F492163

General Info

Members Datasets Scaffolds Average Seq Length
1248 375 1248 249

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10007875|Ga0105248_100078754
Length 295
Sequence MLVRRLVSKASEASDGRLLRAIPDPESAQFCRISGSHKFDEGEGITMSGHSKWATIKHKKGALDAKRGKIFTRLIKEITIAAKNGGGDPDSNPRLRTAIAAAKAENMPADNIKRAVQRGTGELPGSTYEEFTLEGYGPGGVALMLDINTDNRNRTVSEIRHAFGKNGGNMAEAGAVSWMFHKKGDIVVPKSATSEDDLMGIVLEAGADDLRDDGENWEVVTDPSSFEAVVEAVKKAGIHPASAEVAMIPQNYIKLEGQQATTMIRLVEALEEHDDVQNVHSNFDIDAKLLEEVAG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
143 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
144 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
145 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
146 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
147 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
148 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
218 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
219 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
234 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
235 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
236 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
237 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
238 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
244 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
264 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
265 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
372 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 4.57
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7561224 2162886012 Bacteria 3568
2 LJNas_1000076 3300000546 Bacteria 14002
3 JGI24746J21847_1006687 3300001977 Bacteria 1778
4 JGI24748J21848_1002646 3300002074 Bacteria 2033
5 JGI24034J26672_10004087 3300002239 Bacteria 2057
6 Ga0058859_11766681 3300004798 Bacteria 1273
7 Ga0065712_10068497 3300005290 Bacteria 10234
8 Ga0065715_10000735 3300005293 Bacteria 10090
9 Ga0065715_10026413 3300005293 Bacteria 1420
10 Ga0065715_10093168 3300005293 Bacteria 4784
11 Ga0065715_10239199 3300005293 Bacteria 1205
12 Ga0065707_10307055 3300005295 Bacteria 992
13 Ga0070658_10033292 3300005327 Bacteria 4146
14 Ga0070676_10001008 3300005328 Bacteria 13991
15 Ga0070676_10007541 3300005328 Bacteria 5844
16 Ga0070676_10039318 3300005328 Bacteria 2735
17 Ga0070683_100015693 3300005329 Bacteria 6659
18 Ga0070683_100073999 3300005329 Bacteria 3181
19 Ga0070683_100114547 3300005329 Bacteria 2545
20 Ga0070683_100140563 3300005329 Bacteria 2287
21 Ga0070690_100002659 3300005330 Bacteria 9628
22 Ga0070690_100047347 3300005330 Bacteria 2736
23 Ga0070670_100003376 3300005331 Bacteria 13226
24 Ga0070670_100004468 3300005331 Bacteria 11713
25 Ga0070670_100019753 3300005331 Bacteria 5785
26 Ga0070670_100088516 3300005331 Bacteria 2662
27 Ga0070670_100141952 3300005331 Bacteria 2077
28 Ga0070677_10034306 3300005333 Bacteria 1959
29 Ga0070677_10207151 3300005333 Bacteria 950
30 Ga0068869_100001024 3300005334 Bacteria 16265
31 Ga0068869_100005230 3300005334 Bacteria 8149
32 Ga0068869_100053048 3300005334 Bacteria 2946
33 Ga0070666_10077472 3300005335 Bacteria 2269
34 Ga0070680_100108502 3300005336 Bacteria 2309
35 Ga0070680_100163309 3300005336 Bacteria 1872
36 Ga0070682_100057810 3300005337 Bacteria 2444
37 Ga0068868_100003993 3300005338 Bacteria 10300
38 Ga0068868_100010878 3300005338 Bacteria 6604
39 Ga0068868_100040790 3300005338 Bacteria 3614
40 Ga0068868_100054292 3300005338 Bacteria 3157
41 Ga0070660_100006036 3300005339 Bacteria 8374
42 Ga0070660_100022684 3300005339 Bacteria 4646
43 Ga0070660_100095191 3300005339 Bacteria 2354
44 Ga0070689_100003010 3300005340 Bacteria 11090
45 Ga0070691_10017726 3300005341 Bacteria 3277
46 Ga0070691_10064057 3300005341 Bacteria 1773
47 Ga0070687_100003542 3300005343 Bacteria 6079
48 Ga0070687_100054676 3300005343 Bacteria 2081
49 Ga0070661_100003579 3300005344 Bacteria 10694
50 Ga0070661_100038869 3300005344 Bacteria 3465
51 Ga0070661_100090522 3300005344 Bacteria 2266
52 Ga0070661_100091381 3300005344 Bacteria 2254
53 Ga0070668_100006090 3300005347 Bacteria 8944
54 Ga0070668_100012619 3300005347 Bacteria 6289
55 Ga0070675_100004241 3300005354 Bacteria 10908
56 Ga0070675_100004987 3300005354 Bacteria 10135
57 Ga0070671_100057370 3300005355 Bacteria 3240
58 Ga0070671_100218015 3300005355 Bacteria 1619
59 Ga0070671_100345830 3300005355 Bacteria 1269
60 Ga0070671_100470784 3300005355 Bacteria 1079
61 Ga0070671_100482536 3300005355 Bacteria 1065
62 Ga0070674_100015644 3300005356 Bacteria 4742
63 Ga0070673_100005685 3300005364 Bacteria 8016
64 Ga0070673_100008711 3300005364 Bacteria 6767
65 Ga0070673_100049255 3300005364 Bacteria 3289
66 Ga0070688_100002330 3300005365 Bacteria 9577
67 Ga0070688_100046328 3300005365 Bacteria 2692
68 Ga0070688_100057566 3300005365 Bacteria 2444
69 Ga0070659_100002864 3300005366 Bacteria 12281
70 Ga0070659_100143792 3300005366 Bacteria 1942
71 Ga0070667_100014780 3300005367 Bacteria 6449
72 Ga0070667_100111231 3300005367 Bacteria 2376
73 Ga0070667_100355255 3300005367 Bacteria 1327
74 Ga0070709_10001917 3300005434 Bacteria 11302
75 Ga0070709_10017128 3300005434 Bacteria 4149
76 Ga0070709_10026291 3300005434 Bacteria 3449
77 Ga0070709_10033161 3300005434 Bacteria 3120
78 Ga0070709_10113160 3300005434 Bacteria 1827
79 Ga0070709_10161655 3300005434 Bacteria 1558
80 Ga0070709_10164385 3300005434 Bacteria 1546
81 Ga0070709_10172194 3300005434 Bacteria 1514
82 Ga0070714_100000027 3300005435 Bacteria 141750
83 Ga0070714_100003569 3300005435 Bacteria 11633
84 Ga0070714_100006592 3300005435 Bacteria 8982
85 Ga0070714_100006599 3300005435 Bacteria 8978
86 Ga0070714_100031322 3300005435 Bacteria 4437
87 Ga0070714_100032502 3300005435 Bacteria 4355
88 Ga0070714_100066916 3300005435 Bacteria 3097
89 Ga0070714_100126547 3300005435 Bacteria 2279
90 Ga0070714_100153946 3300005435 Bacteria 2074
91 Ga0070714_100209203 3300005435 Bacteria 1787
92 Ga0070714_100318450 3300005435 Bacteria 1454
93 Ga0070714_100444800 3300005435 Bacteria 1230
94 Ga0070713_100000116 3300005436 Bacteria 52486
95 Ga0070713_100001584 3300005436 Bacteria 14570
96 Ga0070713_100011324 3300005436 Bacteria 6492
97 Ga0070713_100012740 3300005436 Bacteria 6179
98 Ga0070713_100014620 3300005436 Bacteria 5838
99 Ga0070713_100080583 3300005436 Bacteria 2776
100 Ga0070713_100097063 3300005436 Bacteria 2546
101 Ga0070713_100193769 3300005436 Bacteria 1832
102 Ga0070713_100300545 3300005436 Bacteria 1477
103 Ga0070710_10003989 3300005437 Bacteria 6997
104 Ga0070710_10046423 3300005437 Bacteria 2419
105 Ga0070710_10055019 3300005437 Bacteria 2247
106 Ga0070710_10098815 3300005437 Bacteria 1734
107 Ga0070710_10127944 3300005437 Bacteria 1545
108 Ga0070711_100000206 3300005439 Bacteria 31253
109 Ga0070711_100000272 3300005439 Bacteria 26766
110 Ga0070711_100003497 3300005439 Bacteria 9163
111 Ga0070711_100005166 3300005439 Bacteria 7783
112 Ga0070711_100023104 3300005439 Bacteria 4040
113 Ga0070711_100045861 3300005439 Bacteria 2976
114 Ga0070711_100071120 3300005439 Bacteria 2451
115 Ga0070711_100310011 3300005439 Bacteria 1258
116 Ga0070711_100406729 3300005439 Bacteria 1106
117 Ga0070711_100418086 3300005439 Bacteria 1092
118 Ga0070705_100176677 3300005440 Bacteria 1442
119 Ga0070694_100007431 3300005444 Bacteria 6681
120 Ga0070694_100163494 3300005444 Bacteria 1635
121 Ga0070694_100243781 3300005444 Bacteria 1356
122 Ga0070694_100569758 3300005444 Bacteria 909
123 Ga0070708_100001701 3300005445 Bacteria 16914
124 Ga0070708_100007752 3300005445 Bacteria 8602
125 Ga0070708_100011623 3300005445 Bacteria 7165
126 Ga0070708_100031502 3300005445 Bacteria 4590
127 Ga0070708_100033307 3300005445 Bacteria 4477
128 Ga0070708_100035322 3300005445 Bacteria 4354
129 Ga0070708_100051081 3300005445 Bacteria 3662
130 Ga0070708_100425842 3300005445 Bacteria 1252
131 Ga0070663_100075465 3300005455 Bacteria 2464
132 Ga0070663_100094977 3300005455 Bacteria 2215
133 Ga0070663_100175536 3300005455 Bacteria 1659
134 Ga0070663_100499271 3300005455 Bacteria 1010
135 Ga0070678_100010777 3300005456 Bacteria 5602
136 Ga0070678_100010889 3300005456 Bacteria 5579
137 Ga0070678_100033398 3300005456 Bacteria 3572
138 Ga0070678_100097304 3300005456 Bacteria 2272
139 Ga0070678_100243042 3300005456 Bacteria 1506
140 Ga0070678_100314012 3300005456 Bacteria 1336
141 Ga0070662_100005628 3300005457 Bacteria 8012
142 Ga0070662_100016346 3300005457 Bacteria 4981
143 Ga0070662_100036070 3300005457 Bacteria 3496
144 Ga0070662_100089333 3300005457 Bacteria 2311
145 Ga0070662_100111223 3300005457 Bacteria 2087
146 Ga0070681_10001816 3300005458 Bacteria 19215
147 Ga0070681_10009561 3300005458 Bacteria 9538
148 Ga0070681_10160889 3300005458 Bacteria 2169
149 Ga0068867_100005043 3300005459 Bacteria 9318
150 Ga0068867_100007820 3300005459 Bacteria 7561
151 Ga0068867_100214905 3300005459 Bacteria 1546
152 Ga0068867_100346707 3300005459 Bacteria 1238
153 Ga0068867_100645903 3300005459 Bacteria 928
154 Ga0070685_10000631 3300005466 Bacteria 19272
155 Ga0070706_100004001 3300005467 Bacteria 14336
156 Ga0070706_100008753 3300005467 Bacteria 9428
157 Ga0070706_100024824 3300005467 Bacteria 5518
158 Ga0070706_100036214 3300005467 Bacteria 4557
159 Ga0070706_100051162 3300005467 Bacteria 3812
160 Ga0070706_100058258 3300005467 Bacteria 3565
161 Ga0070706_100071993 3300005467 Bacteria 3198
162 Ga0070706_100099044 3300005467 Bacteria 2708
163 Ga0070706_100165285 3300005467 Bacteria 2066
164 Ga0070707_100013742 3300005468 Bacteria 7581
165 Ga0070707_100018159 3300005468 Bacteria 6619
166 Ga0070707_100045396 3300005468 Bacteria 4206
167 Ga0070707_100055976 3300005468 Bacteria 3781
168 Ga0070707_100092570 3300005468 Bacteria 2927
169 Ga0070707_100483551 3300005468 Bacteria 1200
170 Ga0070698_100000171 3300005471 Bacteria 60242
171 Ga0070698_100016069 3300005471 Bacteria 7902
172 Ga0070698_100018824 3300005471 Bacteria 7265
173 Ga0070698_100102525 3300005471 Bacteria 2832
174 Ga0070698_100191332 3300005471 Bacteria 1984
175 Ga0070699_100003678 3300005518 Bacteria 13582
176 Ga0070699_100016767 3300005518 Bacteria 6289
177 Ga0070699_100042118 3300005518 Bacteria 3950
178 Ga0070699_100060971 3300005518 Bacteria 3269
179 Ga0070699_100067126 3300005518 Bacteria 3115
180 Ga0070699_100093641 3300005518 Bacteria 2629
181 Ga0070699_100358917 3300005518 Bacteria 1314
182 Ga0070699_100412582 3300005518 Bacteria 1222
183 Ga0070679_100012778 3300005530 Bacteria 8033
184 Ga0070679_100175859 3300005530 Bacteria 2113
185 Ga0070679_100215243 3300005530 Bacteria 1884
186 Ga0070679_100520962 3300005530 Bacteria 1133
187 Ga0070684_100001110 3300005535 Bacteria 19289
188 Ga0070684_100013201 3300005535 Bacteria 6651
189 Ga0070684_100262360 3300005535 Bacteria 1580
190 Ga0070684_100491698 3300005535 Bacteria 1136
191 Ga0070697_100000099 3300005536 Bacteria 71389
192 Ga0070697_100000320 3300005536 Bacteria 38249
193 Ga0070697_100001005 3300005536 Bacteria 21283
194 Ga0070697_100002342 3300005536 Bacteria 14568
195 Ga0070697_100007565 3300005536 Bacteria 8461
196 Ga0070697_100038435 3300005536 Bacteria 3867
197 Ga0070697_100163781 3300005536 Bacteria 1879
198 Ga0070697_100228482 3300005536 Bacteria 1587
199 Ga0068853_100004528 3300005539 Bacteria 10784
200 Ga0068853_100006375 3300005539 Bacteria 9371
201 Ga0068853_100140782 3300005539 Bacteria 2165
202 Ga0068853_100277651 3300005539 Bacteria 1544
203 Ga0070672_100002695 3300005543 Bacteria 11362
204 Ga0070672_100036606 3300005543 Bacteria 3740
205 Ga0070672_100037164 3300005543 Bacteria 3713
206 Ga0070686_100006747 3300005544 Bacteria 6388
207 Ga0070686_100035071 3300005544 Bacteria 3096
208 Ga0070686_100065651 3300005544 Bacteria 2358
209 Ga0070686_100076043 3300005544 Bacteria 2210
210 Ga0070695_100062694 3300005545 Bacteria 2415
211 Ga0070695_100182760 3300005545 Bacteria 1487
212 Ga0070696_100303449 3300005546 Bacteria 1223
213 Ga0070693_100020497 3300005547 Bacteria 3488
214 Ga0070693_100090992 3300005547 Bacteria 1839
215 Ga0070693_100297405 3300005547 Bacteria 1087
216 Ga0070665_100007148 3300005548 Bacteria 11352
217 Ga0070665_100018792 3300005548 Bacteria 6929
218 Ga0070665_100233284 3300005548 Bacteria 1840
219 Ga0070704_100014874 3300005549 Bacteria 4870
220 Ga0070704_100276336 3300005549 Bacteria 1390
221 Ga0070704_100286294 3300005549 Bacteria 1367
222 Ga0070704_100368640 3300005549 Bacteria 1217
223 Ga0070704_100391093 3300005549 Bacteria 1184
224 Ga0070704_100420417 3300005549 Bacteria 1144
225 Ga0068855_100002199 3300005563 Bacteria 24120
226 Ga0068855_100066516 3300005563 Bacteria 4202
227 Ga0068855_100078756 3300005563 Bacteria 3823
228 Ga0068855_100084289 3300005563 Bacteria 3680
229 Ga0068855_100101569 3300005563 Bacteria 3311
230 Ga0068855_100147089 3300005563 Bacteria 2681
231 Ga0068855_100226540 3300005563 Bacteria 2095
232 Ga0068855_100244492 3300005563 Bacteria 2004
233 Ga0070664_100004464 3300005564 Bacteria 11231
234 Ga0070664_100009155 3300005564 Bacteria 8040
235 Ga0070664_100021327 3300005564 Bacteria 5338
236 Ga0070664_100190450 3300005564 Bacteria 1827
237 Ga0068857_100000130 3300005577 Bacteria 45479
238 Ga0068857_100006956 3300005577 Bacteria 9737
239 Ga0068857_100024037 3300005577 Bacteria 5364
240 Ga0068857_100029418 3300005577 Bacteria 4848
241 Ga0068857_100082988 3300005577 Bacteria 2863
242 Ga0068857_100132854 3300005577 Bacteria 2246
243 Ga0068857_100265466 3300005577 Bacteria 1576
244 Ga0068854_100007795 3300005578 Bacteria 6849
245 Ga0068854_100009053 3300005578 Bacteria 6415
246 Ga0068854_100010220 3300005578 Bacteria 6082
247 Ga0068854_100025281 3300005578 Bacteria 4074
248 Ga0068854_100025484 3300005578 Bacteria 4058
249 Ga0068854_100025620 3300005578 Bacteria 4048
250 Ga0068854_100216224 3300005578 Bacteria 1514
251 Ga0068856_100002284 3300005614 Bacteria 19785
252 Ga0068856_100009064 3300005614 Bacteria 9682
253 Ga0068856_100009253 3300005614 Bacteria 9574
254 Ga0068856_100012319 3300005614 Bacteria 8281
255 Ga0068856_100034344 3300005614 Bacteria 4967
256 Ga0068856_100097143 3300005614 Bacteria 2934
257 Ga0068856_100182905 3300005614 Bacteria 2109
258 Ga0068856_100212005 3300005614 Bacteria 1952
259 Ga0068856_100256619 3300005614 Bacteria 1763
260 Ga0068856_100262200 3300005614 Bacteria 1743
261 Ga0068856_100381685 3300005614 Bacteria 1428
262 Ga0068856_100854966 3300005614 Bacteria 929
263 Ga0070702_100013668 3300005615 Bacteria 4104
264 Ga0068852_100076064 3300005616 Bacteria 2963
265 Ga0068852_100086107 3300005616 Bacteria 2800
266 Ga0068859_100000387 3300005617 Bacteria 43906
267 Ga0068859_100004358 3300005617 Bacteria 14441
268 Ga0068859_100023926 3300005617 Bacteria 6129
269 Ga0068859_100027045 3300005617 Bacteria 5754
270 Ga0068859_100037751 3300005617 Bacteria 4848
271 Ga0068859_100041061 3300005617 Bacteria 4647
272 Ga0068859_100253330 3300005617 Bacteria 1851
273 Ga0068864_100004181 3300005618 Bacteria 11863
274 Ga0068864_100004837 3300005618 Bacteria 11037
275 Ga0068864_100036872 3300005618 Bacteria 4169
276 Ga0068864_100105641 3300005618 Bacteria 2503
277 Ga0068864_100154608 3300005618 Bacteria 2081
278 Ga0068864_100235187 3300005618 Bacteria 1696
279 Ga0068864_100305356 3300005618 Bacteria 1491
280 Ga0068864_100324845 3300005618 Bacteria 1446
281 Ga0068864_100837209 3300005618 Bacteria 906
282 Ga0068866_10001371 3300005718 Bacteria 10510
283 Ga0068866_10004664 3300005718 Bacteria 5625
284 Ga0068866_10012138 3300005718 Bacteria 3749
285 Ga0068861_100003909 3300005719 Bacteria 9964
286 Ga0068861_100011191 3300005719 Bacteria 6229
287 Ga0068861_100195000 3300005719 Bacteria 1696
288 Ga0068861_100584547 3300005719 Bacteria 1023
289 Ga0068851_10007389 3300005834 Bacteria 5042
290 Ga0068851_10008189 3300005834 Bacteria 4825
291 Ga0068851_10008776 3300005834 Bacteria 4683
292 Ga0068851_10068828 3300005834 Bacteria 1828
293 Ga0068870_10005594 3300005840 Bacteria 5492
294 Ga0068870_10011012 3300005840 Bacteria 4178
295 Ga0068870_10061578 3300005840 Bacteria 2018
296 Ga0068863_100025391 3300005841 Bacteria 5649
297 Ga0068863_100053323 3300005841 Bacteria 3833
298 Ga0068863_100067978 3300005841 Bacteria 3370
299 Ga0068863_100089057 3300005841 Bacteria 2925
300 Ga0068863_100136335 3300005841 Bacteria 2345
301 Ga0068863_100145531 3300005841 Bacteria 2266
302 Ga0068863_100354490 3300005841 Bacteria 1429
303 Ga0068863_100393815 3300005841 Bacteria 1354
304 Ga0068858_100010831 3300005842 Bacteria 8620
305 Ga0068858_100013406 3300005842 Bacteria 7737
306 Ga0068858_100015430 3300005842 Bacteria 7185
307 Ga0068858_100022310 3300005842 Bacteria 5912
308 Ga0068858_100135590 3300005842 Bacteria 2310
309 Ga0068858_100309307 3300005842 Bacteria 1509
310 Ga0068860_100018027 3300005843 Bacteria 6875
311 Ga0068860_100018060 3300005843 Bacteria 6868
312 Ga0068860_100026346 3300005843 Bacteria 5606
313 Ga0068860_100029437 3300005843 Bacteria 5282
314 Ga0068860_100148797 3300005843 Bacteria 2254
315 Ga0068860_100250964 3300005843 Bacteria 1723
316 Ga0068862_100016880 3300005844 Bacteria 6075
317 Ga0068862_100069844 3300005844 Bacteria 3032
318 Ga0068862_100098556 3300005844 Bacteria 2553
319 Ga0081455_10090149 3300005937 Bacteria 2487
320 Ga0081540_1030546 3300005983 Bacteria 2981
321 Ga0081540_1035291 3300005983 Bacteria 2684
322 Ga0070717_10001615 3300006028 Bacteria 15611
323 Ga0070717_10002183 3300006028 Bacteria 13728
324 Ga0070717_10004989 3300006028 Bacteria 9656
325 Ga0070717_10005465 3300006028 Bacteria 9279
