2684622632 | 2685148575 | 441 |
| 431 | iso_pu_bacteria | 2695420987 | 2698324600 | 441 |
| 432 | iso_pu_bacteria | 2703719227 | 2705992507 | 441 |
| 433 | iso_pu_bacteria | 2706794495 | 2707100913 | 441 |
| 434 | iso_pu_bacteria | 2718218445 | 2721503956 | 441 |
| 435 | iso_pu_bacteria | 2721755607 | 2723251396 | 441 |
| 436 | iso_pu_bacteria | 2738541294 | 2738807285 | 441 |
| 437 | iso_pu_bacteria | 2738541309 | 2738894645 | 441 |
| 438 | iso_pu_bacteria | 2738541358 | 2739158269 | 441 |
| 439 | iso_pu_bacteria | 2738543006 | 2739211320 | 441 |
| 440 | iso_pu_bacteria | 2738543023 | 2739301965 | 441 |
| 441 | iso_pu_bacteria | 2808606385 | 2808976180 | 441 |
| 442 | iso_pu_bacteria | 2808606388 | 2808994356 | 441 |
| 443 | iso_pu_bacteria | 2818991443 | 2819583377 | 441 |
| 444 | iso_pu_bacteria | 2834028612 | 2834030984 | 441 |
| 445 | iso_pu_bacteria | 2842826826 | 2842831257 | 441 |
| 446 | iso_pu_bacteria | 2842837860 | 2842837929 | 441 |
| 447 | iso_pu_bacteria | 2852103415 | 2852104309 | 441 |
| 448 | iso_pu_bacteria | 2852612431 | 2852616383 | 441 |
| 449 | iso_pu_bacteria | 2852627209 | 2852629075 | 441 |
| 450 | iso_pu_bacteria | 2852667396 | 2852671351 | 441 |
| 451 | iso_pu_bacteria | 2854601825 | 2854603335 | 441 |
| 452 | iso_pu_bacteria | 2855195626 | 2855199042 | 441 |
| 453 | iso_pu_bacteria | 2858466076 | 2858466787 | 441 |
| 454 | iso_pu_bacteria | 2860867994 | 2860873058 | 441 |
| 455 | iso_pu_bacteria | 2871272651 | 2871274952 | 441 |
| 456 | iso_pu_bacteria | 2871282230 | 2871282491 | 441 |
| 457 | iso_pu_bacteria | 2904474040 | 2904478744 | 441 |
| 458 | iso_pu_bacteria | 2919150387 | 2919154852 | 441 |
| 459 | iso_pu_bacteria | 2927143783 | 2927148436 | 441 |
| 460 | iso_pu_bacteria | 2929189879 | 2929195182 | 441 |
| 461 | iso_pu_bacteria | 2929233124 | 2929233824 | 441 |
| 462 | iso_pu_bacteria | 2931390751 | 2931396445 | 441 |
| 463 | iso_pu_bacteria | 2938917290 | 2938917993 | 441 |
| 464 | iso_pu_bacteria | 2945928738 | 2945930882 | 441 |
| 465 | iso_pu_bacteria | 2945961074 | 2945966891 | 441 |
| 466 | iso_pu_bacteria | 2946006987 | 2946013251 | 441 |
| 467 | iso_pu_bacteria | 2946027586 | 2946027933 | 441 |
| 468 | iso_pu_bacteria | 2947233263 | 2947234457 | 441 |
| 469 | iso_pu_bacteria | 2947426588 | 2947427318 | 441 |
| 470 | iso_pu_bacteria | 2965761152 | 2965761886 | 441 |
| 471 | iso_pu_bacteria | 2979083700 | 2979084313 | 441 |
| 472 | iso_pu_bacteria | 3007252601 | 3007253496 | 441 |
| 473 | iso_pu_bacteria | 8022621104 | 8022621760 | 441 |
| 474 | iso_pu_bacteria | 8022792930 | 8022796130 | 441 |
| 475 | iso_pu_bacteria | 8023438354 | 8023438839 | 441 |
| 476 | iso_pu_bacteria | 8023444577 | 8023450442 | 441 |
| 477 | iso_pu_bacteria | 8054285046 | 8054285692 | 441 |
| 478 | iso_pu_bacteria | 8054347763 | 8054349554 | 441 |
| 479 | iso_pu_bacteria | 8054503363 | 8054508967 | 441 |
| 480 | iso_pu_bacteria | 8054849141 | 8054851938 | 441 |
| 481 | iso_pu_bacteria | 8055817908 | 8055823938 | 441 |
| 482 | iso_pu_bacteria | 8056131705 | 8056137343 | 441 |
| 483 | iso_pu_bacteria | 8056148874 | 8056151462 | 441 |
| 484 | iso_pu_bacteria | 8056161164 | 8056163661 | 441 |
| 485 | iso_pu_bacteria | 8057582654 | 8057583387 | 441 |
| 486 | 3300003856 | Ga0058692_1000179 | Ga0058692_100017918 | 442 |
| 487 | 3300003856 | Ga0058692_1006561 | Ga0058692_10065612 | 442 |
| 488 | 3300003856 | Ga0058692_1010808 | Ga0058692_10108082 | 442 |
| 489 | 3300005347 | Ga0070668_100027375 | Ga0070668_1000273751 | 442 |
| 490 | 3300005353 | Ga0070669_100080329 | Ga0070669_1000803292 | 442 |
| 491 | 3300005548 | Ga0070665_100013985 | Ga0070665_1000139855 | 442 |
| 492 | 3300009011 | Ga0105251_10008923 | Ga0105251_100089233 | 442 |
| 493 | 3300009011 | Ga0105251_10014212 | Ga0105251_100142123 | 442 |
| 494 | 3300009036 | Ga0105244_10002581 | Ga0105244_1000258112 | 442 |
| 495 | 3300009092 | Ga0105250_10007623 | Ga0105250_100076232 | 442 |
| 496 | 3300011119 | Ga0105246_10001513 | Ga0105246_100015136 | 442 |
| 497 | 3300011119 | Ga0105246_10023518 | Ga0105246_100235182 | 442 |
| 498 | 3300013306 | Ga0163162_10016516 | Ga0163162_100165163 | 442 |
| 499 | 3300025207 | Ga0209760_102616 | Ga0209760_1026161 | 442 |
| 500 | 3300025233 | Ga0209437_100092 | Ga0209437_100092190 | 442 |
| 501 | 3300025711 | Ga0207696_1000434 | Ga0207696_100043411 | 442 |
| 502 | 3300025728 | Ga0207655_1000111 | Ga0207655_100011124 | 442 |
| 503 | 3300025728 | Ga0207655_1003418 | Ga0207655_100341811 | 442 |
| 504 | 3300025735 | Ga0207713_1000045 | Ga0207713_1000045187 | 442 |
| 505 | 3300025735 | Ga0207713_1007461 | Ga0207713_10074615 | 442 |
| 506 | 3300025933 | Ga0207706_10006159 | Ga0207706_1000615911 | 442 |
| 507 | 3300027312 | Ga0209371_1000063 | Ga0209371_100006325 | 442 |
| 508 | 3300027312 | Ga0209371_1000617 | Ga0209371_100061712 | 442 |
| 509 | 3300027312 | Ga0209371_1004020 | Ga0209371_10040202 | 442 |
| 510 | 3300030500 | Ga0268256_1000060 | Ga0268256_1000060159 | 442 |
| 511 | 3300030500 | Ga0268256_1000386 | Ga0268256_100038619 | 442 |
| 512 | 3300030500 | Ga0268256_1008842 | Ga0268256_10088423 | 442 |
| 513 | 3300041411 | Ga0439466_0000008 | Ga0439466_0000008_217753_219093 | 442 |
| 514 | 3300042146 | Ga0450907_000030 | Ga0450907_000030_27783_29123 | 442 |
| 515 | 3300047320 | Ga0495672_0000083 | Ga0495672_0000083_128888_130228 | 442 |
| 516 | 3300048905 | Ga0496102_0012189 | Ga0496102_0012189_43_1383 | 442 |
| 517 | 3300048919 | Ga0496116_0020828 | Ga0496116_0020828_3051_4391 | 442 |
| 518 | 3300048919 | Ga0496116_0020959 | Ga0496116_0020959_1479_2819 | 442 |
| 519 | 3300048920 | Ga0496117_0000470 | Ga0496117_0000470_38728_40068 | 442 |
| 520 | 3300048920 | Ga0496117_0001133 | Ga0496117_0001133_32158_33498 | 442 |
| 521 | 3300048921 | Ga0496118_0000490 | Ga0496118_0000490_26907_28247 | 442 |
| 522 | 3300048921 | Ga0496118_0002301 | Ga0496118_0002301_18984_20324 | 442 |
| 523 | 3300048922 | Ga0496119_0000490 | Ga0496119_0000490_24972_26312 | 442 |
| 524 | 3300048922 | Ga0496119_0000706 | Ga0496119_0000706_27718_29058 | 442 |
| 525 | 3300048923 | Ga0496120_0000108 | Ga0496120_0000108_27892_29232 | 442 |
| 526 | 3300048923 | Ga0496120_0000476 | Ga0496120_0000476_24103_25443 | 442 |
| 527 | 3300048923 | Ga0496120_0000813 | Ga0496120_0000813_15703_17043 | 442 |
| 528 | 3300048924 | Ga0496121_0000074 | Ga0496121_0000074_27839_29179 | 442 |
| 529 | 3300048925 | Ga0496122_0003475 | Ga0496122_0003475_8029_9369 | 442 |
| 530 | 3300048925 | Ga0496122_0033526 | Ga0496122_0033526_2424_3764 | 442 |
| 531 | 3300048926 | Ga0496123_0002061 | Ga0496123_0002061_21508_22848 | 442 |
| 532 | 3300048926 | Ga0496123_0064996 | Ga0496123_0064996_222_1562 | 442 |
| 533 | 3300048927 | Ga0496124_0009646 | Ga0496124_0009646_7239_8579 | 442 |
| 534 | 3300048927 | Ga0496124_0021157 | Ga0496124_0021157_792_2132 | 442 |
| 535 | 3300048927 | Ga0496124_0050341 | Ga0496124_0050341_1039_2379 | 442 |
| 536 | iso_pu_bacteria | 2510065053 | 2510282413 | 442 |
| 537 | iso_pu_bacteria | 2510065055 | 2510294707 | 442 |
| 538 | iso_pu_bacteria | 2510065058 | 2510311299 | 442 |
| 539 | iso_pu_bacteria | 2547132103 | 2547373984 | 442 |
| 540 | iso_pu_bacteria | 2547132181 | 2547697286 | 442 |
| 541 | iso_pu_bacteria | 2547132416 | 2548649312 | 442 |
| 542 | iso_pu_bacteria | 2561511199 | 2562463568 | 442 |
| 543 | iso_pu_bacteria | 2600255256 | 2601534982 | 442 |
