F492346

General Info

Members Datasets Scaffolds Average Seq Length
1265 695 839 442

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0025614|Ga0496117_0025614_2719_4176
Length 480
Sequence VTITILCAKWKLRFAIFTACFCPNLLGTHNYIAPWRATLMLSIFKPAPHRPQVADDRVDPLYRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLVMGFVPWATSSIMVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWKAALYMPAFGAILIAIIAFALMRDTPQSCGLPPIEAWKNDYPPDYNEDHEQELTAKQIFMQYILPNKLLWYIALANVFVYLLRYGILDWSPTYLKEVKHFTLDKSSWAYFFYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATVVYWLNPPGNPGIDMLCMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDYFGWDGGFIVMIGGSVLAVTMVSEHKHKKQLS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231012 Pseudomonas sp. GM33 Isolate Nodule
16 2511231016 Pseudomonas sp. GM50 Isolate Nodule
17 2511231017 Pseudomonas sp. GM55 Isolate Nodule
18 2511231018 Pseudomonas sp. GM60 Isolate Nodule
19 2511231019 Pseudomonas sp. GM67 Isolate Nodule
20 2511231020 Pseudomonas sp. GM74 Isolate Nodule
21 2511231021 Pseudomonas sp. GM78 Isolate Nodule
22 2511231022 Pseudomonas sp. GM79 Isolate Nodule
23 2511231023 Pseudomonas sp. GM80 Isolate Nodule
24 2511231031 Pseudomonas sp. GM16 Isolate Nodule
25 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
26 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
27 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
28 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
29 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
30 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
31 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
32 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
33 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
34 2547132181 Kosakonia sacchari SP1 Isolate Stem
35 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
36 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
37 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
38 2554235283 Bacillus safensis VK Isolate Rhizosphere
39 2561511199 Enterobacter sp. R4-368 Isolate Nodule
40 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
41 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
42 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
43 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
44 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
45 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
46 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
47 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
48 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
49 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
50 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
51 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
52 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
53 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
54 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
55 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
56 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
57 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
58 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
59 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
60 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
61 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
62 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
63 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
64 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
65 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
66 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
67 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
68 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
69 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
70 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
71 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
72 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
73 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
74 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
75 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
76 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
77 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
78 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
79 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
80 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
81 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
82 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
83 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
84 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
85 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
86 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
87 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
88 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
89 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
90 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
91 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
92 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
93 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
94 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
95 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
96 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
97 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
98 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
99 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
100 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
101 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
102 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
103 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
104 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
105 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
106 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
107 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
108 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
109 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
110 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
111 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
112 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
113 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
114 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
115 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
116 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
117 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
118 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
119 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
120 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
121 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
122 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
123 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
124 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
125 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
126 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
127 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
128 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
129 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
130 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
131 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
132 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
133 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
134 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
135 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
136 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
137 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
138 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
139 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
140 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
141 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
142 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
143 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
144 2636415599 Klebsiella variicola DX120E Isolate Unclassified
145 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
146 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
147 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
148 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
149 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
150 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
151 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
152 2643221729 Bacillus sp. Root11 Isolate Unclassified
153 2643221730 Bacillus sp. Root131 Isolate Unclassified
154 2643221735 Bacillus sp. Root920 Isolate Unclassified
155 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
156 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
157 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
158 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
159 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
160 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
161 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
162 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
163 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
164 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
165 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
166 2671180694 Paenibacillus sp. A3 Isolate Unclassified
167 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
168 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
169 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
170 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
171 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
172 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
173 2684622632 Bacillus cereus 905 Isolate Unclassified
174 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
175 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
176 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
177 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
178 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
179 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
180 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
181 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
182 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
183 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
184 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
185 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
186 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
187 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
188 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
189 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
190 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
191 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
192 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
193 2738541358 Bacillus sp. OV752 Isolate Unclassified
194 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
195 2738543006 Bacillus sp. OK077 Isolate Unclassified
196 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
197 2738543023 Pedobacter sp. OK628 Isolate Unclassified
198 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
199 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
200 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
201 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
202 2751185917 Enterobacter sp. HK169 Isolate Unclassified
203 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
204 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
205 2773857670 Pseudomonas sp. 478 Isolate Unclassified
206 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
207 2773857673 Pseudomonas sp. 443 Isolate Unclassified
208 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
209 2775507074 Klebsiella sp. D5A Isolate Unclassified
210 2784132063 Pseudomonas sp. 424 Isolate Unclassified
211 2784132072 Pseudomonas sp. 460 Isolate Unclassified
212 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
213 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
214 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
215 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
216 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
217 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
218 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
219 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
220 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
221 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
222 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
223 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
224 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
225 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
226 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
227 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
228 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
229 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
230 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
231 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
232 2811994870 Bacillus sp. JB4 Isolate Unclassified
233 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
234 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
235 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
236 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
237 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
238 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
239 2821118458 Enterobacter asburiae 609 Isolate Unclassified
240 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
241 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
242 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
243 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
244 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
245 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
246 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
247 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
248 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
249 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
250 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
251 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
252 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
253 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
254 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
255 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
256 2847085930 Erwinia persicina B64 Isolate Bulb
257 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
258 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
259 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
260 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
261 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
262 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
263 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
264 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
265 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
266 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
267 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
268 2860837431 Bacillus sp. WR11 Isolate Unclassified
269 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
270 2865014394 Pantoea sp. R-71966 Isolate Unclassified
271 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
272 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
273 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
274 2876601092 Pantoea endophytica 596 Isolate Unclassified
275 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
276 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
277 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
278 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
279 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
280 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
281 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
282 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
283 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
284 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
285 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
286 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
287 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
288 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
289 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
290 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
291 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
292 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
293 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
294 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
295 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
296 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
297 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
298 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
299 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
300 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
301 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
302 2919150387 Rahnella aceris 1817 Isolate Unclassified
303 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
304 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
305 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
306 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
307 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
308 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
309 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
310 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
311 2919726948 Bacillus pumilus 4489 Isolate Unclassified
312 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
313 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
314 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
315 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
316 2927143783 Rahnella sp. 2050 Isolate Unclassified
317 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
318 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
319 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
320 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
321 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
322 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
323 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
324 2932406140 Serratia sp. 2723 Isolate Rhizosphere
325 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
326 2937539931 Pantoea sp. LS15 Isolate Unclassified
327 2937967321 Serratia sp. YC16 Isolate Unclassified
328 2938917290 Bacillus sp. CR71 Isolate Unclassified
329 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
330 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
331 2939577877 Serratia sp. 509 Isolate Rhizosphere
332 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
333 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