326 Ga0070717_10009827 3300006028 Bacteria 7205
327 Ga0070717_10012522 3300006028 Bacteria 6469
328 Ga0070717_10029001 3300006028 Bacteria 4436
329 Ga0070717_10053288 3300006028 Bacteria 3334
330 Ga0070717_10073761 3300006028 Bacteria 2852
331 Ga0070717_10091874 3300006028 Bacteria 2564
332 Ga0070717_10092374 3300006028 Bacteria 2557
333 Ga0070717_10137636 3300006028 Bacteria 2104
334 Ga0075365_10044578 3300006038 Bacteria 2907
335 Ga0070715_10001590 3300006163 Bacteria 6690
336 Ga0070715_10002793 3300006163 Bacteria 5435
337 Ga0070715_10054664 3300006163 Bacteria 1730
338 Ga0070715_10192294 3300006163 Bacteria 1031
339 Ga0070716_100000328 3300006173 Bacteria 19205
340 Ga0070716_100022002 3300006173 Bacteria 3366
341 Ga0070716_100025558 3300006173 Bacteria 3152
342 Ga0070716_100042017 3300006173 Bacteria 2550
343 Ga0070716_100048371 3300006173 Bacteria 2403
344 Ga0070716_100054416 3300006173 Bacteria 2286
345 Ga0070716_100141760 3300006173 Bacteria 1533
346 Ga0070716_100306074 3300006173 Bacteria 1107
347 Ga0070712_100000223 3300006175 Bacteria 31964
348 Ga0070712_100000342 3300006175 Bacteria 26253
349 Ga0070712_100000576 3300006175 Bacteria 21379
350 Ga0070712_100000641 3300006175 Bacteria 20568
351 Ga0070712_100010096 3300006175 Bacteria 5951
352 Ga0070712_100037469 3300006175 Bacteria 3306
353 Ga0070712_100054526 3300006175 Bacteria 2795
354 Ga0070712_100393083 3300006175 Bacteria 1144
355 Ga0097621_100000422 3300006237 Bacteria 29438
356 Ga0097621_100001910 3300006237 Bacteria 14231
357 Ga0097621_100032544 3300006237 Bacteria 4146
358 Ga0097621_100036732 3300006237 Bacteria 3920
359 Ga0097621_100080074 3300006237 Bacteria 2716
360 Ga0097621_100278483 3300006237 Bacteria 1472
361 Ga0068871_100000387 3300006358 Bacteria 30959
362 Ga0068871_100000924 3300006358 Bacteria 19604
363 Ga0068871_100045064 3300006358 Bacteria 3549
364 Ga0068871_100049109 3300006358 Bacteria 3409
365 Ga0068871_100059137 3300006358 Bacteria 3122
366 Ga0068871_100074199 3300006358 Bacteria 2806
367 Ga0075428_100006386 3300006844 Bacteria 13120
368 Ga0075428_100007219 3300006844 Bacteria 12306
369 Ga0075428_100034567 3300006844 Bacteria 5574
370 Ga0075428_100147056 3300006844 Bacteria 2561
371 Ga0075430_100002239 3300006846 Bacteria 16031
372 Ga0075430_100023975 3300006846 Bacteria 5196
373 Ga0075430_100176196 3300006846 Bacteria 1779
374 Ga0075431_100001153 3300006847 Bacteria 23746
375 Ga0075431_100020409 3300006847 Bacteria 6770
376 Ga0075433_10000204 3300006852 Bacteria 33250
377 Ga0075433_10031796 3300006852 Bacteria 4515
378 Ga0075433_10094046 3300006852 Bacteria 2652
379 Ga0075433_10182634 3300006852 Bacteria 1866
380 Ga0075433_10330472 3300006852 Bacteria 1348
381 Ga0075434_100000087 3300006871 Bacteria 50514
382 Ga0075434_100015527 3300006871 Bacteria 7307
383 Ga0075434_100037402 3300006871 Bacteria 4805
384 Ga0075434_100051482 3300006871 Bacteria 4093
385 Ga0075434_100152994 3300006871 Bacteria 2327
386 Ga0075434_100446672 3300006871 Unclassified 1314
387 Ga0075429_100020579 3300006880 Bacteria 5726
388 Ga0075429_100029634 3300006880 Bacteria 4753
389 Ga0075429_100333547 3300006880 Bacteria 1327
390 Ga0068865_100000910 3300006881 Bacteria 16760
391 Ga0068865_100011767 3300006881 Bacteria 5482
392 Ga0068865_100179968 3300006881 Bacteria 1627
393 Ga0068865_100181643 3300006881 Bacteria 1620
394 Ga0068865_100251991 3300006881 Bacteria 1394
395 Ga0068865_100395641 3300006881 Bacteria 1130
396 Ga0075436_100005352 3300006914 Bacteria 8832
397 Ga0075436_100022463 3300006914 Bacteria 4333
398 Ga0075436_100036527 3300006914 Bacteria 3391
399 Ga0075436_100055389 3300006914 Bacteria 2738
400 Ga0075436_100164802 3300006914 Bacteria 1563
401 Ga0075436_100282581 3300006914 Bacteria 1187
402 Ga0075436_100350458 3300006914 Bacteria 1064
403 Ga0097620_100000387 3300006931 Bacteria 43906
404 Ga0097620_100004358 3300006931 Bacteria 14441
405 Ga0097620_100023926 3300006931 Bacteria 6129
406 Ga0097620_100027047 3300006931 Bacteria 5754
407 Ga0097620_100037751 3300006931 Bacteria 4848
408 Ga0097620_100041063 3300006931 Bacteria 4647
409 Ga0097620_100253318 3300006931 Bacteria 1851
410 Ga0075435_100000998 3300007076 Bacteria 17932
411 Ga0075435_100036722 3300007076 Bacteria 3896
412 Ga0075435_100054469 3300007076 Bacteria 3228
413 Ga0075435_100155781 3300007076 Bacteria 1922
414 Ga0075435_100162334 3300007076 Bacteria 1882
415 Ga0075435_100375088 3300007076 Bacteria 1222
416 Ga0075435_100395004 3300007076 Bacteria 1189
417 Ga0099794_10132719 3300007265 Unclassified 1258
418 Ga0105251_10201596 3300009011 Bacteria 896
419 Ga0105250_10032350 3300009092 Bacteria 2100
420 Ga0105250_10041336 3300009092 Bacteria 1849
421 Ga0105240_10012519 3300009093 Bacteria 11703
422 Ga0105240_10020118 3300009093 Bacteria 8910
423 Ga0105240_10037911 3300009093 Bacteria 6189
424 Ga0105240_10051093 3300009093 Bacteria 5205
425 Ga0105240_10115812 3300009093 Bacteria 3235
426 Ga0105240_10172503 3300009093 Bacteria 2560
427 Ga0105240_10471485 3300009093 Bacteria 1401
428 Ga0111539_10005838 3300009094 Bacteria 15917
429 Ga0111539_10430493 3300009094 Bacteria 1536
430 Ga0105245_10005678 3300009098 Bacteria 10966
431 Ga0105245_10031049 3300009098 Bacteria 4725
432 Ga0105245_10053402 3300009098 Bacteria 3627
433 Ga0105245_10090127 3300009098 Bacteria 2820
434 Ga0105245_10164828 3300009098 Bacteria 2106
435 Ga0105247_10000753 3300009101 Bacteria 25022
436 Ga0105247_10592189 3300009101 Bacteria 821
437 Ga0114129_10061315 3300009147 Bacteria 5256
438 Ga0114129_10229914 3300009147 Bacteria 2498
439 Ga0114129_10256529 3300009147 Bacteria 2345
440 Ga0114129_10261688 3300009147 Bacteria 2318
441 Ga0114129_10324303 3300009147 Unclassified 2047
442 Ga0105241_10000531 3300009174 Bacteria 28727
443 Ga0105241_10007497 3300009174 Bacteria 8028
444 Ga0105241_10019849 3300009174 Bacteria 4960
445 Ga0105241_10074453 3300009174 Bacteria 2644
446 Ga0105241_10099982 3300009174 Bacteria 2304
447 Ga0105241_10103880 3300009174 Bacteria 2263
448 Ga0105242_10018075 3300009176 Bacteria 5506
449 Ga0105242_10131051 3300009176 Bacteria 2164
450 Ga0105242_10235803 3300009176 Bacteria 1642
451 Ga0105242_10287755 3300009176 Bacteria 1495
452 Ga0105248_10007875 3300009177 Bacteria 11702
453 Ga0105248_10013270 3300009177 Bacteria 9069
454 Ga0105248_10064217 3300009177 Bacteria 4122
455 Ga0105248_10064364 3300009177 Bacteria 4117
456 Ga0105248_10108048 3300009177 Bacteria 3137
457 Ga0105248_10191238 3300009177 Bacteria 2306
458 Ga0105248_10296484 3300009177 Bacteria 1821
459 Ga0105237_10023574 3300009545 Bacteria 6304
460 Ga0105237_10085811 3300009545 Bacteria 3138
461 Ga0105237_10160383 3300009545 Bacteria 2247
462 Ga0105237_10288662 3300009545 Bacteria 1643
463 Ga0105238_10000250 3300009551 Bacteria 60084
464 Ga0105238_10025900 3300009551 Bacteria 5979
465 Ga0105238_10060143 3300009551 Bacteria 3805
466 Ga0105238_10242972 3300009551 Bacteria 1778
467 Ga0105238_10251455 3300009551 Bacteria 1746
468 Ga0105238_10366792 3300009551 Bacteria 1430
469 Ga0105249_10015751 3300009553 Bacteria 6697
470 Ga0105249_10023639 3300009553 Bacteria 5517
471 Ga0105249_10048315 3300009553 Bacteria 3880
472 Ga0105249_10067209 3300009553 Bacteria 3302
473 Ga0099796_10030414 3300010159 Bacteria 1752
474 Ga0099796_10055868 3300010159 Bacteria 1384
475 Ga0105239_10001966 3300010375 Bacteria 26740
476 Ga0105239_10006192 3300010375 Bacteria 13922
477 Ga0105239_10025161 3300010375 Bacteria 6556
478 Ga0105239_10061859 3300010375 Bacteria 4109
479 Ga0105239_10091485 3300010375 Bacteria 3357
480 Ga0105239_10134708 3300010375 Bacteria 2750
481 Ga0105239_10689869 3300010375 Bacteria 1167
482 Ga0105239_11121319 3300010375 Bacteria 906
483 Ga0105246_10002717 3300011119 Bacteria 10699
484 Ga0105246_10041738 3300011119 Bacteria 3102
485 Ga0105246_10368912 3300011119 Bacteria 1182
486 Ga0105246_10532008 3300011119 Bacteria 1004
487 Ga0105246_10569065 3300011119 Bacteria 974
488 Ga0157373_10025425 3300013100 Bacteria 4283
489 Ga0157373_10036029 3300013100 Bacteria 3551
490 Ga0157373_10096437 3300013100 Bacteria 2082
491 Ga0157371_10039015 3300013102 Bacteria 3397
492 Ga0157371_10041241 3300013102 Bacteria 3294
493 Ga0157371_10048470 3300013102 Bacteria 3020
494 Ga0157369_10000689 3300013105 Bacteria 43705
495 Ga0157369_10018965 3300013105 Bacteria 7704
496 Ga0157369_10021271 3300013105 Bacteria 7255
497 Ga0157369_10023337 3300013105 Bacteria 6891
498 Ga0157369_10037172 3300013105 Bacteria 5331
499 Ga0157369_10078173 3300013105 Bacteria 3545
500 Ga0157369_10087366 3300013105 Bacteria 3329
501 Ga0157369_10347522 3300013105 Bacteria 1541
502 Ga0157369_10513613 3300013105 Bacteria 1239
503 Ga0157374_10000191 3300013296 Bacteria 56852
504 Ga0157374_10002601 3300013296 Bacteria 15215
505 Ga0157374_10006970 3300013296 Bacteria 9619
506 Ga0157374_10012721 3300013296 Bacteria 7331
507 Ga0157374_10067693 3300013296 Bacteria 3358
508 Ga0157374_10116125 3300013296 Bacteria 2578
509 Ga0157378_10000008 3300013297 Bacteria 162605
510 Ga0157378_10000062 3300013297 Bacteria 94916
511 Ga0157378_10000287 3300013297 Bacteria 49194
512 Ga0157378_10176768 3300013297 Bacteria 2006
513 Ga0157378_10268939 3300013297 Bacteria 1639
514 Ga0163162_10020552 3300013306 Bacteria 6487
515 Ga0163162_10026539 3300013306 Bacteria 5725
516 Ga0163162_10036011 3300013306 Bacteria 4930
517 Ga0163162_10092874 3300013306 Bacteria 3102
518 Ga0163162_10291008 3300013306 Bacteria 1765
519 Ga0163162_10320781 3300013306 Bacteria 1682
520 Ga0163162_10707509 3300013306 Bacteria 1129
521 Ga0157372_10001774 3300013307 Bacteria 23407
522 Ga0157372_10002883 3300013307 Bacteria 18597
523 Ga0157372_10002972 3300013307 Bacteria 18262
524 Ga0157372_10003471 3300013307 Bacteria 17006
525 Ga0157372_10004519 3300013307 Bacteria 14837
526 Ga0157372_10011058 3300013307 Bacteria 9603
527 Ga0157372_10029167 3300013307 Bacteria 6022
528 Ga0157372_10038318 3300013307 Bacteria 5290
529 Ga0157372_10038564 3300013307 Bacteria 5273
530 Ga0157372_10070632 3300013307 Bacteria 3930
531 Ga0157372_10112960 3300013307 Bacteria 3113
532 Ga0157372_10177521 3300013307 Bacteria 2465
533 Ga0157372_10197665 3300013307 Bacteria 2329
534 Ga0157372_10350131 3300013307 Bacteria 1721
535 Ga0157372_10380198 3300013307 Bacteria 1645
536 Ga0157372_10785166 3300013307 Bacteria 1107
537 Ga0157375_10120448 3300013308 Bacteria 2733
538 Ga0157375_10232182 3300013308 Bacteria 2004
539 Ga0163163_10002286 3300014325 Bacteria 16164
540 Ga0163163_10004472 3300014325 Bacteria 11925
541 Ga0163163_10020482 3300014325 Bacteria 6229
542 Ga0163163_10027815 3300014325 Bacteria 5422
543 Ga0163163_10135562 3300014325 Bacteria 2503
544 Ga0163163_10168149 3300014325 Bacteria 2239
545 Ga0163163_10321966 3300014325 Bacteria 1600
546 Ga0163163_10806172 3300014325 Bacteria 1002
547 Ga0157380_10015991 3300014326 Bacteria 5524
548 Ga0182008_10026785 3300014497 Bacteria 2923
549 Ga0182008_10075758 3300014497 Bacteria 1655
550 Ga0157377_10000776 3300014745 Bacteria 13236
551 Ga0157379_10000722 3300014968 Bacteria 26745
552 Ga0157379_10005070 3300014968 Bacteria 11291
553 Ga0157379_10005265 3300014968 Bacteria 11106
554 Ga0157379_10044427 3300014968 Bacteria 3966
555 Ga0157379_10262031 3300014968 Bacteria 1571
556 Ga0157376_10005118 3300014969 Bacteria 9140
557 Ga0157376_10014704 3300014969 Bacteria 5885
558 Ga0157376_10046492 3300014969 Bacteria 3579
559 Ga0157376_10059573 3300014969 Bacteria 3201
560 Ga0157376_10508654 3300014969 Bacteria 1185
561 Ga0182006_1032196 3300015261 Bacteria 2109
562 Ga0182006_1072375 3300015261 Bacteria 1275
563 Ga0182007_10014680 3300015262 Bacteria 2945
564 Ga0182005_1032302 3300015265 Bacteria 1425
565 Ga0163161_10001844 3300017792 Bacteria 15479
566 Ga0184602_105132 3300019161 Bacteria 892
567 Ga0184593_107928 3300019179 Bacteria 786
568 Ga0184599_138199 3300019188 Bacteria 1002
569 Ga0197907_10754001 3300020069 Bacteria 937
570 Ga0206356_10381687 3300020070 Bacteria 954
571 Ga0206352_10343359 3300020078 Bacteria 973
572 Ga0206350_10082148 3300020080 Bacteria 1022
573 Ga0206350_11323507 3300020080 Bacteria 1115
574 Ga0206353_10259220 3300020082 Bacteria 1140
575 Ga0213871_10097178 3300021441 Bacteria 859
576 Ga0224570_100013 3300022730 Bacteria 7591
577 Ga0224569_100722 3300022732 Bacteria 2830
578 Ga0224569_100768 3300022732 Bacteria 2730
579 Ga0224571_100004 3300022734 Bacteria 7390
580 Ga0224572_1003750 3300024225 Bacteria 2591
581 Ga0224572_1004024 3300024225 Bacteria 2527
582 Ga0224572_1006556 3300024225 Bacteria 2108
583 Ga0224572_1013023 3300024225 Bacteria 1585
584 Ga0228598_1003345 3300024227 Bacteria 3453
585 Ga0228598_1004635 3300024227 Bacteria 2909
586 Ga0228598_1004977 3300024227 Bacteria 2794
587 Ga0207673_1007220 3300025290 Bacteria 1389
588 Ga0207697_10002261 3300025315 Bacteria 10068
589 Ga0207697_10007162 3300025315 Bacteria 4990
590 Ga0207656_10039757 3300025321 Bacteria 1991
591 Ga0207656_10095888 3300025321 Bacteria 1353
592 Ga0207656_10156376 3300025321 Bacteria 1082
593 Ga0207653_10073310 3300025885 Bacteria 1173
594 Ga0207692_10011687 3300025898 Bacteria 3747
595 Ga0207692_10042333 3300025898 Bacteria 2260
596 Ga0207692_10097537 3300025898 Bacteria 1607
597 Ga0207692_10137597 3300025898 Bacteria 1386
598 Ga0207692_10162033 3300025898 Unclassified 1290
599 Ga0207692_10168678 3300025898 Bacteria 1267
600 Ga0207692_10215495 3300025898 Bacteria 1136
601 Ga0207692_10238970 3300025898 Bacteria 1084
602 Ga0207642_10022708 3300025899 Bacteria 2494
603 Ga0207710_10019482 3300025900 Bacteria 2895
604 Ga0207688_10028227 3300025901 Bacteria 3088
605 Ga0207688_10033550 3300025901 Bacteria 2840
606 Ga0207688_10036273 3300025901 Bacteria 2733
607 Ga0207680_10005621 3300025903 Bacteria 6000
608 Ga0207680_10276100 3300025903 Bacteria 1166
609 Ga0207647_10002682 3300025904 Bacteria 13425
610 Ga0207647_10019793 3300025904 Bacteria 4520
611 Ga0207647_10115782 3300025904 Bacteria 1583
612 Ga0207685_10083051 3300025905 Bacteria 1330
613 Ga0207685_10165171 3300025905 Bacteria 1014
614 Ga0207699_10001688 3300025906 Bacteria 10446
615 Ga0207699_10012342 3300025906 Bacteria 4344
616 Ga0207699_10022886 3300025906 Bacteria 3393
617 Ga0207699_10024088 3300025906 Bacteria 3323
618 Ga0207699_10033756 3300025906 Bacteria 2895
619 Ga0207699_10050567 3300025906 Bacteria 2452
620 Ga0207699_10102815 3300025906 Bacteria 1816
621 Ga0207699_10118582 3300025906 Unclassified 1708
622 Ga0207699_10263143 3300025906 Bacteria 1193
623 Ga0207699_10319705 3300025906 Bacteria 1088
624 Ga0207645_10000029 3300025907 Bacteria 93895
625 Ga0207645_10013554 3300025907 Bacteria 5490
626 Ga0207643_10000849 3300025908 Bacteria 18535
627 Ga0207643_10115483 3300025908 Bacteria 1585
628 Ga0207643_10131793 3300025908 Bacteria 1488
629 Ga0207643_10143727 3300025908 Bacteria 1426
630 Ga0207684_10002600 3300025910 Bacteria 18063
631 Ga0207684_10003875 3300025910 Bacteria 14361
632 Ga0207684_10028537 3300025910 Bacteria 4754
633 Ga0207684_10087320 3300025910 Bacteria 2657
634 Ga0207684_10121838 3300025910 Bacteria 2236
635 Ga0207684_10132804 3300025910 Bacteria 2137
636 Ga0207684_10182120 3300025910 Bacteria 1812
637 Ga0207654_10044642 3300025911 Bacteria 2519
638 Ga0207654_10198613 3300025911 Unclassified 1319
639 Ga0207707_10000530 3300025912 Bacteria 39027
640 Ga0207707_10016370 3300025912 Bacteria 6467
641 Ga0207707_10026910 3300025912 Bacteria 5027
642 Ga0207707_10136750 3300025912 Bacteria 2142
643 Ga0207695_10000002 3300025913 Bacteria 2188391
644 Ga0207695_10004905 3300025913 Bacteria 18026
645 Ga0207695_10027014 3300025913 Bacteria 6395
646 Ga0207695_10080160 3300025913 Bacteria 3307
647 Ga0207695_10173127 3300025913 Bacteria 2083
648 Ga0207695_10553203 3300025913 Bacteria 1032
649 Ga0207671_10033268 3300025914 Bacteria 3836
650 Ga0207671_10036064 3300025914 Bacteria 3667
651 Ga0207671_10179158 3300025914 Bacteria 1649
652 Ga0207671_10179638 3300025914 Bacteria 1646
653 Ga0207693_10000004 3300025915 Bacteria 193261
654 Ga0207693_10000020 3300025915 Bacteria 132847
655 Ga0207693_10000661 3300025915 Bacteria 30947
656 Ga0207693_10001443 3300025915 Bacteria 21031
657 Ga0207693_10001883 3300025915 Bacteria 18348
658 Ga0207693_10002150 3300025915 Bacteria 17198
659 Ga0207693_10016761 3300025915 Bacteria 5852
660 Ga0207693_10084490 3300025915 Bacteria 2487
661 Ga0207693_10308929 3300025915 Bacteria 1238
662 Ga0207663_10003220 3300025916 Bacteria 7953
663 Ga0207663_10009282 3300025916 Bacteria 5189
664 Ga0207663_10011479 3300025916 Bacteria 4755
665 Ga0207663_10035458 3300025916 Bacteria 2993
666 Ga0207663_10235189 3300025916 Bacteria 1341
667 Ga0207663_10344738 3300025916 Bacteria 1126
668 Ga0207663_10415553 3300025916 Bacteria 1031
669 Ga0207663_10547985 3300025916 Bacteria 904
670 Ga0207660_10227607 3300025917 Bacteria 1465
671 Ga0207662_10007437 3300025918 Bacteria 5966
672 Ga0207657_10002176 3300025919 Bacteria 21235
673 Ga0207657_10003333 3300025919 Bacteria 17171
674 Ga0207657_10005136 3300025919 Bacteria 13721
675 Ga0207649_10001516 3300025920 Bacteria 13637
676 Ga0207649_10068199 3300025920 Bacteria 2261
677 Ga0207649_10504032 3300025920 Bacteria 921
678 Ga0207652_10046581 3300025921 Bacteria 3700
679 Ga0207652_10138568 3300025921 Bacteria 2174
680 Ga0207652_10500403 3300025921 Bacteria 1094
681 Ga0207646_10000616 3300025922 Bacteria 46319
682 Ga0207646_10000808 3300025922 Bacteria 40751
683 Ga0207646_10020426 3300025922 Bacteria 6135
684 Ga0207646_10051322 3300025922 Bacteria 3691
685 Ga0207646_10151318 3300025922 Bacteria 2093