| 544 | iso_pu_bacteria | 2600255257 | 2601539389 | 442 |
| 545 | iso_pu_bacteria | 2600255310 | 2601757739 | 442 |
| 546 | iso_pu_bacteria | 2600255311 | 2601764097 | 442 |
| 547 | iso_pu_bacteria | 2602042046 | 2603636907 | 442 |
| 548 | iso_pu_bacteria | 2602042047 | 2603645338 | 442 |
| 549 | iso_pu_bacteria | 2602042066 | 2603699307 | 442 |
| 550 | iso_pu_bacteria | 2602042067 | 2603705341 | 442 |
| 551 | iso_pu_bacteria | 2609459761 | 2609909689 | 442 |
| 552 | iso_pu_bacteria | 2667528172 | 2671101153 | 442 |
| 553 | iso_pu_bacteria | 2671180115 | 2671584573 | 442 |
| 554 | iso_pu_bacteria | 2681812866 | 2681996250 | 442 |
| 555 | iso_pu_bacteria | 2681812869 | 2682006409 | 442 |
| 556 | iso_pu_bacteria | 2711768156 | 2712468907 | 442 |
| 557 | iso_pu_bacteria | 2738541281 | 2738744370 | 442 |
| 558 | iso_pu_bacteria | 2738543032 | 2739353600 | 442 |
| 559 | iso_pu_bacteria | 2751185917 | 2753856888 | 442 |
| 560 | iso_pu_bacteria | 2765235842 | 2765589988 | 442 |
| 561 | iso_pu_bacteria | 2773857672 | 2774129534 | 442 |
| 562 | iso_pu_bacteria | 2775506706 | 2775541335 | 442 |
| 563 | iso_pu_bacteria | 2791355010 | 2792312050 | 442 |
| 564 | iso_pu_bacteria | 2791355275 | 2793404771 | 442 |
| 565 | iso_pu_bacteria | 2811995292 | 2813727917 | 442 |
| 566 | iso_pu_bacteria | 2814123068 | 2814695460 | 442 |
| 567 | iso_pu_bacteria | 2821118458 | 2821121012 | 442 |
| 568 | iso_pu_bacteria | 2823373977 | 2823375641 | 442 |
| 569 | iso_pu_bacteria | 2843690924 | 2843695576 | 442 |
| 570 | iso_pu_bacteria | 2844425489 | 2844428332 | 442 |
| 571 | iso_pu_bacteria | 2846540461 | 2846544054 | 442 |
| 572 | iso_pu_bacteria | 2888373701 | 2888375568 | 442 |
| 573 | iso_pu_bacteria | 2917832318 | 2917836516 | 442 |
| 574 | iso_pu_bacteria | 2919125081 | 2919126450 | 442 |
| 575 | iso_pu_bacteria | 2923634449 | 2923635856 | 442 |
| 576 | iso_pu_bacteria | 2927833300 | 2927837641 | 442 |
| 577 | iso_pu_bacteria | 2932406140 | 2932409063 | 442 |
| 578 | iso_pu_bacteria | 2935625433 | 2935625794 | 442 |
| 579 | iso_pu_bacteria | 2937539931 | 2937542479 | 442 |
| 580 | iso_pu_bacteria | 2939568625 | 2939570008 | 442 |
| 581 | iso_pu_bacteria | 2939577877 | 2939581633 | 442 |
| 582 | iso_pu_bacteria | 2939607340 | 2939608708 | 442 |
| 583 | iso_pu_bacteria | 2939617950 | 2939618457 | 442 |
| 584 | iso_pu_bacteria | 2939642701 | 2939642973 | 442 |
| 585 | iso_pu_bacteria | 2945874760 | 2945876877 | 442 |
| 586 | iso_pu_bacteria | 2974298342 | 2974302057 | 442 |
| 587 | iso_pu_bacteria | 2974310843 | 2974311125 | 442 |
| 588 | iso_pu_bacteria | 2974435778 | 2974439252 | 442 |
| 589 | iso_pu_bacteria | 2984499530 | 2984500370 | 442 |
| 590 | iso_pu_bacteria | 2984504281 | 2984506805 | 442 |
| 591 | iso_pu_bacteria | 8015394850 | 8015397378 | 442 |
| 592 | iso_pu_bacteria | 8016728285 | 8016731151 | 442 |
| 593 | iso_pu_bacteria | 8018221730 | 8018223190 | 442 |
| 594 | iso_pu_bacteria | 8018405270 | 8018409274 | 442 |
| 595 | iso_pu_bacteria | 8019504834 | 8019505205 | 442 |
| 596 | iso_pu_bacteria | 8054844752 | 8054846600 | 442 |
| 597 | iso_pu_bacteria | 8055097453 | 8055100173 | 442 |
| 598 | 3300002987 | JGI25159J45721_1006060 | JGI25159J45721_10060603 | 443 |
| 599 | 3300003187 | JGI25151J46595_10000945 | JGI25151J46595_1000094512 | 443 |
| 600 | 3300003187 | JGI25151J46595_10006233 | JGI25151J46595_100062335 | 443 |
| 601 | 3300003187 | JGI25151J46595_10028999 | JGI25151J46595_100289992 | 443 |
| 602 | 3300009036 | Ga0105244_10010258 | Ga0105244_100102583 | 443 |
| 603 | 3300025229 | Ga0209147_101055 | Ga0209147_1010559 | 443 |
| 604 | 3300025284 | Ga0209130_1000293 | Ga0209130_100029352 | 443 |
| 605 | 3300025291 | Ga0209675_1017451 | Ga0209675_10174512 | 443 |
| 606 | 3300025294 | Ga0209025_1001280 | Ga0209025_100128022 | 443 |
| 607 | 3300025294 | Ga0209025_1001433 | Ga0209025_10014333 | 443 |
| 608 | 3300025294 | Ga0209025_1001685 | Ga0209025_10016857 | 443 |
| 609 | 3300025294 | Ga0209025_1002689 | Ga0209025_100268914 | 443 |
| 610 | 3300025294 | Ga0209025_1014973 | Ga0209025_10149732 | 443 |
| 611 | 3300025711 | Ga0207696_1001207 | Ga0207696_10012078 | 443 |
| 612 | 3300025711 | Ga0207696_1021488 | Ga0207696_10214882 | 443 |
| 613 | 3300025728 | Ga0207655_1008594 | Ga0207655_10085944 | 443 |
| 614 | 3300027312 | Ga0209371_1000071 | Ga0209371_100007126 | 443 |
| 615 | 3300030083 | Ga0237817_10004 | Ga0237817_1000442 | 443 |
| 616 | 3300030083 | Ga0237817_10086 | Ga0237817_1008626 | 443 |
| 617 | 3300030500 | Ga0268256_1000070 | Ga0268256_100007023 | 443 |
| 618 | 3300032004 | Ga0307414_10061738 | Ga0307414_100617383 | 443 |
| 619 | 3300038705 | Ga0237819_00136 | Ga0237819_00136_26140_27489 | 443 |
| 620 | 3300038705 | Ga0237819_00899 | Ga0237819_00899_1110_2459 | 443 |
| 621 | 3300045976 | Ga0466967_0000405 | Ga0466967_0000405_10103_11452 | 443 |
| 622 | 3300049758 | Ga0501241_003383 | Ga0501241_003383_606_1940 | 443 |
| 623 | iso_pu_bacteria | 2506520007 | 2506576171 | 443 |
| 624 | iso_pu_bacteria | 2506520008 | 2506581309 | 443 |
| 625 | iso_pu_bacteria | 2508501071 | 2508850140 | 443 |
| 626 | iso_pu_bacteria | 2654587920 | 2656277209 | 443 |
| 627 | iso_pu_bacteria | 2687453601 | 2689442602 | 443 |
| 628 | iso_pu_bacteria | 2772190666 | 2772436746 | 443 |
| 629 | iso_pu_bacteria | 2806310673 | 2807179010 | 443 |
| 630 | iso_pu_bacteria | 2869551831 | 2869552016 | 443 |
| 631 | iso_pu_bacteria | 2888366609 | 2888366794 | 443 |
| 632 | iso_pu_bacteria | 2919186247 | 2919189030 | 443 |
| 633 | iso_pu_bacteria | 2937967321 | 2937971465 | 443 |
| 634 | iso_pu_bacteria | 2939664404 | 2939666815 | 443 |
| 635 | iso_pu_bacteria | 3007315729 | 3007317731 | 443 |
| 636 | iso_pu_bacteria | 640753048 | 640935690 | 443 |
| 637 | iso_pu_bacteria | 8004592986 | 8004593529 | 443 |
| 638 | iso_pu_bacteria | 8055693939 | 8055697844 | 443 |
| 639 | iso_pu_bacteria | 8057304971 | 8057306806 | 443 |
| 640 | 3300002773 | JGI25152J39213_1000056 | JGI25152J39213_10000563 | 444 |
| 641 | 3300002774 | JGI25150J39212_1000009 | JGI25150J39212_100000968 | 444 |
| 642 | 3300003187 | JGI25151J46595_10000017 | JGI25151J46595_1000001768 | 444 |
| 643 | 3300003215 | JGI25153J46596_10000023 | JGI25153J46596_10000023171 | 444 |
| 644 | 3300003856 | Ga0058692_1000253 | Ga0058692_100025310 | 444 |
| 645 | 3300005288 | Ga0065714_10065075 | Ga0065714_100650756 | 444 |
| 646 | 3300013307 | Ga0157372_10105263 | Ga0157372_101052632 | 444 |
| 647 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007488 | 444 |
| 648 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006488 | 444 |
| 649 | 3300025294 | Ga0209025_1000025 | Ga0209025_1000025318 | 444 |
| 650 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016488 | 444 |
| 651 | 3300027312 | Ga0209371_1000331 | Ga0209371_100033127 | 444 |
| 652 | 3300037471 | Ga0395905_0011690 | Ga0395905_0011690_1199_2542 | 444 |
| 653 | 3300048919 | Ga0496116_0000282 | Ga0496116_0000282_24422_25861 | 444 |
| 654 | 3300048922 | Ga0496119_0000219 | Ga0496119_0000219_24587_25933 | 444 |
| 655 | 3300048922 | Ga0496119_0000680 | Ga0496119_0000680_28937_30376 | 444 |
| 656 | 3300048923 | Ga0496120_0000279 | Ga0496120_0000279_59898_61337 | 444 |
| 657 | 3300048923 | Ga0496120_0000301 | Ga0496120_0000301_24587_25933 | 444 |
| 658 | iso_pu_bacteria | 2554235132 | 2554818293 | 444 |
| 659 | iso_pu_bacteria | 2606217733 | 2608380411 | 444 |