334 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
335 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
336 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
337 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
338 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
339 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
340 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
341 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
342 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
343 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
344 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
345 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
346 2952252522 Salinicola sp. DM10 Isolate Unclassified
347 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
348 2965761152 Bacillus sp. COPE52 Isolate Unclassified
349 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
350 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
351 2969141011 Bacillus velezensis MH25 Isolate Unclassified
352 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
353 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
354 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
355 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
356 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
357 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
358 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
359 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
360 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
361 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
362 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
363 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
364 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
365 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
366 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
367 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
368 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
369 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
370 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
371 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
372 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
373 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
374 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
375 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
376 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
377 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
378 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
379 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
380 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
381 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
382 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
383 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
384 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
385 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
386 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
387 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
388 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
389 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
390 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
391 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
392 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
393 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
394 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
395 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
396 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
397 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
398 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
399 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
400 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
401 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
402 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
403 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
404 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
405 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
406 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
407 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
408 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
409 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
410 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
411 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
412 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
413 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
414 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
415 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
416 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
417 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
418 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
419 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
420 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
421 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
422 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
423 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
424 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
425 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
426 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
427 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
428 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
429 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
430 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
431 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
432 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
433 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
434 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
435 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
436 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
437 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
438 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
439 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
440 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
441 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
442 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
443 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
444 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
445 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
446 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
447 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
448 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
449 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
450 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
451 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
452 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
453 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
454 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
455 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
456 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
457 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
458 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
459 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
460 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
461 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
462 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
463 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
464 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
465 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
466 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
467 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
468 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
469 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
470 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
471 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
472 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
473 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
474 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
475 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
476 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
477 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
478 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
479 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
480 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
481 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
482 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
483 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
484 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
485 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
486 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
487 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
488 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
489 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
490 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
491 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
492 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
512 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
513 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
514 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
515 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
516 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
518 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
519 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
520 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
521 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
522 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
523 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
524 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
525 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
526 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
527 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
528 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
529 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
530 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
531 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
532 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
533 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
534 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
535 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
536 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
537 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
538 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
539 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
540 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
541 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
542 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
543 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
544 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
545 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
546 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
547 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
548 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
549 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
550 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
551 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
552 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
553 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
554 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
555 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
556 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
557 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
558 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
559 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
560 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
561 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
562 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
563 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
564 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
565 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
566 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
567 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
568 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
569 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
570 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
571 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
572 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
573 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
574 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
575 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
576 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
577 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
578 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
579 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
580 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
581 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
582 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
583 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
584 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
585 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
586 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
587 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
588 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
589 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
590 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
591 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
592 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
593 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
594 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
595 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
596 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
597 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
598 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
599 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
600 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
601 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
602 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
603 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
604 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
605 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
606 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
607 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
608 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
609 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
610 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
611 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
612 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
613 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
614 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
615 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
616 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
617 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
618 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
619 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
620 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
621 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
622 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
623 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
624 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
625 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
626 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
627 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
628 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
629 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
630 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
631 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
632 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
633 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
634 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
635 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
636 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
637 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
638 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
639 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
640 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
641 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
642 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
643 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
644 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
645 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
646 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
647 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
648 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
649 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
650 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
651 640753048 Serratia proteamaculans 568 Isolate Endosphere
652 8004592986 Serratia sp. S119 Isolate Unclassified
653 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
654 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
655 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
656 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
657 8018221730 Enterobacter sp. CM29 Isolate Unclassified
658 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
659 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
660 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
661 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
662 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
663 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
664 8022653035 Bacillus sp. Rc4 Isolate Unclassified
665 8022792930 Bacillus sp. Xin Isolate Rhizosphere
666 8023438354 Bacillus sp. BH2 Isolate Unclassified
667 8023444577 Bacillus sp. BH32 Isolate Unclassified
668 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
669 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
670 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
671 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
672 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
673 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
674 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
675 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
676 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
677 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
678 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
679 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
680 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
681 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