686 Ga0207681_10027636 3300025923 Bacteria 3670
687 Ga0207681_10044206 3300025923 Bacteria 2984
688 Ga0207681_10060531 3300025923 Bacteria 2599
689 Ga0207694_10000214 3300025924 Bacteria 56464
690 Ga0207694_10014820 3300025924 Bacteria 5878
691 Ga0207694_10175180 3300025924 Bacteria 1738
692 Ga0207650_10000040 3300025925 Bacteria 204095
693 Ga0207650_10110179 3300025925 Bacteria 2130
694 Ga0207650_10581527 3300025925 Bacteria 941
695 Ga0207659_10005511 3300025926 Bacteria 7680
696 Ga0207659_10015756 3300025926 Bacteria 4908
697 Ga0207659_10079511 3300025926 Bacteria 2419
698 Ga0207687_10027683 3300025927 Bacteria 3804
699 Ga0207687_10045809 3300025927 Bacteria 3025
700 Ga0207687_10048001 3300025927 Bacteria 2962
701 Ga0207687_10115298 3300025927 Bacteria 2001
702 Ga0207687_10303522 3300025927 Bacteria 1287
703 Ga0207700_10000612 3300025928 Bacteria 20890
704 Ga0207700_10010985 3300025928 Bacteria 5751
705 Ga0207700_10014531 3300025928 Bacteria 5161
706 Ga0207700_10028527 3300025928 Bacteria 3925
707 Ga0207700_10029257 3300025928 Bacteria 3885
708 Ga0207700_10053575 3300025928 Bacteria 3024
709 Ga0207700_10059358 3300025928 Bacteria 2893
710 Ga0207700_10108948 3300025928 Bacteria 2225
711 Ga0207700_10131329 3300025928 Bacteria 2045
712 Ga0207700_10460847 3300025928 Unclassified 1121
713 Ga0207700_10649509 3300025928 Bacteria 940
714 Ga0207664_10002204 3300025929 Bacteria 12838
715 Ga0207664_10006636 3300025929 Bacteria 7971
716 Ga0207664_10006733 3300025929 Bacteria 7935
717 Ga0207664_10009766 3300025929 Bacteria 6751
718 Ga0207664_10028457 3300025929 Bacteria 4247
719 Ga0207664_10055867 3300025929 Bacteria 3134
720 Ga0207664_10056304 3300025929 Bacteria 3123
721 Ga0207664_10150079 3300025929 Bacteria 1979
722 Ga0207664_10818358 3300025929 Bacteria 838
723 Ga0207644_10008631 3300025931 Bacteria 6667
724 Ga0207644_10294183 3300025931 Bacteria 1307
725 Ga0207644_10353223 3300025931 Bacteria 1194
726 Ga0207644_10431242 3300025931 Bacteria 1081
727 Ga0207644_10575847 3300025931 Bacteria 933
728 Ga0207690_10066617 3300025932 Bacteria 2467
729 Ga0207690_10288171 3300025932 Bacteria 1281
730 Ga0207690_10341879 3300025932 Bacteria 1181
731 Ga0207690_10349202 3300025932 Bacteria 1169
732 Ga0207706_10000772 3300025933 Bacteria 33223
733 Ga0207706_10001546 3300025933 Bacteria 22782
734 Ga0207706_10005517 3300025933 Bacteria 11795
735 Ga0207706_10091092 3300025933 Bacteria 2681
736 Ga0207706_10114183 3300025933 Bacteria 2376
737 Ga0207706_10228531 3300025933 Bacteria 1628
738 Ga0207706_10301720 3300025933 Bacteria 1395
739 Ga0207686_10040379 3300025934 Bacteria 2836
740 Ga0207686_10043467 3300025934 Bacteria 2753
741 Ga0207686_10100478 3300025934 Bacteria 1930
742 Ga0207686_10185082 3300025934 Bacteria 1480
743 Ga0207686_10196924 3300025934 Bacteria 1440
744 Ga0207709_10097174 3300025935 Bacteria 1939
745 Ga0207670_10001487 3300025936 Bacteria 12311
746 Ga0207670_10057297 3300025936 Bacteria 2642
747 Ga0207670_10156792 3300025936 Bacteria 1695
748 Ga0207670_10435044 3300025936 Bacteria 1055
749 Ga0207669_10493664 3300025937 Bacteria 978
750 Ga0207704_10013557 3300025938 Bacteria 4084
751 Ga0207704_10030875 3300025938 Bacteria 3011
752 Ga0207704_10040152 3300025938 Bacteria 2732
753 Ga0207704_10060923 3300025938 Bacteria 2338
754 Ga0207665_10000225 3300025939 Bacteria 38534
755 Ga0207665_10001512 3300025939 Bacteria 15655
756 Ga0207665_10003927 3300025939 Bacteria 9954
757 Ga0207665_10011504 3300025939 Bacteria 5812
758 Ga0207665_10015155 3300025939 Bacteria 5063
759 Ga0207665_10019554 3300025939 Bacteria 4453
760 Ga0207665_10021981 3300025939 Bacteria 4194
761 Ga0207665_10025473 3300025939 Bacteria 3903
762 Ga0207665_10040011 3300025939 Bacteria 3126
763 Ga0207665_10057315 3300025939 Bacteria 2631
764 Ga0207665_10136930 3300025939 Bacteria 1743
765 Ga0207691_10001145 3300025940 Bacteria 26300
766 Ga0207691_10006666 3300025940 Bacteria 11139
767 Ga0207691_10031735 3300025940 Bacteria 4929
768 Ga0207711_10005418 3300025941 Bacteria 10791
769 Ga0207711_10006426 3300025941 Bacteria 9903
770 Ga0207711_10006792 3300025941 Bacteria 9614
771 Ga0207711_10210751 3300025941 Bacteria 1775
772 Ga0207689_10000172 3300025942 Bacteria 56576
773 Ga0207689_10000901 3300025942 Bacteria 28528
774 Ga0207689_10011863 3300025942 Bacteria 7466
775 Ga0207689_10087853 3300025942 Bacteria 2554
776 Ga0207689_10117329 3300025942 Bacteria 2188
777 Ga0207661_10000473 3300025944 Bacteria 25981
778 Ga0207661_10117176 3300025944 Bacteria 2262
779 Ga0207661_10219070 3300025944 Bacteria 1681
780 Ga0207661_10245681 3300025944 Bacteria 1589
781 Ga0207679_10000589 3300025945 Bacteria 24324
782 Ga0207679_10011939 3300025945 Bacteria 5645
783 Ga0207679_10082677 3300025945 Bacteria 2459
784 Ga0207667_10000831 3300025949 Bacteria 39949
785 Ga0207667_10007058 3300025949 Bacteria 13573
786 Ga0207667_10016833 3300025949 Bacteria 8247
787 Ga0207667_10031853 3300025949 Bacteria 5687
788 Ga0207667_10108761 3300025949 Bacteria 2860
789 Ga0207667_10227911 3300025949 Bacteria 1908
790 Ga0207667_10235920 3300025949 Bacteria 1872
791 Ga0207651_10005334 3300025960 Bacteria 6589
792 Ga0207651_10017894 3300025960 Bacteria 4200
793 Ga0207712_10070587 3300025961 Bacteria 2510
794 Ga0207712_10514847 3300025961 Bacteria 1024
795 Ga0207668_10009786 3300025972 Bacteria 5759
796 Ga0207640_10005562 3300025981 Bacteria 6867
797 Ga0207640_10027105 3300025981 Bacteria 3488
798 Ga0207640_10052731 3300025981 Bacteria 2651
799 Ga0207640_10246959 3300025981 Bacteria 1383
800 Ga0207640_10437518 3300025981 Bacteria 1074
801 Ga0207658_10003758 3300025986 Bacteria 10690
802 Ga0207658_10061928 3300025986 Bacteria 2798
803 Ga0207658_10377718 3300025986 Bacteria 1240
804 Ga0207677_10019318 3300026023 Bacteria 4113
805 Ga0207677_10025139 3300026023 Bacteria 3711
806 Ga0207677_10037172 3300026023 Bacteria 3180
807 Ga0207677_10059807 3300026023 Bacteria 2630
808 Ga0207677_10092490 3300026023 Bacteria 2202
809 Ga0207677_10253249 3300026023 Bacteria 1431
810 Ga0207677_10253395 3300026023 Bacteria 1431
811 Ga0207677_10293224 3300026023 Bacteria 1341
812 Ga0207703_10003403 3300026035 Bacteria 13357
813 Ga0207703_10005448 3300026035 Bacteria 10237
814 Ga0207703_10007660 3300026035 Bacteria 8555
815 Ga0207703_10015524 3300026035 Bacteria 5938
816 Ga0207703_10040284 3300026035 Bacteria 3738
817 Ga0207703_10048479 3300026035 Bacteria 3430
818 Ga0207703_10109875 3300026035 Bacteria 2351
819 Ga0207703_10152044 3300026035 Bacteria 2019
820 Ga0207703_10171779 3300026035 Bacteria 1907
821 Ga0207639_10007330 3300026041 Bacteria 7515
822 Ga0207639_10015004 3300026041 Bacteria 5458
823 Ga0207639_10103826 3300026041 Bacteria 2303
824 Ga0207639_10252017 3300026041 Bacteria 1540
825 Ga0207678_10005528 3300026067 Bacteria 11292
826 Ga0207678_10028270 3300026067 Bacteria 4896
827 Ga0207678_10518185 3300026067 Bacteria 1040
828 Ga0207708_10343147 3300026075 Bacteria 1224
829 Ga0207702_10000144 3300026078 Bacteria 84274
830 Ga0207702_10001499 3300026078 Bacteria 23079
831 Ga0207702_10001741 3300026078 Bacteria 21398
832 Ga0207702_10008844 3300026078 Bacteria 8487
833 Ga0207702_10016915 3300026078 Bacteria 6036
834 Ga0207702_10051114 3300026078 Bacteria 3492
835 Ga0207702_10186408 3300026078 Bacteria 1914
836 Ga0207702_10201911 3300026078 Bacteria 1843
837 Ga0207702_10290846 3300026078 Bacteria 1548
838 Ga0207641_10000009 3300026088 Bacteria 407901
839 Ga0207641_10007029 3300026088 Bacteria 9407
840 Ga0207641_10007254 3300026088 Bacteria 9237
841 Ga0207641_10041904 3300026088 Bacteria 3839
842 Ga0207641_10066636 3300026088 Bacteria 3082
843 Ga0207641_10217239 3300026088 Bacteria 1771
844 Ga0207641_10307570 3300026088 Bacteria 1499
845 Ga0207641_10697234 3300026088 Bacteria 1000
846 Ga0207648_10001815 3300026089 Bacteria 23381
847 Ga0207648_10016621 3300026089 Bacteria 6716
848 Ga0207648_10019319 3300026089 Bacteria 6150
849 Ga0207648_10045918 3300026089 Bacteria 3830
850 Ga0207676_10000058 3300026095 Bacteria 120315
851 Ga0207676_10007437 3300026095 Bacteria 7769
852 Ga0207676_10013065 3300026095 Bacteria 5960
853 Ga0207676_10042062 3300026095 Bacteria 3513
854 Ga0207676_10090060 3300026095 Bacteria 2516
855 Ga0207676_10131936 3300026095 Bacteria 2125
856 Ga0207676_10315979 3300026095 Bacteria 1432
857 Ga0207676_10695733 3300026095 Bacteria 984
858 Ga0207674_10000148 3300026116 Bacteria 82478
859 Ga0207674_10000502 3300026116 Bacteria 51641
860 Ga0207674_10014801 3300026116 Bacteria 8603
861 Ga0207674_10024305 3300026116 Bacteria 6478
862 Ga0207674_10296247 3300026116 Bacteria 1566
863 Ga0207674_10367695 3300026116 Bacteria 1390
864 Ga0207675_100025620 3300026118 Bacteria 5489
865 Ga0207675_100330191 3300026118 Bacteria 1491
866 Ga0207683_10000583 3300026121 Bacteria 33700
867 Ga0207683_10052243 3300026121 Bacteria 3580
868 Ga0207683_10093630 3300026121 Bacteria 2677
869 Ga0207683_10124618 3300026121 Bacteria 2315
870 Ga0207683_10342501 3300026121 Bacteria 1371
871 Ga0207698_10007476 3300026142 Bacteria 6845
872 Ga0209813_10009277 3300027866 Bacteria 2511
873 Ga0209974_10094569 3300027876 Bacteria 1039
874 Ga0265354_1003258 3300028016 Bacteria 1841
875 Ga0265356_1001153 3300028017 Bacteria 4066
876 Ga0265356_1001408 3300028017 Unclassified 3591
877 Ga0265355_1000181 3300028036 Bacteria 2745
878 Ga0268266_10005737 3300028379 Bacteria 11498
879 Ga0268266_10028663 3300028379 Bacteria 4732
880 Ga0268266_10029474 3300028379 Bacteria 4665
881 Ga0268266_10205250 3300028379 Bacteria 1805
882 Ga0268265_10009233 3300028380 Bacteria 6665
883 Ga0268265_10034076 3300028380 Bacteria 3709
884 Ga0268265_10049467 3300028380 Bacteria 3162
885 Ga0268264_10006002 3300028381 Bacteria 10280
886 Ga0268264_10026333 3300028381 Bacteria 4751
887 Ga0268264_10120186 3300028381 Bacteria 2314
888 Ga0268264_10155949 3300028381 Bacteria 2052
889 Ga0265338_10008589 3300028800 Bacteria 12357
890 Ga0265338_10063210 3300028800 Bacteria 3229
891 Ga0265338_10103214 3300028800 Bacteria 2317
892 Ga0265338_10258734 3300028800 Bacteria 1280
893 Ga0265338_10261404 3300028800 Bacteria 1272
894 Ga0265762_1000159 3300030760 Bacteria 10581
895 Ga0265762_1002311 3300030760 Bacteria 3445
896 Ga0265762_1003504 3300030760 Bacteria 2812
897 Ga0265762_1005003 3300030760 Bacteria 2375
898 Ga0265760_10000921 3300031090 Bacteria 8485
899 Ga0265760_10001324 3300031090 Bacteria 7256
900 Ga0265760_10003690 3300031090 Bacteria 4437
901 Ga0265760_10012255 3300031090 Bacteria 2450
902 Ga0265760_10082083 3300031090 Bacteria 1000
903 Ga0265325_10013871 3300031241 Bacteria 4574
904 Ga0265325_10017491 3300031241 Bacteria 3982
905 Ga0265325_10020170 3300031241 Bacteria 3677
906 Ga0265340_10013022 3300031247 Bacteria 4381
907 Ga0265340_10032310 3300031247 Bacteria 2613
908 Ga0265339_10023638 3300031249 Bacteria 3551
909 Ga0265339_10129145 3300031249 Bacteria 1294
910 Ga0265316_10013627 3300031344 Bacteria 7214
911 Ga0265316_10025647 3300031344 Bacteria 4916
912 Ga0265316_10363395 3300031344 Bacteria 1046
913 Ga0307408_100398522 3300031548 Bacteria 1181
914 Ga0265314_10019406 3300031711 Bacteria 5268
915 Ga0265342_10056158 3300031712 Bacteria 2335
916 Ga0265342_10134495 3300031712 Unclassified 1383
917 Ga0265342_10143944 3300031712 Bacteria 1328
918 Ga0316053_103904 3300032120 Bacteria 901
919 Ga0316053_104464 3300032120 Bacteria 863
920 Ga0316212_1003456 3300033547 Bacteria 2282
921 Ga0316212_1012921 3300033547 Bacteria 1186
922 Ga0373958_0024502 3300034819 Bacteria 1143
923 Ga0373959_0020074 3300034820 Bacteria 1272
924 Ga0373926_0003092 3300035083 Bacteria 5345
925 Ga0373926_0055846 3300035083 Bacteria 1432
926 Ga0373928_0035941 3300035084 Bacteria 1118
927 Ga0373929_0005095 3300035085 Bacteria 2362
928 Ga0373934_0025447 3300035086 Bacteria 2292
929 Ga0373934_0088684 3300035086 Bacteria 1246
930 Ga0373949_0093217 3300035090 Bacteria 817
931 Ga0373923_0003933 3300035111 Bacteria 4851
932 Ga0373923_0052149 3300035111 Bacteria 1718
933 Ga0373932_0013016 3300035112 Bacteria 2061
934 Ga0373936_0000856 3300035113 Bacteria 10848
935 Ga0373936_0145327 3300035113 Bacteria 1026
936 Ga0373945_0001747 3300035116 Bacteria 6711
937 Ga0373945_0019786 3300035116 Bacteria 2299
938 Ga0373945_0148076 3300035116 Bacteria 950
939 Ga0373953_0028613 3300035117 Bacteria 2150
940 Ga0373960_0039476 3300035121 Bacteria 1358
941 Ga0373943_0000085 3300035170 Bacteria 33641
942 Ga0373943_0010631 3300035170 Bacteria 4130
943 Ga0373943_0059566 3300035170 Bacteria 1903
944 Ga0373943_0083371 3300035170 Bacteria 1643
945 Ga0373943_0145244 3300035170 Bacteria 1281
946 Ga0373946_0001570 3300035171 Bacteria 7957
947 Ga0373946_0009592 3300035171 Bacteria 3570
948 Ga0373955_0159611 3300035172 Bacteria 1330
949 Ga0373924_0022698 3300035410 Bacteria 2455
950 Ga0373924_0030321 3300035410 Bacteria 2167
951 Ga0373931_0006883 3300035691 Bacteria 5346
952 Ga0373935_0002799 3300035692 Bacteria 10040
953 Ga0373935_0004868 3300035692 Bacteria 7890
954 Ga0373935_0060654 3300035692 Bacteria 2420
955 Ga0373927_0001082 3300035695 Bacteria 20747
956 Ga0373927_0009002 3300035695 Bacteria 6702
957 Ga0373927_0340936 3300035695 Bacteria 987
958 Ga0373927_0396530 3300035695 Bacteria 910
959 Ga0373933_0068157 3300035724 Bacteria 2161
960 Ga0373933_0230341 3300035724 Bacteria 1190
961 Ga0373947_0001814 3300035725 Bacteria 13066
962 Ga0373947_0003319 3300035725 Bacteria 9535
963 Ga0373947_0006598 3300035725 Bacteria 6736
964 Ga0373947_0015660 3300035725 Bacteria 4356
965 Ga0373947_0362047 3300035725 Bacteria 974
966 Ga0373937_0000258 3300036401 Bacteria 51434
967 Ga0373937_0031203 3300036401 Bacteria 4827
968 Ga0373937_0190147 3300036401 Bacteria 1929
969 Ga0373937_0248584 3300036401 Bacteria 1676
970 Ga0373925_0001131 3300037068 Bacteria 23661
971 Ga0373925_0001989 3300037068 Bacteria 16928
972 Ga0373925_0005717 3300037068 Bacteria 9244
973 Ga0373925_0053080 3300037068 Bacteria 3029
974 Ga0373925_0136730 3300037068 Bacteria 1915
975 Ga0373925_0160024 3300037068 Bacteria 1773
976 Ga0373925_0599580 3300037068 Bacteria 907
977 Ga0436364_0202456 3300037853 Bacteria 992
978 Ga0436365_0693419 3300039437 Bacteria 1158
979 Ga0436360_0344137 3300039438 Bacteria 1288
980 Ga0436360_0737451 3300039438 Bacteria 976
981 Ga0436363_0117913 3300039450 Bacteria 1125
982 Ga0436363_1636167 3300039450 Unclassified 1279
983 Ga0450894_000401 3300042131 Bacteria 7413
984 Ga0450895_000275 3300042132 Bacteria 2666
985 Ga0450896_021812 3300042133 Bacteria 942
986 Ga0451577_0278237 3300042876 Bacteria 1516
987 Ga0466966_0248923 3300044684 Bacteria 1071
988 Ga0466961_0113358 3300044693 Bacteria 1705
989 Ga0466963_0029507 3300044694 Bacteria 3532
990 Ga0466964_0168050 3300044706 Bacteria 1031
991 Ga0466957_0351766 3300044842 Bacteria 1000
992 Ga0466959_0420118 3300045049 Bacteria 908
993 Ga0451576_0057623 3300045051 Bacteria 4061
994 Ga0451576_0141726 3300045051 Bacteria 2506
995 Ga0451576_0145628 3300045051 Bacteria 2470
996 Ga0451576_1170915 3300045051 Bacteria 803
997 Ga0466967_0001105 3300045976 Bacteria 14956
998 Ga0466967_0027163 3300045976 Bacteria 4758
999 Ga0466967_0085386 3300045976 Bacteria 2858
1000 Ga0466967_0130750 3300045976 Bacteria 2330
1001 Ga0495592_0148988 3300046454 Bacteria 1620
1002 Ga0495603_0096726 3300046455 Bacteria 1725
1003 Ga0495629_0142814 3300046459 Bacteria 1665
1004 Ga0495653_0108576 3300046463 Bacteria 1998
1005 Ga0495580_0000196 3300046472 Bacteria 46289
1006 Ga0495580_0000263 3300046472 Bacteria 42063
1007 Ga0495580_0001147 3300046472 Bacteria 23331
1008 Ga0495580_0002001 3300046472 Bacteria 17936
1009 Ga0495580_0009505 3300046472 Bacteria 7642
1010 Ga0495580_0019453 3300046472 Bacteria 5045
1011 Ga0495580_0020172 3300046472 Bacteria 4939
1012 Ga0495580_0028115 3300046472 Bacteria 4089
1013 Ga0495580_0049642 3300046472 Bacteria 2969
1014 Ga0495580_0152042 3300046472 Bacteria 1603
1015 Ga0495580_0214447 3300046472 Bacteria 1324
1016 Ga0495580_0312135 3300046472 Bacteria 1069
1017 Ga0495582_0001740 3300046473 Bacteria 12286
1018 Ga0495582_0006124 3300046473 Bacteria 6696
1019 Ga0495582_0041773 3300046473 Bacteria 2527
1020 Ga0495582_0064761 3300046473 Bacteria 2019
1021 Ga0495639_0103907 3300046475 Bacteria 1343
1022 Ga0495639_0136323 3300046475 Bacteria 1178
1023 Ga0495664_0171662 3300046477 Bacteria 1315
1024 Ga0495664_0196801 3300046477 Bacteria 1222
1025 Ga0495584_0028892 3300046491 Bacteria 2811
1026 Ga0495628_0095192 3300046516 Bacteria 2301
1027 Ga0495630_0002739 3300046517 Bacteria 12229
1028 Ga0495630_0048977 3300046517 Bacteria 3163
1029 Ga0495630_0054243 3300046517 Bacteria 3003
1030 Ga0495630_0177880 3300046517 Bacteria 1622
1031 Ga0495630_0223107 3300046517 Bacteria 1439
1032 Ga0495666_0102494 3300046526 Bacteria 1348
1033 Ga0495652_0402418 3300046529 Bacteria 969
1034 Ga0495665_0002409 3300046531 Bacteria 10104
1035 Ga0495665_0041622 3300046531 Bacteria 2446
1036 Ga0495665_0052317 3300046531 Bacteria 2162
1037 Ga0495586_0217608 3300046535 Bacteria 1085
1038 Ga0495645_0066613 3300046543 Bacteria 2602
1039 Ga0495635_0037309 3300046663 Bacteria 3365
1040 Ga0495635_0176563 3300046663 Bacteria 1452
1041 Ga0495635_0320851 3300046663 Bacteria 1037
1042 Ga0495659_0143338 3300046664 Bacteria 955
1043 Ga0495588_0064063 3300046674 Bacteria 1907
1044 Ga0495657_0191123 3300046675 Bacteria 1251
1045 Ga0495599_0141115 3300046678 Bacteria 1495
1046 Ga0495623_0180919 3300046679 Bacteria 1225
1047 Ga0495658_0010707 3300046683 Bacteria 4591
1048 Ga0495658_0024007 3300046683 Bacteria 3242