| 660 | iso_pu_bacteria | 2891670763 | 2891673579 | 444 |
| 661 | iso_pu_bacteria | 2939573065 | 2939575317 | 444 |
| 662 | 2162886007 | SwRhRL2b_contig_437820 | SwRhRL2b_0609.00000510 | 445 |
| 663 | 3300002737 | JGI25162J39368_1000116 | JGI25162J39368_100011668 | 445 |
| 664 | 3300002771 | JGI25163J39215_1000099 | JGI25163J39215_100009912 | 445 |
| 665 | 3300002772 | JGI25164J39214_1000095 | JGI25164J39214_100009512 | 445 |
| 666 | 3300003751 | Ga0055538_1000032 | Ga0055538_1000032165 | 445 |
| 667 | 3300003751 | Ga0055538_1000077 | Ga0055538_100007767 | 445 |
| 668 | 3300003752 | Ga0055539_1000043 | Ga0055539_1000043165 | 445 |
| 669 | 3300003752 | Ga0055539_1000114 | Ga0055539_100011470 | 445 |
| 670 | 3300003756 | Ga0055533_1000052 | Ga0055533_1000052165 | 445 |
| 671 | 3300003756 | Ga0055533_1000122 | Ga0055533_100012268 | 445 |
| 672 | 3300003758 | Ga0055532_1000047 | Ga0055532_1000047145 | 445 |
| 673 | 3300003759 | Ga0055525_1000062 | Ga0055525_1000062165 | 445 |
| 674 | 3300003759 | Ga0055525_1000155 | Ga0055525_100015570 | 445 |
| 675 | 3300003761 | Ga0055535_1004747 | Ga0055535_10047472 | 445 |
| 676 | 3300003841 | Ga0055541_1000030 | Ga0055541_1000030165 | 445 |
| 677 | 3300003841 | Ga0055541_1000078 | Ga0055541_100007868 | 445 |
| 678 | 3300005288 | Ga0065714_10073013 | Ga0065714_100730132 | 445 |
| 679 | 3300005289 | Ga0065704_10001437 | Ga0065704_1000143712 | 445 |
| 680 | 3300005331 | Ga0070670_100003472 | Ga0070670_1000034728 | 445 |
| 681 | 3300005353 | Ga0070669_100001006 | Ga0070669_1000010069 | 445 |
| 682 | 3300005457 | Ga0070662_100000101 | Ga0070662_1000001017 | 445 |
| 683 | 3300005539 | Ga0068853_100000372 | Ga0068853_1000003727 | 445 |
| 684 | 3300005578 | Ga0068854_100021339 | Ga0068854_1000213394 | 445 |
| 685 | 3300005834 | Ga0068851_10000007 | Ga0068851_1000000771 | 445 |
| 686 | 3300009036 | Ga0105244_10000119 | Ga0105244_1000011955 | 445 |
| 687 | 3300009036 | Ga0105244_10000588 | Ga0105244_1000058819 | 445 |
| 688 | 3300009092 | Ga0105250_10000981 | Ga0105250_1000098112 | 445 |
| 689 | 3300009092 | Ga0105250_10001145 | Ga0105250_1000114512 | 445 |
| 690 | 3300009148 | Ga0105243_10010014 | Ga0105243_100100144 | 445 |
| 691 | 3300009177 | Ga0105248_10075012 | Ga0105248_100750124 | 445 |
| 692 | 3300009545 | Ga0105237_10123033 | Ga0105237_101230333 | 445 |
| 693 | 3300013102 | Ga0157371_10000102 | Ga0157371_1000010270 | 445 |
| 694 | 3300013102 | Ga0157371_10075932 | Ga0157371_100759322 | 445 |
| 695 | 3300013105 | Ga0157369_10025810 | Ga0157369_100258106 | 445 |
| 696 | 3300015261 | Ga0182006_1001964 | Ga0182006_10019644 | 445 |
| 697 | 3300015261 | Ga0182006_1002621 | Ga0182006_10026212 | 445 |
| 698 | 3300025206 | Ga0209435_100558 | Ga0209435_1005581 | 445 |
| 699 | 3300025207 | Ga0209760_100066 | Ga0209760_10006612 | 445 |
| 700 | 3300025224 | Ga0209784_100007 | Ga0209784_100007351 | 445 |
| 701 | 3300025224 | Ga0209784_100064 | Ga0209784_10006467 | 445 |
| 702 | 3300025225 | Ga0209566_100009 | Ga0209566_100009351 | 445 |
| 703 | 3300025225 | Ga0209566_100079 | Ga0209566_10007967 | 445 |
| 704 | 3300025226 | Ga0209674_100021 | Ga0209674_100021351 | 445 |
| 705 | 3300025226 | Ga0209674_100159 | Ga0209674_10015967 | 445 |
| 706 | 3300025229 | Ga0209147_100009 | Ga0209147_100009351 | 445 |
| 707 | 3300025230 | Ga0209563_100018 | Ga0209563_100018351 | 445 |
| 708 | 3300025230 | Ga0209563_100135 | Ga0209563_10013567 | 445 |
| 709 | 3300025231 | Ga0207427_100136 | Ga0207427_10013667 | 445 |
| 710 | 3300025233 | Ga0209437_100149 | Ga0209437_10014967 | 445 |
| 711 | 3300025242 | Ga0209258_100169 | Ga0209258_100169132 | 445 |
| 712 | 3300025246 | Ga0209646_1000184 | Ga0209646_100018448 | 445 |
| 713 | 3300025253 | Ga0209677_100012 | Ga0209677_100012351 | 445 |
| 714 | 3300025253 | Ga0209677_100110 | Ga0209677_10011067 | 445 |
| 715 | 3300025256 | Ga0209759_1003625 | Ga0209759_10036251 | 445 |
| 716 | 3300025261 | Ga0209233_1002353 | Ga0209233_10023534 | 445 |
| 717 | 3300025321 | Ga0207656_10000006 | Ga0207656_1000000631 | 445 |
| 718 | 3300025711 | Ga0207696_1000357 | Ga0207696_10003577 | 445 |
| 719 | 3300025711 | Ga0207696_1000820 | Ga0207696_100082012 | 445 |
| 720 | 3300025728 | Ga0207655_1000170 | Ga0207655_100017055 | 445 |
| 721 | 3300025728 | Ga0207655_1000284 | Ga0207655_100028411 | 445 |
| 722 | 3300025735 | Ga0207713_1000837 | Ga0207713_10008371 | 445 |
| 723 | 3300025735 | Ga0207713_1001441 | Ga0207713_10014418 | 445 |
| 724 | 3300025923 | Ga0207681_10000099 | Ga0207681_100000993 | 445 |
| 725 | 3300025925 | Ga0207650_10000338 | Ga0207650_100003387 | 445 |
| 726 | 3300025925 | Ga0207650_10000564 | Ga0207650_1000056418 | 445 |
| 727 | 3300025933 | Ga0207706_10009041 | Ga0207706_100090411 | 445 |
| 728 | 3300025935 | Ga0207709_10005277 | Ga0207709_100052773 | 445 |
| 729 | 3300025981 | Ga0207640_10026125 | Ga0207640_100261252 | 445 |
| 730 | 3300026041 | Ga0207639_10000286 | Ga0207639_1000028620 | 445 |
| 731 | 3300028794 | Ga0307515_10097159 | Ga0307515_100971592 | 445 |
| 732 | 3300032002 | Ga0307416_100154504 | Ga0307416_1001545042 | 445 |
| 733 | 3300032004 | Ga0307414_10117922 | Ga0307414_101179222 | 445 |
| 734 | 3300032004 | Ga0307414_10212616 | Ga0307414_102126161 | 445 |
| 735 | 3300038726 | Ga0400490_02503 | Ga0400490_02503_22676_24022 | 445 |
| 736 | 3300039093 | Ga0400489_18894 | Ga0400489_18894_527_1873 | 445 |
| 737 | 3300042006 | Ga0439432_000624 | Ga0439432_000624_3776_5113 | 445 |
| 738 | 3300046453 | Ga0495627_000240 | Ga0495627_000240_5648_6985 | 445 |
| 739 | 3300046458 | Ga0495591_000539 | Ga0495591_000539_25081_26430 | 445 |
| 740 | 3300046471 | Ga0495650_0000199 | Ga0495650_0000199_61037_62407 | 445 |
| 741 | 3300046471 | Ga0495650_0000360 | Ga0495650_0000360_24957_26306 | 445 |
| 742 | 3300046501 | Ga0495607_0007508 | Ga0495607_0007508_1396_2733 | 445 |
| 743 | 3300046506 | Ga0495583_0007528 | Ga0495583_0007528_1301_2638 | 445 |
| 744 | 3300046507 | Ga0495606_0000541 | Ga0495606_0000541_25164_26513 | 445 |
| 745 | 3300046530 | Ga0495654_0000519 | Ga0495654_0000519_4776_6125 | 445 |
| 746 | 3300046530 | Ga0495654_0002898 | Ga0495654_0002898_1899_3236 | 445 |
| 747 | 3300046530 | Ga0495654_0012988 | Ga0495654_0012988_1369_2706 | 445 |
| 748 | 3300046692 | Ga0495671_0012410 | Ga0495671_0012410_1299_2648 | 445 |
| 749 | 3300046794 | Ga0495589_0004351 | Ga0495589_0004351_710_2059 | 445 |
| 750 | 3300046810 | Ga0495660_0000045 | Ga0495660_0000045_84243_85613 | 445 |
| 751 | 3300046810 | Ga0495660_0000134 | Ga0495660_0000134_25248_26597 | 445 |
| 752 | 3300046810 | Ga0495660_0004806 | Ga0495660_0004806_2757_4094 | 445 |
| 753 | 3300047320 | Ga0495672_0000224 | Ga0495672_0000224_53839_55188 | 445 |
| 754 | 3300047323 | Ga0495683_0061129 | Ga0495683_0061129_26_1375 | 445 |
| 755 | 3300047446 | Ga0495679_003543 | Ga0495679_003543_5168_6505 | 445 |
| 756 | 3300047469 | Ga0495673_0000622 | Ga0495673_0000622_8282_9631 | 445 |
| 757 | 3300048919 | Ga0496116_0001110 | Ga0496116_0001110_10987_12357 | 445 |
| 758 | 3300048920 | Ga0496117_0007574 | Ga0496117_0007574_315_1685 | 445 |
| 759 | 3300048920 | Ga0496117_0017576 | Ga0496117_0017576_4499_5836 | 445 |
| 760 | 3300048921 | Ga0496118_0002440 | Ga0496118_0002440_14538_15890 | 445 |
| 761 | 3300048921 | Ga0496118_0004790 | Ga0496118_0004790_7455_8825 | 445 |