682 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
683 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
684 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
685 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
686 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
687 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
688 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
689 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
690 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
691 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
692 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
693 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
694 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
695 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.17
Metatranscriptomes 0.16
Isolates 33.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0.08
Endosphere 7.67
Nodule 3.48
Rhizoplane 8.85
Rhizosphere 59.45
Stem 0.08
Stem Tuber 0.4
Unclassified 19.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_718 2124908027 Bacteria 55855
2 SwRhRL2b_contig_1551154 2162886007 Bacteria 3487
3 SwRhRL2b_contig_437820 2162886007 Bacteria 1693
4 SwRhRL2b_contig_455968 2162886007 Bacteria 5396
5 SwRhRL2b_contig_578990 2162886007 Bacteria 3244
6 SwRhRL2b_contig_994871 2162886007 Bacteria 5629
7 JGI24739J22299_10000016 3300001989 Bacteria 51238
8 JGI25162J39368_1000116 3300002737 Bacteria 87942
9 JGI25162J39368_1001123 3300002737 Bacteria 16116
10 JGI25163J39215_1000099 3300002771 Bacteria 35819
11 JGI25163J39215_1001049 3300002771 Bacteria 5909
12 JGI25164J39214_1000095 3300002772 Bacteria 87499
13 JGI25164J39214_1000593 3300002772 Bacteria 16116
14 JGI25152J39213_1000056 3300002773 Bacteria 75516
15 JGI25152J39213_1000339 3300002773 Bacteria 29759
16 JGI25150J39212_1000009 3300002774 Bacteria 249509
17 JGI25159J45721_1006060 3300002987 Bacteria 3677
18 JGI25151J46595_10000017 3300003187 Bacteria 249509
19 JGI25151J46595_10000035 3300003187 Bacteria 191977
20 JGI25151J46595_10000945 3300003187 Bacteria 22468
21 JGI25151J46595_10006233 3300003187 Bacteria 6032
22 JGI25151J46595_10028999 3300003187 Bacteria 2198
23 JGI25165J46597_1001173 3300003214 Bacteria 16116
24 JGI25153J46596_10000023 3300003215 Bacteria 249509
25 rootH2_10023223 3300003320 Bacteria 7261
26 Ga0006562J51391_1000535 3300003578 Bacteria 11920
27 Ga0006562J51391_1015515 3300003578 Bacteria 2620
28 Ga0055538_1000032 3300003751 Bacteria 199718
29 Ga0055538_1000077 3300003751 Bacteria 87507
30 Ga0055539_1000043 3300003752 Bacteria 199718
31 Ga0055539_1000114 3300003752 Bacteria 89618
32 Ga0055533_1000052 3300003756 Bacteria 199718
33 Ga0055533_1000122 3300003756 Bacteria 89163
34 Ga0055532_1000047 3300003758 Bacteria 179201
35 Ga0055525_1000062 3300003759 Bacteria 199718
36 Ga0055525_1000155 3300003759 Bacteria 91530
37 Ga0055535_1004747 3300003761 Bacteria 3194
38 Ga0055536_1001844 3300003781 Bacteria 12389
39 Ga0055536_1004928 3300003781 Bacteria 6653
40 Ga0055536_1005802 3300003781 Bacteria 5943
41 Ga0055530_10001310 3300003791 Bacteria 18721
42 Ga0055530_10001782 3300003791 Bacteria 14972
43 Ga0055530_10002801 3300003791 Bacteria 10727
44 Ga0055540_1000960 3300003792 Bacteria 18721
45 Ga0055540_1001320 3300003792 Bacteria 14972
46 Ga0055540_1002155 3300003792 Bacteria 10727
47 Ga0055531_10000404 3300003794 Bacteria 41520
48 Ga0055541_1000030 3300003841 Bacteria 199616
49 Ga0055541_1000078 3300003841 Bacteria 88505
50 Ga0058692_1000145 3300003856 Bacteria 44977
51 Ga0058692_1000179 3300003856 Bacteria 38966
52 Ga0058692_1000253 3300003856 Bacteria 29276
53 Ga0058692_1000280 3300003856 Bacteria 27042
54 Ga0058692_1000310 3300003856 Bacteria 24410
55 Ga0058692_1001395 3300003856 Bacteria 8928
56 Ga0058692_1001400 3300003856 Bacteria 8913
57 Ga0058692_1006561 3300003856 Bacteria 3174
58 Ga0058692_1010808 3300003856 Bacteria 2240
59 Ga0065714_10002460 3300005288 Bacteria 16953
60 Ga0065714_10005031 3300005288 Bacteria 6556
61 Ga0065714_10022596 3300005288 Bacteria 1445
62 Ga0065714_10065075 3300005288 Bacteria 13216
63 Ga0065714_10073013 3300005288 Bacteria 3259
64 Ga0065714_10089184 3300005288 Bacteria 1989
65 Ga0065704_10000343 3300005289 Bacteria 29340
66 Ga0065704_10001316 3300005289 Bacteria 16704
67 Ga0065704_10001437 3300005289 Bacteria 28307
68 Ga0065704_10003028 3300005289 Bacteria 4934
69 Ga0065704_10070757 3300005289 Bacteria 16643
70 Ga0065712_10002401 3300005290 Bacteria 6922
71 Ga0065712_10067900 3300005290 Bacteria 22102
72 Ga0070683_100005759 3300005329 Bacteria 10355
73 Ga0070670_100003472 3300005331 Bacteria 13080
74 Ga0070680_100220304 3300005336 Bacteria 1602
75 Ga0070661_100000126 3300005344 Bacteria 63357
76 Ga0070668_100027375 3300005347 Bacteria 4328
77 Ga0070669_100001006 3300005353 Bacteria 20540
78 Ga0070669_100080329 3300005353 Bacteria 2427
79 Ga0070659_100111356 3300005366 Bacteria 2210
80 Ga0070662_100000101 3300005457 Bacteria 47097
81 Ga0070662_100052936 3300005457 Bacteria 2937
82 Ga0070681_10128269 3300005458 Bacteria 2469
83 Ga0068853_100000372 3300005539 Bacteria 30828
84 Ga0070665_100000276 3300005548 Bacteria 84448
85 Ga0070665_100000467 3300005548 Bacteria 58613
86 Ga0070665_100013985 3300005548 Bacteria 8071
87 Ga0070665_100185969 3300005548 Bacteria 2078
88 Ga0070665_100233546 3300005548 Bacteria 1839
89 Ga0070704_100042282 3300005549 Bacteria 3151
90 Ga0070664_100001357 3300005564 Bacteria 19532
91 Ga0068857_100000064 3300005577 Bacteria 59060
92 Ga0068857_100042383 3300005577 Bacteria 4038
93 Ga0068854_100021339 3300005578 Bacteria 4394
94 Ga0068851_10000007 3300005834 Bacteria 244101
95 Ga0068851_10013386 3300005834 Bacteria 3883
96 Ga0068858_100052783 3300005842 Bacteria 3761
97 Ga0075364_10009444 3300006051 Bacteria 5853
98 Ga0075364_10033974 3300006051 Bacteria 3287
99 Ga0075432_10001293 3300006058 Bacteria 8077
100 Ga0075432_10011785 3300006058 Bacteria 2971
101 Ga0075366_10038054 3300006195 Bacteria 2841
102 Ga0097621_100029319 3300006237 Bacteria 4345
103 Ga0075428_100018591 3300006844 Bacteria 7680
104 Ga0075433_10001141 3300006852 Bacteria 19255
105 Ga0075434_100002344 3300006871 Bacteria 16581
106 Ga0079104_1000018 3300006946 Bacteria 271088
107 Ga0079104_1000135 3300006946 Bacteria 103632
108 Ga0079104_1000424 3300006946 Bacteria 48276
109 Ga0079104_1000487 3300006946 Bacteria 43465
110 Ga0079104_1000686 3300006946 Bacteria 31211
111 Ga0079104_1000822 3300006946 Bacteria 25893
112 Ga0079104_1001947 3300006946 Bacteria 12253
113 Ga0079104_1002354 3300006946 Bacteria 10339
114 Ga0079104_1002560 3300006946 Bacteria 9590
115 Ga0079104_1003027 3300006946 Bacteria 8251
116 Ga0099826_10050979 3300006948 Bacteria 2779
117 Ga0105251_10000386 3300009011 Bacteria 43038
118 Ga0105251_10000533 3300009011 Bacteria 35947
119 Ga0105251_10000749 3300009011 Bacteria 29646
120 Ga0105251_10001420 3300009011 Bacteria 20643
121 Ga0105251_10001635 3300009011 Bacteria 18974
122 Ga0105251_10001765 3300009011 Bacteria 18003
123 Ga0105251_10001772 3300009011 Bacteria 17958
124 Ga0105251_10003712 3300009011 Bacteria 10951
125 Ga0105251_10008923 3300009011 Bacteria 5995
126 Ga0105251_10009501 3300009011 Bacteria 5740
127 Ga0105251_10010285 3300009011 Bacteria 5440
128 Ga0105251_10014212 3300009011 Bacteria 4416
129 Ga0105251_10037172 3300009011 Bacteria 2391
130 Ga0105251_10042042 3300009011 Bacteria 2221
131 Ga0105244_10000119 3300009036 Bacteria 83366
132 Ga0105244_10000198 3300009036 Bacteria 61281
133 Ga0105244_10000551 3300009036 Bacteria 33478
134 Ga0105244_10000566 3300009036 Bacteria 33080
135 Ga0105244_10000588 3300009036 Bacteria 32617
136 Ga0105244_10001453 3300009036 Bacteria 19179
137 Ga0105244_10002581 3300009036 Bacteria 13605
138 Ga0105244_10003769 3300009036 Bacteria 10700
139 Ga0105244_10004028 3300009036 Bacteria 10262
140 Ga0105244_10006059 3300009036 Bacteria 7918
141 Ga0105244_10008686 3300009036 Bacteria 6321
142 Ga0105244_10010258 3300009036 Bacteria 5689
143 Ga0105244_10012531 3300009036 Bacteria 5003
144 Ga0105244_10018552 3300009036 Bacteria 3900
145 Ga0105244_10020188 3300009036 Bacteria 3704
146 Ga0105244_10022097 3300009036 Bacteria 3506
147 Ga0105244_10027916 3300009036 Bacteria 3035
148 Ga0105244_10052855 3300009036 Bacteria 2067
149 Ga0105244_10083730 3300009036 Bacteria 1576
150 Ga0105250_10000018 3300009092 Bacteria 246692
151 Ga0105250_10000742 3300009092 Bacteria 19871
152 Ga0105250_10000844 3300009092 Bacteria 18167
153 Ga0105250_10000981 3300009092 Bacteria 16625
154 Ga0105250_10001000 3300009092 Bacteria 16414
155 Ga0105250_10001145 3300009092 Bacteria 14916
156 Ga0105250_10005913 3300009092 Bacteria 5411
157 Ga0105250_10007623 3300009092 Bacteria 4638
158 Ga0105250_10010031 3300009092 Bacteria 3963
159 Ga0105250_10014050 3300009092 Bacteria 3296
160 Ga0105240_10073931 3300009093 Bacteria 4208
161 Ga0105240_10153427 3300009093 Bacteria 2741
162 Ga0111539_10007585 3300009094 Bacteria 13862
163 Ga0111539_10042148 3300009094 Bacteria 5485
164 Ga0111539_10112156 3300009094 Bacteria 3199
165 Ga0105247_10008979 3300009101 Bacteria 6092
166 Ga0114129_10096618 3300009147 Bacteria 4090
167 Ga0105243_10009208 3300009148 Bacteria 7538
168 Ga0105243_10010014 3300009148 Bacteria 7208
169 Ga0105243_10028970 3300009148 Bacteria 4255
170 Ga0105243_10074567 3300009148 Bacteria 2752
171 Ga0105243_10252811 3300009148 Bacteria 1574
172 Ga0105243_10313400 3300009148 Bacteria 1426
173 Ga0105241_10000010 3300009174 Bacteria 253836
174 Ga0105242_10003232 3300009176 Bacteria 12701
175 Ga0105248_10075012 3300009177 Bacteria 3801
176 Ga0105237_10003007 3300009545 Bacteria 20351
177 Ga0105237_10123033 3300009545 Bacteria 2589
178 Ga0105237_10364905 3300009545 Bacteria 1449
179 Ga0105246_10001513 3300011119 Bacteria 13785
180 Ga0105246_10004667 3300011119 Bacteria 8340
181 Ga0105246_10012052 3300011119 Bacteria 5386
182 Ga0105246_10019537 3300011119 Bacteria 4331
183 Ga0105246_10023518 3300011119 Bacteria 3988
184 Ga0105246_10182328 3300011119 Bacteria 1618
185 Ga0157345_1000367 3300012498 Bacteria 5092
186 Ga0157373_10000114 3300013100 Bacteria 63657
187 Ga0157373_10003979 3300013100 Bacteria 11145
188 Ga0157373_10004112 3300013100 Bacteria 10971
189 Ga0157373_10006121 3300013100 Bacteria 8998
190 Ga0157373_10013471 3300013100 Bacteria 5999
191 Ga0157373_10023741 3300013100 Bacteria 4444
192 Ga0157373_10049600 3300013100 Bacteria 2991
193 Ga0157373_10098682 3300013100 Bacteria 2056
194 Ga0157373_10100142 3300013100 Bacteria 2039
195 Ga0157371_10000102 3300013102 Bacteria 129057
196 Ga0157371_10000245 3300013102 Bacteria 77139
197 Ga0157371_10000554 3300013102 Bacteria 44435
198 Ga0157371_10000577 3300013102 Bacteria 43493
199 Ga0157371_10000835 3300013102 Bacteria 35218
200 Ga0157371_10004029 3300013102 Bacteria 13002
201 Ga0157371_10013824 3300013102 Bacteria 6115
202 Ga0157371_10015950 3300013102 Bacteria 5621
203 Ga0157371_10075932 3300013102 Bacteria 2380
204 Ga0157371_10102009 3300013102 Bacteria 2035
205 Ga0157371_10123392 3300013102 Bacteria 1842
206 Ga0157370_10000444 3300013104 Bacteria 51739
207 Ga0157370_10002220 3300013104 Bacteria 23680
208 Ga0157370_10072395 3300013104 Bacteria 3252
209 Ga0157370_10135121 3300013104 Bacteria 2299
210 Ga0157369_10000375 3300013105 Bacteria 59272
211 Ga0157369_10002994 3300013105 Bacteria 20216
212 Ga0157369_10025810 3300013105 Bacteria 6517
213 Ga0157369_10078363 3300013105 Bacteria 3540
214 Ga0163162_10013860 3300013306 Bacteria 7875
215 Ga0163162_10016516 3300013306 Bacteria 7213
216 Ga0163162_10413907 3300013306 Bacteria 1480
217 Ga0157372_10002660 3300013307 Bacteria 19360
218 Ga0157372_10009383 3300013307 Bacteria 10409
219 Ga0157372_10020816 3300013307 Bacteria 7083
220 Ga0157372_10023100 3300013307 Bacteria 6739
221 Ga0157372_10065898 3300013307 Bacteria 4068
222 Ga0157372_10105263 3300013307 Bacteria 3227
223 Ga0182008_10005323 3300014497 Bacteria 7350
224 Ga0182008_10008883 3300014497 Bacteria 5451
225 Ga0182008_10010865 3300014497 Bacteria 4858
226 Ga0157379_10231696 3300014968 Bacteria 1674
227 Ga0157379_10244193 3300014968 Bacteria 1629
228 Ga0182006_1000018 3300015261 Bacteria 299376
229 Ga0182006_1001964 3300015261 Bacteria 11646
230 Ga0182006_1002621 3300015261 Bacteria 9719
231 Ga0182006_1014858 3300015261 Bacteria 3348
232 Ga0182006_1015427 3300015261 Bacteria 3275
233 Ga0182006_1023329 3300015261 Bacteria 2563
234 Ga0182007_10003484 3300015262 Bacteria 7408
235 Ga0182005_1015617 3300015265 Bacteria 2116
236 Ga0183366_1001 3300015679 Bacteria 2743932
237 Ga0183370_1001 3300015680 Bacteria 2743932
238 Ga0183369_1001 3300015685 Bacteria 2743932
239 Ga0183368_1001 3300015687 Bacteria 2743932
240 Ga0163161_10000006 3300017792 Bacteria 302708
241 Ga0163161_10018448 3300017792 Bacteria 4890
242 Ga0163161_10034235 3300017792 Bacteria 3633
243 Ga0163161_10197136 3300017792 Bacteria 1550
244 Ga0163161_10220152 3300017792 Bacteria 1470
245 Ga0213876_10000023 3300021384 Bacteria 255370
246 Ga0209435_100558 3300025206 Bacteria 7035
247 Ga0209760_100027 3300025207 Bacteria 153290
248 Ga0209760_100066 3300025207 Bacteria 88259
249 Ga0209760_102616 3300025207 Bacteria 1667
250 Ga0209784_100007 3300025224 Bacteria 747715
251 Ga0209784_100064 3300025224 Bacteria 158058
252 Ga0209566_100009 3300025225 Bacteria 554018
253 Ga0209566_100079 3300025225 Bacteria 158058
254 Ga0209674_100021 3300025226 Bacteria 629811
255 Ga0209674_100159 3300025226 Bacteria 88259
256 Ga0209147_100009 3300025229 Bacteria 747409
257 Ga0209147_101055 3300025229 Bacteria 11643
258 Ga0209563_100018 3300025230 Bacteria 747850
259 Ga0209563_100135 3300025230 Bacteria 88259
260 Ga0207427_100006 3300025231 Bacteria 785415
261 Ga0207427_100136 3300025231 Bacteria 88259
262 Ga0209437_100013 3300025233 Bacteria 785457
263 Ga0209437_100092 3300025233 Bacteria 240044
264 Ga0209437_100149 3300025233 Bacteria 158058
265 Ga0209258_100169 3300025242 Bacteria 145227
266 Ga0207425_1000007 3300025245 Bacteria 777411
267 Ga0209646_1000184 3300025246 Bacteria 78423
268 Ga0209677_100012 3300025253 Bacteria 554018
269 Ga0209677_100110 3300025253 Bacteria 88259
270 Ga0209759_1003625 3300025256 Bacteria 6077
271 Ga0209129_1000006 3300025258 Bacteria 777761
272 Ga0209129_1000037 3300025258 Bacteria 326534
273 Ga0209233_1000022 3300025261 Bacteria 785415
274 Ga0209233_1002353 3300025261 Bacteria 7032
275 Ga0209130_1000293 3300025284 Bacteria 60879
276 Ga0209675_1000989 3300025291 Bacteria 17959
277 Ga0209675_1017451 3300025291 Bacteria 2049
278 Ga0209676_1000015 3300025292 Bacteria 784458
279 Ga0209676_1000030 3300025292 Bacteria 506421
280 Ga0209676_1000041 3300025292 Bacteria 424583
281 Ga0209676_1004747 3300025292 Bacteria 7428
282 Ga0209025_1000025 3300025294 Bacteria 524454
283 Ga0209025_1000031 3300025294 Bacteria 422015
284 Ga0209025_1001280 3300025294 Bacteria 34557
285 Ga0209025_1001433 3300025294 Bacteria 31455
286 Ga0209025_1001685 3300025294 Bacteria 27007
287 Ga0209025_1002689 3300025294 Bacteria 18126
288 Ga0209025_1014973 3300025294 Bacteria 4719
289 Ga0209758_1000016 3300025297 Bacteria 778557
290 Ga0209050_1000024 3300025298 Bacteria 533389
291 Ga0209050_1000030 3300025298 Bacteria 463381
292 Ga0209050_1000518 3300025298 Bacteria 64332
293 Ga0209050_1002563 3300025298 Bacteria 15157
294 Ga0209051_1000012 3300025303 Bacteria 595474
295 Ga0209051_1000023 3300025303 Bacteria 437371
296 Ga0209051_1001294 3300025303 Bacteria 22056
297 Ga0209051_1010681 3300025303 Bacteria 4605
298 Ga0209257_1002874 3300025304 Bacteria 16040
299 Ga0209257_1004425 3300025304 Bacteria 10900
300 Ga0207656_10000006 3300025321 Bacteria 395044
301 Ga0207696_1000013 3300025711 Bacteria 524881
302 Ga0207696_1000031 3300025711 Bacteria 384169
303 Ga0207696_1000046 3300025711 Bacteria 291327
304 Ga0207696_1000067 3300025711 Bacteria 228478
305 Ga0207696_1000100 3300025711 Bacteria 171029
306 Ga0207696_1000357 3300025711 Bacteria 46078
307 Ga0207696_1000404 3300025711 Bacteria 40294
308 Ga0207696_1000434 3300025711 Bacteria 37870
309 Ga0207696_1000820 3300025711 Bacteria 20003
310 Ga0207696_1001144 3300025711 Bacteria 15249
311 Ga0207696_1001207 3300025711 Bacteria 14700
312 Ga0207696_1003421 3300025711 Bacteria 7245
313 Ga0207696_1008529 3300025711 Bacteria 3906
314 Ga0207696_1021488 3300025711 Bacteria 2066
315 Ga0207655_1000002 3300025728 Bacteria 1148694
316 Ga0207655_1000033 3300025728 Bacteria 377066
317 Ga0207655_1000036 3300025728 Bacteria 356747
318 Ga0207655_1000111 3300025728 Bacteria 170772
319 Ga0207655_1000115 3300025728 Bacteria 162114
320 Ga0207655_1000170 3300025728 Bacteria 119267
321 Ga0207655_1000202 3300025728 Bacteria 103907
322 Ga0207655_1000208 3300025728 Bacteria 102775
323 Ga0207655_1000284 3300025728 Bacteria 77444
324 Ga0207655_1000388 3300025728 Bacteria 61513
325 Ga0207655_1001163 3300025728 Bacteria 25594
326 Ga0207655_1003418 3300025728 Bacteria 11839
327 Ga0207655_1004304 3300025728 Bacteria 10174
328 Ga0207655_1005474 3300025728 Bacteria 8620
329 Ga0207655_1008224 3300025728 Bacteria 6650
330 Ga0207655_1008594 3300025728 Bacteria 6460
331 Ga0207655_1008819 3300025728 Bacteria 6344
332 Ga0207655_1010707 3300025728 Bacteria 5540
333 Ga0207655_1010965 3300025728 Bacteria 5445
334 Ga0207655_1011441 3300025728 Bacteria 5284
335 Ga0207655_1011686 3300025728 Bacteria 5200
336 Ga0207655_1016389 3300025728 Bacteria 4055
337 Ga0207655_1042728 3300025728 Bacteria 1926
338 Ga0207713_1000045 3300025735 Bacteria 235202
339 Ga0207713_1000047 3300025735 Bacteria 229463
340 Ga0207713_1000056 3300025735 Bacteria 217615
341 Ga0207713_1000075 3300025735 Bacteria 179242
342 Ga0207713_1000079 3300025735 Bacteria 172274
343 Ga0207713_1000083 3300025735 Bacteria 160973
344 Ga0207713_1000613 3300025735 Bacteria 35114
345 Ga0207713_1000659 3300025735 Bacteria 32880
346 Ga0207713_1000837 3300025735 Bacteria 28361
347 Ga0207713_1000881 3300025735 Bacteria 27355
348 Ga0207713_1001328 3300025735 Bacteria 20264
349 Ga0207713_1001352 3300025735 Bacteria 19999
350 Ga0207713_1001441 3300025735 Bacteria 18998
351 Ga0207713_1002574 3300025735 Bacteria 13101
352 Ga0207713_1003273 3300025735 Bacteria 11149
353 Ga0207713_1004380 3300025735 Bacteria 9174
354 Ga0207713_1004600 3300025735 Bacteria 8915
355 Ga0207713_1005089 3300025735 Bacteria 8343
356 Ga0207713_1006514 3300025735 Bacteria 7100
357 Ga0207713_1007461 3300025735 Bacteria 6449
358 Ga0207713_1014577 3300025735 Bacteria 4076
359 Ga0207713_1032998 3300025735 Bacteria 2266
360 Ga0207713_1041473 3300025735 Bacteria 1920
361 Ga0207710_10000024 3300025900 Bacteria 319633
362 Ga0207654_10000010 3300025911 Bacteria 304367
363 Ga0207707_10049888 3300025912 Bacteria 3646
364 Ga0207671_10000131 3300025914 Bacteria 116866
365 Ga0207649_10000012 3300025920 Bacteria 265674
366 Ga0207681_10000099 3300025923 Bacteria 73220
367 Ga0207681_10003495 3300025923 Bacteria 9785
368 Ga0207650_10000338 3300025925 Bacteria 45436
369 Ga0207650_10000564 3300025925 Bacteria 30060
370 Ga0207706_10006159 3300025933 Bacteria 11140
371 Ga0207706_10009041 3300025933 Bacteria 9165