1049 Ga0495669_0016937 3300046684 Bacteria 3126
1050 Ga0495624_0048962 3300046690 Bacteria 2681
1051 Ga0495624_0151818 3300046690 Bacteria 1417
1052 Ga0495581_0159740 3300047315 Bacteria 1317
1053 Ga0495674_0003000 3300047319 Bacteria 16446
1054 Ga0495674_0045081 3300047319 Bacteria 3916
1055 Ga0495674_0291643 3300047319 Bacteria 1334
1056 Ga0495674_0298523 3300047319 Bacteria 1316
1057 Ga0495680_0113307 3300047322 Bacteria 2008
1058 Ga0495680_0265054 3300047322 Bacteria 1214
1059 Ga0495675_0021306 3300047444 Bacteria 4127
1060 Ga0495593_0053733 3300047673 Bacteria 2125
1061 Ga0495602_0092168 3300048088 Bacteria 2511
1062 Ga0495602_0325458 3300048088 Bacteria 1117
1063 Ga0495614_0058973 3300048089 Bacteria 1648
1064 Ga0496100_0180392 3300048903 Bacteria 1527
1065 Ga0496100_0296801 3300048903 Bacteria 1209
1066 Ga0496100_0609586 3300048903 Bacteria 848
1067 Ga0496101_0055802 3300048904 Bacteria 2855
1068 Ga0496101_0060944 3300048904 Bacteria 2739
1069 Ga0496101_0190730 3300048904 Bacteria 1582
1070 Ga0496101_0199828 3300048904 Bacteria 1545
1071 Ga0496101_0573856 3300048904 Bacteria 892
1072 Ga0496102_0001630 3300048905 Bacteria 19784
1073 Ga0496102_0264769 3300048905 Bacteria 1620
1074 Ga0496102_0373686 3300048905 Bacteria 1341
1075 Ga0496103_0025138 3300048906 Bacteria 3598
1076 Ga0496104_0050240 3300048907 Bacteria 3935
1077 Ga0496104_0077203 3300048907 Bacteria 3173
1078 Ga0496104_0154054 3300048907 Bacteria 2206
1079 Ga0496104_0203045 3300048907 Bacteria 1894
1080 Ga0496104_0353156 3300048907 Bacteria 1383
1081 Ga0496104_0364239 3300048907 Bacteria 1358
1082 Ga0496105_0015943 3300048908 Bacteria 5994
1083 Ga0496106_0112849 3300048909 Bacteria 2118
1084 Ga0496106_0133102 3300048909 Bacteria 1951
1085 Ga0496106_0313041 3300048909 Bacteria 1260
1086 Ga0496106_0348839 3300048909 Bacteria 1189
1087 Ga0496107_0155877 3300048910 Bacteria 1691
1088 Ga0496107_0161668 3300048910 Bacteria 1660
1089 Ga0496107_0302611 3300048910 Bacteria 1190
1090 Ga0496107_0303485 3300048910 Bacteria 1188
1091 Ga0496108_0000385 3300048911 Bacteria 36641
1092 Ga0496108_0302268 3300048911 Bacteria 1394
1093 Ga0496109_0000345 3300048912 Bacteria 43268
1094 Ga0496109_0001109 3300048912 Bacteria 22334
1095 Ga0496109_0516489 3300048912 Bacteria 1127
1096 Ga0496110_0002376 3300048913 Bacteria 14099
1097 Ga0496110_0012922 3300048913 Bacteria 6885
1098 Ga0496111_0006985 3300048914 Bacteria 7371
1099 Ga0496111_0028932 3300048914 Bacteria 3930
1100 Ga0496111_0052326 3300048914 Bacteria 2948
1101 Ga0496112_0000152 3300048915 Bacteria 43283
1102 Ga0496112_0001819 3300048915 Bacteria 16770
1103 Ga0496112_0002005 3300048915 Bacteria 16104
1104 Ga0496112_0009007 3300048915 Bacteria 8962
1105 Ga0496112_0032465 3300048915 Bacteria 5070
1106 Ga0496112_0577960 3300048915 Bacteria 1056
1107 Ga0496112_0584412 3300048915 Bacteria 1049
1108 Ga0496112_0671332 3300048915 Bacteria 965
1109 Ga0496113_0054669 3300048916 Bacteria 2989
1110 Ga0496113_0064928 3300048916 Bacteria 2761
1111 Ga0496113_0157577 3300048916 Bacteria 1794
1112 Ga0496113_0193836 3300048916 Bacteria 1613
1113 Ga0496114_0029533 3300048917 Bacteria 4508
1114 Ga0496114_0106637 3300048917 Bacteria 2397
1115 Ga0496114_0689735 3300048917 Bacteria 896
1116 Ga0496115_0007286 3300048918 Bacteria 8133
1117 Ga0496115_0050776 3300048918 Bacteria 3324
1118 Ga0496115_0121067 3300048918 Bacteria 2154
1119 Ga0496115_0226158 3300048918 Bacteria 1543
1120 Ga0496115_0270272 3300048918 Bacteria 1397
1121 Ga0501296_020136 3300049519 Bacteria 849
1122 Ga0501031_0002823 3300049568 Bacteria 11100
1123 Ga0501031_0058932 3300049568 Bacteria 2502
1124 Ga0501032_0008205 3300049569 Bacteria 7610
1125 Ga0501032_0024552 3300049569 Bacteria 4160
1126 Ga0501033_0001797 3300049570 Bacteria 18718
1127 Ga0501033_0020881 3300049570 Bacteria 4943
1128 Ga0501034_0005356 3300049571 Bacteria 14048
1129 Ga0501034_0029877 3300049571 Bacteria 5540
1130 Ga0501034_0072351 3300049571 Bacteria 3456
1131 Ga0501036_0005695 3300049572 Bacteria 10106
1132 Ga0501037_0001960 3300049573 Bacteria 14869
1133 Ga0501038_0063672 3300049574 Bacteria 3146
1134 Ga0501039_0024578 3300049575 Bacteria 4628
1135 Ga0501039_0035549 3300049575 Bacteria 3845
1136 Ga0501040_0015297 3300049576 Bacteria 5073
1137 Ga0501041_0176006 3300049577 Bacteria 1339
1138 Ga0501041_0235022 3300049577 Bacteria 1151
1139 Ga0501042_0031405 3300049578 Bacteria 3756
1140 Ga0501042_0119765 3300049578 Bacteria 1895
1141 Ga0501043_0013132 3300049579 Bacteria 6476
1142 Ga0501046_0023436 3300049580 Bacteria 5078
1143 Ga0501046_0366962 3300049580 Bacteria 1043
1144 Ga0501047_0071928 3300049581 Bacteria 3328
1145 Ga0501047_0208140 3300049581 Bacteria 1815
1146 Ga0501048_0004103 3300049582 Bacteria 11093
1147 Ga0501048_0008075 3300049582 Bacteria 7966
1148 Ga0501048_0178942 3300049582 Bacteria 1503
1149 Ga0501067_0001385 3300049583 Bacteria 13146
1150 Ga0501067_0166610 3300049583 Bacteria 1227
1151 Ga0501067_0287647 3300049583 Bacteria 915
1152 Ga0501067_0288597 3300049583 Bacteria 913
1153 Ga0501068_0012541 3300049584 Bacteria 4810
1154 Ga0501068_0052767 3300049584 Bacteria 2460
1155 Ga0501069_0003738 3300049585 Bacteria 7819
1156 Ga0501069_0021106 3300049585 Bacteria 3532
1157 Ga0501070_0005646 3300049586 Bacteria 10669
1158 Ga0501070_0022268 3300049586 Bacteria 5309
1159 Ga0501071_0019087 3300049587 Bacteria 4757
1160 Ga0501071_0098567 3300049587 Bacteria 2153
1161 Ga0501072_0077689 3300049588 Bacteria 2628
1162 Ga0501073_0008693 3300049589 Bacteria 7520
1163 Ga0501073_0078516 3300049589 Bacteria 2297
1164 Ga0501073_0093745 3300049589 Bacteria 2086
1165 Ga0501073_0141553 3300049589 Bacteria 1667
1166 Ga0501074_0003931 3300049590 Bacteria 10589
1167 Ga0501074_0007266 3300049590 Bacteria 8006
1168 Ga0501075_0005672 3300049591 Bacteria 8543
1169 Ga0501075_0042395 3300049591 Bacteria 3412
1170 Ga0501075_0521673 3300049591 Bacteria 906
1171 Ga0501076_0039666 3300049592 Bacteria 3698
1172 Ga0501076_0128579 3300049592 Bacteria 2053
1173 Ga0501076_0580334 3300049592 Bacteria 925
1174 Ga0501077_0160931 3300049593 Unclassified 1425
1175 Ga0501077_0354089 3300049593 Bacteria 937
1176 Ga0501079_0009681 3300049741 Bacteria 7306
1177 Ga0501079_0017966 3300049741 Bacteria 5399
1178 Ga0501079_0020511 3300049741 Bacteria 5054
1179 Ga0501079_0021979 3300049741 Bacteria 4887
1180 Ga0501080_0001466 3300049742 Bacteria 19854
1181 Ga0501080_0061022 3300049742 Bacteria 3510
1182 Ga0501080_0123925 3300049742 Bacteria 2394
1183 Ga0501080_0246226 3300049742 Bacteria 1630
1184 Ga0501080_0490783 3300049742 Bacteria 1098
1185 Ga0501081_0007223 3300049743 Bacteria 7222
1186 Ga0501081_0030520 3300049743 Bacteria 3649
1187 Ga0501081_0238632 3300049743 Bacteria 1325
1188 Ga0501083_0026727 3300049744 Bacteria 3987
1189 Ga0501083_0170013 3300049744 Bacteria 1425
1190 Ga0501083_0210876 3300049744 Bacteria 1266
1191 Ga0501035_0027160 3300049822 Bacteria 5233
1192 Ga0501035_0444311 3300049822 Bacteria 1073
1193 Ga0501035_0599613 3300049822 Bacteria 898
1194 Ga0501044_0009040 3300049823 Bacteria 10890
1195 Ga0501045_0036031 3300049824 Bacteria 3592
1196 Ga0501045_0094903 3300049824 Bacteria 2206
1197 nmdc:mga0yw44_6678_c1 3300050492 Bacteria 5600
1198 nmdc:mga0yw44_98723_c1 3300050492 Bacteria 1857
1199 nmdc:mga06z11_117204_c1 3300050494 Bacteria 1482
1200 nmdc:mga04h51_13943_c1 3300050495 Bacteria 2287
1201 nmdc:mga07m45_121248_c1 3300050496 Bacteria 1510
1202 nmdc:mga05p37_39487_c2 3300050507 Bacteria 4017
1203 nmdc:mga05p37_435638_c1 3300050507 Bacteria 1522
1204 nmdc:mga05p37_64486_c1 3300050507 Bacteria 4508
1205 nmdc:mga05p37_68443_c1 3300050507 Bacteria 4366
1206 nmdc:mga05p37_713621_c1 3300050507 Bacteria 1112
1207 nmdc:mga09592_20949_c1 3300050508 Bacteria 5383
1208 nmdc:mga0qj67_12794_c1 3300050509 Bacteria 6329
1209 nmdc:mga0qj67_21688_c1 3300050509 Bacteria 4929
1210 nmdc:mga0qj67_293224_c1 3300050509 Bacteria 1318
1211 nmdc:mga06r32_60057_c1 3300050510 Unclassified 3658
1212 nmdc:mga08y16_165892_c1 3300050511 Unclassified 2294
1213 nmdc:mga08y16_25755_c1 3300050511 Bacteria 6207
1214 nmdc:mga0n895_106262_c1 3300050512 Bacteria 2820
1215 nmdc:mga0n895_128_c1 3300050512 Bacteria 45048
1216 nmdc:mga0n895_36785_c1 3300050512 Bacteria 4730
1217 nmdc:mga0n895_481079_c1 3300050512 Unclassified 1252
1218 nmdc:mga0n895_596796_c1 3300050512 Bacteria 1107
1219 nmdc:mga0rr50_106_c1 3300050513 Bacteria 46345
1220 nmdc:mga0rr50_217255_c1 3300050513 Bacteria 1577
1221 nmdc:mga0rr50_218848_c1 3300050513 Bacteria 1572
1222 nmdc:mga0rr50_238829_c1 3300050513 Bacteria 1506
1223 nmdc:mga0rr50_397884_c1 3300050513 Bacteria 1163
1224 nmdc:mga0rr50_55865_c1 3300050513 Bacteria 2947
1225 nmdc:mga0rr50_6762_c1 3300050513 Bacteria 7024
1226 nmdc:mga08x19_104675_c1 3300050514 Bacteria 1881
1227 nmdc:mga08x19_10698_c1 3300050514 Bacteria 5512
1228 nmdc:mga08x19_188419_c1 3300050514 Bacteria 1411
1229 nmdc:mga08x19_198439_c1 3300050514 Bacteria 1375
1230 nmdc:mga08x19_319818_c1 3300050514 Bacteria 1080
1231 nmdc:mga08x19_3369_c1 3300050514 Bacteria 9533
1232 nmdc:mga08x19_460280_c1 3300050514 Bacteria 896
1233 nmdc:mga08x19_6498_c1 3300050514 Bacteria 6924
1234 nmdc:mga0a205_12062_c1 3300050515 Bacteria 6028
1235 nmdc:mga0a205_1541_c1 3300050515 Bacteria 19716
1236 nmdc:mga0a205_262919_c1 3300050515 Bacteria 1603
1237 nmdc:mga0a205_361049_c1 3300050515 Bacteria 1319
1238 Ga0495619_0102639 3300053085 Bacteria 1948
1239 Ga0495619_0245827 3300053085 Bacteria 1240
1240 Ga0500641_0015952 3300053096 Bacteria 2793
1241 Ga0500590_081311 3300053148 Bacteria 1591
1242 Ga0501084_0057219 3300054114 Bacteria 3263
1243 Ga0501084_0108162 3300054114 Unclassified 2336
1244 Ga0501084_0429735 3300054114 Bacteria 1116
1245 Ga0501082_0003063 3300060353 Bacteria 14588
1246 Ga0501082_0271230 3300060353 Bacteria 1477
1247 Ga0530510_0077267 3300061734 Bacteria 2420
1248 Ga0530510_0133320 3300061734 Bacteria 1828

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10044578 Ga0075365_100445782 228
2 3300050492 nmdc:mga0yw44_98723_c1 nmdc:mga0yw44_98723_c1_879_1628 229
3 3300050496 nmdc:mga07m45_121248_c1 nmdc:mga07m45_121248_c1_108_857 229
4 3300005444 Ga0070694_100569758 Ga0070694_1005697581 239
5 3300005545 Ga0070695_100182760 Ga0070695_1001827602 239
6 3300005549 Ga0070704_100420417 Ga0070704_1004204171 239
7 3300049577 Ga0501041_0176006 Ga0501041_0176006_178_927 243
8 3300049591 Ga0501075_0042395 Ga0501075_0042395_534_1283 243
9 3300049741 Ga0501079_0020511 Ga0501079_0020511_4039_4788 243
10 3300049743 Ga0501081_0030520 Ga0501081_0030520_2285_3034 243
11 3300048910 Ga0496107_0161668 Ga0496107_0161668_685_1419 244
12 3300025913 Ga0207695_10000002 Ga0207695_10000002987 246
13 3300009098 Ga0105245_10031049 Ga0105245_100310493 247
14 3300020078 Ga0206352_10343359 Ga0206352_103433592 247
15 3300025908 Ga0207643_10143727 Ga0207643_101437273 247
16 3300025915 Ga0207693_10084490 Ga0207693_100844902 247
17 3300026075 Ga0207708_10343147 Ga0207708_103431472 247
18 3300026121 Ga0207683_10124618 Ga0207683_101246183 247
19 3300046675 Ga0495657_0191123 Ga0495657_0191123_69_818 247
20 3300046678 Ga0495599_0141115 Ga0495599_0141115_605_1354 247
21 3300049589 Ga0501073_0141553 Ga0501073_0141553_385_1134 247
22 3300049592 Ga0501076_0580334 Ga0501076_0580334_32_781 247
23 3300001977 JGI24746J21847_1006687 JGI24746J21847_10066873 248
24 3300004798 Ga0058859_11766681 Ga0058859_117666811 248
25 3300005290 Ga0065712_10068497 Ga0065712_100684975 248
26 3300005293 Ga0065715_10000735 Ga0065715_100007357 248
27 3300005293 Ga0065715_10026413 Ga0065715_100264131 248
28 3300005293 Ga0065715_10093168 Ga0065715_100931682 248
29 3300005293 Ga0065715_10239199 Ga0065715_102391992 248
30 3300005295 Ga0065707_10307055 Ga0065707_103070551 248
31 3300005328 Ga0070676_10007541 Ga0070676_100075413 248
32 3300005328 Ga0070676_10039318 Ga0070676_100393182 248
33 3300005329 Ga0070683_100140563 Ga0070683_1001405632 248
34 3300005330 Ga0070690_100047347 Ga0070690_1000473472 248
35 3300005331 Ga0070670_100004468 Ga0070670_1000044687 248
36 3300005331 Ga0070670_100088516 Ga0070670_1000885161 248
37 3300005331 Ga0070670_100141952 Ga0070670_1001419521 248
38 3300005333 Ga0070677_10207151 Ga0070677_102071511 248
39 3300005334 Ga0068869_100001024 Ga0068869_10000102413 248
40 3300005336 Ga0070680_100108502 Ga0070680_1001085021 248
41 3300005338 Ga0068868_100003993 Ga0068868_1000039938 248
42 3300005338 Ga0068868_100040790 Ga0068868_1000407905 248
43 3300005338 Ga0068868_100054292 Ga0068868_1000542924 248
44 3300005339 Ga0070660_100022684 Ga0070660_1000226844 248
45 3300005339 Ga0070660_100095191 Ga0070660_1000951912 248
46 3300005341 Ga0070691_10017726 Ga0070691_100177263 248
47 3300005343 Ga0070687_100003542 Ga0070687_1000035428 248
48 3300005344 Ga0070661_100038869 Ga0070661_1000388692 248
49 3300005344 Ga0070661_100090522 Ga0070661_1000905223 248
50 3300005344 Ga0070661_100091381 Ga0070661_1000913812 248
51 3300005347 Ga0070668_100012619 Ga0070668_1000126192 248
52 3300005354 Ga0070675_100004987 Ga0070675_1000049877 248
53 3300005355 Ga0070671_100218015 Ga0070671_1002180151 248
54 3300005355 Ga0070671_100345830 Ga0070671_1003458301 248
55 3300005355 Ga0070671_100470784 Ga0070671_1004707841 248
56 3300005355 Ga0070671_100482536 Ga0070671_1004825362 248
57 3300005356 Ga0070674_100015644 Ga0070674_1000156444 248
58 3300005364 Ga0070673_100008711 Ga0070673_1000087118 248
59 3300005365 Ga0070688_100057566 Ga0070688_1000575661 248
60 3300005366 Ga0070659_100143792 Ga0070659_1001437921 248
61 3300005367 Ga0070667_100014780 Ga0070667_1000147804 248
62 3300005367 Ga0070667_100111231 Ga0070667_1001112311 248
63 3300005434 Ga0070709_10026291 Ga0070709_100262912 248
64 3300005434 Ga0070709_10161655 Ga0070709_101616551 248
65 3300005434 Ga0070709_10164385 Ga0070709_101643851 248
66 3300005434 Ga0070709_10172194 Ga0070709_101721943 248
67 3300005435 Ga0070714_100006592 Ga0070714_1000065926 248
68 3300005435 Ga0070714_100031322 Ga0070714_1000313222 248
69 3300005435 Ga0070714_100126547 Ga0070714_1001265472 248
70 3300005435 Ga0070714_100153946 Ga0070714_1001539461 248
71 3300005435 Ga0070714_100209203 Ga0070714_1002092032 248
72 3300005436 Ga0070713_100080583 Ga0070713_1000805831 248
73 3300005437 Ga0070710_10046423 Ga0070710_100464233 248
74 3300005437 Ga0070710_10098815 Ga0070710_100988153 248
75 3300005439 Ga0070711_100000272 Ga0070711_10000027219 248
76 3300005439 Ga0070711_100045861 Ga0070711_1000458612 248
77 3300005439 Ga0070711_100406729 Ga0070711_1004067291 248
78 3300005439 Ga0070711_100418086 Ga0070711_1004180862 248
79 3300005444 Ga0070694_100163494 Ga0070694_1001634942 248
80 3300005445 Ga0070708_100001701 Ga0070708_1000017012 248
81 3300005445 Ga0070708_100051081 Ga0070708_1000510813 248
82 3300005445 Ga0070708_100425842 Ga0070708_1004258421 248
83 3300005455 Ga0070663_100075465 Ga0070663_1000754652 248
84 3300005455 Ga0070663_100175536 Ga0070663_1001755362 248
85 3300005456 Ga0070678_100010777 Ga0070678_1000107772 248
86 3300005456 Ga0070678_100010889 Ga0070678_1000108894 248
87 3300005456 Ga0070678_100033398 Ga0070678_1000333982 248
88 3300005456 Ga0070678_100243042 Ga0070678_1002430421 248
89 3300005456 Ga0070678_100314012 Ga0070678_1003140121 248
90 3300005457 Ga0070662_100005628 Ga0070662_1000056286 248
91 3300005457 Ga0070662_100036070 Ga0070662_1000360704 248
92 3300005457 Ga0070662_100089333 Ga0070662_1000893333 248
93 3300005457 Ga0070662_100111223 Ga0070662_1001112232 248
94 3300005458 Ga0070681_10160889 Ga0070681_101608892 248
95 3300005459 Ga0068867_100214905 Ga0068867_1002149051 248
96 3300005459 Ga0068867_100346707 Ga0068867_1003467072 248
97 3300005459 Ga0068867_100645903 Ga0068867_1006459031 248
98 3300005467 Ga0070706_100004001 Ga0070706_10000400110 248
99 3300005467 Ga0070706_100071993 Ga0070706_1000719935 248
100 3300005467 Ga0070706_100165285 Ga0070706_1001652852 248
101 3300005468 Ga0070707_100013742 Ga0070707_1000137422 248
102 3300005468 Ga0070707_100483551 Ga0070707_1004835512 248
103 3300005471 Ga0070698_100000171 Ga0070698_10000017148 248
104 3300005471 Ga0070698_100191332 Ga0070698_1001913322 248
105 3300005518 Ga0070699_100016767 Ga0070699_1000167678 248
106 3300005518 Ga0070699_100358917 Ga0070699_1003589172 248
107 3300005518 Ga0070699_100412582 Ga0070699_1004125821 248
108 3300005530 Ga0070679_100012778 Ga0070679_1000127787 248
109 3300005530 Ga0070679_100520962 Ga0070679_1005209622 248
110 3300005535 Ga0070684_100262360 Ga0070684_1002623602 248
111 3300005535 Ga0070684_100491698 Ga0070684_1004916982 248
112 3300005536 Ga0070697_100001005 Ga0070697_10000100510 248
113 3300005536 Ga0070697_100002342 Ga0070697_1000023429 248
114 3300005536 Ga0070697_100007565 Ga0070697_1000075652 248
115 3300005536 Ga0070697_100163781 Ga0070697_1001637812 248
116 3300005539 Ga0068853_100006375 Ga0068853_1000063754 248
117 3300005539 Ga0068853_100140782 Ga0068853_1001407822 248
118 3300005543 Ga0070672_100036606 Ga0070672_1000366062 248
119 3300005543 Ga0070672_100037164 Ga0070672_1000371644 248
120 3300005544 Ga0070686_100006747 Ga0070686_1000067473 248
121 3300005544 Ga0070686_100035071 Ga0070686_1000350713 248
122 3300005545 Ga0070695_100062694 Ga0070695_1000626944 248
123 3300005546 Ga0070696_100303449 Ga0070696_1003034492 248
124 3300005547 Ga0070693_100090992 Ga0070693_1000909922 248
125 3300005547 Ga0070693_100297405 Ga0070693_1002974051 248
126 3300005548 Ga0070665_100007148 Ga0070665_1000071488 248
127 3300005548 Ga0070665_100018792 Ga0070665_1000187923 248