| 762 | 3300048922 | Ga0496119_0012834 | Ga0496119_0012834_5278_6648 | 445 |
| 763 | 3300048925 | Ga0496122_0000607 | Ga0496122_0000607_59576_60946 | 445 |
| 764 | 3300048926 | Ga0496123_0000451 | Ga0496123_0000451_59593_60963 | 445 |
| 765 | 3300048927 | Ga0496124_0000379 | Ga0496124_0000379_13368_14738 | 445 |
| 766 | 3300048928 | Ga0496125_0001589 | Ga0496125_0001589_10991_12361 | 445 |
| 767 | 3300048928 | Ga0496125_0013508 | Ga0496125_0013508_6554_7891 | 445 |
| 768 | 3300048929 | Ga0496126_0003284 | Ga0496126_0003284_18933_20303 | 445 |
| 769 | 3300049459 | Ga0495678_000337 | Ga0495678_000337_34101_35450 | 445 |
| 770 | 3300049460 | Ga0495682_0000139 | Ga0495682_0000139_36255_37604 | 445 |
| 771 | 3300049704 | Ga0501221_004019 | Ga0501221_004019_241_1590 | 445 |
| 772 | 3300049705 | Ga0501225_0005805 | Ga0501225_0005805_182_1531 | 445 |
| 773 | 3300053126 | Ga0500621_000018 | Ga0500621_000018_25193_26542 | 445 |
| 774 | iso_pu_bacteria | 2511231004 | 2511254822 | 445 |
| 775 | iso_pu_bacteria | 2511231006 | 2511266036 | 445 |
| 776 | iso_pu_bacteria | 2511231007 | 2511273349 | 445 |
| 777 | iso_pu_bacteria | 2511231008 | 2511275060 | 445 |
| 778 | iso_pu_bacteria | 2511231010 | 2511288492 | 445 |
| 779 | iso_pu_bacteria | 2511231011 | 2511297988 | 445 |
| 780 | iso_pu_bacteria | 2511231012 | 2511304000 | 445 |
| 781 | iso_pu_bacteria | 2511231016 | 2511327978 | 445 |
| 782 | iso_pu_bacteria | 2511231017 | 2511329703 | 445 |
| 783 | iso_pu_bacteria | 2511231018 | 2511335876 | 445 |
| 784 | iso_pu_bacteria | 2511231019 | 2511344762 | 445 |
| 785 | iso_pu_bacteria | 2511231020 | 2511349526 | 445 |
| 786 | iso_pu_bacteria | 2511231021 | 2511354104 | 445 |
| 787 | iso_pu_bacteria | 2511231022 | 2511365974 | 445 |
| 788 | iso_pu_bacteria | 2511231023 | 2511369002 | 445 |
| 789 | iso_pu_bacteria | 2511231031 | 2511412142 | 445 |
| 790 | iso_pu_bacteria | 2511231156 | 2511827674 | 445 |
| 791 | iso_pu_bacteria | 2512047018 | 2512326639 | 445 |
| 792 | iso_pu_bacteria | 2582580891 | 2583795690 | 445 |
| 793 | iso_pu_bacteria | 2597489887 | 2597860916 | 445 |
| 794 | iso_pu_bacteria | 2599185155 | 2599327543 | 445 |
| 795 | iso_pu_bacteria | 2599185185 | 2599485849 | 445 |
| 796 | iso_pu_bacteria | 2599185188 | 2599500295 | 445 |
| 797 | iso_pu_bacteria | 2599185212 | 2599614463 | 445 |
| 798 | iso_pu_bacteria | 2599185248 | 2599768112 | 445 |
| 799 | iso_pu_bacteria | 2599185257 | 2599804629 | 445 |
| 800 | iso_pu_bacteria | 2599185289 | 2599885548 | 445 |
| 801 | iso_pu_bacteria | 2599185291 | 2599897262 | 445 |
| 802 | iso_pu_bacteria | 2599185300 | 2599930682 | 445 |
| 803 | iso_pu_bacteria | 2599185302 | 2599942320 | 445 |
| 804 | iso_pu_bacteria | 2599185304 | 2599954267 | 445 |
| 805 | iso_pu_bacteria | 2599185305 | 2599961951 | 445 |
| 806 | iso_pu_bacteria | 2599185306 | 2599965974 | 445 |
| 807 | iso_pu_bacteria | 2599185307 | 2599972340 | 445 |
| 808 | iso_pu_bacteria | 2599185308 | 2599977976 | 445 |
| 809 | iso_pu_bacteria | 2599185309 | 2599982890 | 445 |
| 810 | iso_pu_bacteria | 2599185310 | 2599988360 | 445 |
| 811 | iso_pu_bacteria | 2599185311 | 2599994021 | 445 |
| 812 | iso_pu_bacteria | 2599185312 | 2599999155 | 445 |
| 813 | iso_pu_bacteria | 2599185313 | 2600004275 | 445 |
| 814 | iso_pu_bacteria | 2599185314 | 2600012143 | 445 |
| 815 | iso_pu_bacteria | 2599185315 | 2600020435 | 445 |
| 816 | iso_pu_bacteria | 2599185316 | 2600026311 | 445 |
| 817 | iso_pu_bacteria | 2599185317 | 2600032057 | 445 |
| 818 | iso_pu_bacteria | 2599185318 | 2600036006 | 445 |
| 819 | iso_pu_bacteria | 2599185319 | 2600044571 | 445 |
| 820 | iso_pu_bacteria | 2599185320 | 2600046686 | 445 |
| 821 | iso_pu_bacteria | 2599185321 | 2600054887 | 445 |
| 822 | iso_pu_bacteria | 2599185322 | 2600061081 | 445 |
| 823 | iso_pu_bacteria | 2599185323 | 2600067994 | 445 |
| 824 | iso_pu_bacteria | 2599185325 | 2600076509 | 445 |
| 825 | iso_pu_bacteria | 2600254930 | 2600358960 | 445 |
| 826 | iso_pu_bacteria | 2600254931 | 2600363515 | 445 |
| 827 | iso_pu_bacteria | 2600255283 | 2601627439 | 445 |
| 828 | iso_pu_bacteria | 2600255318 | 2601798531 | 445 |
| 829 | iso_pu_bacteria | 2603880185 | 2606077425 | 445 |
| 830 | iso_pu_bacteria | 2603880199 | 2606129329 | 445 |
| 831 | iso_pu_bacteria | 2623620443 | 2624483441 | 445 |
| 832 | iso_pu_bacteria | 2623620446 | 2624494966 | 445 |
| 833 | iso_pu_bacteria | 2643221565 | 2643842994 | 445 |
| 834 | iso_pu_bacteria | 2643221589 | 2643955601 | 445 |
| 835 | iso_pu_bacteria | 2643221602 | 2644020395 | 445 |
| 836 | iso_pu_bacteria | 2643221633 | 2644184449 | 445 |
| 837 | iso_pu_bacteria | 2643221650 | 2644283195 | 445 |
| 838 | iso_pu_bacteria | 2648501241 | 2649119691 | 445 |
| 839 | iso_pu_bacteria | 2651869818 | 2652973361 | 445 |
| 840 | iso_pu_bacteria | 2667528170 | 2671089588 | 445 |
| 841 | iso_pu_bacteria | 2667528176 | 2671128555 | 445 |
| 842 | iso_pu_bacteria | 2671180172 | 2671771636 | 445 |
| 843 | iso_pu_bacteria | 2675903420 | 2677897162 | 445 |
| 844 | iso_pu_bacteria | 2675903515 | 2678266182 | 445 |
| 845 | iso_pu_bacteria | 2713897148 | 2715749801 | 445 |
| 846 | iso_pu_bacteria | 2713897149 | 2715754819 | 445 |
| 847 | iso_pu_bacteria | 2718217725 | 2718636646 | 445 |
| 848 | iso_pu_bacteria | 2738541271 | 2738690383 | 445 |
| 849 | iso_pu_bacteria | 2738543004 | 2739199090 | 445 |
| 850 | iso_pu_bacteria | 2738543016 | 2739266157 | 445 |
| 851 | iso_pu_bacteria | 2738543025 | 2739312474 | 445 |
| 852 | iso_pu_bacteria | 2740892503 | 2743740456 | 445 |
| 853 | iso_pu_bacteria | 2744054620 | 2745007414 | 445 |
| 854 | iso_pu_bacteria | 2773857670 | 2774118344 | 445 |
| 855 | iso_pu_bacteria | 2773857673 | 2774135534 | 445 |
| 856 | iso_pu_bacteria | 2784132063 | 2784261784 | 445 |
| 857 | iso_pu_bacteria | 2784132072 | 2784313607 | 445 |
| 858 | iso_pu_bacteria | 2791355520 | 2794593806 | 445 |
| 859 | iso_pu_bacteria | 2806310737 | 2807408975 | 445 |
| 860 | iso_pu_bacteria | 2806310745 | 2807457305 | 445 |
| 861 | iso_pu_bacteria | 2808606361 | 2808855667 | 445 |
| 862 | iso_pu_bacteria | 2808606376 | 2808926538 | 445 |
| 863 | iso_pu_bacteria | 2808606377 | 2808928411 | 445 |
| 864 | iso_pu_bacteria | 2808606378 | 2808935496 | 445 |
| 865 | iso_pu_bacteria | 2808606380 | 2808948699 | 445 |
| 866 | iso_pu_bacteria | 2808606381 | 2808950406 | 445 |
| 867 | iso_pu_bacteria | 2808606382 | 2808959808 | 445 |
| 868 | iso_pu_bacteria | 2808606383 | 2808964104 | 445 |
| 869 | iso_pu_bacteria | 2808606389 | 2808999060 | 445 |
| 870 | iso_pu_bacteria | 2808606445 | 2809217218 | 445 |
| 871 | iso_pu_bacteria | 2818991456 | 2819655164 | 445 |
| 872 | iso_pu_bacteria | 2825651385 | 2825655063 | 445 |
| 873 | iso_pu_bacteria | 2826581358 | 2826581870 | 445 |
| 874 | iso_pu_bacteria | 2842815866 | 2842816876 | 445 |
| 875 | iso_pu_bacteria | 2842832357 | 2842833488 | 445 |
| 876 | iso_pu_bacteria | 2842843487 | 2842845718 | 445 |
| 877 | iso_pu_bacteria | 2842849001 | 2842854142 | 445 |
| 878 | iso_pu_bacteria | 2842854478 | 2842855655 | 445 |
| 879 | iso_pu_bacteria | 2852657418 | 2852659710 | 445 |
| 880 | iso_pu_bacteria | 2860339153 | 2860341749 | 445 |
| 881 | iso_pu_bacteria | 2878029506 | 2878035382 | 445 |
| 882 | iso_pu_bacteria | 2880230671 | 2880236028 | 445 |
| 883 | iso_pu_bacteria | 2904518522 | 2904518925 | 445 |
| 884 | iso_pu_bacteria | 2908446538 | 2908452616 | 445 |