372 Ga0207709_10000248 3300025935 Bacteria 66465
373 Ga0207709_10002118 3300025935 Bacteria 12768
374 Ga0207709_10005277 3300025935 Bacteria 7348
375 Ga0207709_10061385 3300025935 Bacteria 2349
376 Ga0207661_10072049 3300025944 Bacteria 2826
377 Ga0207679_10000015 3300025945 Bacteria 265674
378 Ga0207651_10070235 3300025960 Bacteria 2477
379 Ga0207640_10026125 3300025981 Bacteria 3542
380 Ga0207639_10000286 3300026041 Bacteria 36062
381 Ga0207708_10050675 3300026075 Bacteria 3160
382 Ga0207648_10015778 3300026089 Bacteria 6928
383 Ga0207674_10001883 3300026116 Bacteria 26719
384 Ga0207674_10242856 3300026116 Bacteria 1748
385 Ga0209281_1000004 3300027111 Bacteria 1253949
386 Ga0209281_1000006 3300027111 Bacteria 1170244
387 Ga0209281_1000014 3300027111 Bacteria 643021
388 Ga0209281_1000016 3300027111 Bacteria 588107
389 Ga0209281_1000019 3300027111 Bacteria 576164
390 Ga0209281_1000095 3300027111 Bacteria 238108
391 Ga0209281_1000139 3300027111 Bacteria 179588
392 Ga0209281_1000219 3300027111 Bacteria 123456
393 Ga0209281_1000464 3300027111 Bacteria 57109
394 Ga0209281_1000773 3300027111 Bacteria 30470
395 Ga0209281_1000932 3300027111 Bacteria 24037
396 Ga0209281_1001284 3300027111 Bacteria 16106
397 Ga0209281_1003259 3300027111 Bacteria 5511
398 Ga0209281_1010043 3300027111 Bacteria 2190
399 Ga0209371_1000001 3300027312 Bacteria 2771503
400 Ga0209371_1000015 3300027312 Bacteria 659640
401 Ga0209371_1000063 3300027312 Bacteria 218863
402 Ga0209371_1000068 3300027312 Bacteria 209008
403 Ga0209371_1000071 3300027312 Bacteria 200748
404 Ga0209371_1000244 3300027312 Bacteria 67486
405 Ga0209371_1000331 3300027312 Bacteria 51486
406 Ga0209371_1000429 3300027312 Bacteria 42773
407 Ga0209371_1000617 3300027312 Bacteria 31694
408 Ga0209371_1000980 3300027312 Bacteria 22005
409 Ga0209371_1001170 3300027312 Bacteria 19177
410 Ga0209371_1001783 3300027312 Bacteria 13490
411 Ga0209371_1002443 3300027312 Bacteria 10418
412 Ga0209371_1004020 3300027312 Bacteria 6667
413 Ga0209371_1004846 3300027312 Bacteria 5637
414 Ga0209371_1006649 3300027312 Bacteria 4225
415 Ga0207428_10022610 3300027907 Bacteria 5303
416 Ga0207428_10055895 3300027907 Bacteria 3137
417 Ga0207428_10094654 3300027907 Bacteria 2315
418 Ga0207428_10099304 3300027907 Bacteria 2251
419 Ga0207428_10100480 3300027907 Bacteria 2236
420 Ga0207428_10148203 3300027907 Bacteria 1788
421 Ga0268266_10000502 3300028379 Bacteria 55965
422 Ga0268266_10017876 3300028379 Bacteria 6041
423 Ga0268266_10036568 3300028379 Bacteria 4180
424 Ga0307515_10097159 3300028794 Bacteria 3603
425 Ga0237817_10004 3300030083 Bacteria 96242
426 Ga0237817_10086 3300030083 Bacteria 28492
427 Ga0268256_1000001 3300030500 Bacteria 2771065
428 Ga0268256_1000018 3300030500 Bacteria 594572
429 Ga0268256_1000060 3300030500 Bacteria 218807
430 Ga0268256_1000064 3300030500 Bacteria 210320
431 Ga0268256_1000070 3300030500 Bacteria 189040
432 Ga0268256_1000203 3300030500 Bacteria 67486
433 Ga0268256_1000235 3300030500 Bacteria 58166
434 Ga0268256_1000386 3300030500 Bacteria 40664
435 Ga0268256_1000683 3300030500 Bacteria 25530
436 Ga0268256_1000701 3300030500 Bacteria 25071
437 Ga0268256_1001241 3300030500 Bacteria 15979
438 Ga0268256_1002164 3300030500 Bacteria 10438
439 Ga0268256_1003013 3300030500 Bacteria 7954
440 Ga0268256_1003334 3300030500 Bacteria 7334
441 Ga0268256_1005134 3300030500 Bacteria 5211
442 Ga0268256_1006726 3300030500 Bacteria 4225
443 Ga0268256_1008842 3300030500 Bacteria 3410
444 Ga0316179_1074380 3300030734 Bacteria 3589
445 Ga0316178_1051183 3300030735 Bacteria 40899
446 Ga0316183_1004754 3300030742 Bacteria 7110
447 Ga0265332_10004540 3300031238 Bacteria 6503
448 Ga0265331_10042006 3300031250 Bacteria 2219
449 Ga0307408_100008555 3300031548 Bacteria 6759
450 Ga0307408_100025199 3300031548 Bacteria 4071
451 Ga0307408_100030100 3300031548 Bacteria 3767
452 Ga0265313_10009476 3300031595 Bacteria 6319
453 Ga0265342_10002801 3300031712 Bacteria 14757
454 Ga0307405_10003779 3300031731 Bacteria 7033
455 Ga0307405_10009015 3300031731 Bacteria 5095
456 Ga0307405_10024955 3300031731 Bacteria 3424
457 Ga0307413_10020637 3300031824 Bacteria 3509
458 Ga0307406_10063957 3300031901 Bacteria 2385
459 Ga0307412_10003115 3300031911 Bacteria 9212
460 Ga0307412_10006197 3300031911 Bacteria 6744
461 Ga0307412_10008593 3300031911 Bacteria 5836
462 Ga0307409_100026540 3300031995 Bacteria 4086
463 Ga0307416_100154504 3300032002 Unclassified 2110
464 Ga0307414_10028695 3300032004 Bacteria 3612
465 Ga0307414_10061738 3300032004 Bacteria 2656
466 Ga0307414_10093451 3300032004 Bacteria 2242
467 Ga0307414_10102815 3300032004 Bacteria 2154
468 Ga0307414_10117922 3300032004 Bacteria 2035
469 Ga0307414_10212616 3300032004 Bacteria 1582
470 Ga0307411_10007691 3300032005 Bacteria 5516
471 Ga0395898_0026066 3300037466 Bacteria 5886
472 Ga0395905_0011690 3300037471 Bacteria 8475
473 Ga0237819_00136 3300038705 Bacteria 27619
474 Ga0237819_00899 3300038705 Bacteria 9223
475 Ga0237819_01191 3300038705 Bacteria 7310
476 Ga0400490_02503 3300038726 Bacteria 40089
477 Ga0400489_18894 3300039093 Bacteria 4958
478 Ga0436365_0965775 3300039437 Bacteria 470291
479 Ga0439438_000014 3300041405 Bacteria 130876
480 Ga0439438_003322 3300041405 Bacteria 6539
481 Ga0439438_003720 3300041405 Bacteria 6060
482 Ga0439438_003853 3300041405 Bacteria 5916
483 Ga0439438_005789 3300041405 Bacteria 4487
484 Ga0439438_007455 3300041405 Bacteria 3739
485 Ga0439438_007874 3300041405 Bacteria 3593
486 Ga0439447_003919 3300041407 Bacteria 5213
487 Ga0439447_004242 3300041407 Bacteria 4967
488 Ga0439447_005799 3300041407 Bacteria 4073
489 Ga0439447_008267 3300041407 Bacteria 3233
490 Ga0439466_0000008 3300041411 Bacteria 246721
491 Ga0451853_2848169 3300041512 Bacteria 4112
492 Ga0439432_000624 3300042006 Bacteria 13327
493 Ga0439432_000659 3300042006 Bacteria 12908
494 Ga0439432_003130 3300042006 Bacteria 6157
495 Ga0439432_005623 3300042006 Bacteria 4507
496 Ga0439432_022443 3300042006 Bacteria 2084
497 Ga0439451_017439 3300042009 Bacteria 1447
498 Ga0439452_000002 3300042010 Bacteria 1377577
499 Ga0439452_000020 3300042010 Bacteria 309345
500 Ga0439452_000023 3300042010 Bacteria 232427
501 Ga0439452_000112 3300042010 Bacteria 64831
502 Ga0439452_000370 3300042010 Bacteria 27188
503 Ga0439452_003394 3300042010 Bacteria 5585
504 Ga0439452_003587 3300042010 Bacteria 5407
505 Ga0439463_000362 3300042016 Bacteria 12623
506 Ga0439463_008252 3300042016 Bacteria 2566
507 Ga0450911_002076 3300042115 Bacteria 4114
508 Ga0450920_001025 3300042122 Bacteria 4574
509 Ga0450890_001315 3300042127 Bacteria 3588
510 Ga0450903_003208 3300042138 Bacteria 2845
511 Ga0450906_001093 3300042145 Bacteria 5991
512 Ga0450907_000030 3300042146 Bacteria 68375
513 Ga0450907_001550 3300042146 Bacteria 4895
514 Ga0450907_007918 3300042146 Bacteria 1769
515 Ga0439446_0033311 3300042156 Bacteria 1496
516 Ga0439440_0003394 3300042993 Bacteria 3069
517 Ga0466981_0000013 3300044669 Bacteria 129274
518 Ga0453684_0001338 3300044712 Bacteria 72311
519 Ga0453684_0001761 3300044712 Bacteria 57844
520 Ga0453684_0025986 3300044712 Bacteria 8479
521 Ga0451576_0000051 3300045051 Bacteria 313453
522 Ga0451576_0000696 3300045051 Bacteria 68242
523 Ga0451576_0005481 3300045051 Bacteria 15882
524 Ga0451576_0100909 3300045051 Bacteria 3001
525 Ga0466967_0000405 3300045976 Bacteria 20295
526 Ga0495617_001747 3300046452 Bacteria 9281
527 Ga0495627_000240 3300046453 Bacteria 57483
528 Ga0495590_0007182 3300046457 Bacteria 4308
529 Ga0495590_0033417 3300046457 Bacteria 1798
530 Ga0495591_000031 3300046458 Bacteria 177747
531 Ga0495591_000113 3300046458 Bacteria 93452
532 Ga0495591_000294 3300046458 Bacteria 45588
533 Ga0495591_000539 3300046458 Bacteria 29095
534 Ga0495591_003979 3300046458 Bacteria 7406
535 Ga0495591_010554 3300046458 Bacteria 3571
536 Ga0495653_0007201 3300046463 Bacteria 9116
537 Ga0495650_0000047 3300046471 Bacteria 335136
538 Ga0495650_0000199 3300046471 Bacteria 130411
539 Ga0495650_0000360 3300046471 Bacteria 80145
540 Ga0495650_0000623 3300046471 Bacteria 47691
541 Ga0495650_0004070 3300046471 Bacteria 10227
542 Ga0495650_0011199 3300046471 Bacteria 4935
543 Ga0495650_0031114 3300046471 Bacteria 2406
544 Ga0495580_0000209 3300046472 Bacteria 45294
545 Ga0495605_0000100 3300046474 Bacteria 109002
546 Ga0495605_0000122 3300046474 Bacteria 101994
547 Ga0495605_0000720 3300046474 Bacteria 24370
548 Ga0495605_0010155 3300046474 Bacteria 5272
549 Ga0495605_0016621 3300046474 Bacteria 3980
550 Ga0495639_0003206 3300046475 Bacteria 7110
551 Ga0495584_0008007 3300046491 Bacteria 5492
552 Ga0495584_0008818 3300046491 Bacteria 5214
553 Ga0495584_0011877 3300046491 Bacteria 4453
554 Ga0495585_0016562 3300046492 Bacteria 4271
555 Ga0495585_0023700 3300046492 Bacteria 3521
556 Ga0495585_0033759 3300046492 Bacteria 2894
557 Ga0495596_0023127 3300046500 Bacteria 2523
558 Ga0495607_0002708 3300046501 Bacteria 14140
559 Ga0495607_0005213 3300046501 Bacteria 9350
560 Ga0495607_0005252 3300046501 Bacteria 9319
561 Ga0495607_0007508 3300046501 Bacteria 7531
562 Ga0495607_0014541 3300046501 Bacteria 5118
563 Ga0495607_0020817 3300046501 Bacteria 4138
564 Ga0495583_0000174 3300046506 Bacteria 109079
565 Ga0495583_0001423 3300046506 Bacteria 24377
566 Ga0495583_0003451 3300046506 Bacteria 12018
567 Ga0495583_0004441 3300046506 Bacteria 10036
568 Ga0495583_0007528 3300046506 Bacteria 6815
569 Ga0495583_0010934 3300046506 Bacteria 5242
570 Ga0495606_0000541 3300046507 Bacteria 60650
571 Ga0495606_0002133 3300046507 Bacteria 23878
572 Ga0495606_0135995 3300046507 Bacteria 1455
573 Ga0495610_0009567 3300046512 Bacteria 6112
574 Ga0495610_0031458 3300046512 Bacteria 2768
575 Ga0495616_0011485 3300046513 Bacteria 5070
576 Ga0495616_0058159 3300046513 Bacteria 1904
577 Ga0495620_0000416 3300046515 Bacteria 28487
578 Ga0495620_0007001 3300046515 Bacteria 6154
579 Ga0495631_0003022 3300046518 Bacteria 9311
580 Ga0495632_0000855 3300046519 Bacteria 26752
581 Ga0495632_0010624 3300046519 Bacteria 5433
582 Ga0495632_0037589 3300046519 Bacteria 2455
583 Ga0495632_0048273 3300046519 Bacteria 2108
584 Ga0495637_0000045 3300046520 Bacteria 108215
585 Ga0495637_0001490 3300046520 Bacteria 13729
586 Ga0495637_0008188 3300046520 Bacteria 5144
587 Ga0495637_0016425 3300046520 Bacteria 3459
588 Ga0495637_0042148 3300046520 Bacteria 1954
589 Ga0495637_0048225 3300046520 Bacteria 1794
590 Ga0495637_0069479 3300046520 Bacteria 1425
591 Ga0495644_0011465 3300046523 Bacteria 3413
592 Ga0495648_0083880 3300046524 Bacteria 1804
593 Ga0495642_0001762 3300046528 Bacteria 9324
594 Ga0495642_0009839 3300046528 Bacteria 3662
595 Ga0495654_0000040 3300046530 Bacteria 184580
596 Ga0495654_0000519 3300046530 Bacteria 31360
597 Ga0495654_0002898 3300046530 Bacteria 10753
598 Ga0495654_0010746 3300046530 Bacteria 4972
599 Ga0495654_0012988 3300046530 Bacteria 4462
600 Ga0495654_0013134 3300046530 Bacteria 4435
601 Ga0495654_0032482 3300046530 Bacteria 2646
602 Ga0495654_0051859 3300046530 Bacteria 2000
603 Ga0495654_0062000 3300046530 Bacteria 1793
604 Ga0495587_0051785 3300046536 Bacteria 2425
605 Ga0495609_0000023 3300046538 Bacteria 269702
606 Ga0495609_0000088 3300046538 Bacteria 109269
607 Ga0495609_0000132 3300046538 Bacteria 80926
608 Ga0495609_0017630 3300046538 Bacteria 3314
609 Ga0495609_0057145 3300046538 Bacteria 1727
610 Ga0495597_0000240 3300046542 Bacteria 49641
611 Ga0495597_0003419 3300046542 Bacteria 9274
612 Ga0495597_0046301 3300046542 Bacteria 1927
613 Ga0495597_0053024 3300046542 Bacteria 1784
614 Ga0495622_0006401 3300046557 Bacteria 5466
615 Ga0495633_0000777 3300046558 Bacteria 28543
616 Ga0495633_0032126 3300046558 Bacteria 2537
617 Ga0495656_0008683 3300046615 Bacteria 3635
618 Ga0495656_0040629 3300046615 Bacteria 1939
619 Ga0495668_0004362 3300046616 Bacteria 10095
620 Ga0495668_0005152 3300046616 Bacteria 8974
621 Ga0495668_0025862 3300046616 Bacteria 3333
622 Ga0495634_0029979 3300046642 Bacteria 3761
623 Ga0495611_0004481 3300046648 Bacteria 6048
624 Ga0495611_0013263 3300046648 Bacteria 3506
625 Ga0495625_0000061 3300046660 Bacteria 179140
626 Ga0495625_0006163 3300046660 Bacteria 10742
627 Ga0495625_0027918 3300046660 Bacteria 4238
628 Ga0495635_0031677 3300046663 Bacteria 3669
629 Ga0495659_0002272 3300046664 Bacteria 6233
630 Ga0495661_0000060 3300046665 Bacteria 131162
631 Ga0495661_0000072 3300046665 Bacteria 120743
632 Ga0495661_0000841 3300046665 Bacteria 28595
633 Ga0495661_0030018 3300046665 Bacteria 3464
634 Ga0495623_0029954 3300046679 Bacteria 3502
635 Ga0495669_0022243 3300046684 Bacteria 2753
636 Ga0495624_0005415 3300046690 Bacteria 9200
637 Ga0495670_0016631 3300046691 Bacteria 3617
638 Ga0495670_0018111 3300046691 Bacteria 3469
639 Ga0495670_0102119 3300046691 Bacteria 1477
640 Ga0495671_0011769 3300046692 Bacteria 4796
641 Ga0495671_0012410 3300046692 Bacteria 4655
642 Ga0495671_0013286 3300046692 Bacteria 4466
643 Ga0495671_0029446 3300046692 Bacteria 2819
644 Ga0495671_0030945 3300046692 Bacteria 2738
645 Ga0495649_0001082 3300046694 Bacteria 21260
646 Ga0495649_0001630 3300046694 Bacteria 16705
647 Ga0495649_0004431 3300046694 Bacteria 9174
648 Ga0495649_0006493 3300046694 Bacteria 7278
649 Ga0495649_0015624 3300046694 Bacteria 4316
650 Ga0495649_0022169 3300046694 Bacteria 3553
651 Ga0495649_0023816 3300046694 Bacteria 3418
652 Ga0495589_0002988 3300046794 Bacteria 9315
653 Ga0495589_0004351 3300046794 Bacteria 7554
654 Ga0495589_0057788 3300046794 Bacteria 1907
655 Ga0495660_0000045 3300046810 Bacteria 150303
656 Ga0495660_0000134 3300046810 Bacteria 80417
657 Ga0495660_0004806 3300046810 Bacteria 8152
658 Ga0495660_0020584 3300046810 Bacteria 3781
659 Ga0495604_0012472 3300047317 Bacteria 6759
660 Ga0495604_0043272 3300047317 Bacteria 3526
661 Ga0495672_0000070 3300047320 Bacteria 184471
662 Ga0495672_0000083 3300047320 Bacteria 158118
663 Ga0495672_0000224 3300047320 Bacteria 80413
664 Ga0495672_0004169 3300047320 Bacteria 11998
665 Ga0495672_0004529 3300047320 Bacteria 11335
666 Ga0495672_0006578 3300047320 Bacteria 8952
667 Ga0495672_0017583 3300047320 Bacteria 4779
668 Ga0495672_0018934 3300047320 Bacteria 4556
669 Ga0495672_0029790 3300047320 Bacteria 3431
670 Ga0495676_0000011 3300047321 Bacteria 242612
671 Ga0495676_0007808 3300047321 Bacteria 9815
672 Ga0495676_0039201 3300047321 Bacteria 3926
673 Ga0495680_0014189 3300047322 Bacteria 6912
674 Ga0495683_0000070 3300047323 Bacteria 108186
675 Ga0495683_0000362 3300047323 Bacteria 37471
676 Ga0495683_0009052 3300047323 Bacteria 5307
677 Ga0495683_0013020 3300047323 Bacteria 4355
678 Ga0495683_0022696 3300047323 Bacteria 3226
679 Ga0495683_0061129 3300047323 Bacteria 1865
680 Ga0495687_011045 3300047443 Bacteria 4889
681 Ga0495687_031458 3300047443 Bacteria 2434
682 Ga0495677_0007419 3300047445 Bacteria 4099
683 Ga0495679_000021 3300047446 Bacteria 226183
684 Ga0495679_000028 3300047446 Bacteria 192300
685 Ga0495679_000867 3300047446 Bacteria 19100
686 Ga0495679_003543 3300047446 Bacteria 7461
687 Ga0495673_0000114 3300047469 Bacteria 159048
688 Ga0495673_0000622 3300047469 Bacteria 34841
689 Ga0495673_0002493 3300047469 Bacteria 12887
690 Ga0495673_0002965 3300047469 Bacteria 11438
691 Ga0495673_0003291 3300047469 Bacteria 10722
692 Ga0495673_0003710 3300047469 Bacteria 9931
693 Ga0495673_0004185 3300047469 Bacteria 9113
694 Ga0495673_0004320 3300047469 Bacteria 8946
695 Ga0495673_0012251 3300047469 Bacteria 4559
696 Ga0495673_0012739 3300047469 Bacteria 4441
697 Ga0495681_0004600 3300047470 Bacteria 9385
698 Ga0495681_0010607 3300047470 Bacteria 5569
699 Ga0495681_0010847 3300047470 Bacteria 5482
700 Ga0495626_0009113 3300048091 Bacteria 5381
701 Ga0495626_0013014 3300048091 Bacteria 4337
702 Ga0495626_0036221 3300048091 Bacteria 2351
703 Ga0496101_0000119 3300048904 Bacteria 77119
704 Ga0496102_0012189 3300048905 Bacteria 7432
705 Ga0496102_0048468 3300048905 Bacteria 3862
706 Ga0496103_0007163 3300048906 Bacteria 6652
707 Ga0496104_0005440 3300048907 Bacteria 11145
708 Ga0496105_0066793 3300048908 Bacteria 2969
709 Ga0496116_0000058 3300048919 Bacteria 279767
710 Ga0496116_0000282 3300048919 Bacteria 87438
711 Ga0496116_0000521 3300048919 Bacteria 51818
712 Ga0496116_0001110 3300048919 Bacteria 32241
713 Ga0496116_0001287 3300048919 Bacteria 28859
714 Ga0496116_0014450 3300048919 Bacteria 6303
715 Ga0496116_0020828 3300048919 Bacteria 4966
716 Ga0496116_0020959 3300048919 Bacteria 4944
717 Ga0496116_0033523 3300048919 Bacteria 3643
718 Ga0496116_0034975 3300048919 Bacteria 3535
719 Ga0496116_0036842 3300048919 Bacteria 3418
720 Ga0496116_0037302 3300048919 Bacteria 3390
721 Ga0496117_0000450 3300048920 Bacteria 68428
722 Ga0496117_0000470 3300048920 Bacteria 66974
723 Ga0496117_0001133 3300048920 Bacteria 40208
724 Ga0496117_0001270 3300048920 Bacteria 37430
725 Ga0496117_0002802 3300048920 Bacteria 21283
726 Ga0496117_0005202 3300048920 Bacteria 13842
727 Ga0496117_0007574 3300048920 Bacteria 10566
728 Ga0496117_0014495 3300048920 Bacteria 6785
729 Ga0496117_0017576 3300048920 Bacteria 5967
730 Ga0496117_0025614 3300048920 Bacteria 4634
731 Ga0496117_0037276 3300048920 Bacteria 3624
732 Ga0496117_0047865 3300048920 Bacteria 3061
733 Ga0496118_0000490 3300048921 Bacteria 65592
734 Ga0496118_0002301 3300048921 Bacteria 25935
735 Ga0496118_0002440 3300048921 Bacteria 25026
736 Ga0496118_0003453 3300048921 Bacteria 19890
737 Ga0496118_0004790 3300048921 Bacteria 15801
738 Ga0496118_0006664 3300048921 Bacteria 12600
739 Ga0496118_0014636 3300048921 Bacteria 7331
740 Ga0496118_0082265 3300048921 Bacteria 2257
741 Ga0496118_0153835 3300048921 Bacteria 1434
742 Ga0496119_0000194 3300048922 Bacteria 85475
743 Ga0496119_0000219 3300048922 Bacteria 81203
744 Ga0496119_0000490 3300048922 Bacteria 53979
745 Ga0496119_0000680 3300048922 Bacteria 45409
746 Ga0496119_0000706 3300048922 Bacteria 44781
747 Ga0496119_0001325 3300048922 Bacteria 30443
748 Ga0496119_0003360 3300048922 Bacteria 16657
749 Ga0496119_0006499 3300048922 Bacteria 10795
750 Ga0496119_0006577 3300048922 Bacteria 10713
751 Ga0496119_0012834 3300048922 Bacteria 6756
752 Ga0496119_0025897 3300048922 Bacteria 4083
753 Ga0496119_0041728 3300048922 Bacteria 2917
754 Ga0496120_0000108 3300048923 Bacteria 138566
755 Ga0496120_0000279 3300048923 Bacteria 85805
756 Ga0496120_0000301 3300048923 Bacteria 82406
757 Ga0496120_0000476 3300048923 Bacteria 62924
758 Ga0496120_0000813 3300048923 Bacteria 44710
759 Ga0496120_0001708 3300048923 Bacteria 25110
760 Ga0496120_0001730 3300048923 Bacteria 24837
761 Ga0496120_0002311 3300048923 Bacteria 19699
762 Ga0496120_0003918 3300048923 Bacteria 12988
763 Ga0496120_0009747 3300048923 Bacteria 6774
764 Ga0496120_0010365 3300048923 Bacteria 6509
765 Ga0496120_0091791 3300048923 Bacteria 1620
766 Ga0496121_0000074 3300048924 Bacteria 243022
767 Ga0496121_0002538 3300048924 Bacteria 27667
768 Ga0496121_0003070 3300048924 Bacteria 24190
769 Ga0496121_0004761 3300048924 Bacteria 17911
770 Ga0496121_0006595 3300048924 Bacteria 14318