128 3300005549 Ga0070704_100276336 Ga0070704_1002763362 248
129 3300005549 Ga0070704_100286294 Ga0070704_1002862941 248
130 3300005549 Ga0070704_100368640 Ga0070704_1003686401 248
131 3300005563 Ga0068855_100066516 Ga0068855_1000665164 248
132 3300005563 Ga0068855_100078756 Ga0068855_1000787564 248
133 3300005563 Ga0068855_100084289 Ga0068855_1000842892 248
134 3300005563 Ga0068855_100244492 Ga0068855_1002444921 248
135 3300005564 Ga0070664_100009155 Ga0070664_1000091559 248
136 3300005564 Ga0070664_100190450 Ga0070664_1001904502 248
137 3300005577 Ga0068857_100024037 Ga0068857_1000240375 248
138 3300005577 Ga0068857_100132854 Ga0068857_1001328543 248
139 3300005577 Ga0068857_100265466 Ga0068857_1002654662 248
140 3300005578 Ga0068854_100010220 Ga0068854_1000102204 248
141 3300005578 Ga0068854_100025281 Ga0068854_1000252813 248
142 3300005578 Ga0068854_100025484 Ga0068854_1000254846 248
143 3300005578 Ga0068854_100025620 Ga0068854_1000256202 248
144 3300005578 Ga0068854_100216224 Ga0068854_1002162242 248
145 3300005614 Ga0068856_100182905 Ga0068856_1001829053 248
146 3300005614 Ga0068856_100256619 Ga0068856_1002566192 248
147 3300005614 Ga0068856_100381685 Ga0068856_1003816852 248
148 3300005616 Ga0068852_100076064 Ga0068852_1000760644 248
149 3300005617 Ga0068859_100023926 Ga0068859_1000239263 248
150 3300005617 Ga0068859_100027045 Ga0068859_1000270455 248
151 3300005617 Ga0068859_100041061 Ga0068859_1000410611 248
152 3300005617 Ga0068859_100253330 Ga0068859_1002533303 248
153 3300005618 Ga0068864_100004837 Ga0068864_1000048377 248
154 3300005618 Ga0068864_100154608 Ga0068864_1001546082 248
155 3300005618 Ga0068864_100324845 Ga0068864_1003248452 248
156 3300005718 Ga0068866_10012138 Ga0068866_100121385 248
157 3300005719 Ga0068861_100011191 Ga0068861_1000111913 248
158 3300005719 Ga0068861_100195000 Ga0068861_1001950002 248
159 3300005719 Ga0068861_100584547 Ga0068861_1005845471 248
160 3300005834 Ga0068851_10008189 Ga0068851_100081893 248
161 3300005834 Ga0068851_10008776 Ga0068851_100087764 248
162 3300005834 Ga0068851_10068828 Ga0068851_100688282 248
163 3300005840 Ga0068870_10005594 Ga0068870_100055942 248
164 3300005841 Ga0068863_100053323 Ga0068863_1000533234 248
165 3300005841 Ga0068863_100067978 Ga0068863_1000679783 248
166 3300005841 Ga0068863_100136335 Ga0068863_1001363353 248
167 3300005841 Ga0068863_100354490 Ga0068863_1003544901 248
168 3300005842 Ga0068858_100015430 Ga0068858_1000154306 248
169 3300005842 Ga0068858_100022310 Ga0068858_1000223103 248
170 3300005842 Ga0068858_100309307 Ga0068858_1003093071 248
171 3300005843 Ga0068860_100018060 Ga0068860_1000180608 248
172 3300005843 Ga0068860_100250964 Ga0068860_1002509642 248
173 3300005844 Ga0068862_100016880 Ga0068862_1000168807 248
174 3300005937 Ga0081455_10090149 Ga0081455_100901491 248
175 3300005983 Ga0081540_1030546 Ga0081540_10305462 248
176 3300005983 Ga0081540_1035291 Ga0081540_10352911 248
177 3300006028 Ga0070717_10001615 Ga0070717_100016159 248
178 3300006028 Ga0070717_10002183 Ga0070717_100021839 248
179 3300006028 Ga0070717_10004989 Ga0070717_1000498912 248
180 3300006163 Ga0070715_10001590 Ga0070715_100015905 248
181 3300006163 Ga0070715_10054664 Ga0070715_100546642 248
182 3300006173 Ga0070716_100048371 Ga0070716_1000483713 248
183 3300006173 Ga0070716_100054416 Ga0070716_1000544163 248
184 3300006173 Ga0070716_100141760 Ga0070716_1001417602 248
185 3300006173 Ga0070716_100306074 Ga0070716_1003060742 248
186 3300006175 Ga0070712_100000342 Ga0070712_10000034223 248
187 3300006175 Ga0070712_100037469 Ga0070712_1000374691 248
188 3300006237 Ga0097621_100000422 Ga0097621_10000042216 248
189 3300006237 Ga0097621_100278483 Ga0097621_1002784831 248
190 3300006358 Ga0068871_100000387 Ga0068871_10000038726 248
191 3300006358 Ga0068871_100045064 Ga0068871_1000450643 248
192 3300006844 Ga0075428_100006386 Ga0075428_10000638611 248
193 3300006844 Ga0075428_100007219 Ga0075428_10000721913 248
194 3300006844 Ga0075428_100034567 Ga0075428_1000345674 248
195 3300006846 Ga0075430_100002239 Ga0075430_10000223915 248
196 3300006846 Ga0075430_100023975 Ga0075430_1000239752 248
197 3300006847 Ga0075431_100001153 Ga0075431_10000115323 248
198 3300006847 Ga0075431_100020409 Ga0075431_1000204098 248
199 3300006852 Ga0075433_10000204 Ga0075433_100002046 248
200 3300006871 Ga0075434_100000087 Ga0075434_10000008721 248
201 3300006871 Ga0075434_100152994 Ga0075434_1001529944 248
202 3300006880 Ga0075429_100020579 Ga0075429_1000205794 248
203 3300006880 Ga0075429_100029634 Ga0075429_1000296343 248
204 3300006881 Ga0068865_100179968 Ga0068865_1001799682 248
205 3300006881 Ga0068865_100181643 Ga0068865_1001816431 248
206 3300006881 Ga0068865_100251991 Ga0068865_1002519912 248
207 3300006881 Ga0068865_100395641 Ga0068865_1003956411 248
208 3300006914 Ga0075436_100005352 Ga0075436_1000053527 248
209 3300006914 Ga0075436_100036527 Ga0075436_1000365272 248
210 3300006914 Ga0075436_100055389 Ga0075436_1000553892 248
211 3300006914 Ga0075436_100282581 Ga0075436_1002825812 248
212 3300006931 Ga0097620_100023926 Ga0097620_1000239263 248
213 3300006931 Ga0097620_100027047 Ga0097620_1000270475 248
214 3300006931 Ga0097620_100041063 Ga0097620_1000410631 248
215 3300006931 Ga0097620_100253318 Ga0097620_1002533183 248
216 3300007076 Ga0075435_100000998 Ga0075435_10000099820 248
217 3300007076 Ga0075435_100054469 Ga0075435_1000544695 248
218 3300007076 Ga0075435_100375088 Ga0075435_1003750881 248
219 3300007265 Ga0099794_10132719 Ga0099794_101327192 248
220 3300009093 Ga0105240_10012519 Ga0105240_100125193 248
221 3300009093 Ga0105240_10037911 Ga0105240_100379115 248
222 3300009093 Ga0105240_10115812 Ga0105240_101158124 248
223 3300009094 Ga0111539_10005838 Ga0111539_100058383 248
224 3300009098 Ga0105245_10053402 Ga0105245_100534025 248
225 3300009098 Ga0105245_10090127 Ga0105245_100901272 248
226 3300009147 Ga0114129_10061315 Ga0114129_100613155 248
227 3300009147 Ga0114129_10324303 Ga0114129_103243032 248
228 3300009174 Ga0105241_10000531 Ga0105241_100005318 248
229 3300009174 Ga0105241_10099982 Ga0105241_100999823 248
230 3300009176 Ga0105242_10235803 Ga0105242_102358032 248
231 3300009176 Ga0105242_10287755 Ga0105242_102877551 248
232 3300009177 Ga0105248_10064217 Ga0105248_100642173 248
233 3300009177 Ga0105248_10064364 Ga0105248_100643644 248
234 3300009177 Ga0105248_10108048 Ga0105248_101080482 248
235 3300009177 Ga0105248_10296484 Ga0105248_102964843 248
236 3300009545 Ga0105237_10023574 Ga0105237_100235744 248
237 3300009545 Ga0105237_10160383 Ga0105237_101603832 248
238 3300009551 Ga0105238_10025900 Ga0105238_100259005 248
239 3300009551 Ga0105238_10366792 Ga0105238_103667922 248
240 3300009553 Ga0105249_10015751 Ga0105249_100157514 248
241 3300009553 Ga0105249_10048315 Ga0105249_100483154 248
242 3300010375 Ga0105239_10001966 Ga0105239_1000196622 248
243 3300010375 Ga0105239_10006192 Ga0105239_100061925 248
244 3300010375 Ga0105239_10061859 Ga0105239_100618593 248
245 3300010375 Ga0105239_10091485 Ga0105239_100914853 248
246 3300010375 Ga0105239_11121319 Ga0105239_111213191 248
247 3300011119 Ga0105246_10041738 Ga0105246_100417384 248
248 3300011119 Ga0105246_10368912 Ga0105246_103689121 248
249 3300013100 Ga0157373_10036029 Ga0157373_100360293 248
250 3300013102 Ga0157371_10048470 Ga0157371_100484702 248
251 3300013105 Ga0157369_10021271 Ga0157369_100212716 248
252 3300013105 Ga0157369_10023337 Ga0157369_100233377 248
253 3300013105 Ga0157369_10037172 Ga0157369_100371722 248
254 3300013105 Ga0157369_10078173 Ga0157369_100781733 248
255 3300013105 Ga0157369_10087366 Ga0157369_100873663 248
256 3300013105 Ga0157369_10513613 Ga0157369_105136131 248
257 3300013296 Ga0157374_10116125 Ga0157374_101161251 248
258 3300013297 Ga0157378_10000287 Ga0157378_1000028739 248
259 3300013297 Ga0157378_10176768 Ga0157378_101767682 248
260 3300013297 Ga0157378_10268939 Ga0157378_102689392 248
261 3300013306 Ga0163162_10026539 Ga0163162_100265394 248
262 3300013306 Ga0163162_10036011 Ga0163162_100360114 248
263 3300013306 Ga0163162_10092874 Ga0163162_100928743 248
264 3300013306 Ga0163162_10320781 Ga0163162_103207813 248
265 3300013306 Ga0163162_10707509 Ga0163162_107075091 248
266 3300013307 Ga0157372_10004519 Ga0157372_100045196 248
267 3300013307 Ga0157372_10011058 Ga0157372_100110586 248
268 3300013307 Ga0157372_10029167 Ga0157372_100291675 248
269 3300013307 Ga0157372_10038318 Ga0157372_100383184 248
270 3300013307 Ga0157372_10177521 Ga0157372_101775211 248
271 3300013307 Ga0157372_10197665 Ga0157372_101976653 248
272 3300013307 Ga0157372_10380198 Ga0157372_103801981 248
273 3300013307 Ga0157372_10785166 Ga0157372_107851662 248
274 3300013308 Ga0157375_10120448 Ga0157375_101204482 248
275 3300013308 Ga0157375_10232182 Ga0157375_102321822 248
276 3300014325 Ga0163163_10004472 Ga0163163_1000447213 248
277 3300014325 Ga0163163_10020482 Ga0163163_100204827 248
278 3300014325 Ga0163163_10168149 Ga0163163_101681493 248
279 3300014325 Ga0163163_10321966 Ga0163163_103219661 248
280 3300014325 Ga0163163_10806172 Ga0163163_108061721 248
281 3300014326 Ga0157380_10015991 Ga0157380_100159913 248
282 3300014497 Ga0182008_10026785 Ga0182008_100267854 248
283 3300014968 Ga0157379_10000722 Ga0157379_1000072213 248
284 3300014968 Ga0157379_10005070 Ga0157379_1000507013 248
285 3300014968 Ga0157379_10044427 Ga0157379_100444273 248
286 3300014968 Ga0157379_10262031 Ga0157379_102620313 248
287 3300014969 Ga0157376_10508654 Ga0157376_105086541 248
288 3300015261 Ga0182006_1072375 Ga0182006_10723751 248
289 3300015265 Ga0182005_1032302 Ga0182005_10323022 248
290 3300020082 Ga0206353_10259220 Ga0206353_102592202 248
291 3300025290 Ga0207673_1007220 Ga0207673_10072202 248
292 3300025315 Ga0207697_10007162 Ga0207697_100071627 248
293 3300025321 Ga0207656_10095888 Ga0207656_100958881 248
294 3300025321 Ga0207656_10156376 Ga0207656_101563762 248
295 3300025898 Ga0207692_10137597 Ga0207692_101375971 248
296 3300025898 Ga0207692_10162033 Ga0207692_101620331 248
297 3300025901 Ga0207688_10028227 Ga0207688_100282274 248
298 3300025901 Ga0207688_10033550 Ga0207688_100335503 248
299 3300025903 Ga0207680_10276100 Ga0207680_102761001 248
300 3300025904 Ga0207647_10002682 Ga0207647_1000268215 248
301 3300025905 Ga0207685_10165171 Ga0207685_101651711 248
302 3300025906 Ga0207699_10022886 Ga0207699_100228863 248
303 3300025906 Ga0207699_10050567 Ga0207699_100505672 248
304 3300025906 Ga0207699_10102815 Ga0207699_101028151 248
305 3300025906 Ga0207699_10118582 Ga0207699_101185822 248
306 3300025906 Ga0207699_10263143 Ga0207699_102631431 248
307 3300025907 Ga0207645_10013554 Ga0207645_100135541 248
308 3300025908 Ga0207643_10131793 Ga0207643_101317931 248
309 3300025910 Ga0207684_10003875 Ga0207684_1000387512 248
310 3300025910 Ga0207684_10028537 Ga0207684_100285375 248
311 3300025910 Ga0207684_10132804 Ga0207684_101328042 248
312 3300025911 Ga0207654_10044642 Ga0207654_100446421 248
313 3300025912 Ga0207707_10136750 Ga0207707_101367503 248
314 3300025913 Ga0207695_10004905 Ga0207695_100049051 248
315 3300025913 Ga0207695_10080160 Ga0207695_100801604 248
316 3300025913 Ga0207695_10173127 Ga0207695_101731273 248
317 3300025914 Ga0207671_10036064 Ga0207671_100360644 248
318 3300025914 Ga0207671_10179158 Ga0207671_101791582 248
319 3300025915 Ga0207693_10000020 Ga0207693_1000002086 248
320 3300025915 Ga0207693_10001883 Ga0207693_100018833 248
321 3300025916 Ga0207663_10344738 Ga0207663_103447381 248
322 3300025916 Ga0207663_10415553 Ga0207663_104155531 248
323 3300025916 Ga0207663_10547985 Ga0207663_105479851 248
324 3300025917 Ga0207660_10227607 Ga0207660_102276072 248
325 3300025918 Ga0207662_10007437 Ga0207662_100074371 248
326 3300025919 Ga0207657_10003333 Ga0207657_1000333312 248
327 3300025919 Ga0207657_10005136 Ga0207657_100051368 248
328 3300025920 Ga0207649_10068199 Ga0207649_100681993 248
329 3300025921 Ga0207652_10500403 Ga0207652_105004031 248
330 3300025922 Ga0207646_10000616 Ga0207646_1000061618 248
331 3300025923 Ga0207681_10027636 Ga0207681_100276363 248
332 3300025924 Ga0207694_10014820 Ga0207694_100148203 248
333 3300025925 Ga0207650_10110179 Ga0207650_101101793 248
334 3300025926 Ga0207659_10015756 Ga0207659_100157564 248
335 3300025926 Ga0207659_10079511 Ga0207659_100795114 248
336 3300025927 Ga0207687_10048001 Ga0207687_100480012 248
337 3300025927 Ga0207687_10115298 Ga0207687_101152983 248
338 3300025928 Ga0207700_10014531 Ga0207700_100145315 248
339 3300025928 Ga0207700_10028527 Ga0207700_100285272 248
340 3300025928 Ga0207700_10108948 Ga0207700_101089482 248
341 3300025929 Ga0207664_10006636 Ga0207664_100066361 248
342 3300025929 Ga0207664_10009766 Ga0207664_100097667 248
343 3300025929 Ga0207664_10150079 Ga0207664_101500791 248
344 3300025931 Ga0207644_10294183 Ga0207644_102941832 248
345 3300025931 Ga0207644_10353223 Ga0207644_103532232 248
346 3300025931 Ga0207644_10431242 Ga0207644_104312422 248
347 3300025931 Ga0207644_10575847 Ga0207644_105758471 248
348 3300025932 Ga0207690_10066617 Ga0207690_100666173 248
349 3300025932 Ga0207690_10288171 Ga0207690_102881712 248
350 3300025932 Ga0207690_10341879 Ga0207690_103418791 248
351 3300025933 Ga0207706_10001546 Ga0207706_1000154616 248
352 3300025933 Ga0207706_10005517 Ga0207706_100055173 248
353 3300025933 Ga0207706_10091092 Ga0207706_100910923 248
354 3300025933 Ga0207706_10114183 Ga0207706_101141832 248
355 3300025933 Ga0207706_10228531 Ga0207706_102285312 248
356 3300025933 Ga0207706_10301720 Ga0207706_103017203 248
357 3300025934 Ga0207686_10043467 Ga0207686_100434672 248
358 3300025934 Ga0207686_10100478 Ga0207686_101004782 248
359 3300025934 Ga0207686_10185082 Ga0207686_101850821 248
360 3300025934 Ga0207686_10196924 Ga0207686_101969242 248
361 3300025935 Ga0207709_10097174 Ga0207709_100971742 248
362 3300025936 Ga0207670_10156792 Ga0207670_101567922 248
363 3300025936 Ga0207670_10435044 Ga0207670_104350442 248
364 3300025937 Ga0207669_10493664 Ga0207669_104936641 248
365 3300025938 Ga0207704_10030875 Ga0207704_100308753 248
366 3300025938 Ga0207704_10060923 Ga0207704_100609232 248
367 3300025939 Ga0207665_10001512 Ga0207665_100015126 248
368 3300025939 Ga0207665_10015155 Ga0207665_100151553 248
369 3300025939 Ga0207665_10021981 Ga0207665_100219813 248
370 3300025939 Ga0207665_10057315 Ga0207665_100573152 248
371 3300025939 Ga0207665_10136930 Ga0207665_101369301 248
372 3300025940 Ga0207691_10006666 Ga0207691_1000666612 248
373 3300025940 Ga0207691_10031735 Ga0207691_100317354 248
374 3300025941 Ga0207711_10006426 Ga0207711_100064262 248
375 3300025942 Ga0207689_10000901 Ga0207689_1000090124 248
376 3300025942 Ga0207689_10011863 Ga0207689_100118636 248
377 3300025944 Ga0207661_10219070 Ga0207661_102190701 248
378 3300025945 Ga0207679_10082677 Ga0207679_100826771 248
379 3300025949 Ga0207667_10007058 Ga0207667_100070584 248
380 3300025949 Ga0207667_10031853 Ga0207667_100318532 248
381 3300025972 Ga0207668_10009786 Ga0207668_100097862 248
382 3300025981 Ga0207640_10027105 Ga0207640_100271054 248
383 3300025981 Ga0207640_10052731 Ga0207640_100527312 248
384 3300025981 Ga0207640_10246959 Ga0207640_102469592 248
385 3300025986 Ga0207658_10061928 Ga0207658_100619282 248
386 3300025986 Ga0207658_10377718 Ga0207658_103777181 248
387 3300026023 Ga0207677_10025139 Ga0207677_100251392 248
388 3300026023 Ga0207677_10037172 Ga0207677_100371723 248
389 3300026023 Ga0207677_10253249 Ga0207677_102532492 248
390 3300026023 Ga0207677_10253395 Ga0207677_102533951 248
391 3300026023 Ga0207677_10293224 Ga0207677_102932242 248
392 3300026035 Ga0207703_10007660 Ga0207703_100076605 248
393 3300026035 Ga0207703_10015524 Ga0207703_100155243 248
394 3300026035 Ga0207703_10048479 Ga0207703_100484793 248
395 3300026035 Ga0207703_10152044 Ga0207703_101520443 248
396 3300026041 Ga0207639_10007330 Ga0207639_100073308 248
397 3300026041 Ga0207639_10103826 Ga0207639_101038262 248
398 3300026067 Ga0207678_10028270 Ga0207678_100282706 248
399 3300026067 Ga0207678_10518185 Ga0207678_105181852 248
400 3300026078 Ga0207702_10016915 Ga0207702_100169154 248
401 3300026078 Ga0207702_10051114 Ga0207702_100511143 248
402 3300026078 Ga0207702_10186408 Ga0207702_101864082 248
403 3300026088 Ga0207641_10041904 Ga0207641_100419044 248
404 3300026088 Ga0207641_10307570 Ga0207641_103075701 248
405 3300026088 Ga0207641_10697234 Ga0207641_106972341 248
406 3300026089 Ga0207648_10016621 Ga0207648_100166216 248
407 3300026089 Ga0207648_10045918 Ga0207648_100459183 248
408 3300026095 Ga0207676_10007437 Ga0207676_100074377 248
409 3300026095 Ga0207676_10042062 Ga0207676_100420623 248
410 3300026095 Ga0207676_10315979 Ga0207676_103159791 248
411 3300026116 Ga0207674_10014801 Ga0207674_100148014 248
412 3300026116 Ga0207674_10296247 Ga0207674_102962471 248
413 3300026116 Ga0207674_10367695 Ga0207674_103676951 248
414 3300026118 Ga0207675_100025620 Ga0207675_1000256204 248
415 3300026121 Ga0207683_10052243 Ga0207683_100522434 248
416 3300026121 Ga0207683_10093630 Ga0207683_100936304 248
417 3300026121 Ga0207683_10342501 Ga0207683_103425012 248
418 3300027876 Ga0209974_10094569 Ga0209974_100945691 248
419 3300028379 Ga0268266_10028663 Ga0268266_100286635 248
420 3300028379 Ga0268266_10029474 Ga0268266_100294744 248
421 3300028379 Ga0268266_10205250 Ga0268266_102052501 248
422 3300028380 Ga0268265_10034076 Ga0268265_100340764 248
423 3300031090 Ga0265760_10082083 Ga0265760_100820831 248
424 3300031241 Ga0265325_10017491 Ga0265325_100174913 248