| 885 | iso_pu_bacteria | 2913036834 | 2913042563 | 445 |
| 886 | iso_pu_bacteria | 2919063839 | 2919065487 | 445 |
| 887 | iso_pu_bacteria | 2919385768 | 2919389161 | 445 |
| 888 | iso_pu_bacteria | 2919456309 | 2919457581 | 445 |
| 889 | iso_pu_bacteria | 2919481497 | 2919485689 | 445 |
| 890 | iso_pu_bacteria | 2919487758 | 2919488138 | 445 |
| 891 | iso_pu_bacteria | 2919493220 | 2919496059 | 445 |
| 892 | iso_pu_bacteria | 2919543075 | 2919544336 | 445 |
| 893 | iso_pu_bacteria | 2919697872 | 2919700542 | 445 |
| 894 | iso_pu_bacteria | 2923153595 | 2923159549 | 445 |
| 895 | iso_pu_bacteria | 2923525760 | 2923527902 | 445 |
| 896 | iso_pu_bacteria | 2923586266 | 2923589032 | 445 |
| 897 | iso_pu_bacteria | 2929144301 | 2929149952 | 445 |
| 898 | iso_pu_bacteria | 2931369376 | 2931372607 | 445 |
| 899 | iso_pu_bacteria | 2939636861 | 2939640774 | 445 |
| 900 | iso_pu_bacteria | 2969304461 | 2969310206 | 445 |
| 901 | iso_pu_bacteria | 2974289157 | 2974294051 | 445 |
| 902 | iso_pu_bacteria | 2984286254 | 2984286565 | 445 |
| 903 | iso_pu_bacteria | 2988728565 | 2988731489 | 445 |
| 904 | iso_pu_bacteria | 2998139840 | 2998145429 | 445 |
| 905 | iso_pu_bacteria | 3007395558 | 3007399366 | 445 |
| 906 | iso_pu_bacteria | 3007419365 | 3007425759 | 445 |
| 907 | iso_pu_bacteria | 3007511990 | 3007517214 | 445 |
| 908 | iso_pu_bacteria | 3007614139 | 3007618875 | 445 |
| 909 | iso_pu_bacteria | 3007718800 | 3007721788 | 445 |
| 910 | iso_pu_bacteria | 3007855910 | 3007859221 | 445 |
| 911 | iso_pu_bacteria | 3007861166 | 3007865075 | 445 |
| 912 | iso_pu_bacteria | 3007866637 | 3007866751 | 445 |
| 913 | iso_pu_bacteria | 8015687852 | 8015693647 | 445 |
| 914 | iso_pu_bacteria | 8019775933 | 8019777649 | 445 |
| 915 | iso_pu_bacteria | 8029995093 | 8029995476 | 445 |
| 916 | iso_pu_bacteria | 8055770955 | 8055776894 | 445 |
| 917 | iso_pu_bacteria | 8056115690 | 8056118180 | 445 |
| 918 | iso_pu_bacteria | 8056120720 | 8056124140 | 445 |
| 919 | iso_pu_bacteria | 8056125926 | 8056131638 | 445 |
| 920 | iso_pu_bacteria | 8056137416 | 8056139476 | 445 |
| 921 | iso_pu_bacteria | 8056143049 | 8056148804 | 445 |
| 922 | iso_pu_bacteria | 8056155041 | 8056159734 | 445 |
| 923 | iso_pu_bacteria | 8056166840 | 8056171279 | 445 |
| 924 | iso_pu_bacteria | 8056172158 | 8056177378 | 445 |
| 925 | iso_pu_bacteria | 8056177738 | 8056182030 | 445 |
| 926 | iso_pu_bacteria | 8056569372 | 8056570497 | 445 |
| 927 | 3300009011 | Ga0105251_10001420 | Ga0105251_1000142011 | 446 |
| 928 | 3300009094 | Ga0111539_10112156 | Ga0111539_101121562 | 446 |
| 929 | 3300013102 | Ga0157371_10013824 | Ga0157371_100138246 | 446 |
| 930 | 3300013105 | Ga0157369_10002994 | Ga0157369_100029949 | 446 |
| 931 | 3300025728 | Ga0207655_1011686 | Ga0207655_10116862 | 447 |
| 932 | 3300027312 | Ga0209371_1001783 | Ga0209371_100178314 | 447 |
| 933 | 3300030500 | Ga0268256_1000683 | Ga0268256_10006832 | 447 |
| 934 | 3300046474 | Ga0495605_0000100 | Ga0495605_0000100_87585_88940 | 447 |
| 935 | 3300046506 | Ga0495583_0000174 | Ga0495583_0000174_20093_21448 | 447 |
| 936 | 3300046515 | Ga0495620_0000416 | Ga0495620_0000416_20098_21453 | 447 |
| 937 | 3300046538 | Ga0495609_0000088 | Ga0495609_0000088_20184_21539 | 447 |
| 938 | 3300046558 | Ga0495633_0000777 | Ga0495633_0000777_20182_21537 | 447 |
| 939 | 3300046665 | Ga0495661_0000841 | Ga0495661_0000841_20184_21539 | 447 |
| 940 | 3300047323 | Ga0495683_0000070 | Ga0495683_0000070_19289_20644 | 447 |
| 941 | 3300047469 | Ga0495673_0002965 | Ga0495673_0002965_5745_7100 | 447 |
| 942 | 3300048926 | Ga0496123_0080135 | Ga0496123_0080135_58_1413 | 447 |
| 943 | 3300049459 | Ga0495678_000692 | Ga0495678_000692_7068_8411 | 447 |
| 944 | 3300049584 | Ga0501068_0009844 | Ga0501068_0009844_20_1369 | 447 |
| 945 | 3300046501 | Ga0495607_0005213 | Ga0495607_0005213_204_1550 | 448 |
| 946 | 3300049663 | Ga0501223_000540 | Ga0501223_000540_4220_5590 | 448 |
| 947 | 2124908027 | MRS2a_Contig_718 | MRS2a_00573890 | 449 |
| 948 | 2162886007 | SwRhRL2b_contig_578990 | SwRhRL2b_0722.00008680 | 449 |
| 949 | 3300002737 | JGI25162J39368_1001123 | JGI25162J39368_100112311 | 449 |
| 950 | 3300002771 | JGI25163J39215_1001049 | JGI25163J39215_10010495 | 449 |
| 951 | 3300002772 | JGI25164J39214_1000593 | JGI25164J39214_10005936 | 449 |
| 952 | 3300003214 | JGI25165J46597_1001173 | JGI25165J46597_10011736 | 449 |
| 953 | 3300003781 | Ga0055536_1004928 | Ga0055536_10049282 | 449 |
| 954 | 3300003781 | Ga0055536_1005802 | Ga0055536_10058027 | 449 |
| 955 | 3300003791 | Ga0055530_10001310 | Ga0055530_1000131014 | 449 |
| 956 | 3300003791 | Ga0055530_10002801 | Ga0055530_100028015 | 449 |
| 957 | 3300003792 | Ga0055540_1000960 | Ga0055540_100096014 | 449 |
| 958 | 3300003792 | Ga0055540_1002155 | Ga0055540_10021555 | 449 |
| 959 | 3300003794 | Ga0055531_10000404 | Ga0055531_1000040436 | 449 |
| 960 | 3300005288 | Ga0065714_10002460 | Ga0065714_100024606 | 449 |
| 961 | 3300005288 | Ga0065714_10005031 | Ga0065714_100050316 | 449 |
| 962 | 3300005288 | Ga0065714_10022596 | Ga0065714_100225961 | 449 |
| 963 | 3300005288 | Ga0065714_10089184 | Ga0065714_100891842 | 449 |
| 964 | 3300005289 | Ga0065704_10070757 | Ga0065704_1007075710 | 449 |
| 965 | 3300005290 | Ga0065712_10002401 | Ga0065712_100024014 | 449 |
| 966 | 3300005290 | Ga0065712_10067900 | Ga0065712_1006790012 | 449 |
| 967 | 3300005329 | Ga0070683_100005759 | Ga0070683_10000575910 | 449 |
| 968 | 3300005366 | Ga0070659_100111356 | Ga0070659_1001113562 | 449 |
| 969 | 3300005457 | Ga0070662_100052936 | Ga0070662_1000529361 | 449 |
| 970 | 3300005458 | Ga0070681_10128269 | Ga0070681_101282691 | 449 |
| 971 | 3300005548 | Ga0070665_100000467 | Ga0070665_10000046741 | 449 |
| 972 | 3300005548 | Ga0070665_100233546 | Ga0070665_1002335461 | 449 |
| 973 | 3300005842 | Ga0068858_100052783 | Ga0068858_1000527834 | 449 |
| 974 | 3300006051 | Ga0075364_10033974 | Ga0075364_100339741 | 449 |
| 975 | 3300006058 | Ga0075432_10001293 | Ga0075432_100012934 | 449 |
| 976 | 3300006058 | Ga0075432_10011785 | Ga0075432_100117852 | 449 |
| 977 | 3300006237 | Ga0097621_100029319 | Ga0097621_1000293192 | 449 |
| 978 | 3300006946 | Ga0079104_1000424 | Ga0079104_10004246 | 449 |
| 979 | 3300006946 | Ga0079104_1001947 | Ga0079104_10019479 | 449 |
| 980 | 3300006948 | Ga0099826_10050979 | Ga0099826_100509792 | 449 |
| 981 | 3300009011 | Ga0105251_10001765 | Ga0105251_100017657 | 449 |
| 982 | 3300009011 | Ga0105251_10001772 | Ga0105251_100017727 | 449 |
| 983 | 3300009011 | Ga0105251_10010285 | Ga0105251_100102855 | 449 |
| 984 | 3300009036 | Ga0105244_10001453 | Ga0105244_1000145311 | 449 |
| 985 | 3300009036 | Ga0105244_10006059 | Ga0105244_100060596 | 449 |
| 986 | 3300009036 | Ga0105244_10008686 | Ga0105244_100086866 | 449 |
| 987 | 3300009036 | Ga0105244_10018552 | Ga0105244_100185522 | 449 |
| 988 | 3300009036 | Ga0105244_10027916 | Ga0105244_100279162 | 449 |
| 989 | 3300009036 | Ga0105244_10083730 | Ga0105244_100837302 | 449 |
| 990 | 3300009092 | Ga0105250_10005913 | Ga0105250_100059135 | 449 |
| 991 | 3300009092 | Ga0105250_10014050 | Ga0105250_100140501 | 449 |
| 992 | 3300009093 | Ga0105240_10153427 | Ga0105240_101534272 | 449 |
| 993 | 3300009148 | Ga0105243_10009208 | Ga0105243_100092082 | 449 |
| 994 | 3300009148 | Ga0105243_10028970 | Ga0105243_100289703 | 449 |