771 Ga0496121_0031698 3300048924 Bacteria 4823
772 Ga0496121_0048053 3300048924 Bacteria 3634
773 Ga0496121_0055202 3300048924 Bacteria 3311
774 Ga0496122_0000003 3300048925 Bacteria 645810
775 Ga0496122_0000398 3300048925 Bacteria 92491
776 Ga0496122_0000607 3300048925 Bacteria 73586
777 Ga0496122_0002360 3300048925 Bacteria 27157
778 Ga0496122_0003475 3300048925 Bacteria 20727
779 Ga0496122_0003481 3300048925 Bacteria 20706
780 Ga0496122_0007269 3300048925 Bacteria 12382
781 Ga0496122_0033526 3300048925 Bacteria 4221
782 Ga0496122_0088199 3300048925 Bacteria 2127
783 Ga0496123_0000012 3300048926 Bacteria 458760
784 Ga0496123_0000302 3300048926 Bacteria 95750
785 Ga0496123_0000451 3300048926 Bacteria 73603
786 Ga0496123_0001246 3300048926 Bacteria 36873
787 Ga0496123_0002061 3300048926 Bacteria 25933
788 Ga0496123_0002802 3300048926 Bacteria 20706
789 Ga0496123_0008055 3300048926 Bacteria 9749
790 Ga0496123_0009458 3300048926 Bacteria 8774
791 Ga0496123_0064996 3300048926 Bacteria 2321
792 Ga0496123_0067544 3300048926 Bacteria 2257
793 Ga0496123_0080135 3300048926 Bacteria 1991
794 Ga0496124_0000073 3300048927 Bacteria 219306
795 Ga0496124_0000165 3300048927 Bacteria 134661
796 Ga0496124_0000304 3300048927 Bacteria 90806
797 Ga0496124_0000379 3300048927 Bacteria 81086
798 Ga0496124_0001441 3300048927 Bacteria 35169
799 Ga0496124_0009646 3300048927 Bacteria 9888
800 Ga0496124_0011464 3300048927 Bacteria 8861
801 Ga0496124_0021157 3300048927 Bacteria 5996
802 Ga0496124_0021548 3300048927 Bacteria 5937
803 Ga0496124_0026575 3300048927 Bacteria 5216
804 Ga0496124_0050341 3300048927 Bacteria 3550
805 Ga0496124_0059496 3300048927 Bacteria 3209
806 Ga0496125_0000091 3300048928 Bacteria 212668
807 Ga0496125_0001589 3300048928 Bacteria 32202
808 Ga0496125_0013508 3300048928 Bacteria 8022
809 Ga0496125_0016893 3300048928 Bacteria 6985
810 Ga0496125_0027923 3300048928 Bacteria 5104
811 Ga0496126_0003284 3300048929 Bacteria 20622
812 Ga0496126_0004579 3300048929 Bacteria 16401
813 Ga0496126_0024800 3300048929 Bacteria 5782
814 Ga0496126_0079929 3300048929 Bacteria 2893
815 Ga0496126_0238728 3300048929 Bacteria 1519
816 Ga0495678_000325 3300049459 Bacteria 50656
817 Ga0495678_000337 3300049459 Bacteria 49208
818 Ga0495678_000692 3300049459 Bacteria 30773
819 Ga0495678_007952 3300049459 Bacteria 5429
820 Ga0495678_011303 3300049459 Bacteria 4280
821 Ga0495678_023888 3300049459 Bacteria 2648
822 Ga0495678_046604 3300049459 Bacteria 1702
823 Ga0495682_0000139 3300049460 Bacteria 62814
824 Ga0495682_0000607 3300049460 Bacteria 24172
825 Ga0501033_0020049 3300049570 Bacteria 5055
826 Ga0501068_0009844 3300049584 Bacteria 5354
827 Ga0501076_0081564 3300049592 Bacteria 2597
828 Ga0501217_032818 3300049661 Bacteria 1286
829 Ga0501223_000540 3300049663 Bacteria 9116
830 Ga0501259_000748 3300049688 Bacteria 5311
831 Ga0501221_004019 3300049704 Unclassified 2430
832 Ga0501225_0005805 3300049705 Bacteria 3615
833 Ga0501241_003383 3300049758 Bacteria 3010
834 nmdc:mga0k408_12604_c2 3300050493 Bacteria 2331
835 nmdc:mga08y16_124914_c1 3300050511 Bacteria 2677
836 nmdc:mga08y16_171893_c1 3300050511 Bacteria 2251
837 nmdc:mga0a205_2066_c1 3300050515 Bacteria 17562
838 Ga0500618_007715 3300053125 Bacteria 3047
839 Ga0500621_000018 3300053126 Bacteria 80374

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0153835 Ga0496118_0153835_29_1228 366
2 3300048922 Ga0496119_0006577 Ga0496119_0006577_97_1467 367
3 3300049661 Ga0501217_032818 Ga0501217_032818_50_1246 397
4 3300031238 Ga0265332_10004540 Ga0265332_100045406 401
5 3300031712 Ga0265342_10002801 Ga0265342_1000280112 401
6 3300045051 Ga0451576_0005481 Ga0451576_0005481_1611_2918 404
7 3300005289 Ga0065704_10001316 Ga0065704_1000131615 409
8 3300005548 Ga0070665_100185969 Ga0070665_1001859691 409
9 3300006852 Ga0075433_10001141 Ga0075433_100011412 409
10 3300006871 Ga0075434_100002344 Ga0075434_1000023448 409
11 3300009011 Ga0105251_10000749 Ga0105251_1000074920 409
12 3300009011 Ga0105251_10037172 Ga0105251_100371722 409
13 3300009036 Ga0105244_10004028 Ga0105244_100040287 409
14 3300025735 Ga0207713_1000047 Ga0207713_1000047171 409
15 3300025735 Ga0207713_1032998 Ga0207713_10329981 409
16 3300048929 Ga0496126_0238728 Ga0496126_0238728_80_1426 409
17 3300050511 nmdc:mga08y16_124914_c1 nmdc:mga08y16_124914_c1_368_1714 409
18 3300050515 nmdc:mga0a205_2066_c1 nmdc:mga0a205_2066_c1_11032_12378 409
19 2162886007 SwRhRL2b_contig_1551154 SwRhRL2b_0251.00004660 410
20 2162886007 SwRhRL2b_contig_994871 SwRhRL2b_0799.00008010 410
21 3300005289 Ga0065704_10003028 Ga0065704_100030283 410
22 3300009092 Ga0105250_10000844 Ga0105250_100008442 410
23 3300025711 Ga0207696_1001144 Ga0207696_10011449 410
24 3300025728 Ga0207655_1000036 Ga0207655_1000036319 410
25 3300025735 Ga0207713_1041473 Ga0207713_10414731 410
26 3300027111 Ga0209281_1000464 Ga0209281_100046436 410
27 3300027312 Ga0209371_1000244 Ga0209371_100024429 410
28 3300030500 Ga0268256_1000203 Ga0268256_100020332 410
29 3300048919 Ga0496116_0033523 Ga0496116_0033523_1914_3284 410
30 3300048924 Ga0496121_0004761 Ga0496121_0004761_785_2155 410
31 3300048925 Ga0496122_0000003 Ga0496122_0000003_459249_460619 410
32 3300048926 Ga0496123_0000012 Ga0496123_0000012_214432_215802 410
33 3300048922 Ga0496119_0001325 Ga0496119_0001325_25155_26501 411
34 3300048923 Ga0496120_0001730 Ga0496120_0001730_21997_23343 411
35 3300003856 Ga0058692_1000280 Ga0058692_10002806 412
36 3300006946 Ga0079104_1000487 Ga0079104_100048735 412
37 3300027312 Ga0209371_1002443 Ga0209371_10024437 412
38 3300030500 Ga0268256_1002164 Ga0268256_10021647 412
39 3300027111 Ga0209281_1000219 Ga0209281_1000219109 413
40 3300030500 Ga0268256_1000235 Ga0268256_100023528 413
41 3300006946 Ga0079104_1000686 Ga0079104_10006867 414
42 3300013307 Ga0157372_10023100 Ga0157372_100231005 414
43 3300027111 Ga0209281_1000006 Ga0209281_100000628 414
44 3300027312 Ga0209371_1004846 Ga0209371_10048462 414
45 3300030500 Ga0268256_1005134 Ga0268256_10051344 414
46 2162886007 SwRhRL2b_contig_455968 SwRhRL2b_0692.00000630 415
47 3300005289 Ga0065704_10000343 Ga0065704_100003435 415
48 3300005548 Ga0070665_100000276 Ga0070665_10000027646 415
49 3300006051 Ga0075364_10009444 Ga0075364_100094445 415
50 3300013100 Ga0157373_10023741 Ga0157373_100237412 415
51 3300013102 Ga0157371_10102009 Ga0157371_101020092 415
52 3300013104 Ga0157370_10002220 Ga0157370_1000222010 415
53 3300025728 Ga0207655_1000002 Ga0207655_1000002291 415
54 3300025735 Ga0207713_1004600 Ga0207713_10046003 415
55 3300028379 Ga0268266_10000502 Ga0268266_1000050221 415
56 3300041512 Ga0451853_2848169 Ga0451853_2848169_1965_3317 415
57 3300042010 Ga0439452_000112 Ga0439452_000112_31469_32821 415
58 3300046471 Ga0495650_0000047 Ga0495650_0000047_95590_96942 415
59 3300048919 Ga0496116_0001287 Ga0496116_0001287_4530_5882 415
60 3300048920 Ga0496117_0002802 Ga0496117_0002802_7540_8892 415
61 3300048921 Ga0496118_0003453 Ga0496118_0003453_10999_12351 415
62 3300048922 Ga0496119_0003360 Ga0496119_0003360_13521_14873 415
63 3300048923 Ga0496120_0010365 Ga0496120_0010365_3485_4837 415
64 3300048924 Ga0496121_0003070 Ga0496121_0003070_4530_5882 415
65 3300048925 Ga0496122_0003481 Ga0496122_0003481_14819_16171 415
66 3300048926 Ga0496123_0002802 Ga0496123_0002802_14819_16171 415
67 3300048927 Ga0496124_0021548 Ga0496124_0021548_1397_2749 415
68 3300002773 JGI25152J39213_1000339 JGI25152J39213_10003395 416
69 3300003320 rootH2_10023223 rootH2_100232235 416
70 3300006946 Ga0079104_1002560 Ga0079104_10025604 416
71 3300009011 Ga0105251_10001635 Ga0105251_100016353 416
72 3300013105 Ga0157369_10000375 Ga0157369_1000037532 416
73 3300013307 Ga0157372_10002660 Ga0157372_1000266012 416
74 3300025258 Ga0209129_1000037 Ga0209129_1000037216 416
75 3300025735 Ga0207713_1000083 Ga0207713_1000083145 416
76 3300027111 Ga0209281_1001284 Ga0209281_10012849 416
77 3300027312 Ga0209371_1000015 Ga0209371_1000015267 416
78 3300027312 Ga0209371_1006649 Ga0209371_10066492 416
79 3300030500 Ga0268256_1000018 Ga0268256_1000018357 416
80 3300030500 Ga0268256_1003334 Ga0268256_10033344 416
81 3300030500 Ga0268256_1006726 Ga0268256_10067263 416
82 3300042010 Ga0439452_000020 Ga0439452_000020_56294_57646 416
83 3300042010 Ga0439452_000370 Ga0439452_000370_3231_4583 416
84 3300044669 Ga0466981_0000013 Ga0466981_0000013_121221_122573 416
85 3300048920 Ga0496117_0005202 Ga0496117_0005202_2481_3833 416
86 3300048922 Ga0496119_0000194 Ga0496119_0000194_28057_29409 416
87 3300048923 Ga0496120_0002311 Ga0496120_0002311_10110_11462 416
88 3300048926 Ga0496123_0001246 Ga0496123_0001246_948_2300 416
89 3300048926 Ga0496123_0009458 Ga0496123_0009458_4206_5558 416
90 3300048927 Ga0496124_0001441 Ga0496124_0001441_33777_35129 416
91 3300048928 Ga0496125_0027923 Ga0496125_0027923_825_2177 416
92 3300048929 Ga0496126_0024800 Ga0496126_0024800_3320_4672 416
93 3300003856 Ga0058692_1001395 Ga0058692_10013955 417
94 3300005577 Ga0068857_100000064 Ga0068857_1000000643 417
95 3300005834 Ga0068851_10013386 Ga0068851_100133863 417
96 3300006946 Ga0079104_1000822 Ga0079104_10008224 417
97 3300006946 Ga0079104_1002354 Ga0079104_10023542 417
98 3300009036 Ga0105244_10020188 Ga0105244_100201882 417
99 3300009092 Ga0105250_10000018 Ga0105250_10000018108 417
100 3300009148 Ga0105243_10074567 Ga0105243_100745671 417
101 3300015679 Ga0183366_1001 Ga0183366_10012355 417
102 3300015680 Ga0183370_1001 Ga0183370_10012355 417
103 3300015685 Ga0183369_1001 Ga0183369_10012356 417
104 3300015687 Ga0183368_1001 Ga0183368_10012355 417
105 3300025711 Ga0207696_1000013 Ga0207696_1000013300 417
106 3300026116 Ga0207674_10001883 Ga0207674_1000188317 417
107 3300027111 Ga0209281_1000004 Ga0209281_1000004244 417
108 3300027111 Ga0209281_1000773 Ga0209281_10007736 417
109 3300027111 Ga0209281_1000932 Ga0209281_10009325 417
110 3300027312 Ga0209371_1001170 Ga0209371_10011704 417
111 3300030500 Ga0268256_1000701 Ga0268256_100070117 417
112 3300042006 Ga0439432_022443 Ga0439432_022443_366_1718 417
113 3300044712 Ga0453684_0025986 Ga0453684_0025986_1608_2948 417
114 3300046458 Ga0495591_000294 Ga0495591_000294_2808_4178 417
115 3300047320 Ga0495672_0000070 Ga0495672_0000070_85227_86579 417
116 3300047469 Ga0495673_0000114 Ga0495673_0000114_4443_5813 417
117 3300048920 Ga0496117_0014495 Ga0496117_0014495_2199_3551 417
118 3300048922 Ga0496119_0025897 Ga0496119_0025897_1333_2685 417
119 3300048922 Ga0496119_0041728 Ga0496119_0041728_675_2027 417
120 3300048923 Ga0496120_0091791 Ga0496120_0091791_112_1464 417
121 3300048924 Ga0496121_0031698 Ga0496121_0031698_1270_2622 417
122 3300048924 Ga0496121_0055202 Ga0496121_0055202_183_1535 417
123 3300048925 Ga0496122_0007269 Ga0496122_0007269_4060_5412 417
124 3300048925 Ga0496122_0088199 Ga0496122_0088199_744_2096 417
125 3300048926 Ga0496123_0067544 Ga0496123_0067544_289_1641 417
126 3300048927 Ga0496124_0011464 Ga0496124_0011464_6832_8184 417
127 3300048929 Ga0496126_0004579 Ga0496126_0004579_11921_13273 417
128 3300003856 Ga0058692_1001400 Ga0058692_10014004 418
129 3300006195 Ga0075366_10038054 Ga0075366_100380542 418
130 3300009011 Ga0105251_10003712 Ga0105251_100037124 418
131 3300015261 Ga0182006_1000018 Ga0182006_1000018256 418
132 3300025728 Ga0207655_1001163 Ga0207655_10011634 418
133 3300025735 Ga0207713_1001328 Ga0207713_100132817 418
134 3300025735 Ga0207713_1006514 Ga0207713_10065142 418
135 3300025935 Ga0207709_10061385 Ga0207709_100613851 418
136 3300027312 Ga0209371_1000001 Ga0209371_10000012347 418
137 3300030500 Ga0268256_1000001 Ga0268256_1000001293 418
138 3300048907 Ga0496104_0005440 Ga0496104_0005440_3778_5130 418
139 3300048908 Ga0496105_0066793 Ga0496105_0066793_39_1391 418
140 3300048923 Ga0496120_0009747 Ga0496120_0009747_2656_4008 418
141 3300048924 Ga0496121_0048053 Ga0496121_0048053_1919_3271 418
142 3300048928 Ga0496125_0016893 Ga0496125_0016893_2748_4100 418
143 3300048929 Ga0496126_0079929 Ga0496126_0079929_149_1501 418
144 3300050493 nmdc:mga0k408_12604_c2 nmdc:mga0k408_12604_c2_873_2225 418
145 3300042010 Ga0439452_000002 Ga0439452_000002_283211_284563 419
146 3300003578 Ga0006562J51391_1015515 Ga0006562J51391_10155151 420
147 3300009036 Ga0105244_10000566 Ga0105244_1000056627 420
148 3300025728 Ga0207655_1000208 Ga0207655_100020861 420
149 3300025735 Ga0207713_1000613 Ga0207713_100061321 420
150 3300032004 Ga0307414_10102815 Ga0307414_101028152 420
151 3300049688 Ga0501259_000748 Ga0501259_000748_2916_4190 421
152 3300045051 Ga0451576_0000051 Ga0451576_0000051_171899_173278 422
153 3300009011 Ga0105251_10000386 Ga0105251_1000038618 423
154 3300009174 Ga0105241_10000010 Ga0105241_10000010208 423
155 3300013100 Ga0157373_10006121 Ga0157373_100061214 423
156 3300025735 Ga0207713_1000075 Ga0207713_1000075123 423
157 3300025911 Ga0207654_10000010 Ga0207654_10000010209 423
158 3300027111 Ga0209281_1000139 Ga0209281_100013993 423
159 3300046660 Ga0495625_0006163 Ga0495625_0006163_8250_9605 423
160 3300009092 Ga0105250_10001000 Ga0105250_100010004 424
161 3300047446 Ga0495679_000021 Ga0495679_000021_123439_124797 424
162 3300048922 Ga0496119_0006499 Ga0496119_0006499_97_1449 424
163 3300048923 Ga0496120_0001708 Ga0496120_0001708_17280_18632 424
164 3300048927 Ga0496124_0000304 Ga0496124_0000304_64802_66154 424
165 3300009011 Ga0105251_10009501 Ga0105251_100095013 425
166 3300009092 Ga0105250_10000742 Ga0105250_1000074212 425
167 3300025711 Ga0207696_1000067 Ga0207696_100006739 425
168 3300025711 Ga0207696_1000100 Ga0207696_1000100101 425
169 3300048928 Ga0496125_0000091 Ga0496125_0000091_45042_46427 425
170 3300006946 Ga0079104_1000018 Ga0079104_1000018206 426
171 3300006946 Ga0079104_1003027 Ga0079104_10030275 426
172 3300027111 Ga0209281_1000014 Ga0209281_1000014416 426
173 3300027111 Ga0209281_1003259 Ga0209281_10032594 426
174 3300046694 Ga0495649_0001630 Ga0495649_0001630_1021_2376 426
175 3300046694 Ga0495649_0006493 Ga0495649_0006493_5262_6617 426
176 3300047446 Ga0495679_000867 Ga0495679_000867_15188_16543 426
177 3300005344 Ga0070661_100000126 Ga0070661_10000012641 427
178 3300005564 Ga0070664_100001357 Ga0070664_1000013578 427
179 3300005577 Ga0068857_100042383 Ga0068857_1000423834 427
180 3300009036 Ga0105244_10003769 Ga0105244_100037691 427
181 3300009176 Ga0105242_10003232 Ga0105242_100032324 427
182 3300009545 Ga0105237_10003007 Ga0105237_1000300711 427
183 3300013100 Ga0157373_10049600 Ga0157373_100496002 427
184 3300013104 Ga0157370_10072395 Ga0157370_100723953 427
185 3300025728 Ga0207655_1000388 Ga0207655_10003888 427
186 3300025914 Ga0207671_10000131 Ga0207671_1000013173 427
187 3300025920 Ga0207649_10000012 Ga0207649_10000012138 427
188 3300025945 Ga0207679_10000015 Ga0207679_10000015138 427
189 3300049592 Ga0501076_0081564 Ga0501076_0081564_864_2153 427
190 3300009036 Ga0105244_10000198 Ga0105244_1000019827 428
191 3300021384 Ga0213876_10000023 Ga0213876_10000023100 428
192 3300025728 Ga0207655_1000115 Ga0207655_100011526 428
193 3300039437 Ga0436365_0965775 Ga0436365_0965775_116892_118244 428
194 3300048927 Ga0496124_0000165 Ga0496124_0000165_60322_61698 428
195 3300009011 Ga0105251_10042042 Ga0105251_100420423 429
196 3300009092 Ga0105250_10010031 Ga0105250_100100314 429
197 3300009101 Ga0105247_10008979 Ga0105247_100089795 429
198 3300017792 Ga0163161_10000006 Ga0163161_1000000662 429
199 3300025711 Ga0207696_1000046 Ga0207696_100004664 429
200 3300025735 Ga0207713_1000056 Ga0207713_100005664 429
201 3300025900 Ga0207710_10000024 Ga0207710_10000024229 429
202 3300048919 Ga0496116_0000058 Ga0496116_0000058_213317_214672 429
203 3300048920 Ga0496117_0000450 Ga0496117_0000450_26096_27451 429
204 3300048921 Ga0496118_0006664 Ga0496118_0006664_1254_2609 429
205 3300005549 Ga0070704_100042282 Ga0070704_1000422823 430
206 3300027312 Ga0209371_1000429 Ga0209371_100042923 430
207 3300030500 Ga0268256_1003013 Ga0268256_10030133 430
208 3300009094 Ga0111539_10007585 Ga0111539_100075853 431
209 3300009147 Ga0114129_10096618 Ga0114129_100966182 431
210 3300027907 Ga0207428_10022610 Ga0207428_100226103 431
211 3300006946 Ga0079104_1000135 Ga0079104_100013521 432
212 3300017792 Ga0163161_10034235 Ga0163161_100342353 432
213 3300026116 Ga0207674_10242856 Ga0207674_102428562 432
214 3300027111 Ga0209281_1000095 Ga0209281_1000095217 432
215 3300046513 Ga0495616_0058159 Ga0495616_0058159_518_1867 432
216 3300046810 Ga0495660_0020584 Ga0495660_0020584_1147_2499 432
217 3300003856 Ga0058692_1000145 Ga0058692_100014518 433
218 3300013100 Ga0157373_10100142 Ga0157373_101001422 433
219 3300013102 Ga0157371_10000835 Ga0157371_100008359 433
220 3300013307 Ga0157372_10065898 Ga0157372_100658981 433
221 3300027312 Ga0209371_1000068 Ga0209371_100006825 433
222 3300030500 Ga0268256_1000064 Ga0268256_1000064166 433
223 3300041405 Ga0439438_000014 Ga0439438_000014_26654_27997 433
224 3300041407 Ga0439447_003919 Ga0439447_003919_3212_4555 433
225 3300003781 Ga0055536_1001844 Ga0055536_100184410 434
226 3300003791 Ga0055530_10001782 Ga0055530_1000178210 434
227 3300003792 Ga0055540_1001320 Ga0055540_10013205 434
228 3300003856 Ga0058692_1000310 Ga0058692_100031018 434
229 3300025292 Ga0209676_1000030 Ga0209676_1000030303 434
230 3300025298 Ga0209050_1002563 Ga0209050_100256311 434
231 3300025303 Ga0209051_1001294 Ga0209051_100129411 434
232 3300014497 Ga0182008_10005323 Ga0182008_100053233 435
233 3300015262 Ga0182007_10003484 Ga0182007_100034843 435
234 iso_pu_bacteria 2952252522 2952253580 435
235 3300014968 Ga0157379_10244193 Ga0157379_102441931 436
236 3300015265 Ga0182005_1015617 Ga0182005_10156172 436
237 3300037466 Ga0395898_0026066 Ga0395898_0026066_2162_3520 436
238 3300038705 Ga0237819_01191 Ga0237819_01191_4564_5874 436
239 3300044712 Ga0453684_0001338 Ga0453684_0001338_16643_18016 436
240 3300044712 Ga0453684_0001761 Ga0453684_0001761_17929_19293 436
241 3300045051 Ga0451576_0000696 Ga0451576_0000696_2602_3999 436
242 3300045051 Ga0451576_0100909 Ga0451576_0100909_1507_2847 436
243 3300046458 Ga0495591_000031 Ga0495591_000031_27762_29102 436
244 3300046463 Ga0495653_0007201 Ga0495653_0007201_2410_3720 436
245 3300046472 Ga0495580_0000209 Ga0495580_0000209_12227_13576 436
246 3300046524 Ga0495648_0083880 Ga0495648_0083880_30_1343 436
247 3300046530 Ga0495654_0000040 Ga0495654_0000040_155325_156665 436
248 3300046558 Ga0495633_0032126 Ga0495633_0032126_22_1332 436
249 3300047322 Ga0495680_0014189 Ga0495680_0014189_182_1492 436
250 3300049570 Ga0501033_0020049 Ga0501033_0020049_1863_3182 436
251 3300001989 JGI24739J22299_10000016 JGI24739J22299_1000001625 437
252 3300005336 Ga0070680_100220304 Ga0070680_1002203041 437
253 3300009011 Ga0105251_10000533 Ga0105251_1000053312 437
254 3300009036 Ga0105244_10000551 Ga0105244_100005519 437
255 3300009036 Ga0105244_10012531 Ga0105244_100125313 437
256 3300009036 Ga0105244_10022097 Ga0105244_100220972 437
257 3300009093 Ga0105240_10073931 Ga0105240_100739314 437
258 3300009094 Ga0111539_10042148 Ga0111539_100421481 437
259 3300011119 Ga0105246_10012052 Ga0105246_100120524 437
260 3300013100 Ga0157373_10000114 Ga0157373_1000011451 437
261 3300013102 Ga0157371_10000554 Ga0157371_1000055424 437
262 3300013102 Ga0157371_10000577 Ga0157371_1000057743 437
263 3300013104 Ga0157370_10000444 Ga0157370_1000044426 437
264 3300025711 Ga0207696_1000404 Ga0207696_100040412 437
265 3300025728 Ga0207655_1008224 Ga0207655_10082245 437
266 3300025728 Ga0207655_1016389 Ga0207655_10163894 437
267 3300025735 Ga0207713_1003273 Ga0207713_10032732 437
268 3300025960 Ga0207651_10070235 Ga0207651_100702351 437
269 3300026075 Ga0207708_10050675 Ga0207708_100506752 437
270 3300026089 Ga0207648_10015778 Ga0207648_100157784 437
271 3300027907 Ga0207428_10099304 Ga0207428_100993041 437
272 3300042006 Ga0439432_000659 Ga0439432_000659_673_2013 437
273 3300042010 Ga0439452_000023 Ga0439452_000023_25429_26769 437
274 3300048904 Ga0496101_0000119 Ga0496101_0000119_48260_49600 437
275 3300048919 Ga0496116_0000521 Ga0496116_0000521_25009_26349 437
276 3300048920 Ga0496117_0001270 Ga0496117_0001270_11439_12779 437
277 3300048920 Ga0496117_0025614 Ga0496117_0025614_2719_4176 437
278 3300048921 Ga0496118_0014636 Ga0496118_0014636_4176_5516 437
279 3300048923 Ga0496120_0003918 Ga0496120_0003918_5635_7092 437
280 3300048925 Ga0496122_0002360 Ga0496122_0002360_8959_10416 437
281 3300048926 Ga0496123_0008055 Ga0496123_0008055_3723_5063 437
282 3300048927 Ga0496124_0026575 Ga0496124_0026575_2456_3913 437
283 3300048927 Ga0496124_0059496 Ga0496124_0059496_625_1965 437
284 3300050511 nmdc:mga08y16_171893_c1 nmdc:mga08y16_171893_c1_786_2105 437
285 3300025735 Ga0207713_1005089 Ga0207713_10050896 438
286 3300031595 Ga0265313_10009476 Ga0265313_100094762 438
287 iso_pu_bacteria 2511231035 2511435574 438
288 iso_pu_bacteria 2511231119 2511698114 438
289 iso_pu_bacteria 2540341094 2540605325 438
290 iso_pu_bacteria 2545555800 2545558946 438
291 iso_pu_bacteria 2554235283 2555469421 438
292 iso_pu_bacteria 2576861599 2578933398 438
293 iso_pu_bacteria 2599185299 2599925156 438
294 iso_pu_bacteria 2608642108 2608671357 438
295 iso_pu_bacteria 2643221735 2644741784 438
296 iso_pu_bacteria 2648501693 2650897281 438
297 iso_pu_bacteria 2648501850 2651529754 438
298 iso_pu_bacteria 2671180844 2674421020 438
299 iso_pu_bacteria 2684622997 2686356229 438
300 iso_pu_bacteria 2684623153 2686995424 438
301 iso_pu_bacteria 2687453109 2687496667 438
302 iso_pu_bacteria 2695420354 2695630026 438
303 iso_pu_bacteria 2716884898 2717918072 438
304 iso_pu_bacteria 2808606399 2809055506 438
305 iso_pu_bacteria 2808606414 2809126604 438
306 iso_pu_bacteria 2811994870 2812314561 438
307 iso_pu_bacteria 2816332295 2817482315 438
308 iso_pu_bacteria 2818991468 2819725791 438
309 iso_pu_bacteria 2823526263 2823526525 438
310 iso_pu_bacteria 2844528606 2844531913 438
311 iso_pu_bacteria 2847797336 2847801891 438
312 iso_pu_bacteria 2860837431 2860837689 438
313 iso_pu_bacteria 2865014394 2865018701 438
314 iso_pu_bacteria 2876601092 2876603386 438
315 iso_pu_bacteria 2877768649 2877768904 438
316 iso_pu_bacteria 2880169592 2880169846 438
317 iso_pu_bacteria 2881609920 2881611516 438
318 iso_pu_bacteria 2897109615 2897109874 438
319 iso_pu_bacteria 2904560550 2904562362 438
320 iso_pu_bacteria 2908665501 2908668605 438
321 iso_pu_bacteria 2919093281 2919096673 438
322 iso_pu_bacteria 2919726948 2919729849 438
323 iso_pu_bacteria 2939602548 2939605103 438
324 iso_pu_bacteria 2945951305 2945954773 438
325 iso_pu_bacteria 2962290636 2962290983 438
326 iso_pu_bacteria 2969136845 2969137115 438
327 iso_pu_bacteria 2969141011 2969141276 438
328 iso_pu_bacteria 2969765954 2969770311 438
329 iso_pu_bacteria 2969770375 2969773994 438
330 iso_pu_bacteria 2971893375 2971893642 438
331 iso_pu_bacteria 2978975091 2978977263 438
332 iso_pu_bacteria 2980492589 2980492860 438
333 iso_pu_bacteria 2984494565 2984498655 438
334 iso_pu_bacteria 2990261002 2990264140 438
335 iso_pu_bacteria 3006858327 3006862745 438
336 iso_pu_bacteria 3006879489 3006881781 438
337 iso_pu_bacteria 8016733728 8016737727 438
338 iso_pu_bacteria 8019499862 8019503553 438
339 iso_pu_bacteria 8022630665 8022634363 438
340 iso_pu_bacteria 8022653035 8022653185 438
341 iso_pu_bacteria 8051952484 8051956083 438
342 iso_pu_bacteria 8052174270 8052177574 438
343 iso_pu_bacteria 2512564013 2512638797 439
344 iso_pu_bacteria 2857460504 2857463445 439
345 iso_pu_bacteria 2896317667 2896320010 439
346 iso_pu_bacteria 2896344016 2896344653 439
347 iso_pu_bacteria 2929183550 2929183931 439
348 3300003187 JGI25151J46595_10000035 JGI25151J46595_10000035157 440
349 3300003578 Ga0006562J51391_1000535 Ga0006562J51391_100053510 440
350 3300006844 Ga0075428_100018591 Ga0075428_1000185913 440
351 3300009036 Ga0105244_10052855 Ga0105244_100528552 440
352 3300009545 Ga0105237_10364905 Ga0105237_103649051 440
353 3300013102 Ga0157371_10004029 Ga0157371_100040297 440
354 3300013307 Ga0157372_10009383 Ga0157372_100093832 440
355 3300013307 Ga0157372_10020816 Ga0157372_100208162 440
356 3300025294 Ga0209025_1000031 Ga0209025_1000031356 440
357 3300048919 Ga0496116_0034975 Ga0496116_0034975_296_1630 440
358 iso_pu_bacteria 2599185169 2599411294 440
359 iso_pu_bacteria 2600255254 2601524289 440
360 iso_pu_bacteria 2600255255 2601529443 440
361 iso_pu_bacteria 2600255280 2601616277 440
362 iso_pu_bacteria 2600255281 2601620999 440
363 iso_pu_bacteria 2600255287 2601644346 440
364 iso_pu_bacteria 2600255288 2601649396 440
365 iso_pu_bacteria 2600255289 2601654323 440
366 iso_pu_bacteria 2600255290 2601659745 440
367 iso_pu_bacteria 2600255291 2601664168 440
368 iso_pu_bacteria 2600255298 2601697128 440
369 iso_pu_bacteria 2600255299 2601702174 440
370 iso_pu_bacteria 2600255300 2601707067 440
371 iso_pu_bacteria 2600255301 2601711981 440
372 iso_pu_bacteria 2600255302 2601717584 440
373 iso_pu_bacteria 2600255303 2601722146 440
374 iso_pu_bacteria 2600255304 2601727512 440
375 iso_pu_bacteria 2600255305 2601732423 440
376 iso_pu_bacteria 2600255306 2601737062 440
377 iso_pu_bacteria 2600255307 2601741344 440
378 iso_pu_bacteria 2600255309 2601752402 440
379 iso_pu_bacteria 2600255392 2602019243 440
380 iso_pu_bacteria 2602042052 2603662331 440
381 iso_pu_bacteria 2602042053 2603667227 440
382 iso_pu_bacteria 2602042103 2603839936 440
383 iso_pu_bacteria 2602042104 2603845013 440
384 iso_pu_bacteria 2602042105 2603849983 440
385 iso_pu_bacteria 2602042106 2603855154 440
386 iso_pu_bacteria 2602042109 2603867966 440
387 iso_pu_bacteria 2602042110 2603872734 440
388 iso_pu_bacteria 2602042111 2603878038 440
389 iso_pu_bacteria 2603880178 2606049809 440
390 iso_pu_bacteria 2603880184 2606071469 440
391 iso_pu_bacteria 2603880202 2606147598 440
392 iso_pu_bacteria 2603880211 2606177698 440
393 iso_pu_bacteria 2636415599 2637224106 440
394 iso_pu_bacteria 2671180694 2673821444 440
395 iso_pu_bacteria 2675903046 2676405519 440
396 iso_pu_bacteria 2775507074 2777020921 440
397 iso_pu_bacteria 2847085930 2847089597 440
398 iso_pu_bacteria 2890737413 2890738104 440
399 iso_pu_bacteria 2898713307 2898715179 440
400 iso_pu_bacteria 2904513164 2904515420 440
401 iso_pu_bacteria 2908669403 2908674550 440
402 iso_pu_bacteria 2915597211 2915598809 440
403 iso_pu_bacteria 2919108558 2919110920 440
404 iso_pu_bacteria 2969079654 2969081140 440
405 iso_pu_bacteria 2984559226 2984563598 440
406 iso_pu_bacteria 3000376612 3000378382 440
407 iso_pu_bacteria 8057160832 8057163052 440
408 iso_pu_bacteria 2537561728 2538425115 441
409 iso_pu_bacteria 2551306519 2553394168 441
410 iso_pu_bacteria 2565956521 2566038327 441
411 iso_pu_bacteria 2585427591 2585829035 441
412 iso_pu_bacteria 2585427592 2585833807 441
413 iso_pu_bacteria 2597489888 2597866660 441
414 iso_pu_bacteria 2597489889 2597872518 441
415 iso_pu_bacteria 2599185167 2599400507 441
416 iso_pu_bacteria 2599185179 2599449831 441
417 iso_pu_bacteria 2599185189 2599505781 441
418 iso_pu_bacteria 2599185190 2599511905 441
419 iso_pu_bacteria 2599185191 2599516889 441
420 iso_pu_bacteria 2599185288 2599879069 441
421 iso_pu_bacteria 2599185290 2599892733 441
422 iso_pu_bacteria 2599185303 2599951483 441
423 iso_pu_bacteria 2599185324 2600071902 441
424 iso_pu_bacteria 2600255296 2601693415 441
425 iso_pu_bacteria 2643221571 2643872296 441
426 iso_pu_bacteria 2643221713 2644624737 441
427 iso_pu_bacteria 2643221729 2644708319 441
428 iso_pu_bacteria 2643221730 2644714917 441
429 iso_pu_bacteria 2667528173 2671110329 441
430 iso_pu_bacteria 2684622632 2685148575 441
431 iso_pu_bacteria 2695420987 2698324600 441
432 iso_pu_bacteria 2703719227 2705992507 441
433 iso_pu_bacteria 2706794495 2707100913 441
434 iso_pu_bacteria 2718218445 2721503956 441
435 iso_pu_bacteria 2721755607 2723251396 441
436 iso_pu_bacteria 2738541294 2738807285 441
437 iso_pu_bacteria 2738541309 2738894645 441
438 iso_pu_bacteria 2738541358 2739158269 441
439 iso_pu_bacteria 2738543006 2739211320 441
440 iso_pu_bacteria 2738543023 2739301965 441
441 iso_pu_bacteria 2808606385 2808976180 441
442 iso_pu_bacteria 2808606388 2808994356 441
443 iso_pu_bacteria 2818991443 2819583377 441
444 iso_pu_bacteria 2834028612 2834030984 441
445 iso_pu_bacteria 2842826826 2842831257 441
446 iso_pu_bacteria 2842837860 2842837929 441
447 iso_pu_bacteria 2852103415 2852104309 441
448 iso_pu_bacteria 2852612431 2852616383 441
449 iso_pu_bacteria 2852627209 2852629075 441
450 iso_pu_bacteria 2852667396 2852671351 441
451 iso_pu_bacteria 2854601825 2854603335 441
452 iso_pu_bacteria 2855195626 2855199042 441
453 iso_pu_bacteria 2858466076 2858466787 441
454 iso_pu_bacteria 2860867994 2860873058 441
455 iso_pu_bacteria 2871272651 2871274952 441
456 iso_pu_bacteria 2871282230 2871282491 441
457 iso_pu_bacteria 2904474040 2904478744 441
458 iso_pu_bacteria 2919150387 2919154852 441
459 iso_pu_bacteria 2927143783 2927148436 441
460 iso_pu_bacteria 2929189879 2929195182 441
461 iso_pu_bacteria 2929233124 2929233824 441
462 iso_pu_bacteria 2931390751 2931396445 441
463 iso_pu_bacteria 2938917290 2938917993 441
464 iso_pu_bacteria 2945928738 2945930882 441
465 iso_pu_bacteria 2945961074 2945966891 441
466 iso_pu_bacteria 2946006987 2946013251 441
467 iso_pu_bacteria 2946027586 2946027933 441
468 iso_pu_bacteria 2947233263 2947234457 441
469 iso_pu_bacteria 2947426588 2947427318 441
470 iso_pu_bacteria 2965761152 2965761886 441
471 iso_pu_bacteria 2979083700 2979084313 441
472 iso_pu_bacteria 3007252601 3007253496 441
473 iso_pu_bacteria 8022621104 8022621760 441
474 iso_pu_bacteria 8022792930 8022796130 441
475 iso_pu_bacteria 8023438354 8023438839 441
476 iso_pu_bacteria 8023444577 8023450442 441
477 iso_pu_bacteria 8054285046 8054285692 441
478 iso_pu_bacteria 8054347763 8054349554 441
479 iso_pu_bacteria 8054503363 8054508967 441
480 iso_pu_bacteria 8054849141 8054851938 441
481 iso_pu_bacteria 8055817908 8055823938 441
482 iso_pu_bacteria 8056131705 8056137343 441
483 iso_pu_bacteria 8056148874 8056151462 441
484 iso_pu_bacteria 8056161164 8056163661 441
485 iso_pu_bacteria 8057582654 8057583387 441
486 3300003856 Ga0058692_1000179 Ga0058692_100017918 442
487 3300003856 Ga0058692_1006561 Ga0058692_10065612 442
488 3300003856 Ga0058692_1010808 Ga0058692_10108082 442
489 3300005347 Ga0070668_100027375 Ga0070668_1000273751 442
490 3300005353 Ga0070669_100080329 Ga0070669_1000803292 442
491 3300005548 Ga0070665_100013985 Ga0070665_1000139855 442
492 3300009011 Ga0105251_10008923 Ga0105251_100089233 442
493 3300009011 Ga0105251_10014212 Ga0105251_100142123 442
494 3300009036 Ga0105244_10002581 Ga0105244_1000258112 442
495 3300009092 Ga0105250_10007623 Ga0105250_100076232 442
496 3300011119 Ga0105246_10001513 Ga0105246_100015136 442
497 3300011119 Ga0105246_10023518 Ga0105246_100235182 442
498 3300013306 Ga0163162_10016516 Ga0163162_100165163 442
499 3300025207 Ga0209760_102616 Ga0209760_1026161 442
500 3300025233 Ga0209437_100092 Ga0209437_100092190 442
501 3300025711 Ga0207696_1000434 Ga0207696_100043411 442
502 3300025728 Ga0207655_1000111 Ga0207655_100011124 442
503 3300025728 Ga0207655_1003418 Ga0207655_100341811 442
504 3300025735 Ga0207713_1000045 Ga0207713_1000045187 442
505 3300025735 Ga0207713_1007461 Ga0207713_10074615 442
506 3300025933 Ga0207706_10006159 Ga0207706_1000615911 442
507 3300027312 Ga0209371_1000063 Ga0209371_100006325 442
508 3300027312 Ga0209371_1000617 Ga0209371_100061712 442
509 3300027312 Ga0209371_1004020 Ga0209371_10040202 442
510 3300030500 Ga0268256_1000060 Ga0268256_1000060159 442
511 3300030500 Ga0268256_1000386 Ga0268256_100038619 442
512 3300030500 Ga0268256_1008842 Ga0268256_10088423 442
513 3300041411 Ga0439466_0000008 Ga0439466_0000008_217753_219093 442
514 3300042146 Ga0450907_000030 Ga0450907_000030_27783_29123 442
515 3300047320 Ga0495672_0000083 Ga0495672_0000083_128888_130228 442
516 3300048905 Ga0496102_0012189 Ga0496102_0012189_43_1383 442
517 3300048919 Ga0496116_0020828 Ga0496116_0020828_3051_4391 442
518 3300048919 Ga0496116_0020959 Ga0496116_0020959_1479_2819 442
519 3300048920 Ga0496117_0000470 Ga0496117_0000470_38728_40068 442
520 3300048920 Ga0496117_0001133 Ga0496117_0001133_32158_33498 442
521 3300048921 Ga0496118_0000490 Ga0496118_0000490_26907_28247 442
522 3300048921 Ga0496118_0002301 Ga0496118_0002301_18984_20324 442
523 3300048922 Ga0496119_0000490 Ga0496119_0000490_24972_26312 442
524 3300048922 Ga0496119_0000706 Ga0496119_0000706_27718_29058 442
525 3300048923 Ga0496120_0000108 Ga0496120_0000108_27892_29232 442
526 3300048923 Ga0496120_0000476 Ga0496120_0000476_24103_25443 442
527 3300048923 Ga0496120_0000813 Ga0496120_0000813_15703_17043 442
528 3300048924 Ga0496121_0000074 Ga0496121_0000074_27839_29179 442
529 3300048925 Ga0496122_0003475 Ga0496122_0003475_8029_9369 442
530 3300048925 Ga0496122_0033526 Ga0496122_0033526_2424_3764 442
531 3300048926 Ga0496123_0002061 Ga0496123_0002061_21508_22848 442
532 3300048926 Ga0496123_0064996 Ga0496123_0064996_222_1562 442
533 3300048927 Ga0496124_0009646 Ga0496124_0009646_7239_8579 442
534 3300048927 Ga0496124_0021157 Ga0496124_0021157_792_2132 442
535 3300048927 Ga0496124_0050341 Ga0496124_0050341_1039_2379 442
536 iso_pu_bacteria 2510065053 2510282413 442
537 iso_pu_bacteria 2510065055 2510294707 442
538 iso_pu_bacteria 2510065058 2510311299 442
539 iso_pu_bacteria 2547132103 2547373984 442
540 iso_pu_bacteria 2547132181 2547697286 442
541 iso_pu_bacteria 2547132416 2548649312 442
542 iso_pu_bacteria 2561511199 2562463568 442
543 iso_pu_bacteria 2600255256 2601534982 442
544 iso_pu_bacteria 2600255257 2601539389 442
545 iso_pu_bacteria 2600255310 2601757739 442
546 iso_pu_bacteria 2600255311 2601764097 442
547 iso_pu_bacteria 2602042046 2603636907 442
548 iso_pu_bacteria 2602042047 2603645338 442
549 iso_pu_bacteria 2602042066 2603699307 442
550 iso_pu_bacteria 2602042067 2603705341 442
551 iso_pu_bacteria 2609459761 2609909689 442
552 iso_pu_bacteria 2667528172 2671101153 442
553 iso_pu_bacteria 2671180115 2671584573 442
554 iso_pu_bacteria 2681812866 2681996250 442
555 iso_pu_bacteria 2681812869 2682006409 442
556 iso_pu_bacteria 2711768156 2712468907 442
557 iso_pu_bacteria 2738541281 2738744370 442
558 iso_pu_bacteria 2738543032 2739353600 442
559 iso_pu_bacteria 2751185917 2753856888 442
560 iso_pu_bacteria 2765235842 2765589988 442
561 iso_pu_bacteria 2773857672 2774129534 442
562 iso_pu_bacteria 2775506706 2775541335 442
563 iso_pu_bacteria 2791355010 2792312050 442
564 iso_pu_bacteria 2791355275 2793404771 442
565 iso_pu_bacteria 2811995292 2813727917 442
566 iso_pu_bacteria 2814123068 2814695460 442
567 iso_pu_bacteria 2821118458 2821121012 442
568 iso_pu_bacteria 2823373977 2823375641 442
569 iso_pu_bacteria 2843690924 2843695576 442
570 iso_pu_bacteria 2844425489 2844428332 442
571 iso_pu_bacteria 2846540461 2846544054 442
572 iso_pu_bacteria 2888373701 2888375568 442
573 iso_pu_bacteria 2917832318 2917836516 442
574 iso_pu_bacteria 2919125081 2919126450 442
575 iso_pu_bacteria 2923634449 2923635856 442
576 iso_pu_bacteria 2927833300 2927837641 442
577 iso_pu_bacteria 2932406140 2932409063 442
578 iso_pu_bacteria 2935625433 2935625794 442
579 iso_pu_bacteria 2937539931 2937542479 442
580 iso_pu_bacteria 2939568625 2939570008 442
581 iso_pu_bacteria 2939577877 2939581633 442
582 iso_pu_bacteria 2939607340 2939608708 442
583 iso_pu_bacteria 2939617950 2939618457 442
584 iso_pu_bacteria 2939642701 2939642973 442
585 iso_pu_bacteria 2945874760 2945876877 442
586 iso_pu_bacteria 2974298342 2974302057 442
587 iso_pu_bacteria 2974310843 2974311125 442
588 iso_pu_bacteria 2974435778 2974439252 442
589 iso_pu_bacteria 2984499530 2984500370 442
590 iso_pu_bacteria 2984504281 2984506805 442
591 iso_pu_bacteria 8015394850 8015397378 442
592 iso_pu_bacteria 8016728285 8016731151 442
593 iso_pu_bacteria 8018221730 8018223190 442
594 iso_pu_bacteria 8018405270 8018409274 442
595 iso_pu_bacteria 8019504834 8019505205 442
596 iso_pu_bacteria 8054844752 8054846600 442
597 iso_pu_bacteria 8055097453 8055100173 442
598 3300002987 JGI25159J45721_1006060 JGI25159J45721_10060603 443
599 3300003187 JGI25151J46595_10000945 JGI25151J46595_1000094512 443
600 3300003187 JGI25151J46595_10006233 JGI25151J46595_100062335 443
601 3300003187 JGI25151J46595_10028999 JGI25151J46595_100289992 443
602 3300009036 Ga0105244_10010258 Ga0105244_100102583 443
603 3300025229 Ga0209147_101055 Ga0209147_1010559 443
604 3300025284 Ga0209130_1000293 Ga0209130_100029352 443
605 3300025291 Ga0209675_1017451 Ga0209675_10174512 443
606 3300025294 Ga0209025_1001280 Ga0209025_100128022 443
607 3300025294 Ga0209025_1001433 Ga0209025_10014333 443
608 3300025294 Ga0209025_1001685 Ga0209025_10016857 443
609 3300025294 Ga0209025_1002689 Ga0209025_100268914 443
610 3300025294 Ga0209025_1014973 Ga0209025_10149732 443
611 3300025711 Ga0207696_1001207 Ga0207696_10012078 443
612 3300025711 Ga0207696_1021488 Ga0207696_10214882 443
613 3300025728 Ga0207655_1008594 Ga0207655_10085944 443
614 3300027312 Ga0209371_1000071 Ga0209371_100007126 443
615 3300030083 Ga0237817_10004 Ga0237817_1000442 443
616 3300030083 Ga0237817_10086 Ga0237817_1008626 443
617 3300030500 Ga0268256_1000070 Ga0268256_100007023 443
618 3300032004 Ga0307414_10061738 Ga0307414_100617383 443
619 3300038705 Ga0237819_00136 Ga0237819_00136_26140_27489 443
620 3300038705 Ga0237819_00899 Ga0237819_00899_1110_2459 443
621 3300045976 Ga0466967_0000405 Ga0466967_0000405_10103_11452 443
622 3300049758 Ga0501241_003383 Ga0501241_003383_606_1940 443
623 iso_pu_bacteria 2506520007 2506576171 443
624 iso_pu_bacteria 2506520008 2506581309 443
625 iso_pu_bacteria 2508501071 2508850140 443
626 iso_pu_bacteria 2654587920 2656277209 443
627 iso_pu_bacteria 2687453601 2689442602 443
628 iso_pu_bacteria 2772190666 2772436746 443
629 iso_pu_bacteria 2806310673 2807179010 443
630 iso_pu_bacteria 2869551831 2869552016 443
631 iso_pu_bacteria 2888366609 2888366794 443
632 iso_pu_bacteria 2919186247 2919189030 443
633 iso_pu_bacteria 2937967321 2937971465 443
634 iso_pu_bacteria 2939664404 2939666815 443
635 iso_pu_bacteria 3007315729 3007317731 443
636 iso_pu_bacteria 640753048 640935690 443
637 iso_pu_bacteria 8004592986 8004593529 443
638 iso_pu_bacteria 8055693939 8055697844 443
639 iso_pu_bacteria 8057304971 8057306806 443
640 3300002773 JGI25152J39213_1000056 JGI25152J39213_10000563 444
641 3300002774 JGI25150J39212_1000009 JGI25150J39212_100000968 444
642 3300003187 JGI25151J46595_10000017 JGI25151J46595_1000001768 444
643 3300003215 JGI25153J46596_10000023 JGI25153J46596_10000023171 444
644 3300003856 Ga0058692_1000253 Ga0058692_100025310 444
645 3300005288 Ga0065714_10065075 Ga0065714_100650756 444
646 3300013307 Ga0157372_10105263 Ga0157372_101052632 444
647 3300025245 Ga0207425_1000007 Ga0207425_1000007488 444
648 3300025258 Ga0209129_1000006 Ga0209129_1000006488 444
649 3300025294 Ga0209025_1000025 Ga0209025_1000025318 444
650 3300025297 Ga0209758_1000016 Ga0209758_1000016488 444
651 3300027312 Ga0209371_1000331 Ga0209371_100033127 444
652 3300037471 Ga0395905_0011690 Ga0395905_0011690_1199_2542 444
653 3300048919 Ga0496116_0000282 Ga0496116_0000282_24422_25861 444
654 3300048922 Ga0496119_0000219 Ga0496119_0000219_24587_25933 444
655 3300048922 Ga0496119_0000680 Ga0496119_0000680_28937_30376 444
656 3300048923 Ga0496120_0000279 Ga0496120_0000279_59898_61337 444
657 3300048923 Ga0496120_0000301 Ga0496120_0000301_24587_25933 444
658 iso_pu_bacteria 2554235132 2554818293 444
659 iso_pu_bacteria 2606217733 2608380411 444
660 iso_pu_bacteria 2891670763 2891673579 444
661 iso_pu_bacteria 2939573065 2939575317 444
662 2162886007 SwRhRL2b_contig_437820 SwRhRL2b_0609.00000510 445
663 3300002737 JGI25162J39368_1000116 JGI25162J39368_100011668 445
664 3300002771 JGI25163J39215_1000099 JGI25163J39215_100009912 445
665 3300002772 JGI25164J39214_1000095 JGI25164J39214_100009512 445
666 3300003751 Ga0055538_1000032 Ga0055538_1000032165 445
667 3300003751 Ga0055538_1000077 Ga0055538_100007767 445
668 3300003752 Ga0055539_1000043 Ga0055539_1000043165 445
669 3300003752 Ga0055539_1000114 Ga0055539_100011470 445
670 3300003756 Ga0055533_1000052 Ga0055533_1000052165 445
671 3300003756 Ga0055533_1000122 Ga0055533_100012268 445
672 3300003758 Ga0055532_1000047 Ga0055532_1000047145 445
673 3300003759 Ga0055525_1000062 Ga0055525_1000062165 445
674 3300003759 Ga0055525_1000155 Ga0055525_100015570 445
675 3300003761 Ga0055535_1004747 Ga0055535_10047472 445
676 3300003841 Ga0055541_1000030 Ga0055541_1000030165 445
677 3300003841 Ga0055541_1000078 Ga0055541_100007868 445
678 3300005288 Ga0065714_10073013 Ga0065714_100730132 445
679 3300005289 Ga0065704_10001437 Ga0065704_1000143712 445
680 3300005331 Ga0070670_100003472 Ga0070670_1000034728 445
681 3300005353 Ga0070669_100001006 Ga0070669_1000010069 445
682 3300005457 Ga0070662_100000101 Ga0070662_1000001017 445
683 3300005539 Ga0068853_100000372 Ga0068853_1000003727 445
684 3300005578 Ga0068854_100021339 Ga0068854_1000213394 445
685 3300005834 Ga0068851_10000007 Ga0068851_1000000771 445
686 3300009036 Ga0105244_10000119 Ga0105244_1000011955 445
687 3300009036 Ga0105244_10000588 Ga0105244_1000058819 445
688 3300009092 Ga0105250_10000981 Ga0105250_1000098112 445
689 3300009092 Ga0105250_10001145 Ga0105250_1000114512 445
690 3300009148 Ga0105243_10010014 Ga0105243_100100144 445
691 3300009177 Ga0105248_10075012 Ga0105248_100750124 445
692 3300009545 Ga0105237_10123033 Ga0105237_101230333 445
693 3300013102 Ga0157371_10000102 Ga0157371_1000010270 445
694 3300013102 Ga0157371_10075932 Ga0157371_100759322 445
695 3300013105 Ga0157369_10025810 Ga0157369_100258106 445
696 3300015261 Ga0182006_1001964 Ga0182006_10019644 445
697 3300015261 Ga0182006_1002621 Ga0182006_10026212 445
698 3300025206 Ga0209435_100558 Ga0209435_1005581 445
699 3300025207 Ga0209760_100066 Ga0209760_10006612 445
700 3300025224 Ga0209784_100007 Ga0209784_100007351 445
701 3300025224 Ga0209784_100064 Ga0209784_10006467 445
702 3300025225 Ga0209566_100009 Ga0209566_100009351 445
703 3300025225 Ga0209566_100079 Ga0209566_10007967 445
704 3300025226 Ga0209674_100021 Ga0209674_100021351 445
705 3300025226 Ga0209674_100159 Ga0209674_10015967 445
706 3300025229 Ga0209147_100009 Ga0209147_100009351 445
707 3300025230 Ga0209563_100018 Ga0209563_100018351 445
708 3300025230 Ga0209563_100135 Ga0209563_10013567 445
709 3300025231 Ga0207427_100136 Ga0207427_10013667 445
710 3300025233 Ga0209437_100149 Ga0209437_10014967 445
711 3300025242 Ga0209258_100169 Ga0209258_100169132 445
712 3300025246 Ga0209646_1000184 Ga0209646_100018448 445
713 3300025253 Ga0209677_100012 Ga0209677_100012351 445
714 3300025253 Ga0209677_100110 Ga0209677_10011067 445
715 3300025256 Ga0209759_1003625 Ga0209759_10036251 445
716 3300025261 Ga0209233_1002353 Ga0209233_10023534 445
717 3300025321 Ga0207656_10000006 Ga0207656_1000000631 445
718 3300025711 Ga0207696_1000357 Ga0207696_10003577 445
719 3300025711 Ga0207696_1000820 Ga0207696_100082012 445
720 3300025728 Ga0207655_1000170 Ga0207655_100017055 445
721 3300025728 Ga0207655_1000284 Ga0207655_100028411 445
722 3300025735 Ga0207713_1000837 Ga0207713_10008371 445
723 3300025735 Ga0207713_1001441 Ga0207713_10014418 445
724 3300025923 Ga0207681_10000099 Ga0207681_100000993 445
725 3300025925 Ga0207650_10000338 Ga0207650_100003387 445
726 3300025925 Ga0207650_10000564 Ga0207650_1000056418 445
727 3300025933 Ga0207706_10009041 Ga0207706_100090411 445
728 3300025935 Ga0207709_10005277 Ga0207709_100052773 445
729 3300025981 Ga0207640_10026125 Ga0207640_100261252 445
730 3300026041 Ga0207639_10000286 Ga0207639_1000028620 445
731 3300028794 Ga0307515_10097159 Ga0307515_100971592 445
732 3300032002 Ga0307416_100154504 Ga0307416_1001545042 445
733 3300032004 Ga0307414_10117922 Ga0307414_101179222 445
734 3300032004 Ga0307414_10212616 Ga0307414_102126161 445
735 3300038726 Ga0400490_02503 Ga0400490_02503_22676_24022 445
736 3300039093 Ga0400489_18894 Ga0400489_18894_527_1873 445
737 3300042006 Ga0439432_000624 Ga0439432_000624_3776_5113 445
738 3300046453 Ga0495627_000240 Ga0495627_000240_5648_6985 445
739 3300046458 Ga0495591_000539 Ga0495591_000539_25081_26430 445
740 3300046471 Ga0495650_0000199 Ga0495650_0000199_61037_62407 445
741 3300046471 Ga0495650_0000360 Ga0495650_0000360_24957_26306 445
742 3300046501 Ga0495607_0007508 Ga0495607_0007508_1396_2733 445
743 3300046506 Ga0495583_0007528 Ga0495583_0007528_1301_2638 445
744 3300046507 Ga0495606_0000541 Ga0495606_0000541_25164_26513 445
745 3300046530 Ga0495654_0000519 Ga0495654_0000519_4776_6125 445
746 3300046530 Ga0495654_0002898 Ga0495654_0002898_1899_3236 445
747 3300046530 Ga0495654_0012988 Ga0495654_0012988_1369_2706 445
748 3300046692 Ga0495671_0012410 Ga0495671_0012410_1299_2648 445
749 3300046794 Ga0495589_0004351 Ga0495589_0004351_710_2059 445
750 3300046810 Ga0495660_0000045 Ga0495660_0000045_84243_85613 445
751 3300046810 Ga0495660_0000134 Ga0495660_0000134_25248_26597 445
752 3300046810 Ga0495660_0004806 Ga0495660_0004806_2757_4094 445
753 3300047320 Ga0495672_0000224 Ga0495672_0000224_53839_55188 445
754 3300047323 Ga0495683_0061129 Ga0495683_0061129_26_1375 445
755 3300047446 Ga0495679_003543 Ga0495679_003543_5168_6505 445
756 3300047469 Ga0495673_0000622 Ga0495673_0000622_8282_9631 445
757 3300048919 Ga0496116_0001110 Ga0496116_0001110_10987_12357 445
758 3300048920 Ga0496117_0007574 Ga0496117_0007574_315_1685 445
759 3300048920 Ga0496117_0017576 Ga0496117_0017576_4499_5836 445
760 3300048921 Ga0496118_0002440 Ga0496118_0002440_14538_15890 445
761 3300048921 Ga0496118_0004790 Ga0496118_0004790_7455_8825 445
762 3300048922 Ga0496119_0012834 Ga0496119_0012834_5278_6648 445
763 3300048925 Ga0496122_0000607 Ga0496122_0000607_59576_60946 445
764 3300048926 Ga0496123_0000451 Ga0496123_0000451_59593_60963 445
765 3300048927 Ga0496124_0000379 Ga0496124_0000379_13368_14738 445
766 3300048928 Ga0496125_0001589 Ga0496125_0001589_10991_12361 445
767 3300048928 Ga0496125_0013508 Ga0496125_0013508_6554_7891 445
768 3300048929 Ga0496126_0003284 Ga0496126_0003284_18933_20303 445
769 3300049459 Ga0495678_000337 Ga0495678_000337_34101_35450 445
770 3300049460 Ga0495682_0000139 Ga0495682_0000139_36255_37604 445
771 3300049704 Ga0501221_004019 Ga0501221_004019_241_1590 445
772 3300049705 Ga0501225_0005805 Ga0501225_0005805_182_1531 445
773 3300053126 Ga0500621_000018 Ga0500621_000018_25193_26542 445
774 iso_pu_bacteria 2511231004 2511254822 445
775 iso_pu_bacteria 2511231006 2511266036 445
776 iso_pu_bacteria 2511231007 2511273349 445
777 iso_pu_bacteria 2511231008 2511275060 445
778 iso_pu_bacteria 2511231010 2511288492 445
779 iso_pu_bacteria 2511231011 2511297988 445
780 iso_pu_bacteria 2511231012 2511304000 445
781 iso_pu_bacteria 2511231016 2511327978 445
782 iso_pu_bacteria 2511231017 2511329703 445
783 iso_pu_bacteria 2511231018 2511335876 445
784 iso_pu_bacteria 2511231019 2511344762 445
785 iso_pu_bacteria 2511231020 2511349526 445
786 iso_pu_bacteria 2511231021 2511354104 445
787 iso_pu_bacteria 2511231022 2511365974 445
788 iso_pu_bacteria 2511231023 2511369002 445
789 iso_pu_bacteria 2511231031 2511412142 445
790 iso_pu_bacteria 2511231156 2511827674 445
791 iso_pu_bacteria 2512047018 2512326639 445
792 iso_pu_bacteria 2582580891 2583795690 445
793 iso_pu_bacteria 2597489887 2597860916 445
794 iso_pu_bacteria 2599185155 2599327543 445
795 iso_pu_bacteria 2599185185 2599485849 445
796 iso_pu_bacteria 2599185188 2599500295 445
797 iso_pu_bacteria 2599185212 2599614463 445
798 iso_pu_bacteria 2599185248 2599768112 445
799 iso_pu_bacteria 2599185257 2599804629 445
800 iso_pu_bacteria 2599185289 2599885548 445
801 iso_pu_bacteria 2599185291 2599897262 445
802 iso_pu_bacteria 2599185300 2599930682 445
803 iso_pu_bacteria 2599185302 2599942320 445
804 iso_pu_bacteria 2599185304 2599954267 445
805 iso_pu_bacteria 2599185305 2599961951 445
806 iso_pu_bacteria 2599185306 2599965974 445
807 iso_pu_bacteria 2599185307 2599972340 445
808 iso_pu_bacteria 2599185308 2599977976 445
809 iso_pu_bacteria 2599185309 2599982890 445
810 iso_pu_bacteria 2599185310 2599988360 445
811 iso_pu_bacteria 2599185311 2599994021 445
812 iso_pu_bacteria 2599185312 2599999155 445
813 iso_pu_bacteria 2599185313 2600004275 445
814 iso_pu_bacteria 2599185314 2600012143 445
815 iso_pu_bacteria 2599185315 2600020435 445
816 iso_pu_bacteria 2599185316 2600026311 445
817 iso_pu_bacteria 2599185317 2600032057 445
818 iso_pu_bacteria 2599185318 2600036006 445
819 iso_pu_bacteria 2599185319 2600044571 445
820 iso_pu_bacteria 2599185320 2600046686 445
821 iso_pu_bacteria 2599185321 2600054887 445
822 iso_pu_bacteria 2599185322 2600061081 445
823 iso_pu_bacteria 2599185323 2600067994 445
824 iso_pu_bacteria 2599185325 2600076509 445
825 iso_pu_bacteria 2600254930 2600358960 445
826 iso_pu_bacteria 2600254931 2600363515 445
827 iso_pu_bacteria 2600255283 2601627439 445
828 iso_pu_bacteria 2600255318 2601798531 445
829 iso_pu_bacteria 2603880185 2606077425 445
830 iso_pu_bacteria 2603880199 2606129329 445
831 iso_pu_bacteria 2623620443 2624483441 445
832 iso_pu_bacteria 2623620446 2624494966 445
833 iso_pu_bacteria 2643221565 2643842994 445
834 iso_pu_bacteria 2643221589 2643955601 445
835 iso_pu_bacteria 2643221602 2644020395 445
836 iso_pu_bacteria 2643221633 2644184449 445
837 iso_pu_bacteria 2643221650 2644283195 445
838 iso_pu_bacteria 2648501241 2649119691 445
839 iso_pu_bacteria 2651869818 2652973361 445
840 iso_pu_bacteria 2667528170 2671089588 445
841 iso_pu_bacteria 2667528176 2671128555 445
842 iso_pu_bacteria 2671180172 2671771636 445
843 iso_pu_bacteria 2675903420 2677897162 445
844 iso_pu_bacteria 2675903515 2678266182 445
845 iso_pu_bacteria 2713897148 2715749801 445
846 iso_pu_bacteria 2713897149 2715754819 445
847 iso_pu_bacteria 2718217725 2718636646 445
848 iso_pu_bacteria 2738541271 2738690383 445
849 iso_pu_bacteria 2738543004 2739199090 445
850 iso_pu_bacteria 2738543016 2739266157 445
851 iso_pu_bacteria 2738543025 2739312474 445
852 iso_pu_bacteria 2740892503 2743740456 445
853 iso_pu_bacteria 2744054620 2745007414 445
854 iso_pu_bacteria 2773857670 2774118344 445
855 iso_pu_bacteria 2773857673 2774135534 445
856 iso_pu_bacteria 2784132063 2784261784 445
857 iso_pu_bacteria 2784132072 2784313607 445
858 iso_pu_bacteria 2791355520 2794593806 445
859 iso_pu_bacteria 2806310737 2807408975 445
860 iso_pu_bacteria 2806310745 2807457305 445
861 iso_pu_bacteria 2808606361 2808855667 445
862 iso_pu_bacteria 2808606376 2808926538 445
863 iso_pu_bacteria 2808606377 2808928411 445
864 iso_pu_bacteria 2808606378 2808935496 445
865 iso_pu_bacteria 2808606380 2808948699 445
866 iso_pu_bacteria 2808606381 2808950406 445
867 iso_pu_bacteria 2808606382 2808959808 445
868 iso_pu_bacteria 2808606383 2808964104 445
869 iso_pu_bacteria 2808606389 2808999060 445
870 iso_pu_bacteria 2808606445 2809217218 445
871 iso_pu_bacteria 2818991456 2819655164 445
872 iso_pu_bacteria 2825651385 2825655063 445
873 iso_pu_bacteria 2826581358 2826581870 445
874 iso_pu_bacteria 2842815866 2842816876 445
875 iso_pu_bacteria 2842832357 2842833488 445
876 iso_pu_bacteria 2842843487 2842845718 445
877 iso_pu_bacteria 2842849001 2842854142 445
878 iso_pu_bacteria 2842854478 2842855655 445
879 iso_pu_bacteria 2852657418 2852659710 445
880 iso_pu_bacteria 2860339153 2860341749 445
881 iso_pu_bacteria 2878029506 2878035382 445
882 iso_pu_bacteria 2880230671 2880236028 445
883 iso_pu_bacteria 2904518522 2904518925 445
884 iso_pu_bacteria 2908446538 2908452616 445
885 iso_pu_bacteria 2913036834 2913042563 445
886 iso_pu_bacteria 2919063839 2919065487 445
887 iso_pu_bacteria 2919385768 2919389161 445
888 iso_pu_bacteria 2919456309 2919457581 445
889 iso_pu_bacteria 2919481497 2919485689 445
890 iso_pu_bacteria 2919487758 2919488138 445
891 iso_pu_bacteria 2919493220 2919496059 445
892 iso_pu_bacteria 2919543075 2919544336 445
893 iso_pu_bacteria 2919697872 2919700542 445
894 iso_pu_bacteria 2923153595 2923159549 445
895 iso_pu_bacteria 2923525760 2923527902 445
896 iso_pu_bacteria 2923586266 2923589032 445
897 iso_pu_bacteria 2929144301 2929149952 445
898 iso_pu_bacteria 2931369376 2931372607 445
899 iso_pu_bacteria 2939636861 2939640774 445
900 iso_pu_bacteria 2969304461 2969310206 445
901 iso_pu_bacteria 2974289157 2974294051 445
902 iso_pu_bacteria 2984286254 2984286565 445
903 iso_pu_bacteria 2988728565 2988731489 445
904 iso_pu_bacteria 2998139840 2998145429 445
905 iso_pu_bacteria 3007395558 3007399366 445
906 iso_pu_bacteria 3007419365 3007425759 445
907 iso_pu_bacteria 3007511990 3007517214 445
908 iso_pu_bacteria 3007614139 3007618875 445
909 iso_pu_bacteria 3007718800 3007721788 445
910 iso_pu_bacteria 3007855910 3007859221 445
911 iso_pu_bacteria 3007861166 3007865075 445
912 iso_pu_bacteria 3007866637 3007866751 445
913 iso_pu_bacteria 8015687852 8015693647 445
914 iso_pu_bacteria 8019775933 8019777649 445
915 iso_pu_bacteria 8029995093 8029995476 445
916 iso_pu_bacteria 8055770955 8055776894 445
917 iso_pu_bacteria 8056115690 8056118180 445
918 iso_pu_bacteria 8056120720 8056124140 445
919 iso_pu_bacteria 8056125926 8056131638 445
920 iso_pu_bacteria 8056137416 8056139476 445
921 iso_pu_bacteria 8056143049 8056148804 445
922 iso_pu_bacteria 8056155041 8056159734 445
923 iso_pu_bacteria 8056166840 8056171279 445
924 iso_pu_bacteria 8056172158 8056177378 445
925 iso_pu_bacteria 8056177738 8056182030 445
926 iso_pu_bacteria 8056569372 8056570497 445
927 3300009011 Ga0105251_10001420 Ga0105251_1000142011 446
928 3300009094 Ga0111539_10112156 Ga0111539_101121562 446
929 3300013102 Ga0157371_10013824 Ga0157371_100138246 446
930 3300013105 Ga0157369_10002994 Ga0157369_100029949 446
931 3300025728 Ga0207655_1011686 Ga0207655_10116862 447
932 3300027312 Ga0209371_1001783 Ga0209371_100178314 447
933 3300030500 Ga0268256_1000683 Ga0268256_10006832 447
934 3300046474 Ga0495605_0000100 Ga0495605_0000100_87585_88940 447
935 3300046506 Ga0495583_0000174 Ga0495583_0000174_20093_21448 447
936 3300046515 Ga0495620_0000416 Ga0495620_0000416_20098_21453 447
937 3300046538 Ga0495609_0000088 Ga0495609_0000088_20184_21539 447
938 3300046558 Ga0495633_0000777 Ga0495633_0000777_20182_21537 447
939 3300046665 Ga0495661_0000841 Ga0495661_0000841_20184_21539 447
940 3300047323 Ga0495683_0000070 Ga0495683_0000070_19289_20644 447
941 3300047469 Ga0495673_0002965 Ga0495673_0002965_5745_7100 447
942 3300048926 Ga0496123_0080135 Ga0496123_0080135_58_1413 447
943 3300049459 Ga0495678_000692 Ga0495678_000692_7068_8411 447
944 3300049584 Ga0501068_0009844 Ga0501068_0009844_20_1369 447
945 3300046501 Ga0495607_0005213 Ga0495607_0005213_204_1550 448
946 3300049663 Ga0501223_000540 Ga0501223_000540_4220_5590 448
947 2124908027 MRS2a_Contig_718 MRS2a_00573890 449
948 2162886007 SwRhRL2b_contig_578990 SwRhRL2b_0722.00008680 449
949 3300002737 JGI25162J39368_1001123 JGI25162J39368_100112311 449
950 3300002771 JGI25163J39215_1001049 JGI25163J39215_10010495 449
951 3300002772 JGI25164J39214_1000593 JGI25164J39214_10005936 449
952 3300003214 JGI25165J46597_1001173 JGI25165J46597_10011736 449
953 3300003781 Ga0055536_1004928 Ga0055536_10049282 449
954 3300003781 Ga0055536_1005802 Ga0055536_10058027 449
955 3300003791 Ga0055530_10001310 Ga0055530_1000131014 449
956 3300003791 Ga0055530_10002801 Ga0055530_100028015 449
957 3300003792 Ga0055540_1000960 Ga0055540_100096014 449
958 3300003792 Ga0055540_1002155 Ga0055540_10021555 449
959 3300003794 Ga0055531_10000404 Ga0055531_1000040436 449
960 3300005288 Ga0065714_10002460 Ga0065714_100024606 449
961 3300005288 Ga0065714_10005031 Ga0065714_100050316 449
962 3300005288 Ga0065714_10022596 Ga0065714_100225961 449
963 3300005288 Ga0065714_10089184 Ga0065714_100891842 449
964 3300005289 Ga0065704_10070757 Ga0065704_1007075710 449
965 3300005290 Ga0065712_10002401 Ga0065712_100024014 449
966 3300005290 Ga0065712_10067900 Ga0065712_1006790012 449
967 3300005329 Ga0070683_100005759 Ga0070683_10000575910 449
968 3300005366 Ga0070659_100111356 Ga0070659_1001113562 449
969 3300005457 Ga0070662_100052936 Ga0070662_1000529361 449
970 3300005458 Ga0070681_10128269 Ga0070681_101282691 449
971 3300005548 Ga0070665_100000467 Ga0070665_10000046741 449
972 3300005548 Ga0070665_100233546 Ga0070665_1002335461 449
973 3300005842 Ga0068858_100052783 Ga0068858_1000527834 449
974 3300006051 Ga0075364_10033974 Ga0075364_100339741 449
975 3300006058 Ga0075432_10001293 Ga0075432_100012934 449
976 3300006058 Ga0075432_10011785 Ga0075432_100117852 449
977 3300006237 Ga0097621_100029319 Ga0097621_1000293192 449
978 3300006946 Ga0079104_1000424 Ga0079104_10004246 449
979 3300006946 Ga0079104_1001947 Ga0079104_10019479 449
980 3300006948 Ga0099826_10050979 Ga0099826_100509792 449
981 3300009011 Ga0105251_10001765 Ga0105251_100017657 449
982 3300009011 Ga0105251_10001772 Ga0105251_100017727 449
983 3300009011 Ga0105251_10010285 Ga0105251_100102855 449
984 3300009036 Ga0105244_10001453 Ga0105244_1000145311 449
985 3300009036 Ga0105244_10006059 Ga0105244_100060596 449
986 3300009036 Ga0105244_10008686 Ga0105244_100086866 449
987 3300009036 Ga0105244_10018552 Ga0105244_100185522 449
988 3300009036 Ga0105244_10027916 Ga0105244_100279162 449
989 3300009036 Ga0105244_10083730 Ga0105244_100837302 449
990 3300009092 Ga0105250_10005913 Ga0105250_100059135 449
991 3300009092 Ga0105250_10014050 Ga0105250_100140501 449
992 3300009093 Ga0105240_10153427 Ga0105240_101534272 449
993 3300009148 Ga0105243_10009208 Ga0105243_100092082 449
994 3300009148 Ga0105243_10028970 Ga0105243_100289703 449
995 3300009148 Ga0105243_10252811 Ga0105243_102528111 449
996 3300009148 Ga0105243_10313400 Ga0105243_103134001 449
997 3300011119 Ga0105246_10004667 Ga0105246_100046675 449
998 3300011119 Ga0105246_10019537 Ga0105246_100195375 449
999 3300011119 Ga0105246_10182328 Ga0105246_101823281 449
1000 3300012498 Ga0157345_1000367 Ga0157345_10003672 449
1001 3300013100 Ga0157373_10003979 Ga0157373_100039794 449
1002 3300013100 Ga0157373_10004112 Ga0157373_100041126 449
1003 3300013100 Ga0157373_10013471 Ga0157373_100134714 449
1004 3300013100 Ga0157373_10098682 Ga0157373_100986822 449
1005 3300013102 Ga0157371_10000245 Ga0157371_1000024529 449
1006 3300013102 Ga0157371_10015950 Ga0157371_100159501 449
1007 3300013102 Ga0157371_10123392 Ga0157371_101233921 449
1008 3300013104 Ga0157370_10135121 Ga0157370_101351212 449
1009 3300013105 Ga0157369_10078363 Ga0157369_100783634 449
1010 3300013306 Ga0163162_10013860 Ga0163162_100138606 449
1011 3300013306 Ga0163162_10413907 Ga0163162_104139071 449
1012 3300014497 Ga0182008_10008883 Ga0182008_100088833 449
1013 3300014497 Ga0182008_10010865 Ga0182008_100108654 449
1014 3300014968 Ga0157379_10231696 Ga0157379_102316961 449
1015 3300015261 Ga0182006_1014858 Ga0182006_10148582 449
1016 3300015261 Ga0182006_1015427 Ga0182006_10154273 449
1017 3300015261 Ga0182006_1023329 Ga0182006_10233292 449
1018 3300017792 Ga0163161_10018448 Ga0163161_100184483 449
1019 3300017792 Ga0163161_10197136 Ga0163161_101971361 449
1020 3300017792 Ga0163161_10220152 Ga0163161_102201522 449
1021 3300025207 Ga0209760_100027 Ga0209760_10002778 449
1022 3300025231 Ga0207427_100006 Ga0207427_100006410 449
1023 3300025233 Ga0209437_100013 Ga0209437_100013410 449
1024 3300025261 Ga0209233_1000022 Ga0209233_1000022410 449
1025 3300025291 Ga0209675_1000989 Ga0209675_100098913 449
1026 3300025292 Ga0209676_1000015 Ga0209676_1000015381 449
1027 3300025292 Ga0209676_1000041 Ga0209676_1000041145 449
1028 3300025292 Ga0209676_1004747 Ga0209676_10047476 449
1029 3300025298 Ga0209050_1000024 Ga0209050_1000024137 449
1030 3300025298 Ga0209050_1000030 Ga0209050_100003057 449
1031 3300025298 Ga0209050_1000518 Ga0209050_10005184 449
1032 3300025303 Ga0209051_1000012 Ga0209051_1000012298 449
1033 3300025303 Ga0209051_1000023 Ga0209051_100002353 449
1034 3300025303 Ga0209051_1010681 Ga0209051_10106813 449
1035 3300025304 Ga0209257_1002874 Ga0209257_100287410 449
1036 3300025304 Ga0209257_1004425 Ga0209257_10044259 449
1037 3300025711 Ga0207696_1000031 Ga0207696_1000031265 449
1038 3300025711 Ga0207696_1003421 Ga0207696_10034214 449
1039 3300025711 Ga0207696_1008529 Ga0207696_10085292 449
1040 3300025728 Ga0207655_1000033 Ga0207655_100003387 449
1041 3300025728 Ga0207655_1000202 Ga0207655_10002028 449
1042 3300025728 Ga0207655_1004304 Ga0207655_10043044 449
1043 3300025728 Ga0207655_1005474 Ga0207655_10054744 449
1044 3300025728 Ga0207655_1008819 Ga0207655_10088193 449
1045 3300025728 Ga0207655_1010707 Ga0207655_10107077 449
1046 3300025728 Ga0207655_1010965 Ga0207655_10109654 449
1047 3300025728 Ga0207655_1011441 Ga0207655_10114414 449
1048 3300025728 Ga0207655_1042728 Ga0207655_10427281 449
1049 3300025735 Ga0207713_1000079 Ga0207713_1000079116 449
1050 3300025735 Ga0207713_1000659 Ga0207713_100065915 449
1051 3300025735 Ga0207713_1000881 Ga0207713_10008815 449
1052 3300025735 Ga0207713_1001352 Ga0207713_10013525 449
1053 3300025735 Ga0207713_1002574 Ga0207713_10025746 449
1054 3300025735 Ga0207713_1004380 Ga0207713_10043806 449
1055 3300025735 Ga0207713_1014577 Ga0207713_10145773 449
1056 3300025912 Ga0207707_10049888 Ga0207707_100498882 449
1057 3300025923 Ga0207681_10003495 Ga0207681_100034956 449
1058 3300025935 Ga0207709_10000248 Ga0207709_1000024812 449
1059 3300025935 Ga0207709_10002118 Ga0207709_100021186 449
1060 3300025944 Ga0207661_10072049 Ga0207661_100720493 449
1061 3300027111 Ga0209281_1000016 Ga0209281_1000016344 449
1062 3300027111 Ga0209281_1000019 Ga0209281_1000019193 449
1063 3300027111 Ga0209281_1010043 Ga0209281_10100431 449
1064 3300027312 Ga0209371_1000980 Ga0209371_100098020 449
1065 3300027907 Ga0207428_10055895 Ga0207428_100558953 449
1066 3300027907 Ga0207428_10094654 Ga0207428_100946542 449
1067 3300027907 Ga0207428_10100480 Ga0207428_101004802 449
1068 3300027907 Ga0207428_10148203 Ga0207428_101482032 449
1069 3300028379 Ga0268266_10017876 Ga0268266_100178762 449
1070 3300028379 Ga0268266_10036568 Ga0268266_100365684 449
1071 3300030500 Ga0268256_1001241 Ga0268256_100124113 449
1072 3300030734 Ga0316179_1074380 Ga0316179_10743803 449
1073 3300030735 Ga0316178_1051183 Ga0316178_10511832 449
1074 3300030742 Ga0316183_1004754 Ga0316183_10047547 449
1075 3300031250 Ga0265331_10042006 Ga0265331_100420062 449
1076 3300031548 Ga0307408_100008555 Ga0307408_1000085553 449
1077 3300031548 Ga0307408_100025199 Ga0307408_1000251993 449
1078 3300031548 Ga0307408_100030100 Ga0307408_1000301003 449
1079 3300031731 Ga0307405_10003779 Ga0307405_100037793 449
1080 3300031731 Ga0307405_10009015 Ga0307405_100090153 449
1081 3300031731 Ga0307405_10024955 Ga0307405_100249552 449
1082 3300031824 Ga0307413_10020637 Ga0307413_100206373 449
1083 3300031901 Ga0307406_10063957 Ga0307406_100639572 449
1084 3300031911 Ga0307412_10003115 Ga0307412_100031156 449
1085 3300031911 Ga0307412_10006197 Ga0307412_100061976 449
1086 3300031911 Ga0307412_10008593 Ga0307412_100085934 449
1087 3300031995 Ga0307409_100026540 Ga0307409_1000265404 449
1088 3300032004 Ga0307414_10028695 Ga0307414_100286953 449
1089 3300032004 Ga0307414_10093451 Ga0307414_100934512 449
1090 3300032005 Ga0307411_10007691 Ga0307411_100076916 449
1091 3300041405 Ga0439438_003322 Ga0439438_003322_1572_2921 449
1092 3300041405 Ga0439438_003720 Ga0439438_003720_2767_4116 449
1093 3300041405 Ga0439438_003853 Ga0439438_003853_4349_5698 449
1094 3300041405 Ga0439438_005789 Ga0439438_005789_1183_2532 449
1095 3300041405 Ga0439438_007455 Ga0439438_007455_1200_2549 449
1096 3300041405 Ga0439438_007874 Ga0439438_007874_840_2189 449
1097 3300041407 Ga0439447_004242 Ga0439447_004242_1202_2551 449
1098 3300041407 Ga0439447_005799 Ga0439447_005799_1073_2422 449
1099 3300041407 Ga0439447_008267 Ga0439447_008267_14_1363 449
1100 3300042006 Ga0439432_003130 Ga0439432_003130_2766_4115 449
1101 3300042006 Ga0439432_005623 Ga0439432_005623_1190_2539 449
1102 3300042009 Ga0439451_017439 Ga0439451_017439_63_1415 449
1103 3300042010 Ga0439452_003394 Ga0439452_003394_1937_3286 449
1104 3300042010 Ga0439452_003587 Ga0439452_003587_2135_3484 449
1105 3300042016 Ga0439463_000362 Ga0439463_000362_6255_7604 449
1106 3300042016 Ga0439463_008252 Ga0439463_008252_1055_2404 449
1107 3300042115 Ga0450911_002076 Ga0450911_002076_1809_3158 449
1108 3300042122 Ga0450920_001025 Ga0450920_001025_1565_2914 449
1109 3300042127 Ga0450890_001315 Ga0450890_001315_807_2156 449
1110 3300042138 Ga0450903_003208 Ga0450903_003208_928_2277 449
1111 3300042145 Ga0450906_001093 Ga0450906_001093_3486_4835 449
1112 3300042146 Ga0450907_001550 Ga0450907_001550_1899_3248 449
1113 3300042146 Ga0450907_007918 Ga0450907_007918_257_1606 449
1114 3300042156 Ga0439446_0033311 Ga0439446_0033311_30_1379 449
1115 3300042993 Ga0439440_0003394 Ga0439440_0003394_791_2140 449
1116 3300046452 Ga0495617_001747 Ga0495617_001747_1140_2489 449
1117 3300046457 Ga0495590_0007182 Ga0495590_0007182_239_1588 449
1118 3300046457 Ga0495590_0033417 Ga0495590_0033417_390_1739 449
1119 3300046458 Ga0495591_000113 Ga0495591_000113_39520_40869 449
1120 3300046458 Ga0495591_003979 Ga0495591_003979_2989_4338 449
1121 3300046458 Ga0495591_010554 Ga0495591_010554_2195_3544 449
1122 3300046471 Ga0495650_0000623 Ga0495650_0000623_40348_41697 449
1123 3300046471 Ga0495650_0004070 Ga0495650_0004070_2199_3548 449
1124 3300046471 Ga0495650_0011199 Ga0495650_0011199_3437_4786 449
1125 3300046471 Ga0495650_0031114 Ga0495650_0031114_930_2279 449
1126 3300046474 Ga0495605_0000122 Ga0495605_0000122_86535_87884 449
1127 3300046474 Ga0495605_0000720 Ga0495605_0000720_308_1657 449
1128 3300046474 Ga0495605_0010155 Ga0495605_0010155_2709_4058 449
1129 3300046474 Ga0495605_0016621 Ga0495605_0016621_1318_2667 449
1130 3300046475 Ga0495639_0003206 Ga0495639_0003206_1147_2496 449
1131 3300046491 Ga0495584_0008007 Ga0495584_0008007_1900_3252 449
1132 3300046491 Ga0495584_0008818 Ga0495584_0008818_21_1370 449
1133 3300046491 Ga0495584_0011877 Ga0495584_0011877_2038_3387 449
1134 3300046492 Ga0495585_0016562 Ga0495585_0016562_1953_3302 449
1135 3300046492 Ga0495585_0023700 Ga0495585_0023700_1926_3275 449
1136 3300046492 Ga0495585_0033759 Ga0495585_0033759_1234_2583 449
1137 3300046500 Ga0495596_0023127 Ga0495596_0023127_1089_2438 449
1138 3300046501 Ga0495607_0002708 Ga0495607_0002708_6252_7601 449
1139 3300046501 Ga0495607_0005252 Ga0495607_0005252_6802_8151 449
1140 3300046501 Ga0495607_0014541 Ga0495607_0014541_1306_2655 449
1141 3300046501 Ga0495607_0020817 Ga0495607_0020817_873_2222 449
1142 3300046506 Ga0495583_0001423 Ga0495583_0001423_20822_22171 449
1143 3300046506 Ga0495583_0003451 Ga0495583_0003451_4380_5729 449
1144 3300046506 Ga0495583_0004441 Ga0495583_0004441_6777_8126 449
1145 3300046506 Ga0495583_0010934 Ga0495583_0010934_66_1418 449
1146 3300046507 Ga0495606_0002133 Ga0495606_0002133_415_1764 449
1147 3300046507 Ga0495606_0135995 Ga0495606_0135995_53_1402 449
1148 3300046512 Ga0495610_0009567 Ga0495610_0009567_3973_5322 449
1149 3300046512 Ga0495610_0031458 Ga0495610_0031458_812_2164 449
1150 3300046513 Ga0495616_0011485 Ga0495616_0011485_991_2340 449
1151 3300046515 Ga0495620_0007001 Ga0495620_0007001_288_1637 449
1152 3300046518 Ga0495631_0003022 Ga0495631_0003022_1337_2686 449
1153 3300046519 Ga0495632_0000855 Ga0495632_0000855_19654_21003 449
1154 3300046519 Ga0495632_0010624 Ga0495632_0010624_152_1501 449
1155 3300046519 Ga0495632_0037589 Ga0495632_0037589_978_2327 449
1156 3300046519 Ga0495632_0048273 Ga0495632_0048273_71_1420 449
1157 3300046520 Ga0495637_0000045 Ga0495637_0000045_6844_8193 449
1158 3300046520 Ga0495637_0001490 Ga0495637_0001490_6845_8194 449
1159 3300046520 Ga0495637_0008188 Ga0495637_0008188_1968_3317 449
1160 3300046520 Ga0495637_0016425 Ga0495637_0016425_768_2117 449
1161 3300046520 Ga0495637_0042148 Ga0495637_0042148_229_1578 449
1162 3300046520 Ga0495637_0048225 Ga0495637_0048225_391_1740 449
1163 3300046520 Ga0495637_0069479 Ga0495637_0069479_10_1362 449
1164 3300046523 Ga0495644_0011465 Ga0495644_0011465_1934_3283 449
1165 3300046528 Ga0495642_0001762 Ga0495642_0001762_6067_7416 449
1166 3300046528 Ga0495642_0009839 Ga0495642_0009839_577_1926 449
1167 3300046530 Ga0495654_0010746 Ga0495654_0010746_1120_2469 449
1168 3300046530 Ga0495654_0013134 Ga0495654_0013134_2311_3660 449
1169 3300046530 Ga0495654_0032482 Ga0495654_0032482_558_1910 449
1170 3300046530 Ga0495654_0051859 Ga0495654_0051859_23_1372 449
1171 3300046530 Ga0495654_0062000 Ga0495654_0062000_389_1738 449
1172 3300046536 Ga0495587_0051785 Ga0495587_0051785_862_2211 449
1173 3300046538 Ga0495609_0000023 Ga0495609_0000023_87423_88772 449
1174 3300046538 Ga0495609_0000132 Ga0495609_0000132_38421_39770 449
1175 3300046538 Ga0495609_0017630 Ga0495609_0017630_1939_3291 449
1176 3300046538 Ga0495609_0057145 Ga0495609_0057145_63_1412 449
1177 3300046542 Ga0495597_0000240 Ga0495597_0000240_5483_6832 449
1178 3300046542 Ga0495597_0003419 Ga0495597_0003419_6792_8141 449
1179 3300046542 Ga0495597_0046301 Ga0495597_0046301_133_1482 449
1180 3300046542 Ga0495597_0053024 Ga0495597_0053024_381_1730 449
1181 3300046557 Ga0495622_0006401 Ga0495622_0006401_1150_2499 449
1182 3300046615 Ga0495656_0008683 Ga0495656_0008683_2243_3592 449
1183 3300046615 Ga0495656_0040629 Ga0495656_0040629_521_1870 449
1184 3300046616 Ga0495668_0004362 Ga0495668_0004362_3657_5006 449
1185 3300046616 Ga0495668_0005152 Ga0495668_0005152_6029_7378 449
1186 3300046616 Ga0495668_0025862 Ga0495668_0025862_1640_2989 449
1187 3300046642 Ga0495634_0029979 Ga0495634_0029979_889_2238 449
1188 3300046648 Ga0495611_0004481 Ga0495611_0004481_3203_4552 449
1189 3300046648 Ga0495611_0013263 Ga0495611_0013263_392_1741 449
1190 3300046660 Ga0495625_0000061 Ga0495625_0000061_90299_91648 449
1191 3300046660 Ga0495625_0027918 Ga0495625_0027918_2234_3583 449
1192 3300046663 Ga0495635_0031677 Ga0495635_0031677_1440_2789 449
1193 3300046664 Ga0495659_0002272 Ga0495659_0002272_2447_3796 449
1194 3300046665 Ga0495661_0000060 Ga0495661_0000060_91878_93227 449
1195 3300046665 Ga0495661_0000072 Ga0495661_0000072_6853_8202 449
1196 3300046665 Ga0495661_0030018 Ga0495661_0030018_486_1835 449
1197 3300046679 Ga0495623_0029954 Ga0495623_0029954_1350_2699 449
1198 3300046684 Ga0495669_0022243 Ga0495669_0022243_1134_2483 449
1199 3300046690 Ga0495624_0005415 Ga0495624_0005415_5351_6700 449
1200 3300046691 Ga0495670_0016631 Ga0495670_0016631_621_1970 449
1201 3300046691 Ga0495670_0018111 Ga0495670_0018111_1463_2815 449
1202 3300046691 Ga0495670_0102119 Ga0495670_0102119_41_1390 449
1203 3300046692 Ga0495671_0011769 Ga0495671_0011769_1439_2788 449
1204 3300046692 Ga0495671_0013286 Ga0495671_0013286_1923_3272 449
1205 3300046692 Ga0495671_0029446 Ga0495671_0029446_1126_2475 449
1206 3300046692 Ga0495671_0030945 Ga0495671_0030945_963_2312 449
1207 3300046694 Ga0495649_0001082 Ga0495649_0001082_1865_3217 449
1208 3300046694 Ga0495649_0004431 Ga0495649_0004431_1172_2521 449
1209 3300046694 Ga0495649_0015624 Ga0495649_0015624_1698_3047 449
1210 3300046694 Ga0495649_0022169 Ga0495649_0022169_1541_2890 449
1211 3300046694 Ga0495649_0023816 Ga0495649_0023816_49_1398 449
1212 3300046794 Ga0495589_0002988 Ga0495589_0002988_1163_2512 449
1213 3300046794 Ga0495589_0057788 Ga0495589_0057788_476_1825 449
1214 3300047317 Ga0495604_0012472 Ga0495604_0012472_30_1379 449
1215 3300047317 Ga0495604_0043272 Ga0495604_0043272_1375_2724 449
1216 3300047320 Ga0495672_0004169 Ga0495672_0004169_8885_10234 449
1217 3300047320 Ga0495672_0004529 Ga0495672_0004529_4608_5957 449
1218 3300047320 Ga0495672_0006578 Ga0495672_0006578_2780_4129 449
1219 3300047320 Ga0495672_0017583 Ga0495672_0017583_1331_2680 449
1220 3300047320 Ga0495672_0018934 Ga0495672_0018934_1333_2682 449
1221 3300047320 Ga0495672_0029790 Ga0495672_0029790_1232_2581 449
1222 3300047321 Ga0495676_0000011 Ga0495676_0000011_88319_89668 449
1223 3300047321 Ga0495676_0007808 Ga0495676_0007808_5142_6494 449
1224 3300047321 Ga0495676_0039201 Ga0495676_0039201_2543_3892 449
1225 3300047323 Ga0495683_0000362 Ga0495683_0000362_30058_31410 449
1226 3300047323 Ga0495683_0009052 Ga0495683_0009052_1274_2623 449
1227 3300047323 Ga0495683_0013020 Ga0495683_0013020_905_2254 449
1228 3300047323 Ga0495683_0022696 Ga0495683_0022696_656_2005 449
1229 3300047443 Ga0495687_011045 Ga0495687_011045_1144_2493 449
1230 3300047443 Ga0495687_031458 Ga0495687_031458_914_2263 449
1231 3300047445 Ga0495677_0007419 Ga0495677_0007419_1178_2527 449
1232 3300047446 Ga0495679_000028 Ga0495679_000028_107075_108424 449
1233 3300047469 Ga0495673_0002493 Ga0495673_0002493_8662_10011 449
1234 3300047469 Ga0495673_0003291 Ga0495673_0003291_3602_4951 449
1235 3300047469 Ga0495673_0003710 Ga0495673_0003710_6639_7988 449
1236 3300047469 Ga0495673_0004185 Ga0495673_0004185_1152_2501 449
1237 3300047469 Ga0495673_0004320 Ga0495673_0004320_1776_3125 449
1238 3300047469 Ga0495673_0012251 Ga0495673_0012251_1476_2828 449
1239 3300047469 Ga0495673_0012739 Ga0495673_0012739_22_1371 449
1240 3300047470 Ga0495681_0004600 Ga0495681_0004600_3444_4793 449
1241 3300047470 Ga0495681_0010607 Ga0495681_0010607_1864_3216 449
1242 3300047470 Ga0495681_0010847 Ga0495681_0010847_3201_4550 449
1243 3300048091 Ga0495626_0009113 Ga0495626_0009113_2961_4310 449
1244 3300048091 Ga0495626_0013014 Ga0495626_0013014_1807_3156 449
1245 3300048091 Ga0495626_0036221 Ga0495626_0036221_336_1685 449
1246 3300048905 Ga0496102_0048468 Ga0496102_0048468_852_2201 449
1247 3300048906 Ga0496103_0007163 Ga0496103_0007163_1462_2811 449
1248 3300048919 Ga0496116_0014450 Ga0496116_0014450_1729_3078 449
1249 3300048919 Ga0496116_0036842 Ga0496116_0036842_774_2123 449
1250 3300048919 Ga0496116_0037302 Ga0496116_0037302_2010_3359 449
1251 3300048920 Ga0496117_0037276 Ga0496117_0037276_856_2205 449
1252 3300048920 Ga0496117_0047865 Ga0496117_0047865_1664_3013 449
1253 3300048921 Ga0496118_0082265 Ga0496118_0082265_892_2241 449
1254 3300048924 Ga0496121_0002538 Ga0496121_0002538_218_1567 449
1255 3300048924 Ga0496121_0006595 Ga0496121_0006595_7085_8434 449
1256 3300048925 Ga0496122_0000398 Ga0496122_0000398_2956_4305 449
1257 3300048926 Ga0496123_0000302 Ga0496123_0000302_2850_4199 449
1258 3300048927 Ga0496124_0000073 Ga0496124_0000073_134521_135870 449
1259 3300049459 Ga0495678_000325 Ga0495678_000325_43360_44709 449
1260 3300049459 Ga0495678_007952 Ga0495678_007952_537_1886 449
1261 3300049459 Ga0495678_011303 Ga0495678_011303_1679_3028 449
1262 3300049459 Ga0495678_023888 Ga0495678_023888_535_1884 449
1263 3300049459 Ga0495678_046604 Ga0495678_046604_271_1620 449
1264 3300049460 Ga0495682_0000607 Ga0495682_0000607_20265_21614 449
1265 3300053125 Ga0500618_007715 Ga0500618_007715_1262_2614 449

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

73

439

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pw4-assembly1.cif.gz_A crystal structure of the glycerol-3-phosphate transporter from e.coli 0.9261 5 443
1pw4-assembly1.cif.gz_A crystal structure of the glycerol-3-phosphate transporter from e.coli 0.9097 5 443
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8542 26 430
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.8517 26 434
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.831 28 431
ID Description Score Start End Superfamily
af_P08194_18_226_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9891 19 225 1.20.1250.20
af_P08194_18_226_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9751 19 225 1.20.1250.20
af_P09836_237_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9588 239 434 1.20.1250.20
af_P08194_240_451_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.954 239 448 1.20.1250.20
af_P08194_240_451_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9407 239 448 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3M3X1E7-F1-model_v4 Glycerol-3-phosphate transporter 0.9846 1 214 GO:0005886
GO:0012505
GO:0035435
GO:0061513
AF-A0A6Y6LTY8-F1-model_v4 MFS transporter 0.984 1 281 GO:0005886
GO:0035435
GO:0061513
AF-A0A2R7SZ92-F1-model_v4 deleted 0.9834 1 191
AF-A0A376WYM6-F1-model_v4 Glycerol-3-phosphate transporter 0.9811 1 223 GO:0005886
GO:0012505
GO:0035435
GO:0061513
AF-A0A6N8Q3X7-F1-model_v4 deleted 0.9795 143 398

Feature Viewer

pLDDT pTM Quality
88.39 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map