425 3300031247 Ga0265340_10013022 Ga0265340_100130222 248
426 3300031249 Ga0265339_10129145 Ga0265339_101291452 248
427 3300031548 Ga0307408_100398522 Ga0307408_1003985221 248
428 3300034819 Ga0373958_0024502 Ga0373958_0024502_336_1085 248
429 3300034820 Ga0373959_0020074 Ga0373959_0020074_490_1236 248
430 3300035083 Ga0373926_0003092 Ga0373926_0003092_690_1439 248
431 3300035084 Ga0373928_0035941 Ga0373928_0035941_49_795 248
432 3300035085 Ga0373929_0005095 Ga0373929_0005095_109_855 248
433 3300035086 Ga0373934_0088684 Ga0373934_0088684_418_1167 248
434 3300035090 Ga0373949_0093217 Ga0373949_0093217_17_763 248
435 3300035112 Ga0373932_0013016 Ga0373932_0013016_615_1361 248
436 3300035116 Ga0373945_0148076 Ga0373945_0148076_190_939 248
437 3300035121 Ga0373960_0039476 Ga0373960_0039476_515_1261 248
438 3300035170 Ga0373943_0010631 Ga0373943_0010631_1670_2419 248
439 3300035691 Ga0373931_0006883 Ga0373931_0006883_2536_3285 248
440 3300035692 Ga0373935_0004868 Ga0373935_0004868_5493_6242 248
441 3300035724 Ga0373933_0068157 Ga0373933_0068157_54_803 248
442 3300035725 Ga0373947_0003319 Ga0373947_0003319_3389_4138 248
443 3300036401 Ga0373937_0000258 Ga0373937_0000258_7051_7800 248
444 3300036401 Ga0373937_0031203 Ga0373937_0031203_3215_3964 248
445 3300037068 Ga0373925_0001131 Ga0373925_0001131_18215_18964 248
446 3300037068 Ga0373925_0001989 Ga0373925_0001989_10784_11533 248
447 3300037068 Ga0373925_0599580 Ga0373925_0599580_36_785 248
448 3300037853 Ga0436364_0202456 Ga0436364_0202456_179_925 248
449 3300039437 Ga0436365_0693419 Ga0436365_0693419_84_830 248
450 3300039450 Ga0436363_0117913 Ga0436363_0117913_50_796 248
451 3300039450 Ga0436363_1636167 Ga0436363_1636167_413_1159 248
452 3300042131 Ga0450894_000401 Ga0450894_000401_2985_3734 248
453 3300042132 Ga0450895_000275 Ga0450895_000275_1268_2017 248
454 3300042133 Ga0450896_021812 Ga0450896_021812_81_830 248
455 3300044842 Ga0466957_0351766 Ga0466957_0351766_14_760 248
456 3300045049 Ga0466959_0420118 Ga0466959_0420118_96_842 248
457 3300045051 Ga0451576_0141726 Ga0451576_0141726_1031_1777 248
458 3300045051 Ga0451576_0145628 Ga0451576_0145628_1641_2387 248
459 3300045976 Ga0466967_0001105 Ga0466967_0001105_10621_11367 248
460 3300045976 Ga0466967_0027163 Ga0466967_0027163_446_1192 248
461 3300045976 Ga0466967_0130750 Ga0466967_0130750_147_896 248
462 3300046472 Ga0495580_0001147 Ga0495580_0001147_8725_9474 248
463 3300046472 Ga0495580_0020172 Ga0495580_0020172_44_796 248
464 3300046472 Ga0495580_0028115 Ga0495580_0028115_2657_3406 248
465 3300046472 Ga0495580_0049642 Ga0495580_0049642_1902_2648 248
466 3300046472 Ga0495580_0152042 Ga0495580_0152042_225_971 248
467 3300046473 Ga0495582_0001740 Ga0495582_0001740_9880_10629 248
468 3300046475 Ga0495639_0103907 Ga0495639_0103907_308_1057 248
469 3300046475 Ga0495639_0136323 Ga0495639_0136323_421_1167 248
470 3300046477 Ga0495664_0171662 Ga0495664_0171662_72_818 248
471 3300046517 Ga0495630_0048977 Ga0495630_0048977_263_1012 248
472 3300046526 Ga0495666_0102494 Ga0495666_0102494_398_1147 248
473 3300046529 Ga0495652_0402418 Ga0495652_0402418_51_797 248
474 3300046531 Ga0495665_0002409 Ga0495665_0002409_538_1287 248
475 3300046535 Ga0495586_0217608 Ga0495586_0217608_92_838 248
476 3300046663 Ga0495635_0037309 Ga0495635_0037309_1112_1858 248
477 3300046663 Ga0495635_0320851 Ga0495635_0320851_135_881 248
478 3300046674 Ga0495588_0064063 Ga0495588_0064063_801_1550 248
479 3300046679 Ga0495623_0180919 Ga0495623_0180919_146_892 248
480 3300046683 Ga0495658_0010707 Ga0495658_0010707_1236_1985 248
481 3300046684 Ga0495669_0016937 Ga0495669_0016937_874_1620 248
482 3300047315 Ga0495581_0159740 Ga0495581_0159740_124_873 248
483 3300047319 Ga0495674_0298523 Ga0495674_0298523_286_1035 248
484 3300047322 Ga0495680_0265054 Ga0495680_0265054_433_1182 248
485 3300047444 Ga0495675_0021306 Ga0495675_0021306_2266_3012 248
486 3300047673 Ga0495593_0053733 Ga0495593_0053733_954_1703 248
487 3300048088 Ga0495602_0092168 Ga0495602_0092168_224_976 248
488 3300048088 Ga0495602_0325458 Ga0495602_0325458_58_807 248
489 3300048089 Ga0495614_0058973 Ga0495614_0058973_696_1445 248
490 3300048903 Ga0496100_0180392 Ga0496100_0180392_336_1085 248
491 3300048903 Ga0496100_0296801 Ga0496100_0296801_30_779 248
492 3300048904 Ga0496101_0060944 Ga0496101_0060944_324_1073 248
493 3300048904 Ga0496101_0190730 Ga0496101_0190730_208_954 248
494 3300048904 Ga0496101_0199828 Ga0496101_0199828_61_810 248
495 3300048904 Ga0496101_0573856 Ga0496101_0573856_85_831 248
496 3300048905 Ga0496102_0001630 Ga0496102_0001630_7938_8684 248
497 3300048905 Ga0496102_0264769 Ga0496102_0264769_140_886 248
498 3300048907 Ga0496104_0050240 Ga0496104_0050240_1065_1814 248
499 3300048907 Ga0496104_0077203 Ga0496104_0077203_2187_2933 248
500 3300048907 Ga0496104_0154054 Ga0496104_0154054_960_1709 248
501 3300048907 Ga0496104_0364239 Ga0496104_0364239_290_1036 248
502 3300048908 Ga0496105_0015943 Ga0496105_0015943_3337_4086 248
503 3300048909 Ga0496106_0112849 Ga0496106_0112849_1335_2081 248
504 3300048909 Ga0496106_0133102 Ga0496106_0133102_951_1700 248
505 3300048909 Ga0496106_0313041 Ga0496106_0313041_500_1246 248
506 3300048909 Ga0496106_0348839 Ga0496106_0348839_197_943 248
507 3300048910 Ga0496107_0302611 Ga0496107_0302611_337_1083 248
508 3300048910 Ga0496107_0303485 Ga0496107_0303485_410_1156 248
509 3300048911 Ga0496108_0302268 Ga0496108_0302268_540_1289 248
510 3300048912 Ga0496109_0001109 Ga0496109_0001109_15144_15893 248
511 3300048912 Ga0496109_0516489 Ga0496109_0516489_186_932 248
512 3300048913 Ga0496110_0012922 Ga0496110_0012922_2408_3157 248
513 3300048914 Ga0496111_0028932 Ga0496111_0028932_325_1071 248
514 3300048914 Ga0496111_0052326 Ga0496111_0052326_755_1504 248
515 3300048915 Ga0496112_0001819 Ga0496112_0001819_9511_10260 248
516 3300048915 Ga0496112_0009007 Ga0496112_0009007_2125_2871 248
517 3300048915 Ga0496112_0032465 Ga0496112_0032465_843_1592 248
518 3300048915 Ga0496112_0584412 Ga0496112_0584412_96_842 248
519 3300048915 Ga0496112_0671332 Ga0496112_0671332_28_774 248
520 3300048916 Ga0496113_0054669 Ga0496113_0054669_1679_2428 248
521 3300048916 Ga0496113_0064928 Ga0496113_0064928_1106_1852 248
522 3300048916 Ga0496113_0157577 Ga0496113_0157577_107_856 248
523 3300048917 Ga0496114_0029533 Ga0496114_0029533_1326_2075 248
524 3300048918 Ga0496115_0050776 Ga0496115_0050776_165_914 248
525 3300048918 Ga0496115_0121067 Ga0496115_0121067_1207_1953 248
526 3300049519 Ga0501296_020136 Ga0501296_020136_41_838 248
527 3300049568 Ga0501031_0002823 Ga0501031_0002823_6068_6817 248
528 3300049568 Ga0501031_0058932 Ga0501031_0058932_294_1043 248
529 3300049569 Ga0501032_0008205 Ga0501032_0008205_1920_2669 248
530 3300049569 Ga0501032_0024552 Ga0501032_0024552_1934_2683 248
531 3300049570 Ga0501033_0001797 Ga0501033_0001797_6416_7165 248
532 3300049570 Ga0501033_0020881 Ga0501033_0020881_1920_2669 248
533 3300049571 Ga0501034_0005356 Ga0501034_0005356_5279_6028 248
534 3300049571 Ga0501034_0029877 Ga0501034_0029877_2085_2834 248
535 3300049571 Ga0501034_0072351 Ga0501034_0072351_660_1409 248
536 3300049572 Ga0501036_0005695 Ga0501036_0005695_788_1537 248
537 3300049573 Ga0501037_0001960 Ga0501037_0001960_6515_7264 248
538 3300049574 Ga0501038_0063672 Ga0501038_0063672_2048_2797 248
539 3300049575 Ga0501039_0024578 Ga0501039_0024578_963_1712 248
540 3300049575 Ga0501039_0035549 Ga0501039_0035549_397_1146 248
541 3300049576 Ga0501040_0015297 Ga0501040_0015297_557_1306 248
542 3300049577 Ga0501041_0235022 Ga0501041_0235022_256_1005 248
543 3300049578 Ga0501042_0031405 Ga0501042_0031405_583_1332 248
544 3300049578 Ga0501042_0119765 Ga0501042_0119765_458_1207 248
545 3300049579 Ga0501043_0013132 Ga0501043_0013132_4869_5618 248
546 3300049580 Ga0501046_0023436 Ga0501046_0023436_2048_2797 248
547 3300049580 Ga0501046_0366962 Ga0501046_0366962_109_858 248
548 3300049581 Ga0501047_0071928 Ga0501047_0071928_660_1409 248
549 3300049581 Ga0501047_0208140 Ga0501047_0208140_696_1445 248
550 3300049582 Ga0501048_0004103 Ga0501048_0004103_424_1173 248
551 3300049582 Ga0501048_0008075 Ga0501048_0008075_4758_5507 248
552 3300049582 Ga0501048_0178942 Ga0501048_0178942_295_1044 248
553 3300049583 Ga0501067_0001385 Ga0501067_0001385_5750_6499 248
554 3300049583 Ga0501067_0166610 Ga0501067_0166610_231_977 248
555 3300049583 Ga0501067_0287647 Ga0501067_0287647_27_776 248
556 3300049583 Ga0501067_0288597 Ga0501067_0288597_134_883 248
557 3300049584 Ga0501068_0012541 Ga0501068_0012541_864_1613 248
558 3300049584 Ga0501068_0052767 Ga0501068_0052767_424_1173 248
559 3300049585 Ga0501069_0003738 Ga0501069_0003738_5843_6592 248
560 3300049585 Ga0501069_0021106 Ga0501069_0021106_991_1740 248
561 3300049586 Ga0501070_0005646 Ga0501070_0005646_4188_4937 248
562 3300049586 Ga0501070_0022268 Ga0501070_0022268_2279_3028 248
563 3300049587 Ga0501071_0019087 Ga0501071_0019087_3581_4330 248
564 3300049587 Ga0501071_0098567 Ga0501071_0098567_771_1520 248
565 3300049588 Ga0501072_0077689 Ga0501072_0077689_302_1051 248
566 3300049589 Ga0501073_0008693 Ga0501073_0008693_2489_3238 248
567 3300049589 Ga0501073_0093745 Ga0501073_0093745_947_1696 248
568 3300049590 Ga0501074_0003931 Ga0501074_0003931_6422_7171 248
569 3300049590 Ga0501074_0007266 Ga0501074_0007266_1798_2547 248
570 3300049591 Ga0501075_0005672 Ga0501075_0005672_1938_2687 248
571 3300049591 Ga0501075_0521673 Ga0501075_0521673_61_810 248
572 3300049592 Ga0501076_0039666 Ga0501076_0039666_1697_2446 248
573 3300049592 Ga0501076_0128579 Ga0501076_0128579_257_1006 248
574 3300049593 Ga0501077_0354089 Ga0501077_0354089_58_807 248
575 3300049741 Ga0501079_0009681 Ga0501079_0009681_2275_3024 248
576 3300049741 Ga0501079_0017966 Ga0501079_0017966_2291_3040 248
577 3300049741 Ga0501079_0021979 Ga0501079_0021979_1780_2529 248
578 3300049742 Ga0501080_0001466 Ga0501080_0001466_15443_16192 248
579 3300049742 Ga0501080_0061022 Ga0501080_0061022_1142_1891 248
580 3300049742 Ga0501080_0123925 Ga0501080_0123925_1606_2355 248
581 3300049742 Ga0501080_0246226 Ga0501080_0246226_811_1560 248
582 3300049742 Ga0501080_0490783 Ga0501080_0490783_72_821 248
583 3300049743 Ga0501081_0007223 Ga0501081_0007223_3018_3767 248
584 3300049743 Ga0501081_0238632 Ga0501081_0238632_188_937 248
585 3300049744 Ga0501083_0026727 Ga0501083_0026727_3208_3957 248
586 3300049744 Ga0501083_0170013 Ga0501083_0170013_298_1047 248
587 3300049822 Ga0501035_0027160 Ga0501035_0027160_3208_3957 248
588 3300049822 Ga0501035_0444311 Ga0501035_0444311_113_862 248
589 3300049822 Ga0501035_0599613 Ga0501035_0599613_135_884 248
590 3300049823 Ga0501044_0009040 Ga0501044_0009040_4375_5124 248
591 3300049824 Ga0501045_0036031 Ga0501045_0036031_1141_1890 248
592 3300049824 Ga0501045_0094903 Ga0501045_0094903_1327_2076 248
593 3300050492 nmdc:mga0yw44_6678_c1 nmdc:mga0yw44_6678_c1_2215_2964 248
594 3300050507 nmdc:mga05p37_68443_c1 nmdc:mga05p37_68443_c1_2083_2832 248
595 3300050508 nmdc:mga09592_20949_c1 nmdc:mga09592_20949_c1_3082_3831 248
596 3300050509 nmdc:mga0qj67_12794_c1 nmdc:mga0qj67_12794_c1_3888_4637 248
597 3300050509 nmdc:mga0qj67_21688_c1 nmdc:mga0qj67_21688_c1_865_1614 248
598 3300050510 nmdc:mga06r32_60057_c1 nmdc:mga06r32_60057_c1_1751_2500 248
599 3300050511 nmdc:mga08y16_165892_c1 nmdc:mga08y16_165892_c1_293_1042 248
600 3300050511 nmdc:mga08y16_25755_c1 nmdc:mga08y16_25755_c1_166_915 248
601 3300050512 nmdc:mga0n895_128_c1 nmdc:mga0n895_128_c1_27715_28461 248
602 3300050512 nmdc:mga0n895_36785_c1 nmdc:mga0n895_36785_c1_3852_4601 248
603 3300050513 nmdc:mga0rr50_106_c1 nmdc:mga0rr50_106_c1_11863_12609 248
604 3300050513 nmdc:mga0rr50_217255_c1 nmdc:mga0rr50_217255_c1_312_1058 248
605 3300050513 nmdc:mga0rr50_218848_c1 nmdc:mga0rr50_218848_c1_490_1236 248
606 3300050513 nmdc:mga0rr50_6762_c1 nmdc:mga0rr50_6762_c1_1582_2331 248
607 3300050514 nmdc:mga08x19_104675_c1 nmdc:mga08x19_104675_c1_599_1345 248
608 3300050514 nmdc:mga08x19_188419_c1 nmdc:mga08x19_188419_c1_303_1049 248
609 3300050514 nmdc:mga08x19_319818_c1 nmdc:mga08x19_319818_c1_120_866 248
610 3300050514 nmdc:mga08x19_3369_c1 nmdc:mga08x19_3369_c1_8159_8908 248
611 3300050515 nmdc:mga0a205_1541_c1 nmdc:mga0a205_1541_c1_8311_9057 248
612 3300053085 Ga0495619_0102639 Ga0495619_0102639_1028_1774 248
613 3300053096 Ga0500641_0015952 Ga0500641_0015952_356_1105 248
614 3300053148 Ga0500590_081311 Ga0500590_081311_174_920 248
615 3300054114 Ga0501084_0057219 Ga0501084_0057219_1116_1865 248
616 3300054114 Ga0501084_0429735 Ga0501084_0429735_58_807 248
617 3300060353 Ga0501082_0003063 Ga0501082_0003063_6280_7029 248
618 3300060353 Ga0501082_0271230 Ga0501082_0271230_192_941 248
619 3300061734 Ga0530510_0077267 Ga0530510_0077267_743_1492 248
620 3300061734 Ga0530510_0133320 Ga0530510_0133320_1044_1793 248
621 2162886012 MBSR1b_contig_7561224 MBSR1b_0664.00007070 249
622 3300000546 LJNas_1000076 LJNas_10000769 249
623 3300002074 JGI24748J21848_1002646 JGI24748J21848_10026462 249
624 3300002239 JGI24034J26672_10004087 JGI24034J26672_100040872 249
625 3300005327 Ga0070658_10033292 Ga0070658_100332922 249
626 3300005328 Ga0070676_10001008 Ga0070676_1000100814 249
627 3300005329 Ga0070683_100015693 Ga0070683_1000156935 249
628 3300005329 Ga0070683_100073999 Ga0070683_1000739993 249
629 3300005329 Ga0070683_100114547 Ga0070683_1001145472 249
630 3300005330 Ga0070690_100002659 Ga0070690_10000265910 249
631 3300005331 Ga0070670_100003376 Ga0070670_10000337610 249
632 3300005331 Ga0070670_100019753 Ga0070670_1000197537 249
633 3300005333 Ga0070677_10034306 Ga0070677_100343062 249
634 3300005334 Ga0068869_100005230 Ga0068869_1000052309 249
635 3300005334 Ga0068869_100053048 Ga0068869_1000530483 249
636 3300005335 Ga0070666_10077472 Ga0070666_100774723 249
637 3300005336 Ga0070680_100163309 Ga0070680_1001633091 249
638 3300005337 Ga0070682_100057810 Ga0070682_1000578103 249
639 3300005338 Ga0068868_100010878 Ga0068868_1000108784 249
640 3300005339 Ga0070660_100006036 Ga0070660_1000060363 249
641 3300005340 Ga0070689_100003010 Ga0070689_1000030108 249
642 3300005341 Ga0070691_10064057 Ga0070691_100640571 249
643 3300005343 Ga0070687_100054676 Ga0070687_1000546763 249
644 3300005344 Ga0070661_100003579 Ga0070661_1000035798 249
645 3300005347 Ga0070668_100006090 Ga0070668_10000609010 249
646 3300005354 Ga0070675_100004241 Ga0070675_10000424111 249
647 3300005355 Ga0070671_100057370 Ga0070671_1000573703 249
648 3300005364 Ga0070673_100005685 Ga0070673_1000056857 249
649 3300005364 Ga0070673_100049255 Ga0070673_1000492553 249
650 3300005365 Ga0070688_100002330 Ga0070688_1000023307 249
651 3300005365 Ga0070688_100046328 Ga0070688_1000463284 249
652 3300005366 Ga0070659_100002864 Ga0070659_1000028643 249
653 3300005367 Ga0070667_100355255 Ga0070667_1003552551 249
654 3300005434 Ga0070709_10001917 Ga0070709_100019175 249
655 3300005434 Ga0070709_10017128 Ga0070709_100171284 249
656 3300005434 Ga0070709_10033161 Ga0070709_100331612 249
657 3300005434 Ga0070709_10113160 Ga0070709_101131602 249
658 3300005435 Ga0070714_100000027 Ga0070714_10000002768 249
659 3300005435 Ga0070714_100003569 Ga0070714_1000035697 249
660 3300005435 Ga0070714_100006599 Ga0070714_1000065992 249
661 3300005435 Ga0070714_100032502 Ga0070714_1000325022 249
662 3300005435 Ga0070714_100066916 Ga0070714_1000669163 249
663 3300005435 Ga0070714_100318450 Ga0070714_1003184502 249
664 3300005435 Ga0070714_100444800 Ga0070714_1004448001 249
665 3300005436 Ga0070713_100000116 Ga0070713_1000001169 249
666 3300005436 Ga0070713_100001584 Ga0070713_10000158414 249
667 3300005436 Ga0070713_100011324 Ga0070713_1000113244 249
668 3300005436 Ga0070713_100012740 Ga0070713_1000127404 249
669 3300005436 Ga0070713_100014620 Ga0070713_1000146203 249
670 3300005436 Ga0070713_100097063 Ga0070713_1000970632 249
671 3300005436 Ga0070713_100193769 Ga0070713_1001937692 249
672 3300005436 Ga0070713_100300545 Ga0070713_1003005451 249
673 3300005437 Ga0070710_10003989 Ga0070710_100039896 249
674 3300005437 Ga0070710_10055019 Ga0070710_100550193 249
675 3300005437 Ga0070710_10127944 Ga0070710_101279442 249
676 3300005439 Ga0070711_100000206 Ga0070711_10000020623 249
677 3300005439 Ga0070711_100003497 Ga0070711_1000034976 249
678 3300005439 Ga0070711_100005166 Ga0070711_1000051664 249
679 3300005439 Ga0070711_100023104 Ga0070711_1000231042 249
680 3300005439 Ga0070711_100071120 Ga0070711_1000711202 249
681 3300005439 Ga0070711_100310011 Ga0070711_1003100111 249
682 3300005440 Ga0070705_100176677 Ga0070705_1001766773 249
683 3300005444 Ga0070694_100007431 Ga0070694_1000074313 249
684 3300005444 Ga0070694_100243781 Ga0070694_1002437812 249
685 3300005445 Ga0070708_100007752 Ga0070708_1000077525 249
686 3300005445 Ga0070708_100011623 Ga0070708_1000116233 249
687 3300005445 Ga0070708_100031502 Ga0070708_1000315024 249
688 3300005445 Ga0070708_100033307 Ga0070708_1000333075 249
689 3300005445 Ga0070708_100035322 Ga0070708_1000353226 249
690 3300005455 Ga0070663_100094977 Ga0070663_1000949773 249
691 3300005455 Ga0070663_100499271 Ga0070663_1004992711 249
692 3300005456 Ga0070678_100097304 Ga0070678_1000973041 249
693 3300005457 Ga0070662_100016346 Ga0070662_1000163466 249
694 3300005458 Ga0070681_10001816 Ga0070681_1000181612 249
695 3300005458 Ga0070681_10009561 Ga0070681_100095614 249
696 3300005459 Ga0068867_100005043 Ga0068867_10000504310 249
697 3300005459 Ga0068867_100007820 Ga0068867_1000078203 249
698 3300005466 Ga0070685_10000631 Ga0070685_1000063113 249
699 3300005467 Ga0070706_100008753 Ga0070706_10000875311 249
700 3300005467 Ga0070706_100024824 Ga0070706_1000248244 249
701 3300005467 Ga0070706_100036214 Ga0070706_1000362142 249
702 3300005467 Ga0070706_100051162 Ga0070706_1000511622 249
703 3300005467 Ga0070706_100058258 Ga0070706_1000582583 249
704 3300005467 Ga0070706_100099044 Ga0070706_1000990444 249
705 3300005468 Ga0070707_100018159 Ga0070707_1000181596 249
706 3300005468 Ga0070707_100045396 Ga0070707_1000453963 249
707 3300005468 Ga0070707_100055976 Ga0070707_1000559764 249
708 3300005468 Ga0070707_100092570 Ga0070707_1000925704 249
709 3300005471 Ga0070698_100016069 Ga0070698_1000160692 249
710 3300005471 Ga0070698_100018824 Ga0070698_1000188248 249
711 3300005471 Ga0070698_100102525 Ga0070698_1001025253 249
712 3300005518 Ga0070699_100003678 Ga0070699_1000036788 249
713 3300005518 Ga0070699_100042118 Ga0070699_1000421185 249
714 3300005518 Ga0070699_100060971 Ga0070699_1000609712 249
715 3300005518 Ga0070699_100067126 Ga0070699_1000671261 249
716 3300005518 Ga0070699_100093641 Ga0070699_1000936412 249
717 3300005530 Ga0070679_100175859 Ga0070679_1001758592 249
718 3300005530 Ga0070679_100215243 Ga0070679_1002152432 249
719 3300005535 Ga0070684_100001110 Ga0070684_10000111013 249
720 3300005535 Ga0070684_100013201 Ga0070684_1000132013 249
721 3300005536 Ga0070697_100000099 Ga0070697_10000009953 249
722 3300005536 Ga0070697_100000320 Ga0070697_1000003203 249
723 3300005536 Ga0070697_100038435 Ga0070697_1000384352 249
724 3300005536 Ga0070697_100228482 Ga0070697_1002284822 249
725 3300005539 Ga0068853_100004528 Ga0068853_1000045289 249
726 3300005539 Ga0068853_100277651 Ga0068853_1002776511 249
727 3300005543 Ga0070672_100002695 Ga0070672_1000026952 249
728 3300005544 Ga0070686_100065651 Ga0070686_1000656513 249
729 3300005544 Ga0070686_100076043 Ga0070686_1000760433 249
730 3300005547 Ga0070693_100020497 Ga0070693_1000204972 249
731 3300005548 Ga0070665_100233284 Ga0070665_1002332842 249
732 3300005549 Ga0070704_100014874 Ga0070704_1000148743 249
733 3300005549 Ga0070704_100391093 Ga0070704_1003910931 249
734 3300005563 Ga0068855_100002199 Ga0068855_10000219917 249
735 3300005563 Ga0068855_100101569 Ga0068855_1001015692 249
736 3300005563 Ga0068855_100147089 Ga0068855_1001470892 249
737 3300005563 Ga0068855_100226540 Ga0068855_1002265402 249
738 3300005564 Ga0070664_100004464 Ga0070664_1000044645 249
739 3300005564 Ga0070664_100021327 Ga0070664_1000213276 249
740 3300005577 Ga0068857_100000130 Ga0068857_10000013033 249
741 3300005577 Ga0068857_100006956 Ga0068857_10000695611 249
742 3300005577 Ga0068857_100029418 Ga0068857_1000294184 249
743 3300005577 Ga0068857_100082988 Ga0068857_1000829884 249
744 3300005578 Ga0068854_100007795 Ga0068854_1000077954 249
745 3300005578 Ga0068854_100009053 Ga0068854_1000090533 249
746 3300005614 Ga0068856_100002284 Ga0068856_1000022844 249
747 3300005614 Ga0068856_100009064 Ga0068856_1000090649 249
748 3300005614 Ga0068856_100009253 Ga0068856_1000092534 249
749 3300005614 Ga0068856_100012319 Ga0068856_1000123197 249
750 3300005614 Ga0068856_100034344 Ga0068856_1000343442 249
751 3300005614 Ga0068856_100097143 Ga0068856_1000971433 249
752 3300005614 Ga0068856_100212005 Ga0068856_1002120053 249
753 3300005614 Ga0068856_100262200 Ga0068856_1002622003 249
754 3300005614 Ga0068856_100854966 Ga0068856_1008549661 249
755 3300005615 Ga0070702_100013668 Ga0070702_1000136683 249
756 3300005616 Ga0068852_100086107 Ga0068852_1000861072 249
757 3300005617 Ga0068859_100000387 Ga0068859_10000038731 249
758 3300005617 Ga0068859_100004358 Ga0068859_10000435815 249
759 3300005617 Ga0068859_100037751 Ga0068859_1000377515 249
760 3300005618 Ga0068864_100004181 Ga0068864_1000041815 249
761 3300005618 Ga0068864_100036872 Ga0068864_1000368726 249
762 3300005618 Ga0068864_100105641 Ga0068864_1001056412 249
763 3300005618 Ga0068864_100235187 Ga0068864_1002351872 249
764 3300005618 Ga0068864_100305356 Ga0068864_1003053562 249
765 3300005618 Ga0068864_100837209 Ga0068864_1008372091 249
766 3300005718 Ga0068866_10001371 Ga0068866_100013713 249
767 3300005718 Ga0068866_10004664 Ga0068866_100046644 249
768 3300005719 Ga0068861_100003909 Ga0068861_10000390912 249
769 3300005834 Ga0068851_10007389 Ga0068851_100073897 249
770 3300005840 Ga0068870_10011012 Ga0068870_100110123 249
771 3300005840 Ga0068870_10061578 Ga0068870_100615782 249
772 3300005841 Ga0068863_100025391 Ga0068863_1000253918 249
773 3300005841 Ga0068863_100089057 Ga0068863_1000890573 249
774 3300005841 Ga0068863_100145531 Ga0068863_1001455312 249
775 3300005841 Ga0068863_100393815 Ga0068863_1003938152 249
776 3300005842 Ga0068858_100010831 Ga0068858_1000108316 249
777 3300005842 Ga0068858_100013406 Ga0068858_1000134064 249
778 3300005842 Ga0068858_100135590 Ga0068858_1001355903 249
779 3300005843 Ga0068860_100018027 Ga0068860_1000180274 249
780 3300005843 Ga0068860_100026346 Ga0068860_1000263463 249
781 3300005843 Ga0068860_100029437 Ga0068860_1000294371 249
782 3300005843 Ga0068860_100148797 Ga0068860_1001487972 249
783 3300005844 Ga0068862_100069844 Ga0068862_1000698443 249
784 3300005844 Ga0068862_100098556 Ga0068862_1000985562 249
785 3300006028 Ga0070717_10005465 Ga0070717_100054651 249
786 3300006028 Ga0070717_10009827 Ga0070717_100098274 249
787 3300006028 Ga0070717_10012522 Ga0070717_100125225 249
788 3300006028 Ga0070717_10029001 Ga0070717_100290012 249
789 3300006028 Ga0070717_10053288 Ga0070717_100532885 249
790 3300006028 Ga0070717_10073761 Ga0070717_100737612 249
791 3300006028 Ga0070717_10091874 Ga0070717_100918742 249
792 3300006028 Ga0070717_10092374 Ga0070717_100923744 249
793 3300006028 Ga0070717_10137636 Ga0070717_101376363 249
794 3300006163 Ga0070715_10002793 Ga0070715_100027932 249
795 3300006163 Ga0070715_10192294 Ga0070715_101922941 249
796 3300006173 Ga0070716_100000328 Ga0070716_10000032811 249
797 3300006173 Ga0070716_100022002 Ga0070716_1000220021 249
798 3300006173 Ga0070716_100025558 Ga0070716_1000255584 249
799 3300006173 Ga0070716_100042017 Ga0070716_1000420173 249
800 3300006175 Ga0070712_100000223 Ga0070712_1000002234 249
801 3300006175 Ga0070712_100000576 Ga0070712_1000005769 249
802 3300006175 Ga0070712_100000641 Ga0070712_1000006419 249
803 3300006175 Ga0070712_100010096 Ga0070712_1000100963 249
804 3300006175 Ga0070712_100054526 Ga0070712_1000545262 249
805 3300006175 Ga0070712_100393083 Ga0070712_1003930832 249
806 3300006237 Ga0097621_100001910 Ga0097621_10000191011 249
807 3300006237 Ga0097621_100032544 Ga0097621_1000325445 249
808 3300006237 Ga0097621_100036732 Ga0097621_1000367324 249
809 3300006237 Ga0097621_100080074 Ga0097621_1000800741 249
810 3300006358 Ga0068871_100000924 Ga0068871_10000092413 249
811 3300006358 Ga0068871_100049109 Ga0068871_1000491092 249
812 3300006358 Ga0068871_100059137 Ga0068871_1000591372 249
813 3300006358 Ga0068871_100074199 Ga0068871_1000741992 249
814 3300006844 Ga0075428_100147056 Ga0075428_1001470564 249
815 3300006846 Ga0075430_100176196 Ga0075430_1001761962 249
816 3300006852 Ga0075433_10031796 Ga0075433_100317962 249
817 3300006852 Ga0075433_10094046 Ga0075433_100940461 249
818 3300006852 Ga0075433_10182634 Ga0075433_101826343 249
819 3300006852 Ga0075433_10330472 Ga0075433_103304721 249
820 3300006871 Ga0075434_100015527 Ga0075434_1000155276 249
821 3300006871 Ga0075434_100037402 Ga0075434_1000374023 249
822 3300006871 Ga0075434_100051482 Ga0075434_1000514822 249
823 3300006871 Ga0075434_100446672 Ga0075434_1004466721 249
824 3300006880 Ga0075429_100333547 Ga0075429_1003335472 249
825 3300006881 Ga0068865_100000910 Ga0068865_10000091016 249
826 3300006881 Ga0068865_100011767 Ga0068865_1000117674 249
827 3300006914 Ga0075436_100022463 Ga0075436_1000224633 249
828 3300006914 Ga0075436_100164802 Ga0075436_1001648021 249
829 3300006914 Ga0075436_100350458 Ga0075436_1003504581 249
830 3300006931 Ga0097620_100000387 Ga0097620_1000003874 249
831 3300006931 Ga0097620_100004358 Ga0097620_1000043583 249
832 3300006931 Ga0097620_100037751 Ga0097620_1000377512 249
833 3300007076 Ga0075435_100036722 Ga0075435_1000367221 249
834 3300007076 Ga0075435_100155781 Ga0075435_1001557812 249
835 3300007076 Ga0075435_100162334 Ga0075435_1001623343 249
836 3300007076 Ga0075435_100395004 Ga0075435_1003950042 249
837 3300009011 Ga0105251_10201596 Ga0105251_102015961 249
838 3300009092 Ga0105250_10032350 Ga0105250_100323501 249
839 3300009092 Ga0105250_10041336 Ga0105250_100413362 249
840 3300009093 Ga0105240_10020118 Ga0105240_100201186 249
841 3300009093 Ga0105240_10051093 Ga0105240_100510934 249
842 3300009093 Ga0105240_10172503 Ga0105240_101725031 249
843 3300009093 Ga0105240_10471485 Ga0105240_104714851 249
844 3300009094 Ga0111539_10430493 Ga0111539_104304933 249
845 3300009098 Ga0105245_10005678 Ga0105245_100056783 249
846 3300009098 Ga0105245_10164828 Ga0105245_101648281 249
847 3300009101 Ga0105247_10000753 Ga0105247_100007533 249
848 3300009101 Ga0105247_10592189 Ga0105247_105921891 249
849 3300009147 Ga0114129_10229914 Ga0114129_102299142 249
850 3300009147 Ga0114129_10256529 Ga0114129_102565292 249
851 3300009147 Ga0114129_10261688 Ga0114129_102616882 249
852 3300009174 Ga0105241_10007497 Ga0105241_100074977 249
853 3300009174 Ga0105241_10019849 Ga0105241_100198493 249
854 3300009174 Ga0105241_10074453 Ga0105241_100744533 249
855 3300009174 Ga0105241_10103880 Ga0105241_101038802 249
856 3300009176 Ga0105242_10018075 Ga0105242_100180754 249
857 3300009176 Ga0105242_10131051 Ga0105242_101310513 249
858 3300009177 Ga0105248_10007875 Ga0105248_100078754 249
859 3300009177 Ga0105248_10013270 Ga0105248_100132708 249
860 3300009177 Ga0105248_10191238 Ga0105248_101912382 249
861 3300009545 Ga0105237_10085811 Ga0105237_100858113 249
862 3300009545 Ga0105237_10288662 Ga0105237_102886622 249
863 3300009551 Ga0105238_10000250 Ga0105238_100002504 249
864 3300009551 Ga0105238_10060143 Ga0105238_100601436 249
865 3300009551 Ga0105238_10242972 Ga0105238_102429722 249
866 3300009551 Ga0105238_10251455 Ga0105238_102514551 249
867 3300009553 Ga0105249_10023639 Ga0105249_100236394 249
868 3300009553 Ga0105249_10067209 Ga0105249_100672092 249
869 3300010159 Ga0099796_10030414 Ga0099796_100304142 249
870 3300010159 Ga0099796_10055868 Ga0099796_100558681 249
871 3300010375 Ga0105239_10025161 Ga0105239_100251613 249
872 3300010375 Ga0105239_10134708 Ga0105239_101347081 249
873 3300010375 Ga0105239_10689869 Ga0105239_106898691 249
874 3300011119 Ga0105246_10002717 Ga0105246_1000271712 249
875 3300011119 Ga0105246_10532008 Ga0105246_105320081 249
876 3300011119 Ga0105246_10569065 Ga0105246_105690651 249
877 3300013100 Ga0157373_10025425 Ga0157373_100254256 249
878 3300013100 Ga0157373_10096437 Ga0157373_100964372 249
879 3300013102 Ga0157371_10039015 Ga0157371_100390151 249
880 3300013102 Ga0157371_10041241 Ga0157371_100412413 249
881 3300013105 Ga0157369_10000689 Ga0157369_100006894 249
882 3300013105 Ga0157369_10018965 Ga0157369_100189658 249
883 3300013105 Ga0157369_10347522 Ga0157369_103475222 249
884 3300013296 Ga0157374_10000191 Ga0157374_100001914 249
885 3300013296 Ga0157374_10002601 Ga0157374_1000260110 249
886 3300013296 Ga0157374_10006970 Ga0157374_100069708 249
887 3300013296 Ga0157374_10012721 Ga0157374_100127218 249
888 3300013296 Ga0157374_10067693 Ga0157374_100676933 249
889 3300013297 Ga0157378_10000008 Ga0157378_10000008133 249
890 3300013297 Ga0157378_10000062 Ga0157378_1000006226 249
891 3300013306 Ga0163162_10020552 Ga0163162_100205526 249
892 3300013306 Ga0163162_10291008 Ga0163162_102910082 249
893 3300013307 Ga0157372_10001774 Ga0157372_1000177415 249
894 3300013307 Ga0157372_10002883 Ga0157372_1000288310 249
895 3300013307 Ga0157372_10002972 Ga0157372_1000297210 249
896 3300013307 Ga0157372_10003471 Ga0157372_1000347110 249
897 3300013307 Ga0157372_10038564 Ga0157372_100385646 249
898 3300013307 Ga0157372_10070632 Ga0157372_100706323 249
899 3300013307 Ga0157372_10112960 Ga0157372_101129603 249
900 3300013307 Ga0157372_10350131 Ga0157372_103501311 249
901 3300014325 Ga0163163_10002286 Ga0163163_100022866 249
902 3300014325 Ga0163163_10027815 Ga0163163_100278156 249
903 3300014325 Ga0163163_10135562 Ga0163163_101355623 249
904 3300014497 Ga0182008_10075758 Ga0182008_100757582 249
905 3300014745 Ga0157377_10000776 Ga0157377_100007764 249
906 3300014968 Ga0157379_10005265 Ga0157379_100052657 249
907 3300014969 Ga0157376_10005118 Ga0157376_100051187 249
908 3300014969 Ga0157376_10014704 Ga0157376_100147042 249
909 3300014969 Ga0157376_10046492 Ga0157376_100464921 249
910 3300014969 Ga0157376_10059573 Ga0157376_100595732 249
911 3300015261 Ga0182006_1032196 Ga0182006_10321962 249
912 3300015262 Ga0182007_10014680 Ga0182007_100146802 249
913 3300017792 Ga0163161_10001844 Ga0163161_1000184415 249
914 3300019161 Ga0184602_105132 Ga0184602_1051321 249
915 3300019179 Ga0184593_107928 Ga0184593_1079281 249
916 3300019188 Ga0184599_138199 Ga0184599_1381991 249
917 3300020069 Ga0197907_10754001 Ga0197907_107540011 249
918 3300020070 Ga0206356_10381687 Ga0206356_103816871 249
919 3300020080 Ga0206350_10082148 Ga0206350_100821481 249
920 3300020080 Ga0206350_11323507 Ga0206350_113235072 249
921 3300021441 Ga0213871_10097178 Ga0213871_100971781 249
922 3300022730 Ga0224570_100013 Ga0224570_1000135 249
923 3300022732 Ga0224569_100722 Ga0224569_1007222 249
924 3300022732 Ga0224569_100768 Ga0224569_1007682 249
925 3300022734 Ga0224571_100004 Ga0224571_1000042 249
926 3300024225 Ga0224572_1003750 Ga0224572_10037502 249
927 3300024225 Ga0224572_1004024 Ga0224572_10040243 249
928 3300024225 Ga0224572_1006556 Ga0224572_10065562 249
929 3300024225 Ga0224572_1013023 Ga0224572_10130232 249
930 3300024227 Ga0228598_1003345 Ga0228598_10033453 249
931 3300024227 Ga0228598_1004635 Ga0228598_10046353 249
932 3300024227 Ga0228598_1004977 Ga0228598_10049773 249
933 3300025315 Ga0207697_10002261 Ga0207697_100022613 249
934 3300025321 Ga0207656_10039757 Ga0207656_100397572 249
935 3300025885 Ga0207653_10073310 Ga0207653_100733101 249
936 3300025898 Ga0207692_10011687 Ga0207692_100116873 249
937 3300025898 Ga0207692_10042333 Ga0207692_100423332 249
938 3300025898 Ga0207692_10097537 Ga0207692_100975371 249
939 3300025898 Ga0207692_10168678 Ga0207692_101686781 249
940 3300025898 Ga0207692_10215495 Ga0207692_102154952 249
941 3300025898 Ga0207692_10238970 Ga0207692_102389702 249
942 3300025899 Ga0207642_10022708 Ga0207642_100227082 249
943 3300025900 Ga0207710_10019482 Ga0207710_100194824 249
944 3300025901 Ga0207688_10036273 Ga0207688_100362733 249
945 3300025903 Ga0207680_10005621 Ga0207680_100056213 249
946 3300025904 Ga0207647_10019793 Ga0207647_100197935 249
947 3300025904 Ga0207647_10115782 Ga0207647_101157822 249
948 3300025905 Ga0207685_10083051 Ga0207685_100830511 249
949 3300025906 Ga0207699_10001688 Ga0207699_100016885 249
950 3300025906 Ga0207699_10012342 Ga0207699_100123424 249
951 3300025906 Ga0207699_10024088 Ga0207699_100240881 249
952 3300025906 Ga0207699_10033756 Ga0207699_100337562 249
953 3300025906 Ga0207699_10319705 Ga0207699_103197051 249
954 3300025907 Ga0207645_10000029 Ga0207645_1000002971 249
955 3300025908 Ga0207643_10000849 Ga0207643_1000084915 249
956 3300025908 Ga0207643_10115483 Ga0207643_101154831 249
957 3300025910 Ga0207684_10002600 Ga0207684_100026004 249
958 3300025910 Ga0207684_10087320 Ga0207684_100873204 249
959 3300025910 Ga0207684_10121838 Ga0207684_101218384 249
960 3300025910 Ga0207684_10182120 Ga0207684_101821202 249
961 3300025911 Ga0207654_10198613 Ga0207654_101986131 249
962 3300025912 Ga0207707_10000530 Ga0207707_1000053012 249
963 3300025912 Ga0207707_10016370 Ga0207707_100163704 249
964 3300025912 Ga0207707_10026910 Ga0207707_100269102 249
965 3300025913 Ga0207695_10027014 Ga0207695_100270146 249
966 3300025913 Ga0207695_10553203 Ga0207695_105532031 249
967 3300025914 Ga0207671_10033268 Ga0207671_100332685 249
968 3300025914 Ga0207671_10179638 Ga0207671_101796382 249
969 3300025915 Ga0207693_10000004 Ga0207693_10000004104 249
970 3300025915 Ga0207693_10000661 Ga0207693_1000066118 249
971 3300025915 Ga0207693_10001443 Ga0207693_100014439 249
972 3300025915 Ga0207693_10002150 Ga0207693_100021508 249
973 3300025915 Ga0207693_10016761 Ga0207693_100167614 249
974 3300025915 Ga0207693_10308929 Ga0207693_103089291 249
975 3300025916 Ga0207663_10003220 Ga0207663_100032204 249
976 3300025916 Ga0207663_10009282 Ga0207663_100092823 249
977 3300025916 Ga0207663_10011479 Ga0207663_100114791 249
978 3300025916 Ga0207663_10035458 Ga0207663_100354583 249
979 3300025916 Ga0207663_10235189 Ga0207663_102351892 249
980 3300025919 Ga0207657_10002176 Ga0207657_1000217616 249
981 3300025920 Ga0207649_10001516 Ga0207649_100015165 249
982 3300025920 Ga0207649_10504032 Ga0207649_105040321 249
983 3300025921 Ga0207652_10046581 Ga0207652_100465814 249
984 3300025921 Ga0207652_10138568 Ga0207652_101385681 249
985 3300025922 Ga0207646_10000808 Ga0207646_1000080812 249
986 3300025922 Ga0207646_10020426 Ga0207646_100204263 249
987 3300025922 Ga0207646_10051322 Ga0207646_100513221 249
988 3300025922 Ga0207646_10151318 Ga0207646_101513181 249
989 3300025923 Ga0207681_10044206 Ga0207681_100442061 249
990 3300025923 Ga0207681_10060531 Ga0207681_100605312 249
991 3300025924 Ga0207694_10000214 Ga0207694_1000021430 249
992 3300025924 Ga0207694_10175180 Ga0207694_101751802 249
993 3300025925 Ga0207650_10000040 Ga0207650_100000408 249
994 3300025925 Ga0207650_10581527 Ga0207650_105815271 249
995 3300025926 Ga0207659_10005511 Ga0207659_100055116 249
996 3300025927 Ga0207687_10027683 Ga0207687_100276831 249
997 3300025927 Ga0207687_10045809 Ga0207687_100458091 249
998 3300025927 Ga0207687_10303522 Ga0207687_103035222 249
999 3300025928 Ga0207700_10000612 Ga0207700_1000061215 249
1000 3300025928 Ga0207700_10010985 Ga0207700_100109854 249
1001 3300025928 Ga0207700_10029257 Ga0207700_100292574 249
1002 3300025928 Ga0207700_10053575 Ga0207700_100535751 249
1003 3300025928 Ga0207700_10059358 Ga0207700_100593583 249
1004 3300025928 Ga0207700_10131329 Ga0207700_101313291 249
1005 3300025928 Ga0207700_10460847 Ga0207700_104608471 249
1006 3300025928 Ga0207700_10649509 Ga0207700_106495091 249
1007 3300025929 Ga0207664_10002204 Ga0207664_100022043 249
1008 3300025929 Ga0207664_10006733 Ga0207664_100067334 249
1009 3300025929 Ga0207664_10028457 Ga0207664_100284574 249
1010 3300025929 Ga0207664_10055867 Ga0207664_100558673 249
1011 3300025929 Ga0207664_10056304 Ga0207664_100563042 249
1012 3300025929 Ga0207664_10818358 Ga0207664_108183581 249
1013 3300025931 Ga0207644_10008631 Ga0207644_100086319 249
1014 3300025932 Ga0207690_10349202 Ga0207690_103492022 249
1015 3300025933 Ga0207706_10000772 Ga0207706_1000077223 249
1016 3300025934 Ga0207686_10040379 Ga0207686_100403796 249
1017 3300025936 Ga0207670_10001487 Ga0207670_100014877 249
1018 3300025936 Ga0207670_10057297 Ga0207670_100572972 249
1019 3300025938 Ga0207704_10013557 Ga0207704_100135574 249
1020 3300025938 Ga0207704_10040152 Ga0207704_100401522 249
1021 3300025939 Ga0207665_10000225 Ga0207665_1000022525 249
1022 3300025939 Ga0207665_10003927 Ga0207665_100039271 249
1023 3300025939 Ga0207665_10011504 Ga0207665_100115042 249
1024 3300025939 Ga0207665_10019554 Ga0207665_100195543 249
1025 3300025939 Ga0207665_10025473 Ga0207665_100254732 249
1026 3300025939 Ga0207665_10040011 Ga0207665_100400112 249
1027 3300025940 Ga0207691_10001145 Ga0207691_1000114518 249
1028 3300025941 Ga0207711_10005418 Ga0207711_100054183 249
1029 3300025941 Ga0207711_10006792 Ga0207711_100067926 249
1030 3300025941 Ga0207711_10210751 Ga0207711_102107512 249
1031 3300025942 Ga0207689_10000172 Ga0207689_1000017215 249
1032 3300025942 Ga0207689_10087853 Ga0207689_100878532 249
1033 3300025942 Ga0207689_10117329 Ga0207689_101173293 249
1034 3300025944 Ga0207661_10000473 Ga0207661_100004737 249
1035 3300025944 Ga0207661_10117176 Ga0207661_101171762 249
1036 3300025944 Ga0207661_10245681 Ga0207661_102456812 249
1037 3300025945 Ga0207679_10000589 Ga0207679_1000058910 249
1038 3300025945 Ga0207679_10011939 Ga0207679_100119392 249
1039 3300025949 Ga0207667_10000831 Ga0207667_100008314 249
1040 3300025949 Ga0207667_10016833 Ga0207667_100168334 249
1041 3300025949 Ga0207667_10108761 Ga0207667_101087613 249
1042 3300025949 Ga0207667_10227911 Ga0207667_102279112 249
1043 3300025949 Ga0207667_10235920 Ga0207667_102359202 249
1044 3300025960 Ga0207651_10005334 Ga0207651_100053343 249
1045 3300025960 Ga0207651_10017894 Ga0207651_100178945 249
1046 3300025961 Ga0207712_10070587 Ga0207712_100705872 249
1047 3300025961 Ga0207712_10514847 Ga0207712_105148471 249
1048 3300025981 Ga0207640_10005562 Ga0207640_100055623 249
1049 3300025981 Ga0207640_10437518 Ga0207640_104375181 249
1050 3300025986 Ga0207658_10003758 Ga0207658_100037588 249
1051 3300026023 Ga0207677_10019318 Ga0207677_100193183 249
1052 3300026023 Ga0207677_10059807 Ga0207677_100598072 249
1053 3300026023 Ga0207677_10092490 Ga0207677_100924902 249
1054 3300026035 Ga0207703_10003403 Ga0207703_1000340310 249
1055 3300026035 Ga0207703_10005448 Ga0207703_1000544811 249
1056 3300026035 Ga0207703_10040284 Ga0207703_100402844 249
1057 3300026035 Ga0207703_10109875 Ga0207703_101098753 249
1058 3300026035 Ga0207703_10171779 Ga0207703_101717792 249
1059 3300026041 Ga0207639_10015004 Ga0207639_100150042 249
1060 3300026041 Ga0207639_10252017 Ga0207639_102520172 249
1061 3300026067 Ga0207678_10005528 Ga0207678_100055282 249
1062 3300026078 Ga0207702_10000144 Ga0207702_1000014422 249
1063 3300026078 Ga0207702_10001499 Ga0207702_100014998 249
1064 3300026078 Ga0207702_10001741 Ga0207702_100017414 249
1065 3300026078 Ga0207702_10008844 Ga0207702_100088441 249
1066 3300026078 Ga0207702_10201911 Ga0207702_102019112 249
1067 3300026078 Ga0207702_10290846 Ga0207702_102908463 249
1068 3300026088 Ga0207641_10000009 Ga0207641_10000009365 249
1069 3300026088 Ga0207641_10007029 Ga0207641_100070294 249
1070 3300026088 Ga0207641_10007254 Ga0207641_100072544 249
1071 3300026088 Ga0207641_10066636 Ga0207641_100666363 249
1072 3300026088 Ga0207641_10217239 Ga0207641_102172393 249
1073 3300026089 Ga0207648_10001815 Ga0207648_1000181514 249
1074 3300026089 Ga0207648_10019319 Ga0207648_100193193 249
1075 3300026095 Ga0207676_10000058 Ga0207676_1000005837 249
1076 3300026095 Ga0207676_10013065 Ga0207676_100130652 249
1077 3300026095 Ga0207676_10090060 Ga0207676_100900602 249
1078 3300026095 Ga0207676_10131936 Ga0207676_101319362 249
1079 3300026095 Ga0207676_10695733 Ga0207676_106957331 249
1080 3300026116 Ga0207674_10000148 Ga0207674_1000014865 249
1081 3300026116 Ga0207674_10000502 Ga0207674_1000050236 249
1082 3300026116 Ga0207674_10024305 Ga0207674_100243053 249
1083 3300026118 Ga0207675_100330191 Ga0207675_1003301912 249
1084 3300026121 Ga0207683_10000583 Ga0207683_1000058331 249
1085 3300026142 Ga0207698_10007476 Ga0207698_100074763 249
1086 3300027866 Ga0209813_10009277 Ga0209813_100092773 249
1087 3300028016 Ga0265354_1003258 Ga0265354_10032582 249
1088 3300028017 Ga0265356_1001153 Ga0265356_10011532 249
1089 3300028017 Ga0265356_1001408 Ga0265356_10014083 249
1090 3300028036 Ga0265355_1000181 Ga0265355_10001812 249
1091 3300028379 Ga0268266_10005737 Ga0268266_100057374 249
1092 3300028380 Ga0268265_10009233 Ga0268265_100092336 249
1093 3300028380 Ga0268265_10049467 Ga0268265_100494673 249
1094 3300028381 Ga0268264_10006002 Ga0268264_100060022 249
1095 3300028381 Ga0268264_10026333 Ga0268264_100263332 249
1096 3300028381 Ga0268264_10120186 Ga0268264_101201862 249
1097 3300028381 Ga0268264_10155949 Ga0268264_101559492 249
1098 3300028800 Ga0265338_10008589 Ga0265338_100085896 249
1099 3300028800 Ga0265338_10063210 Ga0265338_100632102 249
1100 3300028800 Ga0265338_10103214 Ga0265338_101032142 249
1101 3300028800 Ga0265338_10258734 Ga0265338_102587341 249
1102 3300028800 Ga0265338_10261404 Ga0265338_102614041 249
1103 3300030760 Ga0265762_1000159 Ga0265762_10001597 249
1104 3300030760 Ga0265762_1002311 Ga0265762_10023112 249
1105 3300030760 Ga0265762_1003504 Ga0265762_10035043 249
1106 3300030760 Ga0265762_1005003 Ga0265762_10050031 249
1107 3300031090 Ga0265760_10000921 Ga0265760_100009213 249
1108 3300031090 Ga0265760_10001324 Ga0265760_100013247 249
1109 3300031090 Ga0265760_10003690 Ga0265760_100036902 249
1110 3300031090 Ga0265760_10012255 Ga0265760_100122551 249
1111 3300031241 Ga0265325_10013871 Ga0265325_100138714 249
1112 3300031241 Ga0265325_10020170 Ga0265325_100201704 249
1113 3300031247 Ga0265340_10032310 Ga0265340_100323101 249
1114 3300031249 Ga0265339_10023638 Ga0265339_100236382 249
1115 3300031344 Ga0265316_10013627 Ga0265316_100136272 249
1116 3300031344 Ga0265316_10025647 Ga0265316_100256471 249
1117 3300031344 Ga0265316_10363395 Ga0265316_103633951 249
1118 3300031711 Ga0265314_10019406 Ga0265314_100194062 249
1119 3300031712 Ga0265342_10056158 Ga0265342_100561581 249
1120 3300031712 Ga0265342_10134495 Ga0265342_101344952 249
1121 3300031712 Ga0265342_10143944 Ga0265342_101439442 249
1122 3300032120 Ga0316053_103904 Ga0316053_1039041 249
1123 3300032120 Ga0316053_104464 Ga0316053_1044641 249
1124 3300033547 Ga0316212_1003456 Ga0316212_10034562 249
1125 3300033547 Ga0316212_1012921 Ga0316212_10129211 249
1126 3300035083 Ga0373926_0055846 Ga0373926_0055846_606_1355 249
1127 3300035086 Ga0373934_0025447 Ga0373934_0025447_600_1349 249
1128 3300035111 Ga0373923_0003933 Ga0373923_0003933_3389_4138 249
1129 3300035111 Ga0373923_0052149 Ga0373923_0052149_577_1329 249
1130 3300035113 Ga0373936_0000856 Ga0373936_0000856_3442_4191 249
1131 3300035113 Ga0373936_0145327 Ga0373936_0145327_32_784 249
1132 3300035116 Ga0373945_0001747 Ga0373945_0001747_804_1553 249
1133 3300035116 Ga0373945_0019786 Ga0373945_0019786_1457_2206 249
1134 3300035117 Ga0373953_0028613 Ga0373953_0028613_443_1192 249
1135 3300035170 Ga0373943_0000085 Ga0373943_0000085_30539_31288 249
1136 3300035170 Ga0373943_0059566 Ga0373943_0059566_371_1120 249
1137 3300035170 Ga0373943_0083371 Ga0373943_0083371_623_1372 249
1138 3300035170 Ga0373943_0145244 Ga0373943_0145244_188_937 249
1139 3300035171 Ga0373946_0001570 Ga0373946_0001570_2370_3119 249
1140 3300035171 Ga0373946_0009592 Ga0373946_0009592_2365_3114 249
1141 3300035172 Ga0373955_0159611 Ga0373955_0159611_522_1274 249
1142 3300035410 Ga0373924_0022698 Ga0373924_0022698_1386_2135 249
1143 3300035410 Ga0373924_0030321 Ga0373924_0030321_264_1013 249
1144 3300035692 Ga0373935_0002799 Ga0373935_0002799_7277_8026 249
1145 3300035692 Ga0373935_0060654 Ga0373935_0060654_1308_2057 249
1146 3300035695 Ga0373927_0001082 Ga0373927_0001082_14930_15679 249
1147 3300035695 Ga0373927_0009002 Ga0373927_0009002_4140_4889 249
1148 3300035695 Ga0373927_0340936 Ga0373927_0340936_218_967 249
1149 3300035695 Ga0373927_0396530 Ga0373927_0396530_69_818 249
1150 3300035724 Ga0373933_0230341 Ga0373933_0230341_423_1175 249
1151 3300035725 Ga0373947_0001814 Ga0373947_0001814_8079_8828 249
1152 3300035725 Ga0373947_0006598 Ga0373947_0006598_2833_3582 249
1153 3300035725 Ga0373947_0015660 Ga0373947_0015660_2601_3350 249
1154 3300035725 Ga0373947_0362047 Ga0373947_0362047_90_839 249
1155 3300036401 Ga0373937_0190147 Ga0373937_0190147_139_891 249
1156 3300036401 Ga0373937_0248584 Ga0373937_0248584_216_965 249
1157 3300037068 Ga0373925_0005717 Ga0373925_0005717_1837_2586 249
1158 3300037068 Ga0373925_0053080 Ga0373925_0053080_560_1309 249
1159 3300037068 Ga0373925_0136730 Ga0373925_0136730_965_1714 249
1160 3300037068 Ga0373925_0160024 Ga0373925_0160024_654_1406 249
1161 3300039438 Ga0436360_0344137 Ga0436360_0344137_513_1262 249
1162 3300039438 Ga0436360_0737451 Ga0436360_0737451_194_943 249
1163 3300042876 Ga0451577_0278237 Ga0451577_0278237_361_1113 249
1164 3300044684 Ga0466966_0248923 Ga0466966_0248923_306_1058 249
1165 3300044693 Ga0466961_0113358 Ga0466961_0113358_912_1664 249
1166 3300044694 Ga0466963_0029507 Ga0466963_0029507_205_957 249
1167 3300044706 Ga0466964_0168050 Ga0466964_0168050_74_823 249
1168 3300045051 Ga0451576_0057623 Ga0451576_0057623_287_1036 249
1169 3300045051 Ga0451576_1170915 Ga0451576_1170915_23_772 249
1170 3300045976 Ga0466967_0085386 Ga0466967_0085386_1996_2745 249
1171 3300046454 Ga0495592_0148988 Ga0495592_0148988_356_1105 249
1172 3300046455 Ga0495603_0096726 Ga0495603_0096726_209_958 249
1173 3300046459 Ga0495629_0142814 Ga0495629_0142814_343_1092 249
1174 3300046463 Ga0495653_0108576 Ga0495653_0108576_836_1585 249
1175 3300046472 Ga0495580_0000196 Ga0495580_0000196_35157_35906 249
1176 3300046472 Ga0495580_0000263 Ga0495580_0000263_9599_10348 249
1177 3300046472 Ga0495580_0002001 Ga0495580_0002001_9441_10196 249
1178 3300046472 Ga0495580_0009505 Ga0495580_0009505_2728_3480 249
1179 3300046472 Ga0495580_0019453 Ga0495580_0019453_363_1112 249
1180 3300046472 Ga0495580_0214447 Ga0495580_0214447_147_899 249
1181 3300046472 Ga0495580_0312135 Ga0495580_0312135_99_848 249
1182 3300046473 Ga0495582_0006124 Ga0495582_0006124_5261_6010 249
1183 3300046473 Ga0495582_0041773 Ga0495582_0041773_763_1512 249
1184 3300046473 Ga0495582_0064761 Ga0495582_0064761_77_829 249
1185 3300046477 Ga0495664_0196801 Ga0495664_0196801_341_1090 249
1186 3300046491 Ga0495584_0028892 Ga0495584_0028892_1388_2137 249
1187 3300046516 Ga0495628_0095192 Ga0495628_0095192_616_1365 249
1188 3300046517 Ga0495630_0002739 Ga0495630_0002739_9928_10677 249
1189 3300046517 Ga0495630_0054243 Ga0495630_0054243_593_1342 249
1190 3300046517 Ga0495630_0177880 Ga0495630_0177880_820_1572 249
1191 3300046517 Ga0495630_0223107 Ga0495630_0223107_397_1146 249
1192 3300046531 Ga0495665_0041622 Ga0495665_0041622_1316_2065 249
1193 3300046531 Ga0495665_0052317 Ga0495665_0052317_1195_1944 249
1194 3300046543 Ga0495645_0066613 Ga0495645_0066613_663_1412 249
1195 3300046663 Ga0495635_0176563 Ga0495635_0176563_168_917 249
1196 3300046664 Ga0495659_0143338 Ga0495659_0143338_23_772 249
1197 3300046683 Ga0495658_0024007 Ga0495658_0024007_254_1003 249
1198 3300046690 Ga0495624_0048962 Ga0495624_0048962_1619_2368 249
1199 3300046690 Ga0495624_0151818 Ga0495624_0151818_257_1006 249
1200 3300047319 Ga0495674_0003000 Ga0495674_0003000_12947_13696 249
1201 3300047319 Ga0495674_0045081 Ga0495674_0045081_1321_2070 249
1202 3300047319 Ga0495674_0291643 Ga0495674_0291643_263_1015 249
1203 3300047322 Ga0495680_0113307 Ga0495680_0113307_762_1511 249
1204 3300048903 Ga0496100_0609586 Ga0496100_0609586_31_780 249
1205 3300048904 Ga0496101_0055802 Ga0496101_0055802_792_1541 249
1206 3300048905 Ga0496102_0373686 Ga0496102_0373686_58_807 249
1207 3300048906 Ga0496103_0025138 Ga0496103_0025138_1786_2535 249
1208 3300048907 Ga0496104_0203045 Ga0496104_0203045_44_793 249
1209 3300048907 Ga0496104_0353156 Ga0496104_0353156_351_1238 249
1210 3300048910 Ga0496107_0155877 Ga0496107_0155877_531_1280 249
1211 3300048911 Ga0496108_0000385 Ga0496108_0000385_13748_14497 249
1212 3300048912 Ga0496109_0000345 Ga0496109_0000345_38324_39073 249
1213 3300048913 Ga0496110_0002376 Ga0496110_0002376_4451_5200 249
1214 3300048914 Ga0496111_0006985 Ga0496111_0006985_548_1297 249
1215 3300048915 Ga0496112_0000152 Ga0496112_0000152_52_801 249
1216 3300048915 Ga0496112_0002005 Ga0496112_0002005_2941_3690 249
1217 3300048915 Ga0496112_0577960 Ga0496112_0577960_221_970 249
1218 3300048916 Ga0496113_0193836 Ga0496113_0193836_808_1557 249
1219 3300048917 Ga0496114_0106637 Ga0496114_0106637_1133_1885 249
1220 3300048917 Ga0496114_0689735 Ga0496114_0689735_76_825 249
1221 3300048918 Ga0496115_0007286 Ga0496115_0007286_6342_7091 249
1222 3300048918 Ga0496115_0226158 Ga0496115_0226158_451_1200 249
1223 3300048918 Ga0496115_0270272 Ga0496115_0270272_431_1180 249
1224 3300049589 Ga0501073_0078516 Ga0501073_0078516_1218_1967 249
1225 3300049593 Ga0501077_0160931 Ga0501077_0160931_164_913 249
1226 3300049744 Ga0501083_0210876 Ga0501083_0210876_402_1151 249
1227 3300050494 nmdc:mga06z11_117204_c1 nmdc:mga06z11_117204_c1_53_808 249
1228 3300050495 nmdc:mga04h51_13943_c1 nmdc:mga04h51_13943_c1_403_1158 249
1229 3300050507 nmdc:mga05p37_39487_c2 nmdc:mga05p37_39487_c2_2691_3446 249
1230 3300050507 nmdc:mga05p37_435638_c1 nmdc:mga05p37_435638_c1_480_1235 249
1231 3300050507 nmdc:mga05p37_64486_c1 nmdc:mga05p37_64486_c1_1363_2118 249
1232 3300050507 nmdc:mga05p37_713621_c1 nmdc:mga05p37_713621_c1_111_866 249
1233 3300050509 nmdc:mga0qj67_293224_c1 nmdc:mga0qj67_293224_c1_47_799 249
1234 3300050512 nmdc:mga0n895_106262_c1 nmdc:mga0n895_106262_c1_1051_1800 249
1235 3300050512 nmdc:mga0n895_481079_c1 nmdc:mga0n895_481079_c1_214_963 249
1236 3300050512 nmdc:mga0n895_596796_c1 nmdc:mga0n895_596796_c1_316_1071 249
1237 3300050513 nmdc:mga0rr50_238829_c1 nmdc:mga0rr50_238829_c1_428_1177 249
1238 3300050513 nmdc:mga0rr50_397884_c1 nmdc:mga0rr50_397884_c1_70_825 249
1239 3300050513 nmdc:mga0rr50_55865_c1 nmdc:mga0rr50_55865_c1_574_1326 249
1240 3300050514 nmdc:mga08x19_10698_c1 nmdc:mga08x19_10698_c1_2213_2962 249
1241 3300050514 nmdc:mga08x19_198439_c1 nmdc:mga08x19_198439_c1_460_1215 249
1242 3300050514 nmdc:mga08x19_460280_c1 nmdc:mga08x19_460280_c1_119_868 249
1243 3300050514 nmdc:mga08x19_6498_c1 nmdc:mga08x19_6498_c1_928_1677 249
1244 3300050515 nmdc:mga0a205_12062_c1 nmdc:mga0a205_12062_c1_3119_3868 249
1245 3300050515 nmdc:mga0a205_262919_c1 nmdc:mga0a205_262919_c1_738_1493 249
1246 3300050515 nmdc:mga0a205_361049_c1 nmdc:mga0a205_361049_c1_92_847 249
1247 3300053085 Ga0495619_0245827 Ga0495619_0245827_55_804 249
1248 3300054114 Ga0501084_0108162 Ga0501084_0108162_1166_1915 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

128

283

0.98

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

51

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.9066 6 243
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8993 6 243
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8037 3 242
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.7845 3 242
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.7778 5 244
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.989 28 74 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.958 83 244 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9267 19 79 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9176 83 244 3.30.70.980
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.904 83 238 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A1F4Q977-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.9864 80 249 GO:0005829
AF-A0A536RP66-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9854 1 135 GO:0003677
GO:0005829
AF-A0A2E2AKZ7-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9837 1 136 GO:0003677
GO:0005829
AF-A0A1F4Q977-F1-model_v4 TACO1/YebC-like second and third domain-containing protein 0.9807 80 249 GO:0005829
AF-A0A356A0F7-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9768 1 135 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
88.76 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map