| 995 | 3300009148 | Ga0105243_10252811 | Ga0105243_102528111 | 449 |
| 996 | 3300009148 | Ga0105243_10313400 | Ga0105243_103134001 | 449 |
| 997 | 3300011119 | Ga0105246_10004667 | Ga0105246_100046675 | 449 |
| 998 | 3300011119 | Ga0105246_10019537 | Ga0105246_100195375 | 449 |
| 999 | 3300011119 | Ga0105246_10182328 | Ga0105246_101823281 | 449 |
| 1000 | 3300012498 | Ga0157345_1000367 | Ga0157345_10003672 | 449 |
| 1001 | 3300013100 | Ga0157373_10003979 | Ga0157373_100039794 | 449 |
| 1002 | 3300013100 | Ga0157373_10004112 | Ga0157373_100041126 | 449 |
| 1003 | 3300013100 | Ga0157373_10013471 | Ga0157373_100134714 | 449 |
| 1004 | 3300013100 | Ga0157373_10098682 | Ga0157373_100986822 | 449 |
| 1005 | 3300013102 | Ga0157371_10000245 | Ga0157371_1000024529 | 449 |
| 1006 | 3300013102 | Ga0157371_10015950 | Ga0157371_100159501 | 449 |
| 1007 | 3300013102 | Ga0157371_10123392 | Ga0157371_101233921 | 449 |
| 1008 | 3300013104 | Ga0157370_10135121 | Ga0157370_101351212 | 449 |
| 1009 | 3300013105 | Ga0157369_10078363 | Ga0157369_100783634 | 449 |
| 1010 | 3300013306 | Ga0163162_10013860 | Ga0163162_100138606 | 449 |
| 1011 | 3300013306 | Ga0163162_10413907 | Ga0163162_104139071 | 449 |
| 1012 | 3300014497 | Ga0182008_10008883 | Ga0182008_100088833 | 449 |
| 1013 | 3300014497 | Ga0182008_10010865 | Ga0182008_100108654 | 449 |
| 1014 | 3300014968 | Ga0157379_10231696 | Ga0157379_102316961 | 449 |
| 1015 | 3300015261 | Ga0182006_1014858 | Ga0182006_10148582 | 449 |
| 1016 | 3300015261 | Ga0182006_1015427 | Ga0182006_10154273 | 449 |
| 1017 | 3300015261 | Ga0182006_1023329 | Ga0182006_10233292 | 449 |
| 1018 | 3300017792 | Ga0163161_10018448 | Ga0163161_100184483 | 449 |
| 1019 | 3300017792 | Ga0163161_10197136 | Ga0163161_101971361 | 449 |
| 1020 | 3300017792 | Ga0163161_10220152 | Ga0163161_102201522 | 449 |
| 1021 | 3300025207 | Ga0209760_100027 | Ga0209760_10002778 | 449 |
| 1022 | 3300025231 | Ga0207427_100006 | Ga0207427_100006410 | 449 |
| 1023 | 3300025233 | Ga0209437_100013 | Ga0209437_100013410 | 449 |
| 1024 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022410 | 449 |
| 1025 | 3300025291 | Ga0209675_1000989 | Ga0209675_100098913 | 449 |
| 1026 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015381 | 449 |
| 1027 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041145 | 449 |
| 1028 | 3300025292 | Ga0209676_1004747 | Ga0209676_10047476 | 449 |
| 1029 | 3300025298 | Ga0209050_1000024 | Ga0209050_1000024137 | 449 |
| 1030 | 3300025298 | Ga0209050_1000030 | Ga0209050_100003057 | 449 |
| 1031 | 3300025298 | Ga0209050_1000518 | Ga0209050_10005184 | 449 |
| 1032 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012298 | 449 |
| 1033 | 3300025303 | Ga0209051_1000023 | Ga0209051_100002353 | 449 |
| 1034 | 3300025303 | Ga0209051_1010681 | Ga0209051_10106813 | 449 |
| 1035 | 3300025304 | Ga0209257_1002874 | Ga0209257_100287410 | 449 |
| 1036 | 3300025304 | Ga0209257_1004425 | Ga0209257_10044259 | 449 |
| 1037 | 3300025711 | Ga0207696_1000031 | Ga0207696_1000031265 | 449 |
| 1038 | 3300025711 | Ga0207696_1003421 | Ga0207696_10034214 | 449 |
| 1039 | 3300025711 | Ga0207696_1008529 | Ga0207696_10085292 | 449 |
| 1040 | 3300025728 | Ga0207655_1000033 | Ga0207655_100003387 | 449 |
| 1041 | 3300025728 | Ga0207655_1000202 | Ga0207655_10002028 | 449 |
| 1042 | 3300025728 | Ga0207655_1004304 | Ga0207655_10043044 | 449 |
| 1043 | 3300025728 | Ga0207655_1005474 | Ga0207655_10054744 | 449 |
| 1044 | 3300025728 | Ga0207655_1008819 | Ga0207655_10088193 | 449 |
| 1045 | 3300025728 | Ga0207655_1010707 | Ga0207655_10107077 | 449 |
| 1046 | 3300025728 | Ga0207655_1010965 | Ga0207655_10109654 | 449 |
| 1047 | 3300025728 | Ga0207655_1011441 | Ga0207655_10114414 | 449 |
| 1048 | 3300025728 | Ga0207655_1042728 | Ga0207655_10427281 | 449 |
| 1049 | 3300025735 | Ga0207713_1000079 | Ga0207713_1000079116 | 449 |
| 1050 | 3300025735 | Ga0207713_1000659 | Ga0207713_100065915 | 449 |
| 1051 | 3300025735 | Ga0207713_1000881 | Ga0207713_10008815 | 449 |
| 1052 | 3300025735 | Ga0207713_1001352 | Ga0207713_10013525 | 449 |
| 1053 | 3300025735 | Ga0207713_1002574 | Ga0207713_10025746 | 449 |
| 1054 | 3300025735 | Ga0207713_1004380 | Ga0207713_10043806 | 449 |
| 1055 | 3300025735 | Ga0207713_1014577 | Ga0207713_10145773 | 449 |
| 1056 | 3300025912 | Ga0207707_10049888 | Ga0207707_100498882 | 449 |
| 1057 | 3300025923 | Ga0207681_10003495 | Ga0207681_100034956 | 449 |
| 1058 | 3300025935 | Ga0207709_10000248 | Ga0207709_1000024812 | 449 |
| 1059 | 3300025935 | Ga0207709_10002118 | Ga0207709_100021186 | 449 |
| 1060 | 3300025944 | Ga0207661_10072049 | Ga0207661_100720493 | 449 |
| 1061 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016344 | 449 |
| 1062 | 3300027111 | Ga0209281_1000019 | Ga0209281_1000019193 | 449 |
| 1063 | 3300027111 | Ga0209281_1010043 | Ga0209281_10100431 | 449 |
| 1064 | 3300027312 | Ga0209371_1000980 | Ga0209371_100098020 | 449 |
| 1065 | 3300027907 | Ga0207428_10055895 | Ga0207428_100558953 | 449 |
| 1066 | 3300027907 | Ga0207428_10094654 | Ga0207428_100946542 | 449 |
| 1067 | 3300027907 | Ga0207428_10100480 | Ga0207428_101004802 | 449 |
| 1068 | 3300027907 | Ga0207428_10148203 | Ga0207428_101482032 | 449 |
| 1069 | 3300028379 | Ga0268266_10017876 | Ga0268266_100178762 | 449 |
| 1070 | 3300028379 | Ga0268266_10036568 | Ga0268266_100365684 | 449 |
| 1071 | 3300030500 | Ga0268256_1001241 | Ga0268256_100124113 | 449 |
| 1072 | 3300030734 | Ga0316179_1074380 | Ga0316179_10743803 | 449 |
| 1073 | 3300030735 | Ga0316178_1051183 | Ga0316178_10511832 | 449 |
| 1074 | 3300030742 | Ga0316183_1004754 | Ga0316183_10047547 | 449 |
| 1075 | 3300031250 | Ga0265331_10042006 | Ga0265331_100420062 | 449 |
| 1076 | 3300031548 | Ga0307408_100008555 | Ga0307408_1000085553 | 449 |
| 1077 | 3300031548 | Ga0307408_100025199 | Ga0307408_1000251993 | 449 |
| 1078 | 3300031548 | Ga0307408_100030100 | Ga0307408_1000301003 | 449 |
| 1079 | 3300031731 | Ga0307405_10003779 | Ga0307405_100037793 | 449 |
| 1080 | 3300031731 | Ga0307405_10009015 | Ga0307405_100090153 | 449 |
| 1081 | 3300031731 | Ga0307405_10024955 | Ga0307405_100249552 | 449 |
| 1082 | 3300031824 | Ga0307413_10020637 | Ga0307413_100206373 | 449 |
| 1083 | 3300031901 | Ga0307406_10063957 | Ga0307406_100639572 | 449 |
| 1084 | 3300031911 | Ga0307412_10003115 | Ga0307412_100031156 | 449 |
| 1085 | 3300031911 | Ga0307412_10006197 | Ga0307412_100061976 | 449 |
| 1086 | 3300031911 | Ga0307412_10008593 | Ga0307412_100085934 | 449 |
| 1087 | 3300031995 | Ga0307409_100026540 | Ga0307409_1000265404 | 449 |
| 1088 | 3300032004 | Ga0307414_10028695 | Ga0307414_100286953 | 449 |
| 1089 | 3300032004 | Ga0307414_10093451 | Ga0307414_100934512 | 449 |
| 1090 | 3300032005 | Ga0307411_10007691 | Ga0307411_100076916 | 449 |
| 1091 | 3300041405 | Ga0439438_003322 | Ga0439438_003322_1572_2921 | 449 |
| 1092 | 3300041405 | Ga0439438_003720 | Ga0439438_003720_2767_4116 | 449 |
| 1093 | 3300041405 | Ga0439438_003853 | Ga0439438_003853_4349_5698 | 449 |
| 1094 | 3300041405 | Ga0439438_005789 | Ga0439438_005789_1183_2532 | 449 |
| 1095 | 3300041405 | Ga0439438_007455 | Ga0439438_007455_1200_2549 | 449 |
| 1096 | 3300041405 | Ga0439438_007874 | Ga0439438_007874_840_2189 | 449 |
| 1097 | 3300041407 | Ga0439447_004242 | Ga0439447_004242_1202_2551 | 449 |
| 1098 | 3300041407 | Ga0439447_005799 | Ga0439447_005799_1073_2422 | 449 |
| 1099 | 3300041407 | Ga0439447_008267 | Ga0439447_008267_14_1363 | 449 |
| 1100 | 3300042006 | Ga0439432_003130 | Ga0439432_003130_2766_4115 | 449 |
| 1101 | 3300042006 | Ga0439432_005623 | Ga0439432_005623_1190_2539 | 449 |
| 1102 | 3300042009 | Ga0439451_017439 | Ga0439451_017439_63_1415 | 449 |
| 1103 | 3300042010 | Ga0439452_003394 | Ga0439452_003394_1937_3286 | 449 |
| 1104 | 3300042010 | Ga0439452_003587 | Ga0439452_003587_2135_3484 | 449 |
| 1105 | 3300042016 | Ga0439463_000362 | Ga0439463_000362_6255_7604 | 449 |
| 1106 | 3300042016 | Ga0439463_008252 | Ga0439463_008252_1055_2404 | 449 |
| 1107 | 3300042115 | Ga0450911_002076 | Ga0450911_002076_1809_3158 | 449 |
| 1108 | 3300042122 | Ga0450920_001025 | Ga0450920_001025_1565_2914 | 449 |
| 1109 | 3300042127 | Ga0450890_001315 | Ga0450890_001315_807_2156 | 449 |
| 1110 | 3300042138 | Ga0450903_003208 | Ga0450903_003208_928_2277 | 449 |
| 1111 | 3300042145 | Ga0450906_001093 | Ga0450906_001093_3486_4835 | 449 |
| 1112 | 3300042146 | Ga0450907_001550 | Ga0450907_001550_1899_3248 | 449 |
| 1113 | 3300042146 | Ga0450907_007918 | Ga0450907_007918_257_1606 | 449 |
| 1114 | 3300042156 | Ga0439446_0033311 | Ga0439446_0033311_30_1379 | 449 |
| 1115 | 3300042993 | Ga0439440_0003394 | Ga0439440_0003394_791_2140 | 449 |
| 1116 | 3300046452 | Ga0495617_001747 | Ga0495617_001747_1140_2489 | 449 |
| 1117 | 3300046457 | Ga0495590_0007182 | Ga0495590_0007182_239_1588 | 449 |
| 1118 | 3300046457 | Ga0495590_0033417 | Ga0495590_0033417_390_1739 | 449 |
| 1119 | 3300046458 | Ga0495591_000113 | Ga0495591_000113_39520_40869 | 449 |
| 1120 | 3300046458 | Ga0495591_003979 | Ga0495591_003979_2989_4338 | 449 |
| 1121 | 3300046458 | Ga0495591_010554 | Ga0495591_010554_2195_3544 | 449 |
| 1122 | 3300046471 | Ga0495650_0000623 | Ga0495650_0000623_40348_41697 | 449 |
| 1123 | 3300046471 | Ga0495650_0004070 | Ga0495650_0004070_2199_3548 | 449 |
| 1124 | 3300046471 | Ga0495650_0011199 | Ga0495650_0011199_3437_4786 | 449 |
| 1125 | 3300046471 | Ga0495650_0031114 | Ga0495650_0031114_930_2279 | 449 |
| 1126 | 3300046474 | Ga0495605_0000122 | Ga0495605_0000122_86535_87884 | 449 |
| 1127 | 3300046474 | Ga0495605_0000720 | Ga0495605_0000720_308_1657 | 449 |
| 1128 | 3300046474 | Ga0495605_0010155 | Ga0495605_0010155_2709_4058 | 449 |
| 1129 | 3300046474 | Ga0495605_0016621 | Ga0495605_0016621_1318_2667 | 449 |
| 1130 | 3300046475 | Ga0495639_0003206 | Ga0495639_0003206_1147_2496 | 449 |
| 1131 | 3300046491 | Ga0495584_0008007 | Ga0495584_0008007_1900_3252 | 449 |
| 1132 | 3300046491 | Ga0495584_0008818 | Ga0495584_0008818_21_1370 | 449 |
| 1133 | 3300046491 | Ga0495584_0011877 | Ga0495584_0011877_2038_3387 | 449 |
| 1134 | 3300046492 | Ga0495585_0016562 | Ga0495585_0016562_1953_3302 | 449 |
| 1135 | 3300046492 | Ga0495585_0023700 | Ga0495585_0023700_1926_3275 | 449 |
| 1136 | 3300046492 | Ga0495585_0033759 | Ga0495585_0033759_1234_2583 | 449 |
| 1137 | 3300046500 | Ga0495596_0023127 | Ga0495596_0023127_1089_2438 | 449 |
| 1138 | 3300046501 | Ga0495607_0002708 | Ga0495607_0002708_6252_7601 | 449 |
| 1139 | 3300046501 | Ga0495607_0005252 | Ga0495607_0005252_6802_8151 | 449 |
| 1140 | 3300046501 | Ga0495607_0014541 | Ga0495607_0014541_1306_2655 | 449 |
| 1141 | 3300046501 | Ga0495607_0020817 | Ga0495607_0020817_873_2222 | 449 |
| 1142 | 3300046506 | Ga0495583_0001423 | Ga0495583_0001423_20822_22171 | 449 |
| 1143 | 3300046506 | Ga0495583_0003451 | Ga0495583_0003451_4380_5729 | 449 |
| 1144 | 3300046506 | Ga0495583_0004441 | Ga0495583_0004441_6777_8126 | 449 |
| 1145 | 3300046506 | Ga0495583_0010934 | Ga0495583_0010934_66_1418 | 449 |
| 1146 | 3300046507 | Ga0495606_0002133 | Ga0495606_0002133_415_1764 | 449 |
| 1147 | 3300046507 | Ga0495606_0135995 | Ga0495606_0135995_53_1402 | 449 |
| 1148 | 3300046512 | Ga0495610_0009567 | Ga0495610_0009567_3973_5322 | 449 |
| 1149 | 3300046512 | Ga0495610_0031458 | Ga0495610_0031458_812_2164 | 449 |
| 1150 | 3300046513 | Ga0495616_0011485 | Ga0495616_0011485_991_2340 | 449 |
| 1151 | 3300046515 | Ga0495620_0007001 | Ga0495620_0007001_288_1637 | 449 |
| 1152 | 3300046518 | Ga0495631_0003022 | Ga0495631_0003022_1337_2686 | 449 |
| 1153 | 3300046519 | Ga0495632_0000855 | Ga0495632_0000855_19654_21003 | 449 |
| 1154 | 3300046519 | Ga0495632_0010624 | Ga0495632_0010624_152_1501 | 449 |
| 1155 | 3300046519 | Ga0495632_0037589 | Ga0495632_0037589_978_2327 | 449 |
| 1156 | 3300046519 | Ga0495632_0048273 | Ga0495632_0048273_71_1420 | 449 |
| 1157 | 3300046520 | Ga0495637_0000045 | Ga0495637_0000045_6844_8193 | 449 |
| 1158 | 3300046520 | Ga0495637_0001490 | Ga0495637_0001490_6845_8194 | 449 |
| 1159 | 3300046520 | Ga0495637_0008188 | Ga0495637_0008188_1968_3317 | 449 |
| 1160 | 3300046520 | Ga0495637_0016425 | Ga0495637_0016425_768_2117 | 449 |
| 1161 | 3300046520 | Ga0495637_0042148 | Ga0495637_0042148_229_1578 | 449 |
| 1162 | 3300046520 | Ga0495637_0048225 | Ga0495637_0048225_391_1740 | 449 |
| 1163 | 3300046520 | Ga0495637_0069479 | Ga0495637_0069479_10_1362 | 449 |
| 1164 | 3300046523 | Ga0495644_0011465 | Ga0495644_0011465_1934_3283 | 449 |
| 1165 | 3300046528 | Ga0495642_0001762 | Ga0495642_0001762_6067_7416 | 449 |
| 1166 | 3300046528 | Ga0495642_0009839 | Ga0495642_0009839_577_1926 | 449 |
| 1167 | 3300046530 | Ga0495654_0010746 | Ga0495654_0010746_1120_2469 | 449 |
| 1168 | 3300046530 | Ga0495654_0013134 | Ga0495654_0013134_2311_3660 | 449 |
| 1169 | 3300046530 | Ga0495654_0032482 | Ga0495654_0032482_558_1910 | 449 |
| 1170 | 3300046530 | Ga0495654_0051859 | Ga0495654_0051859_23_1372 | 449 |
| 1171 | 3300046530 | Ga0495654_0062000 | Ga0495654_0062000_389_1738 | 449 |
| 1172 | 3300046536 | Ga0495587_0051785 | Ga0495587_0051785_862_2211 | 449 |
| 1173 | 3300046538 | Ga0495609_0000023 | Ga0495609_0000023_87423_88772 | 449 |
| 1174 | 3300046538 | Ga0495609_0000132 | Ga0495609_0000132_38421_39770 | 449 |
| 1175 | 3300046538 | Ga0495609_0017630 | Ga0495609_0017630_1939_3291 | 449 |
| 1176 | 3300046538 | Ga0495609_0057145 | Ga0495609_0057145_63_1412 | 449 |
| 1177 | 3300046542 | Ga0495597_0000240 | Ga0495597_0000240_5483_6832 | 449 |
| 1178 | 3300046542 | Ga0495597_0003419 | Ga0495597_0003419_6792_8141 | 449 |
| 1179 | 3300046542 | Ga0495597_0046301 | Ga0495597_0046301_133_1482 | 449 |
| 1180 | 3300046542 | Ga0495597_0053024 | Ga0495597_0053024_381_1730 | 449 |
| 1181 | 3300046557 | Ga0495622_0006401 | Ga0495622_0006401_1150_2499 | 449 |
| 1182 | 3300046615 | Ga0495656_0008683 | Ga0495656_0008683_2243_3592 | 449 |
| 1183 | 3300046615 | Ga0495656_0040629 | Ga0495656_0040629_521_1870 | 449 |
| 1184 | 3300046616 | Ga0495668_0004362 | Ga0495668_0004362_3657_5006 | 449 |
| 1185 | 3300046616 | Ga0495668_0005152 | Ga0495668_0005152_6029_7378 | 449 |
| 1186 | 3300046616 | Ga0495668_0025862 | Ga0495668_0025862_1640_2989 | 449 |
| 1187 | 3300046642 | Ga0495634_0029979 | Ga0495634_0029979_889_2238 | 449 |
| 1188 | 3300046648 | Ga0495611_0004481 | Ga0495611_0004481_3203_4552 | 449 |
| 1189 | 3300046648 | Ga0495611_0013263 | Ga0495611_0013263_392_1741 | 449 |
| 1190 | 3300046660 | Ga0495625_0000061 | Ga0495625_0000061_90299_91648 | 449 |
| 1191 | 3300046660 | Ga0495625_0027918 | Ga0495625_0027918_2234_3583 | 449 |
| 1192 | 3300046663 | Ga0495635_0031677 | Ga0495635_0031677_1440_2789 | 449 |
| 1193 | 3300046664 | Ga0495659_0002272 | Ga0495659_0002272_2447_3796 | 449 |
| 1194 | 3300046665 | Ga0495661_0000060 | Ga0495661_0000060_91878_93227 | 449 |
| 1195 | 3300046665 | Ga0495661_0000072 | Ga0495661_0000072_6853_8202 | 449 |
| 1196 | 3300046665 | Ga0495661_0030018 | Ga0495661_0030018_486_1835 | 449 |
| 1197 | 3300046679 | Ga0495623_0029954 | Ga0495623_0029954_1350_2699 | 449 |
| 1198 | 3300046684 | Ga0495669_0022243 | Ga0495669_0022243_1134_2483 | 449 |
| 1199 | 3300046690 | Ga0495624_0005415 | Ga0495624_0005415_5351_6700 | 449 |
| 1200 | 3300046691 | Ga0495670_0016631 | Ga0495670_0016631_621_1970 | 449 |
| 1201 | 3300046691 | Ga0495670_0018111 | Ga0495670_0018111_1463_2815 | 449 |
| 1202 | 3300046691 | Ga0495670_0102119 | Ga0495670_0102119_41_1390 | 449 |
| 1203 | 3300046692 | Ga0495671_0011769 | Ga0495671_0011769_1439_2788 | 449 |
| 1204 | 3300046692 | Ga0495671_0013286 | Ga0495671_0013286_1923_3272 | 449 |
| 1205 | 3300046692 | Ga0495671_0029446 | Ga0495671_0029446_1126_2475 | 449 |
| 1206 | 3300046692 | Ga0495671_0030945 | Ga0495671_0030945_963_2312 | 449 |
| 1207 | 3300046694 | Ga0495649_0001082 | Ga0495649_0001082_1865_3217 | 449 |
| 1208 | 3300046694 | Ga0495649_0004431 | Ga0495649_0004431_1172_2521 | 449 |
| 1209 | 3300046694 | Ga0495649_0015624 | Ga0495649_0015624_1698_3047 | 449 |
| 1210 | 3300046694 | Ga0495649_0022169 | Ga0495649_0022169_1541_2890 | 449 |
| 1211 | 3300046694 | Ga0495649_0023816 | Ga0495649_0023816_49_1398 | 449 |
| 1212 | 3300046794 | Ga0495589_0002988 | Ga0495589_0002988_1163_2512 | 449 |
| 1213 | 3300046794 | Ga0495589_0057788 | Ga0495589_0057788_476_1825 | 449 |
| 1214 | 3300047317 | Ga0495604_0012472 | Ga0495604_0012472_30_1379 | 449 |
| 1215 | 3300047317 | Ga0495604_0043272 | Ga0495604_0043272_1375_2724 | 449 |
| 1216 | 3300047320 | Ga0495672_0004169 | Ga0495672_0004169_8885_10234 | 449 |
| 1217 | 3300047320 | Ga0495672_0004529 | Ga0495672_0004529_4608_5957 | 449 |
| 1218 | 3300047320 | Ga0495672_0006578 | Ga0495672_0006578_2780_4129 | 449 |
| 1219 | 3300047320 | Ga0495672_0017583 | Ga0495672_0017583_1331_2680 | 449 |
| 1220 | 3300047320 | Ga0495672_0018934 | Ga0495672_0018934_1333_2682 | 449 |
| 1221 | 3300047320 | Ga0495672_0029790 | Ga0495672_0029790_1232_2581 | 449 |
| 1222 | 3300047321 | Ga0495676_0000011 | Ga0495676_0000011_88319_89668 | 449 |
| 1223 | 3300047321 | Ga0495676_0007808 | Ga0495676_0007808_5142_6494 | 449 |
| 1224 | 3300047321 | Ga0495676_0039201 | Ga0495676_0039201_2543_3892 | 449 |
| 1225 | 3300047323 | Ga0495683_0000362 | Ga0495683_0000362_30058_31410 | 449 |
| 1226 | 3300047323 | Ga0495683_0009052 | Ga0495683_0009052_1274_2623 | 449 |
| 1227 | 3300047323 | Ga0495683_0013020 | Ga0495683_0013020_905_2254 | 449 |
| 1228 | 3300047323 | Ga0495683_0022696 | Ga0495683_0022696_656_2005 | 449 |
| 1229 | 3300047443 | Ga0495687_011045 | Ga0495687_011045_1144_2493 | 449 |
| 1230 | 3300047443 | Ga0495687_031458 | Ga0495687_031458_914_2263 | 449 |
| 1231 | 3300047445 | Ga0495677_0007419 | Ga0495677_0007419_1178_2527 | 449 |
| 1232 | 3300047446 | Ga0495679_000028 | Ga0495679_000028_107075_108424 | 449 |
| 1233 | 3300047469 | Ga0495673_0002493 | Ga0495673_0002493_8662_10011 | 449 |
| 1234 | 3300047469 | Ga0495673_0003291 | Ga0495673_0003291_3602_4951 | 449 |
| 1235 | 3300047469 | Ga0495673_0003710 | Ga0495673_0003710_6639_7988 | 449 |
| 1236 | 3300047469 | Ga0495673_0004185 | Ga0495673_0004185_1152_2501 | 449 |
| 1237 | 3300047469 | Ga0495673_0004320 | Ga0495673_0004320_1776_3125 | 449 |
| 1238 | 3300047469 | Ga0495673_0012251 | Ga0495673_0012251_1476_2828 | 449 |
| 1239 | 3300047469 | Ga0495673_0012739 | Ga0495673_0012739_22_1371 | 449 |
| 1240 | 3300047470 | Ga0495681_0004600 | Ga0495681_0004600_3444_4793 | 449 |
| 1241 | 3300047470 | Ga0495681_0010607 | Ga0495681_0010607_1864_3216 | 449 |
| 1242 | 3300047470 | Ga0495681_0010847 | Ga0495681_0010847_3201_4550 | 449 |
| 1243 | 3300048091 | Ga0495626_0009113 | Ga0495626_0009113_2961_4310 | 449 |
| 1244 | 3300048091 | Ga0495626_0013014 | Ga0495626_0013014_1807_3156 | 449 |
| 1245 | 3300048091 | Ga0495626_0036221 | Ga0495626_0036221_336_1685 | 449 |
| 1246 | 3300048905 | Ga0496102_0048468 | Ga0496102_0048468_852_2201 | 449 |
| 1247 | 3300048906 | Ga0496103_0007163 | Ga0496103_0007163_1462_2811 | 449 |
| 1248 | 3300048919 | Ga0496116_0014450 | Ga0496116_0014450_1729_3078 | 449 |
| 1249 | 3300048919 | Ga0496116_0036842 | Ga0496116_0036842_774_2123 | 449 |
| 1250 | 3300048919 | Ga0496116_0037302 | Ga0496116_0037302_2010_3359 | 449 |
| 1251 | 3300048920 | Ga0496117_0037276 | Ga0496117_0037276_856_2205 | 449 |
| 1252 | 3300048920 | Ga0496117_0047865 | Ga0496117_0047865_1664_3013 | 449 |
| 1253 | 3300048921 | Ga0496118_0082265 | Ga0496118_0082265_892_2241 | 449 |
| 1254 | 3300048924 | Ga0496121_0002538 | Ga0496121_0002538_218_1567 | 449 |
| 1255 | 3300048924 | Ga0496121_0006595 | Ga0496121_0006595_7085_8434 | 449 |
| 1256 | 3300048925 | Ga0496122_0000398 | Ga0496122_0000398_2956_4305 | 449 |
| 1257 | 3300048926 | Ga0496123_0000302 | Ga0496123_0000302_2850_4199 | 449 |
| 1258 | 3300048927 | Ga0496124_0000073 | Ga0496124_0000073_134521_135870 | 449 |
| 1259 | 3300049459 | Ga0495678_000325 | Ga0495678_000325_43360_44709 | 449 |
| 1260 | 3300049459 | Ga0495678_007952 | Ga0495678_007952_537_1886 | 449 |
| 1261 | 3300049459 | Ga0495678_011303 | Ga0495678_011303_1679_3028 | 449 |
| 1262 | 3300049459 | Ga0495678_023888 | Ga0495678_023888_535_1884 | 449 |
| 1263 | 3300049459 | Ga0495678_046604 | Ga0495678_046604_271_1620 | 449 |
| 1264 | 3300049460 | Ga0495682_0000607 | Ga0495682_0000607_20265_21614 | 449 |
| 1265 | 3300053125 | Ga0500618_007715 | Ga0500618_007715_1262_2614 | 449 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pw4-assembly1.cif.gz_A | crystal structure of the glycerol-3-phosphate transporter from e.coli | 0.9261 | 5 | 443 |
| 1pw4-assembly1.cif.gz_A | crystal structure of the glycerol-3-phosphate transporter from e.coli | 0.9097 | 5 | 443 |
| 7da5-assembly1.cif.gz_A | cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. | 0.8542 | 26 | 430 |
| 8ex6-assembly1.cif.gz_A | human s1p transporter spns2 in an inward-facing open conformation (state 1*) | 0.8517 | 26 | 434 |
| 7yr5-assembly1.cif.gz_A | embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state | 0.831 | 28 | 431 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P08194_18_226_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9891 | 19 | 225 | 1.20.1250.20 |
| af_P08194_18_226_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9751 | 19 | 225 | 1.20.1250.20 |
| af_P09836_237_439_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9588 | 239 | 434 | 1.20.1250.20 |
| af_P08194_240_451_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.954 | 239 | 448 | 1.20.1250.20 |
| af_P08194_240_451_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9407 | 239 | 448 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M3X1E7-F1-model_v4 | Glycerol-3-phosphate transporter | 0.9846 | 1 | 214 |
GO:0005886
GO:0012505 GO:0035435 GO:0061513 |
| AF-A0A6Y6LTY8-F1-model_v4 | MFS transporter | 0.984 | 1 | 281 |
GO:0005886
GO:0035435 GO:0061513 |
| AF-A0A2R7SZ92-F1-model_v4 | deleted | 0.9834 | 1 | 191 |
|
| AF-A0A376WYM6-F1-model_v4 | Glycerol-3-phosphate transporter | 0.9811 | 1 | 223 |
GO:0005886
GO:0012505 GO:0035435 GO:0061513 |
| AF-A0A6N8Q3X7-F1-model_v4 | deleted | 0.9795 | 143 | 398 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar