F492155
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1247 | 374 | 2494 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0122093|Ga0496114_0122093_1121_2014 |
| Length | 277 |
| Sequence | MSPTRALVCVPTYNERDNVEALVRALGEVIDTTRDGVLVIDDGSPDGTGEIADRLAAELPWLEVLHRASKQGIGKAYLAGFERALETEAQLVLEMDCDFSHDPQDVPRLIATCEEGGADLALGSRWVAGGGTENWGLVRRAISRGGSLYARIVLGVGIRDLTGGFKCFRRTVLETIDLDAIAARGYGFQIEGTYRALRAGFRVVEIPIVFADRRVGESKMSGAIVLEAMRQVPILRWSRTSRCSSSSPRRGAGRARWRSAASTGSALRATASSPCRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 211 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 241 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.96 |
| Metatranscriptomes | 1.04 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 10.75 |
| Rhizosphere | 88.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496114_0122093 | 3300048917 | Bacteria | 2241 |
| 2 | ARcpr5oldR_c007068 | 3300000041 | Bacteria | 953 |
| 3 | ARSoilOldRDRAFT_c004193 | 3300000044 | Bacteria | 1228 |
| 4 | JGI24746J21847_1004841 | 3300001977 | Bacteria | 2112 |
| 5 | JGI24748J21848_1014522 | 3300002074 | Bacteria | 935 |
| 6 | JGI24738J21930_10000536 | 3300002075 | Bacteria | 10843 |
| 7 | JGI24742J22300_10012387 | 3300002244 | Bacteria | 1421 |
| 8 | JGI25406J46586_10010133 | 3300003203 | Bacteria | 4193 |
| 9 | Ga0058861_10137482 | 3300004800 | Bacteria | 2221 |
| 10 | Ga0065712_10161647 | 3300005290 | Bacteria | 1298 |
| 11 | Ga0065707_10232890 | 3300005295 | Bacteria | 1182 |
| 12 | Ga0065707_10269423 | 3300005295 | Bacteria | 1075 |
| 13 | Ga0070658_10026196 | 3300005327 | Bacteria | 4678 |
| 14 | Ga0070658_10048277 | 3300005327 | Bacteria | 3446 |
| 15 | Ga0070658_10079753 | 3300005327 | Bacteria | 2688 |
| 16 | Ga0070658_10618236 | 3300005327 | Bacteria | 939 |
| 17 | Ga0070683_100007038 | 3300005329 | Bacteria | 9469 |
| 18 | Ga0070683_100012866 | 3300005329 | Bacteria | 7282 |
| 19 | Ga0070683_100025624 | 3300005329 | Bacteria | 5299 |
| 20 | Ga0070683_100040855 | 3300005329 | Bacteria | 4265 |
| 21 | Ga0070683_100045798 | 3300005329 | Bacteria | 4038 |
| 22 | Ga0070683_100046267 | 3300005329 | Bacteria | 4019 |
| 23 | Ga0070683_100052394 | 3300005329 | Bacteria | 3780 |
| 24 | Ga0070683_100073451 | 3300005329 | Bacteria | 3194 |
| 25 | Ga0070683_100105879 | 3300005329 | Bacteria | 2651 |
| 26 | Ga0070683_100110237 | 3300005329 | Bacteria | 2596 |
| 27 | Ga0070683_100146871 | 3300005329 | Bacteria | 2235 |
| 28 | Ga0070683_100211226 | 3300005329 | Bacteria | 1844 |
| 29 | Ga0070683_100494262 | 3300005329 | Bacteria | 1168 |
| 30 | Ga0070690_100399288 | 3300005330 | Bacteria | 1009 |
| 31 | Ga0070670_100117879 | 3300005331 | Bacteria | 2289 |
| 32 | Ga0068869_100027430 | 3300005334 | Bacteria | 3970 |
| 33 | Ga0070680_100014576 | 3300005336 | Bacteria | 6148 |
| 34 | Ga0070680_100030031 | 3300005336 | Bacteria | 4365 |
| 35 | Ga0070680_100090743 | 3300005336 | Bacteria | 2529 |
| 36 | Ga0070680_100111995 | 3300005336 | Bacteria | 2272 |
| 37 | Ga0070680_100158780 | 3300005336 | Bacteria | 1900 |
| 38 | Ga0070680_100375212 | 3300005336 | Bacteria | 1211 |
| 39 | Ga0070680_100392085 | 3300005336 | Bacteria | 1183 |
| 40 | Ga0070682_100001353 | 3300005337 | Bacteria | 13833 |
| 41 | Ga0070682_100007910 | 3300005337 | Bacteria | 5984 |
| 42 | Ga0070682_100018051 | 3300005337 | Bacteria | 4118 |
| 43 | Ga0070682_100023542 | 3300005337 | Bacteria | 3657 |
| 44 | Ga0070682_100041918 | 3300005337 | Bacteria | 2823 |
| 45 | Ga0070682_100130539 | 3300005337 | Bacteria | 1700 |
| 46 | Ga0068868_100005041 | 3300005338 | Bacteria | 9274 |
| 47 | Ga0068868_100040136 | 3300005338 | Bacteria | 3641 |
| 48 | Ga0068868_100367957 | 3300005338 | Bacteria | 1235 |
| 49 | Ga0070660_100000720 | 3300005339 | Bacteria | 21933 |
| 50 | Ga0070660_100001920 | 3300005339 | Bacteria | 14322 |
| 51 | Ga0070660_100006496 | 3300005339 | Bacteria | 8110 |
| 52 | Ga0070660_100013436 | 3300005339 | Bacteria | 5873 |
| 53 | Ga0070660_100022102 | 3300005339 | Bacteria | 4699 |
| 54 | Ga0070660_100117548 | 3300005339 | Bacteria | 2120 |
| 55 | Ga0070689_100024550 | 3300005340 | Bacteria | 4522 |
| 56 | Ga0070691_10014143 | 3300005341 | Bacteria | 3659 |
| 57 | Ga0070691_10032167 | 3300005341 | Bacteria | 2464 |
| 58 | Ga0070687_100039215 | 3300005343 | Bacteria | 2379 |
| 59 | Ga0070661_100004013 | 3300005344 | Bacteria | 10119 |
| 60 | Ga0070661_100019730 | 3300005344 | Bacteria | 4805 |
| 61 | Ga0070661_100031756 | 3300005344 | Bacteria | 3819 |
| 62 | Ga0070661_100141722 | 3300005344 | Bacteria | 1812 |
| 63 | Ga0070661_100150444 | 3300005344 | Bacteria | 1759 |
| 64 | Ga0070692_10000930 | 3300005345 | Bacteria | 9925 |
| 65 | Ga0070692_10003306 | 3300005345 | Bacteria | 6510 |
| 66 | Ga0070692_10093300 | 3300005345 | Bacteria | 1639 |
| 67 | Ga0070668_100096165 | 3300005347 | Bacteria | 2340 |
| 68 | Ga0070669_100110266 | 3300005353 | Bacteria | 2087 |
| 69 | Ga0070669_100555339 | 3300005353 | Bacteria | 958 |
| 70 | Ga0070675_100051942 | 3300005354 | Bacteria | 3369 |
| 71 | Ga0070675_100076785 | 3300005354 | Bacteria | 2779 |
| 72 | Ga0070675_100215134 | 3300005354 | Bacteria | 1672 |
| 73 | Ga0070671_100011250 | 3300005355 | Bacteria | 7189 |
| 74 | Ga0070671_100093396 | 3300005355 | Bacteria | 2521 |
| 75 | Ga0070671_100475225 | 3300005355 | Bacteria | 1074 |
| 76 | Ga0070674_100000011 | 3300005356 | Bacteria | 134886 |
| 77 | Ga0070674_100002258 | 3300005356 | Bacteria | 10631 |
| 78 | Ga0070674_100042686 | 3300005356 | Bacteria | 3082 |
| 79 | Ga0070674_100097182 | 3300005356 | Bacteria | 2138 |
| 80 | Ga0070674_100114517 | 3300005356 | Bacteria | 1986 |
| 81 | Ga0070673_100071001 | 3300005364 | Bacteria | 2797 |
| 82 | Ga0070688_100014636 | 3300005365 | Bacteria | 4448 |
| 83 | Ga0070688_100074260 | 3300005365 | Bacteria | 2183 |
| 84 | Ga0070659_100001903 | 3300005366 | Bacteria | 14933 |
| 85 | Ga0070659_100140303 | 3300005366 | Bacteria | 1967 |
| 86 | Ga0070659_100248284 | 3300005366 | Bacteria | 1474 |
| 87 | Ga0070667_100098837 | 3300005367 | Bacteria | 2518 |
| 88 | Ga0070703_10010148 | 3300005406 | Bacteria | 2656 |
| 89 | Ga0070709_10003121 | 3300005434 | Bacteria | 8891 |
| 90 | Ga0070709_10317981 | 3300005434 | Bacteria | 1142 |
| 91 | Ga0070709_10385380 | 3300005434 | Bacteria | 1043 |
| 92 | Ga0070714_100072299 | 3300005435 | Bacteria | 2985 |
| 93 | Ga0070714_100074075 | 3300005435 | Bacteria | 2951 |
| 94 | Ga0070714_100093033 | 3300005435 | Bacteria | 2643 |
| 95 | Ga0070714_100284729 | 3300005435 | Bacteria | 1537 |
| 96 | Ga0070713_100016357 | 3300005436 | Bacteria | 5577 |
| 97 | Ga0070713_100021279 | 3300005436 | Bacteria | 4986 |
| 98 | Ga0070713_100159483 | 3300005436 | Bacteria | 2012 |
| 99 | Ga0070713_100237263 | 3300005436 | Bacteria | 1659 |
| 100 | Ga0070713_100374392 | 3300005436 | Bacteria | 1325 |
| 101 | Ga0070713_100603630 | 3300005436 | Bacteria | 1043 |
| 102 | Ga0070710_10006790 | 3300005437 | Bacteria | 5518 |
| 103 | Ga0070710_10021256 | 3300005437 | Bacteria | 3378 |
| 104 | Ga0070710_10023167 | 3300005437 | Bacteria | 3259 |
| 105 | Ga0070710_10060770 | 3300005437 | Bacteria | 2150 |
| 106 | Ga0070701_10019177 | 3300005438 | Bacteria | 3228 |
| 107 | Ga0070701_10027515 | 3300005438 | Bacteria | 2786 |
| 108 | Ga0070711_100002187 | 3300005439 | Bacteria | 11090 |
| 109 | Ga0070711_100026552 | 3300005439 | Bacteria | 3795 |
| 110 | Ga0070711_100122937 | 3300005439 | Bacteria | 1922 |
| 111 | Ga0070711_100153974 | 3300005439 | Bacteria | 1736 |
| 112 | Ga0070711_100340256 | 3300005439 | Bacteria | 1204 |
| 113 | Ga0070705_100022527 | 3300005440 | Unclassified | 3367 |
| 114 | Ga0070705_100374765 | 3300005440 | Bacteria | 1046 |
| 115 | Ga0070700_100004058 | 3300005441 | Bacteria | 7625 |
| 116 | Ga0070694_100078132 | 3300005444 | Bacteria | 2295 |
| 117 | Ga0070694_100081959 | 3300005444 | Bacteria | 2245 |
| 118 | Ga0070694_100123774 | 3300005444 | Bacteria | 1859 |
| 119 | Ga0070694_100365935 | 3300005444 | Bacteria | 1121 |
| 120 | Ga0070708_100003637 | 3300005445 | Bacteria | 12092 |
| 121 | Ga0070708_100102959 | 3300005445 | Bacteria | 2617 |
| 122 | Ga0070708_100142365 | 3300005445 | Unclassified | 2224 |
| 123 | Ga0070708_100183683 | 3300005445 | Bacteria | 1955 |
| 124 | Ga0070708_100344102 | 3300005445 | Bacteria | 1405 |
| 125 | Ga0070708_100501545 | 3300005445 | Bacteria | 1145 |
| 126 | Ga0070708_100604824 | 3300005445 | Bacteria | 1034 |
| 127 | Ga0070663_100008888 | 3300005455 | Bacteria | 6203 |
| 128 | Ga0070663_100053859 | 3300005455 | Bacteria | 2873 |
| 129 | Ga0070663_100182502 | 3300005455 | Bacteria | 1629 |
| 130 | Ga0070678_100128924 | 3300005456 | Bacteria | 2006 |
| 131 | Ga0070678_100139231 | 3300005456 | Bacteria | 1939 |
| 132 | Ga0070678_100156214 | 3300005456 | Bacteria | 1843 |
| 133 | Ga0070662_100012271 | 3300005457 | Bacteria | 5675 |
| 134 | Ga0070662_100101322 | 3300005457 | Bacteria | 2180 |
| 135 | Ga0070662_100411385 | 3300005457 | Bacteria | 1117 |
| 136 | Ga0070681_10023372 | 3300005458 | Bacteria | 6216 |
| 137 | Ga0070681_10034789 | 3300005458 | Bacteria | 5059 |
| 138 | Ga0070681_10065376 | 3300005458 | Bacteria | 3606 |
| 139 | Ga0070681_10069243 | 3300005458 | Bacteria | 3495 |
| 140 | Ga0070681_10079364 | 3300005458 | Bacteria | 3239 |
| 141 | Ga0070681_10173624 | 3300005458 | Bacteria | 2077 |
| 142 | Ga0068867_100000550 | 3300005459 | Bacteria | 24730 |
| 143 | Ga0068867_100007373 | 3300005459 | Bacteria | 7781 |
| 144 | Ga0068867_100100636 | 3300005459 | Bacteria | 2207 |
| 145 | Ga0068867_100180621 | 3300005459 | Bacteria | 1677 |
| 146 | Ga0070685_10017914 | 3300005466 | Bacteria | 3801 |
| 147 | Ga0070685_10045149 | 3300005466 | Bacteria | 2525 |
| 148 | Ga0070685_10061574 | 3300005466 | Bacteria | 2198 |
| 149 | Ga0070706_100019895 | 3300005467 | Bacteria | 6189 |
| 150 | Ga0070706_100088621 | 3300005467 | Bacteria | 2869 |
| 151 | Ga0070707_100039227 | 3300005468 | Bacteria | 4526 |
| 152 | Ga0070707_100739972 | 3300005468 | Bacteria | 947 |
| 153 | Ga0070698_100050319 | 3300005471 | Bacteria | 4249 |
| 154 | Ga0070698_100112491 | 3300005471 | Unclassified | 2687 |
| 155 | Ga0070698_100232753 | 3300005471 | Bacteria | 1776 |
| 156 | Ga0070698_100328580 | 3300005471 | Bacteria | 1460 |
| 157 | Ga0070699_100217491 | 3300005518 | Bacteria | 1702 |
| 158 | Ga0070699_100576681 | 3300005518 | Bacteria | 1025 |
| 159 | Ga0070699_100626035 | 3300005518 | Bacteria | 982 |
| 160 | Ga0070679_100012528 | 3300005530 | Bacteria | 8109 |
| 161 | Ga0070679_100053382 | 3300005530 | Bacteria | 4024 |
| 162 | Ga0070679_100066486 | 3300005530 | Bacteria | 3593 |
| 163 | Ga0070679_100086866 | 3300005530 | Bacteria | 3114 |
| 164 | Ga0070679_100133357 | 3300005530 | Bacteria | 2465 |
| 165 | Ga0070679_100204945 | 3300005530 | Bacteria | 1937 |
| 166 | Ga0070684_100025741 | 3300005535 | Bacteria | 4947 |
| 167 | Ga0070684_100039805 | 3300005535 | Bacteria | 4045 |
| 168 | Ga0070684_100040881 | 3300005535 | Bacteria | 3995 |
| 169 | Ga0070684_100077890 | 3300005535 | Bacteria | 2929 |
| 170 | Ga0070684_100102363 | 3300005535 | Bacteria | 2560 |
| 171 | Ga0070684_100128557 | 3300005535 | Bacteria | 2284 |
| 172 | Ga0070684_100147819 | 3300005535 | Bacteria | 2128 |
| 173 | Ga0070684_100174374 | 3300005535 | Bacteria | 1954 |
| 174 | Ga0070684_100242889 | 3300005535 | Bacteria | 1645 |
| 175 | Ga0070684_100314237 | 3300005535 | Bacteria | 1439 |
| 176 | Ga0070684_100315168 | 3300005535 | Bacteria | 1436 |
| 177 | Ga0070697_100128080 | 3300005536 | Bacteria | 2127 |
| 178 | Ga0070697_100148103 | 3300005536 | Unclassified | 1977 |
| 179 | Ga0068853_100013271 | 3300005539 | Bacteria | 6727 |
| 180 | Ga0068853_100039604 | 3300005539 | Bacteria | 4020 |
| 181 | Ga0068853_100108622 | 3300005539 | Bacteria | 2461 |
| 182 | Ga0068853_100224728 | 3300005539 | Bacteria | 1716 |
| 183 | Ga0070672_100202982 | 3300005543 | Bacteria | 1658 |
| 184 | Ga0070686_100001971 | 3300005544 | Bacteria | 11400 |
| 185 | Ga0070686_100035673 | 3300005544 | Bacteria | 3073 |
| 186 | Ga0070686_100076861 | 3300005544 | Bacteria | 2200 |
| 187 | Ga0070695_100006405 | 3300005545 | Bacteria | 6959 |
| 188 | Ga0070695_100020931 | 3300005545 | Bacteria | 3997 |
| 189 | Ga0070695_100032959 | 3300005545 | Bacteria | 3239 |
| 190 | Ga0070696_100002924 | 3300005546 | Bacteria | 11350 |
| 191 | Ga0070696_100022984 | 3300005546 | Bacteria | 4239 |
| 192 | Ga0070696_100074392 | 3300005546 | Bacteria | 2395 |
| 193 | Ga0070696_100095358 | 3300005546 | Bacteria | 2124 |
| 194 | Ga0070696_100133709 | 3300005546 | Bacteria | 1807 |
| 195 | Ga0070693_100003652 | 3300005547 | Bacteria | 7186 |
| 196 | Ga0070693_100165253 | 3300005547 | Bacteria | 1413 |
| 197 | Ga0070693_100170473 | 3300005547 | Bacteria | 1394 |
| 198 | Ga0070665_100062632 | 3300005548 | Bacteria | 3729 |
| 199 | Ga0070665_100099247 | 3300005548 | Bacteria | 2916 |
| 200 | Ga0070704_100001647 | 3300005549 | Bacteria | 12110 |
| 201 | Ga0070704_100014996 | 3300005549 | Bacteria | 4854 |
| 202 | Ga0068855_100017877 | 3300005563 | Bacteria | 8519 |
| 203 | Ga0068855_100115281 | 3300005563 | Bacteria | 3080 |
| 204 | Ga0068855_100380173 | 3300005563 | Bacteria | 1551 |
| 205 | Ga0068855_100418815 | 3300005563 | Bacteria | 1465 |
| 206 | Ga0068855_100483922 | 3300005563 | Bacteria | 1347 |
| 207 | Ga0068855_100959190 | 3300005563 | Bacteria | 900 |
| 208 | Ga0070664_100016484 | 3300005564 | Bacteria | 6057 |
| 209 | Ga0070664_100311475 | 3300005564 | Bacteria | 1425 |
| 210 | Ga0070664_100417311 | 3300005564 | Bacteria | 1229 |
| 211 | Ga0068857_100001566 | 3300005577 | Bacteria | 18312 |
| 212 | Ga0068857_100045252 | 3300005577 | Bacteria | 3904 |
| 213 | Ga0068857_100305286 | 3300005577 | Bacteria | 1468 |
| 214 | Ga0068857_100474726 | 3300005577 | Bacteria | 1171 |
| 215 | Ga0068854_100002923 | 3300005578 | Bacteria | 10601 |
| 216 | Ga0068854_100395647 | 3300005578 | Bacteria | 1142 |
| 217 | Ga0068856_100072817 | 3300005614 | Bacteria | 3402 |
| 218 | Ga0068856_100121449 | 3300005614 | Bacteria | 2614 |
| 219 | Ga0068856_100126393 | 3300005614 | Bacteria | 2560 |
| 220 | Ga0068856_100164868 | 3300005614 | Bacteria | 2227 |
| 221 | Ga0070702_100083241 | 3300005615 | Bacteria | 1921 |
| 222 | Ga0070702_100268889 | 3300005615 | Bacteria | 1165 |
| 223 | Ga0068852_100002137 | 3300005616 | Bacteria | 13553 |
| 224 | Ga0068852_100024660 | 3300005616 | Bacteria | 4864 |
| 225 | Ga0068852_100646360 | 3300005616 | Bacteria | 1065 |
| 226 | Ga0068852_100656025 | 3300005616 | Bacteria | 1057 |
| 227 | Ga0068852_100684723 | 3300005616 | Bacteria | 1035 |
| 228 | Ga0068859_100080311 | 3300005617 | Bacteria | 3302 |
| 229 | Ga0068864_100072287 | 3300005618 | Bacteria | 3005 |
| 230 | Ga0068864_100371775 | 3300005618 | Bacteria | 1353 |
| 231 | Ga0068864_100602782 | 3300005618 | Bacteria | 1066 |
| 232 | Ga0068866_10004786 | 3300005718 | Bacteria | 5554 |
| 233 | Ga0068866_10013817 | 3300005718 | Bacteria | 3551 |
| 234 | Ga0068866_10063629 | 3300005718 | Bacteria | 1924 |
| 235 | Ga0068861_100039499 | 3300005719 | Bacteria | 3522 |
| 236 | Ga0068851_10006756 | 3300005834 | Bacteria | 5249 |
| 237 | Ga0068870_10044961 | 3300005840 | Bacteria | 2309 |
| 238 | Ga0068870_10054354 | 3300005840 | Bacteria | 2129 |
| 239 | Ga0068870_10309100 | 3300005840 | Bacteria | 1000 |
| 240 | Ga0068863_100165571 | 3300005841 | Bacteria | 2120 |
| 241 | Ga0068858_100024014 | 3300005842 | Bacteria | 5680 |
| 242 | Ga0068860_100019254 | 3300005843 | Bacteria | 6625 |
| 243 | Ga0068860_100070171 | 3300005843 | Bacteria | 3331 |
| 244 | Ga0068860_100357542 | 3300005843 | Bacteria | 1438 |
| 245 | Ga0068860_100383937 | 3300005843 | Bacteria | 1387 |
| 246 | Ga0081455_10004052 | 3300005937 | Bacteria | 16607 |
| 247 | Ga0081455_10011861 | 3300005937 | Bacteria | 8725 |
| 248 | Ga0081455_10022948 | 3300005937 | Bacteria | 5818 |
| 249 | Ga0081455_10023031 | 3300005937 | Bacteria | 5805 |
| 250 | Ga0081455_10146332 | 3300005937 | Bacteria | 1827 |
| 251 | Ga0081538_10000053 | 3300005981 | Bacteria | 109213 |
| 252 | Ga0081538_10000820 | 3300005981 | Bacteria | 33705 |
| 253 | Ga0081538_10005518 | 3300005981 | Bacteria | 11360 |
| 254 | Ga0081540_1009278 | 3300005983 | Bacteria | 6785 |
| 255 | Ga0081539_10000095 | 3300005985 | Bacteria | 204474 |
| 256 | Ga0081539_10000103 | 3300005985 | Bacteria | 197839 |
| 257 | Ga0070717_10005225 | 3300006028 | Bacteria | 9459 |
| 258 | Ga0070717_10008934 | 3300006028 | Bacteria | 7509 |
| 259 | Ga0070717_10020482 | 3300006028 | Bacteria | 5202 |
| 260 | Ga0070717_10084473 | 3300006028 | Bacteria | 2670 |
| 261 | Ga0075365_10121062 | 3300006038 | Bacteria | 1805 |
| 262 | Ga0075364_10077751 | 3300006051 | Bacteria | 2191 |
| 263 | Ga0075432_10001731 | 3300006058 | Bacteria | 7181 |
| 264 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 265 | Ga0070715_10000893 | 3300006163 | Bacteria | 8278 |
| 266 | Ga0070716_100008868 | 3300006173 | Bacteria | 4998 |
| 267 | Ga0070712_100010819 | 3300006175 | Bacteria | 5769 |
| 268 | Ga0070712_100050144 | 3300006175 | Bacteria | 2902 |
| 269 | Ga0070712_100068085 | 3300006175 | Bacteria | 2535 |
| 270 | Ga0097621_100011037 | 3300006237 | Bacteria | 6639 |
| 271 | Ga0097621_100023026 | 3300006237 | Bacteria | 4844 |
| 272 | Ga0097621_100139960 | 3300006237 | Bacteria | 2067 |
| 273 | Ga0097621_100408386 | 3300006237 | Bacteria | 1217 |
| 274 | Ga0068871_100037920 | 3300006358 | Bacteria | 3845 |
| 275 | Ga0075428_100000411 | 3300006844 | Bacteria | 42585 |
| 276 | Ga0075428_100331787 | 3300006844 | Bacteria | 1634 |
| 277 | Ga0075428_100341676 | 3300006844 | Bacteria | 1607 |
| 278 | Ga0075430_100148597 | 3300006846 | Unclassified | 1951 |
| 279 | Ga0075430_100190423 | 3300006846 | Bacteria | 1705 |
| 280 | Ga0075431_100000960 | 3300006847 | Bacteria | 25567 |
| 281 | Ga0075431_100305768 | 3300006847 | Bacteria | 1606 |
| 282 | Ga0075433_10126139 | 3300006852 | Bacteria | 2273 |
| 283 | Ga0075434_100016788 | 3300006871 | Bacteria | 7045 |
| 284 | Ga0075434_100441183 | 3300006871 | Bacteria | 1323 |
| 285 | Ga0075429_100218718 | 3300006880 | Bacteria | 1669 |
| 286 | Ga0075429_100450270 | 3300006880 | Bacteria | 1128 |
| 287 | Ga0075429_100467319 | 3300006880 | Bacteria | 1105 |
| 288 | Ga0068865_100000227 | 3300006881 | Bacteria | 31272 |
| 289 | Ga0068865_100042812 | 3300006881 | Bacteria | 3090 |
| 290 | Ga0068865_100357919 | 3300006881 | Bacteria | 1184 |
| 291 | Ga0097620_100080305 | 3300006931 | Bacteria | 3302 |
| 292 | Ga0075435_100046409 | 3300007076 | Bacteria | 3484 |
| 293 | Ga0075435_100188888 | 3300007076 | Bacteria | 1743 |
| 294 | Ga0105240_10006133 | 3300009093 | Bacteria | 17729 |
| 295 | Ga0105240_10035533 | 3300009093 | Bacteria | 6420 |
| 296 | Ga0105240_10061530 | 3300009093 | Bacteria | 4678 |
| 297 | Ga0105240_10515544 | 3300009093 | Bacteria | 1328 |
| 298 | Ga0111539_10005465 | 3300009094 | Bacteria | 16438 |
| 299 | Ga0111539_10006234 | 3300009094 | Bacteria | 15391 |
| 300 | Ga0111539_10049963 | 3300009094 | Bacteria | 4984 |
| 301 | Ga0111539_10788722 | 3300009094 | Bacteria | 1106 |
| 302 | Ga0105245_10007056 | 3300009098 | Bacteria | 9857 |
| 303 | Ga0105245_10022523 | 3300009098 | Bacteria | 5530 |
| 304 | Ga0105245_10027048 | 3300009098 | Bacteria | 5052 |
| 305 | Ga0105245_10057048 | 3300009098 | Bacteria | 3512 |
| 306 | Ga0105245_10110725 | 3300009098 | Bacteria | 2553 |
| 307 | Ga0105245_10194557 | 3300009098 | Bacteria | 1944 |
| 308 | Ga0105245_10354874 | 3300009098 | Bacteria | 1454 |
| 309 | Ga0105247_10000208 | 3300009101 | Bacteria | 56889 |
| 310 | Ga0105247_10086033 | 3300009101 | Bacteria | 1989 |
| 311 | Ga0105247_10264272 | 3300009101 | Bacteria | 1181 |
| 312 | Ga0114129_10006651 | 3300009147 | Bacteria | 16412 |
| 313 | Ga0114129_10007066 | 3300009147 | Bacteria | 15978 |
| 314 | Ga0114129_10075771 | 3300009147 | Bacteria | 4684 |
| 315 | Ga0114129_10079691 | 3300009147 | Bacteria | 4553 |
| 316 | Ga0114129_10184899 | 3300009147 | Bacteria | 2833 |
| 317 | Ga0114129_10720142 | 3300009147 | Bacteria | 1280 |
| 318 | Ga0114129_10822170 | 3300009147 | Bacteria | 1183 |
| 319 | Ga0114129_10877191 | 3300009147 | Bacteria | 1139 |
| 320 | Ga0105243_10004254 | 3300009148 | Bacteria | 11339 |
| 321 | Ga0105243_10008349 | 3300009148 | Bacteria | 7951 |
| 322 | Ga0105243_10010370 | 3300009148 | Bacteria | 7075 |
| 323 | Ga0105243_10121129 | 3300009148 | Bacteria | 2206 |
| 324 | Ga0105241_10092793 | 3300009174 | Bacteria | 2385 |
| 325 | Ga0105242_10001454 | 3300009176 | Bacteria | 18636 |
| 326 | Ga0105242_10007667 | 3300009176 | Bacteria | 8306 |
| 327 | Ga0105242_10055335 | 3300009176 | Bacteria | 3246 |
| 328 | Ga0105242_10135334 | 3300009176 | Bacteria | 2132 |
| 329 | Ga0105242_10273873 | 3300009176 | Bacteria | 1530 |
| 330 | Ga0105248_10048033 | 3300009177 | Bacteria | 4787 |
| 331 | Ga0105248_10058439 | 3300009177 | Bacteria | 4331 |
| 332 | Ga0105248_10103565 | 3300009177 | Bacteria | 3208 |
| 333 | Ga0105248_10170556 | 3300009177 | Bacteria | 2452 |
| 334 | Ga0105248_10232540 | 3300009177 | Bacteria | 2075 |
| 335 | Ga0105237_10070666 | 3300009545 | Bacteria | 3487 |
| 336 | Ga0105238_10009784 | 3300009551 | Bacteria | 9597 |
| 337 | Ga0105238_10646094 | 3300009551 | Bacteria | 1068 |
| 338 | Ga0105238_11147573 | 3300009551 | Bacteria | 800 |
| 339 | Ga0105249_10275329 | 3300009553 | Bacteria | 1678 |
| 340 | Ga0105239_10001933 | 3300010375 | Bacteria | 27042 |
| 341 | Ga0105239_10028738 | 3300010375 | Bacteria | 6113 |
| 342 | Ga0105239_10042107 | 3300010375 | Bacteria | 5004 |
| 343 | Ga0105239_10177802 | 3300010375 | Bacteria | 2380 |
| 344 | Ga0105246_10379125 | 3300011119 | Bacteria | 1168 |
| 345 | Ga0105246_10565690 | 3300011119 | Bacteria | 977 |
| 346 | Ga0157371_10005732 | 3300013102 | Bacteria | 10410 |
| 347 | Ga0157371_10132089 | 3300013102 | Bacteria | 1777 |
| 348 | Ga0157371_10277063 | 3300013102 | Bacteria | 1211 |
| 349 | Ga0157371_10424443 | 3300013102 | Bacteria | 975 |
| 350 | Ga0157370_10006583 | 3300013104 | Bacteria | 12792 |
| 351 | Ga0157370_10015558 | 3300013104 | Bacteria | 7734 |
| 352 | Ga0157370_10053772 | 3300013104 | Bacteria | 3840 |
| 353 | Ga0157370_10222307 | 3300013104 | Bacteria | 1749 |
| 354 | Ga0157370_10373302 | 3300013104 | Bacteria | 1314 |
| 355 | Ga0157370_10481934 | 3300013104 | Bacteria | 1140 |
| 356 | Ga0157369_10021753 | 3300013105 | Bacteria | 7173 |
| 357 | Ga0157369_10179693 | 3300013105 | Bacteria | 2227 |
| 358 | Ga0157369_10405821 | 3300013105 | Bacteria | 1413 |
| 359 | Ga0157369_10634345 | 3300013105 | Bacteria | 1102 |
| 360 | Ga0157369_10805237 | 3300013105 | Bacteria | 965 |
| 361 | Ga0157374_10057906 | 3300013296 | Bacteria | 3620 |
| 362 | Ga0157374_10095952 | 3300013296 | Bacteria | 2836 |
| 363 | Ga0157378_10002034 | 3300013297 | Bacteria | 18114 |
| 364 | Ga0157378_10498583 | 3300013297 | Bacteria | 1216 |
| 365 | Ga0163162_10002291 | 3300013306 | Bacteria | 17972 |
| 366 | Ga0163162_10030608 | 3300013306 | Bacteria | 5333 |
| 367 | Ga0163162_10450111 | 3300013306 | Bacteria | 1420 |
| 368 | Ga0163162_10579299 | 3300013306 | Bacteria | 1249 |
| 369 | Ga0157372_10107318 | 3300013307 | Bacteria | 3195 |
| 370 | Ga0157372_10116885 | 3300013307 | Bacteria | 3058 |
| 371 | Ga0157375_10011702 | 3300013308 | Bacteria | 7754 |
| 372 | Ga0157375_10122700 | 3300013308 | Bacteria | 2710 |
| 373 | Ga0157375_10249313 | 3300013308 | Bacteria | 1936 |
| 374 | Ga0157375_10593993 | 3300013308 | Unclassified | 1267 |
| 375 | Ga0163163_10068194 | 3300014325 | Bacteria | 3539 |
| 376 | Ga0163163_11038771 | 3300014325 | Bacteria | 883 |
| 377 | Ga0157380_10015154 | 3300014326 | Bacteria | 5659 |
| 378 | Ga0157380_10021386 | 3300014326 | Bacteria | 4851 |
| 379 | Ga0157380_10085352 | 3300014326 | Bacteria | 2591 |
| 380 | Ga0157377_10009312 | 3300014745 | Bacteria | 4811 |
| 381 | Ga0157377_10100084 | 3300014745 | Bacteria | 1725 |
| 382 | Ga0157377_10164237 | 3300014745 | Bacteria | 1383 |
| 383 | Ga0157377_10267632 | 3300014745 | Bacteria | 1115 |
| 384 | Ga0157379_10060567 | 3300014968 | Bacteria | 3384 |
| 385 | Ga0157379_10414978 | 3300014968 | Bacteria | 1239 |
| 386 | Ga0157376_10018276 | 3300014969 | Bacteria | 5369 |
| 387 | Ga0157376_10029082 | 3300014969 | Bacteria | 4400 |
| 388 | Ga0157376_10148059 | 3300014969 | Bacteria | 2114 |
| 389 | Ga0157376_10283854 | 3300014969 | Bacteria | 1560 |
| 390 | Ga0157376_10393269 | 3300014969 | Unclassified | 1338 |
| 391 | Ga0163161_10250503 | 3300017792 | Bacteria | 1380 |
| 392 | Ga0206356_10529424 | 3300020070 | Bacteria | 1486 |
| 393 | Ga0206356_11382338 | 3300020070 | Bacteria | 1501 |
| 394 | Ga0206356_11420625 | 3300020070 | Bacteria | 3331 |
| 395 | Ga0206356_11545740 | 3300020070 | Bacteria | 1065 |
| 396 | Ga0206356_11774698 | 3300020070 | Bacteria | 1591 |
| 397 | Ga0206351_10131195 | 3300020077 | Bacteria | 3065 |
| 398 | Ga0206354_11548271 | 3300020081 | Bacteria | 2111 |
| 399 | Ga0206353_10112688 | 3300020082 | Bacteria | 3307 |
| 400 | Ga0206353_10288702 | 3300020082 | Bacteria | 4173 |
| 401 | Ga0206353_11412727 | 3300020082 | Bacteria | 4533 |
| 402 | Ga0206353_11781830 | 3300020082 | Bacteria | 1336 |
| 403 | Ga0154015_1107111 | 3300020610 | Bacteria | 3237 |
| 404 | Ga0213876_10266106 | 3300021384 | Bacteria | 911 |
| 405 | Ga0207656_10004075 | 3300025321 | Bacteria | 5070 |
| 406 | Ga0207653_10006879 | 3300025885 | Bacteria | 3549 |
| 407 | Ga0207682_10102858 | 3300025893 | Unclassified | 1250 |
| 408 | Ga0207692_10004842 | 3300025898 | Bacteria | 5357 |
| 409 | Ga0207692_10018561 | 3300025898 | Bacteria | 3125 |
| 410 | Ga0207692_10024091 | 3300025898 | Bacteria | 2824 |
| 411 | Ga0207692_10289704 | 3300025898 | Bacteria | 993 |
| 412 | Ga0207642_10007951 | 3300025899 | Bacteria | 3609 |
| 413 | Ga0207710_10150880 | 3300025900 | Bacteria | 1127 |
| 414 | Ga0207688_10020622 | 3300025901 | Bacteria | 3598 |
| 415 | Ga0207688_10027728 | 3300025901 | Bacteria | 3115 |
| 416 | Ga0207688_10099143 | 3300025901 | Bacteria | 1681 |
| 417 | Ga0207688_10222831 | 3300025901 | Bacteria | 1136 |
| 418 | Ga0207680_10013547 | 3300025903 | Bacteria | 4194 |
| 419 | Ga0207699_10017845 | 3300025906 | Bacteria | 3748 |
| 420 | Ga0207699_10045246 | 3300025906 | Bacteria | 2568 |
| 421 | Ga0207699_10158973 | 3300025906 | Bacteria | 1502 |
| 422 | Ga0207643_10236096 | 3300025908 | Bacteria | 1123 |
| 423 | Ga0207705_10030069 | 3300025909 | Bacteria | 3874 |
| 424 | Ga0207705_10040237 | 3300025909 | Bacteria | 3352 |
| 425 | Ga0207705_10042505 | 3300025909 | Bacteria | 3263 |
| 426 | Ga0207705_10093559 | 3300025909 | Bacteria | 2204 |
| 427 | Ga0207684_10017250 | 3300025910 | Bacteria | 6194 |
| 428 | Ga0207684_10107949 | 3300025910 | Bacteria | 2382 |
| 429 | Ga0207707_10021198 | 3300025912 | Bacteria | 5680 |
| 430 | Ga0207707_10055604 | 3300025912 | Bacteria | 3442 |
| 431 | Ga0207707_10065163 | 3300025912 | Bacteria | 3173 |
| 432 | Ga0207707_10086838 | 3300025912 | Bacteria | 2733 |
| 433 | Ga0207707_10124757 | 3300025912 | Bacteria | 2252 |
| 434 | Ga0207707_10158157 | 3300025912 | Bacteria | 1981 |
| 435 | Ga0207695_10037165 | 3300025913 | Bacteria | 5256 |
| 436 | Ga0207695_10037539 | 3300025913 | Bacteria | 5227 |
| 437 | Ga0207693_10000282 | 3300025915 | Bacteria | 47278 |
| 438 | Ga0207693_10016283 | 3300025915 | Bacteria | 5945 |
| 439 | Ga0207693_10046432 | 3300025915 | Bacteria | 3411 |
| 440 | Ga0207693_10329325 | 3300025915 | Bacteria | 1195 |
| 441 | Ga0207663_10001508 | 3300025916 | Bacteria | 10873 |
| 442 | Ga0207663_10006327 | 3300025916 | Bacteria | 6048 |
| 443 | Ga0207663_10017905 | 3300025916 | Bacteria | 3957 |
| 444 | Ga0207663_10127032 | 3300025916 | Bacteria | 1756 |
| 445 | Ga0207663_10163398 | 3300025916 | Bacteria | 1574 |
| 446 | Ga0207663_10208650 | 3300025916 | Bacteria | 1414 |
| 447 | Ga0207660_10005405 | 3300025917 | Bacteria | 8292 |
| 448 | Ga0207660_10148744 | 3300025917 | Bacteria | 1798 |
| 449 | Ga0207660_10344245 | 3300025917 | Bacteria | 1194 |
| 450 | Ga0207657_10005534 | 3300025919 | Bacteria | 13187 |
| 451 | Ga0207657_10006847 | 3300025919 | Bacteria | 11759 |
| 452 | Ga0207657_10009681 | 3300025919 | Bacteria | 9670 |
| 453 | Ga0207657_10015976 | 3300025919 | Bacteria | 7248 |
| 454 | Ga0207657_10034935 | 3300025919 | Bacteria | 4512 |
| 455 | Ga0207657_10057550 | 3300025919 | Bacteria | 3350 |
| 456 | Ga0207657_10357017 | 3300025919 | Bacteria | 1152 |
| 457 | Ga0207657_10388564 | 3300025919 | Bacteria | 1098 |
| 458 | Ga0207649_10012383 | 3300025920 | Bacteria | 4731 |
| 459 | Ga0207649_10018770 | 3300025920 | Bacteria | 3941 |
| 460 | Ga0207649_10121994 | 3300025920 | Bacteria | 1758 |
| 461 | Ga0207649_10228589 | 3300025920 | Bacteria | 1329 |
| 462 | Ga0207652_10017797 | 3300025921 | Bacteria | 5821 |
| 463 | Ga0207652_10028339 | 3300025921 | Bacteria | 4673 |
| 464 | Ga0207652_10063692 | 3300025921 | Bacteria | 3189 |
| 465 | Ga0207652_10085958 | 3300025921 | Bacteria | 2757 |
| 466 | Ga0207652_10556936 | 3300025921 | Bacteria | 1030 |
| 467 | Ga0207652_10566564 | 3300025921 | Bacteria | 1020 |
| 468 | Ga0207646_10001031 | 3300025922 | Bacteria | 35603 |
| 469 | Ga0207646_10008000 | 3300025922 | Bacteria | 10663 |
| 470 | Ga0207646_10067184 | 3300025922 | Unclassified | 3201 |
| 471 | Ga0207646_10191518 | 3300025922 | Bacteria | 1847 |
| 472 | Ga0207646_10631997 | 3300025922 | Bacteria | 960 |
| 473 | Ga0207681_10030389 | 3300025923 | Bacteria | 3522 |
| 474 | Ga0207681_10406795 | 3300025923 | Bacteria | 1100 |
| 475 | Ga0207650_10104444 | 3300025925 | Bacteria | 2186 |
| 476 | Ga0207659_10172656 | 3300025926 | Bacteria | 1706 |
| 477 | Ga0207659_10226632 | 3300025926 | Bacteria | 1505 |
| 478 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 479 | Ga0207687_10004375 | 3300025927 | Bacteria | 9423 |
| 480 | Ga0207687_10006749 | 3300025927 | Bacteria | 7564 |
| 481 | Ga0207687_10043708 | 3300025927 | Bacteria | 3088 |
| 482 | Ga0207687_10076285 | 3300025927 | Bacteria | 2407 |
| 483 | Ga0207687_10104709 | 3300025927 | Bacteria | 2089 |
| 484 | Ga0207700_10024533 | 3300025928 | Bacteria | 4175 |
| 485 | Ga0207700_10030363 | 3300025928 | Bacteria | 3827 |
| 486 | Ga0207700_10118551 | 3300025928 | Bacteria | 2142 |
| 487 | Ga0207700_10387683 | 3300025928 | Bacteria | 1223 |
| 488 | Ga0207700_10512045 | 3300025928 | Bacteria | 1063 |
| 489 | Ga0207664_10002945 | 3300025929 | Bacteria | 11314 |
| 490 | Ga0207664_10004602 | 3300025929 | Bacteria | 9348 |
| 491 | Ga0207664_10029077 | 3300025929 | Bacteria | 4206 |
| 492 | Ga0207664_10081819 | 3300025929 | Bacteria | 2629 |
| 493 | Ga0207664_10568443 | 3300025929 | Bacteria | 1018 |
| 494 | Ga0207644_10046368 | 3300025931 | Bacteria | 3096 |
| 495 | Ga0207690_10038484 | 3300025932 | Bacteria | 3113 |
| 496 | Ga0207690_10115273 | 3300025932 | Bacteria | 1942 |
| 497 | Ga0207690_10332468 | 3300025932 | Bacteria | 1197 |
| 498 | Ga0207706_10017885 | 3300025933 | Bacteria | 6383 |
| 499 | Ga0207706_10075373 | 3300025933 | Bacteria | 2966 |
| 500 | Ga0207706_10087752 | 3300025933 | Bacteria | 2735 |
| 501 | Ga0207706_10436817 | 3300025933 | Bacteria | 1133 |
| 502 | Ga0207686_10002081 | 3300025934 | Bacteria | 11023 |
| 503 | Ga0207686_10049986 | 3300025934 | Bacteria | 2598 |
| 504 | Ga0207686_10085876 | 3300025934 | Bacteria | 2065 |
| 505 | Ga0207709_10000390 | 3300025935 | Bacteria | 43485 |
| 506 | Ga0207709_10013978 | 3300025935 | Bacteria | 4433 |
| 507 | Ga0207709_10023116 | 3300025935 | Bacteria | 3535 |
| 508 | Ga0207709_10298635 | 3300025935 | Bacteria | 1197 |
| 509 | Ga0207670_10101027 | 3300025936 | Bacteria | 2060 |
| 510 | Ga0207670_10115281 | 3300025936 | Bacteria | 1943 |
| 511 | Ga0207669_10001870 | 3300025937 | Bacteria | 8925 |
| 512 | Ga0207669_10017282 | 3300025937 | Bacteria | 3695 |
| 513 | Ga0207704_10001726 | 3300025938 | Bacteria | 9786 |
| 514 | Ga0207704_10011263 | 3300025938 | Bacteria | 4397 |
| 515 | Ga0207704_10041968 | 3300025938 | Bacteria | 2688 |
| 516 | Ga0207704_10059007 | 3300025938 | Bacteria | 2366 |
| 517 | Ga0207665_10000835 | 3300025939 | Bacteria | 20809 |
| 518 | Ga0207665_10004227 | 3300025939 | Bacteria | 9558 |
| 519 | Ga0207691_10005205 | 3300025940 | Bacteria | 12557 |
| 520 | Ga0207691_10037892 | 3300025940 | Bacteria | 4463 |
| 521 | Ga0207691_10096191 | 3300025940 | Bacteria | 2648 |
| 522 | Ga0207691_10160354 | 3300025940 | Bacteria | 1973 |
| 523 | Ga0207691_10325566 | 3300025940 | Bacteria | 1317 |
| 524 | Ga0207711_10023885 | 3300025941 | Bacteria | 5117 |
| 525 | Ga0207711_10127111 | 3300025941 | Bacteria | 2282 |
| 526 | Ga0207711_10550274 | 3300025941 | Bacteria | 1076 |
| 527 | Ga0207689_10041643 | 3300025942 | Bacteria | 3801 |
| 528 | Ga0207689_10075939 | 3300025942 | Bacteria | 2762 |
| 529 | Ga0207689_10166991 | 3300025942 | Bacteria | 1813 |
| 530 | Ga0207661_10000504 | 3300025944 | Bacteria | 25223 |
| 531 | Ga0207661_10026253 | 3300025944 | Bacteria | 4435 |
| 532 | Ga0207661_10039314 | 3300025944 | Bacteria | 3713 |
| 533 | Ga0207661_10039530 | 3300025944 | Bacteria | 3703 |
| 534 | Ga0207661_10056402 | 3300025944 | Bacteria | 3154 |
| 535 | Ga0207661_10061472 | 3300025944 | Bacteria | 3035 |
| 536 | Ga0207661_10062555 | 3300025944 | Bacteria | 3012 |
| 537 | Ga0207661_10131487 | 3300025944 | Bacteria | 2144 |
| 538 | Ga0207661_10159565 | 3300025944 | Bacteria | 1956 |
| 539 | Ga0207661_10269653 | 3300025944 | Bacteria | 1519 |
| 540 | Ga0207661_10546174 | 3300025944 | Bacteria | 1061 |
| 541 | Ga0207679_10001100 | 3300025945 | Bacteria | 17213 |
| 542 | Ga0207679_10014748 | 3300025945 | Bacteria | 5147 |
| 543 | Ga0207679_10130466 | 3300025945 | Bacteria | 2015 |
| 544 | Ga0207667_10212082 | 3300025949 | Bacteria | 1985 |
| 545 | Ga0207667_10278448 | 3300025949 | Bacteria | 1709 |
| 546 | Ga0207667_10293733 | 3300025949 | Bacteria | 1660 |
| 547 | Ga0207667_10329241 | 3300025949 | Bacteria | 1560 |
| 548 | Ga0207667_10389560 | 3300025949 | Bacteria | 1419 |
| 549 | Ga0207651_10053639 | 3300025960 | Bacteria | 2757 |
| 550 | Ga0207651_10133280 | 3300025960 | Bacteria | 1906 |
| 551 | Ga0207651_10299412 | 3300025960 | Bacteria | 1337 |
| 552 | Ga0207712_10381413 | 3300025961 | Bacteria | 1180 |
| 553 | Ga0207668_10059222 | 3300025972 | Bacteria | 2682 |
| 554 | Ga0207640_10045593 | 3300025981 | Bacteria | 2816 |
| 555 | Ga0207640_10067181 | 3300025981 | Bacteria | 2398 |
| 556 | Ga0207640_10077812 | 3300025981 | Bacteria | 2256 |
| 557 | Ga0207677_10023374 | 3300026023 | Bacteria | 3817 |
| 558 | Ga0207677_10366166 | 3300026023 | Bacteria | 1212 |
| 559 | Ga0207677_10443856 | 3300026023 | Bacteria | 1110 |
| 560 | Ga0207677_10527746 | 3300026023 | Bacteria | 1025 |
| 561 | Ga0207703_10049019 | 3300026035 | Bacteria | 3412 |
| 562 | Ga0207639_10014663 | 3300026041 | Bacteria | 5520 |
| 563 | Ga0207639_10048831 | 3300026041 | Bacteria | 3205 |
| 564 | Ga0207639_10227118 | 3300026041 | Bacteria | 1616 |
| 565 | Ga0207678_10007853 | 3300026067 | Bacteria | 9414 |
| 566 | Ga0207678_10024434 | 3300026067 | Bacteria | 5276 |
| 567 | Ga0207678_10051635 | 3300026067 | Bacteria | 3549 |
| 568 | Ga0207708_10000175 | 3300026075 | Bacteria | 51009 |
| 569 | Ga0207708_10089767 | 3300026075 | Bacteria | 2368 |
| 570 | Ga0207708_10135907 | 3300026075 | Bacteria | 1925 |
| 571 | Ga0207702_10019694 | 3300026078 | Bacteria | 5587 |
| 572 | Ga0207702_10084112 | 3300026078 | Bacteria | 2769 |
| 573 | Ga0207702_10154572 | 3300026078 | Bacteria | 2090 |
| 574 | Ga0207702_10246517 | 3300026078 | Bacteria | 1676 |
| 575 | Ga0207702_10270949 | 3300026078 | Bacteria | 1601 |
| 576 | Ga0207702_10408071 | 3300026078 | Bacteria | 1311 |
| 577 | Ga0207641_10035482 | 3300026088 | Bacteria | 4155 |
| 578 | Ga0207641_10145617 | 3300026088 | Bacteria | 2142 |
| 579 | Ga0207641_10192191 | 3300026088 | Bacteria | 1877 |
| 580 | Ga0207648_10000082 | 3300026089 | Bacteria | 89474 |
| 581 | Ga0207648_10041723 | 3300026089 | Bacteria | 4030 |
| 582 | Ga0207648_10061064 | 3300026089 | Bacteria | 3287 |
| 583 | Ga0207648_10117837 | 3300026089 | Bacteria | 2333 |
| 584 | Ga0207674_10058638 | 3300026116 | Bacteria | 3899 |
| 585 | Ga0207674_10070519 | 3300026116 | Bacteria | 3514 |
| 586 | Ga0207674_10105994 | 3300026116 | Bacteria | 2789 |
| 587 | Ga0207674_10457940 | 3300026116 | Bacteria | 1233 |
| 588 | Ga0207675_100023549 | 3300026118 | Bacteria | 5729 |
| 589 | Ga0207675_100073656 | 3300026118 | Bacteria | 3195 |
| 590 | Ga0207683_10004007 | 3300026121 | Bacteria | 12751 |
| 591 | Ga0207683_10021708 | 3300026121 | Bacteria | 5503 |
| 592 | Ga0207683_10105954 | 3300026121 | Bacteria | 2513 |
| 593 | Ga0207683_10166364 | 3300026121 | Bacteria | 1995 |
| 594 | Ga0207683_10739915 | 3300026121 | Bacteria | 912 |
| 595 | Ga0207698_10002832 | 3300026142 | Bacteria | 10375 |
| 596 | Ga0207698_10052636 | 3300026142 | Bacteria | 3120 |
| 597 | Ga0207428_10000108 | 3300027907 | Bacteria | 115378 |
| 598 | Ga0207428_10031692 | 3300027907 | Bacteria | 4357 |
| 599 | Ga0207428_10103059 | 3300027907 | Bacteria | 2203 |
| 600 | Ga0207428_10214187 | 3300027907 | Bacteria | 1446 |
| 601 | Ga0268266_10089148 | 3300028379 | Bacteria | 2700 |
| 602 | Ga0268266_10409098 | 3300028379 | Bacteria | 1284 |
| 603 | Ga0268265_10188027 | 3300028380 | Bacteria | 1781 |
| 604 | Ga0268265_10207436 | 3300028380 | Bacteria | 1705 |
| 605 | Ga0268264_10089329 | 3300028381 | Bacteria | 2653 |
| 606 | Ga0268264_10140021 | 3300028381 | Bacteria | 2156 |
| 607 | Ga0265323_10003734 | 3300028653 | Bacteria | 6658 |
| 608 | Ga0265322_10000301 | 3300028654 | Bacteria | 20903 |
| 609 | Ga0265338_10076833 | 3300028800 | Bacteria | 2826 |
| 610 | Ga0265330_10046997 | 3300031235 | Bacteria | 1900 |
| 611 | Ga0265329_10034595 | 3300031242 | Bacteria | 1632 |
| 612 | Ga0265316_10158535 | 3300031344 | Bacteria | 1693 |
| 613 | Ga0316576_10000132 | 3300031727 | Bacteria | 28821 |
| 614 | Ga0307409_100089397 | 3300031995 | Bacteria | 2518 |
| 615 | Ga0307416_100563222 | 3300032002 | Bacteria | 1214 |
| 616 | Ga0316583_10083472 | 3300032133 | Bacteria | 1116 |
| 617 | Ga0373930_0004511 | 3300034816 | Bacteria | 2271 |
| 618 | Ga0373959_0021525 | 3300034820 | Bacteria | 1239 |
| 619 | Ga0373934_0101289 | 3300035086 | Bacteria | 1165 |
| 620 | Ga0373940_0109544 | 3300035088 | Bacteria | 847 |
| 621 | Ga0373944_0000544 | 3300035089 | Bacteria | 8899 |
| 622 | Ga0373949_0018502 | 3300035090 | Bacteria | 1579 |
| 623 | Ga0373949_0070105 | 3300035090 | Bacteria | 917 |
| 624 | Ga0373951_0014861 | 3300035091 | Bacteria | 1752 |
| 625 | Ga0373951_0043560 | 3300035091 | Bacteria | 1088 |
| 626 | Ga0373939_0017221 | 3300035114 | Bacteria | 1917 |
| 627 | Ga0373945_0009294 | 3300035116 | Bacteria | 3219 |
| 628 | Ga0373943_0016651 | 3300035170 | Bacteria | 3355 |
| 629 | Ga0373946_0158954 | 3300035171 | Bacteria | 1060 |
| 630 | Ga0373961_0033330 | 3300035241 | Bacteria | 1450 |
| 631 | Ga0316574_0033526 | 3300035398 | Bacteria | 3126 |
| 632 | Ga0373924_0035860 | 3300035410 | Bacteria | 2013 |
| 633 | Ga0373924_0050263 | 3300035410 | Bacteria | 1727 |
| 634 | Ga0373931_0091333 | 3300035691 | Bacteria | 1697 |
| 635 | Ga0373931_0118835 | 3300035691 | Bacteria | 1508 |
| 636 | Ga0373931_0187880 | 3300035691 | Bacteria | 1227 |
| 637 | Ga0373931_0378823 | 3300035691 | Bacteria | 891 |
| 638 | Ga0373935_0141778 | 3300035692 | Bacteria | 1624 |
| 639 | Ga0373947_0000716 | 3300035725 | Bacteria | 19733 |
| 640 | Ga0373947_0003510 | 3300035725 | Bacteria | 9262 |
| 641 | Ga0373937_0086726 | 3300036401 | Bacteria | 2897 |
| 642 | Ga0373937_0147973 | 3300036401 | Bacteria | 2199 |
| 643 | Ga0373925_0022170 | 3300037068 | Bacteria | 4631 |
| 644 | Ga0373925_0156980 | 3300037068 | Bacteria | 1790 |
| 645 | Ga0373925_0498904 | 3300037068 | Bacteria | 999 |
| 646 | Ga0395899_0118116 | 3300037312 | Bacteria | 1902 |
| 647 | Ga0395899_0198643 | 3300037312 | Bacteria | 1400 |
| 648 | Ga0395899_0361197 | 3300037312 | Bacteria | 969 |
| 649 | Ga0395900_0012967 | 3300037418 | Bacteria | 8516 |
| 650 | Ga0395900_0077987 | 3300037418 | Bacteria | 3404 |
| 651 | Ga0395900_0169269 | 3300037418 | Bacteria | 2225 |
| 652 | Ga0395900_0200385 | 3300037418 | Bacteria | 2020 |
| 653 | Ga0395900_0259569 | 3300037418 | Bacteria | 1736 |
| 654 | Ga0395900_0268261 | 3300037418 | Bacteria | 1702 |
| 655 | Ga0395900_0355888 | 3300037418 | Bacteria | 1436 |
| 656 | Ga0395900_0370475 | 3300037418 | Bacteria | 1402 |
| 657 | Ga0395898_0016830 | 3300037466 | Bacteria | 7468 |
| 658 | Ga0395898_0066497 | 3300037466 | Bacteria | 3492 |
| 659 | Ga0395898_0069532 | 3300037466 | Bacteria | 3406 |
| 660 | Ga0395898_0119027 | 3300037466 | Bacteria | 2530 |
| 661 | Ga0395898_0138899 | 3300037466 | Bacteria | 2326 |
| 662 | Ga0395905_0004086 | 3300037471 | Bacteria | 15296 |
| 663 | Ga0395905_0017117 | 3300037471 | Bacteria | 6884 |
| 664 | Ga0395905_0070299 | 3300037471 | Bacteria | 3280 |
| 665 | Ga0395905_0101994 | 3300037471 | Bacteria | 2694 |
| 666 | Ga0395905_0198439 | 3300037471 | Bacteria | 1881 |
| 667 | Ga0395905_0208010 | 3300037471 | Bacteria | 1834 |
| 668 | Ga0395905_0278442 | 3300037471 | Bacteria | 1559 |
| 669 | Ga0395905_0594559 | 3300037471 | Bacteria | 1008 |
| 670 | Ga0436364_0777213 | 3300037853 | Bacteria | 1857 |
| 671 | Ga0395901_0009118 | 3300038443 | Bacteria | 10048 |
| 672 | Ga0395901_0032690 | 3300038443 | Bacteria | 5366 |
| 673 | Ga0395901_0039481 | 3300038443 | Bacteria | 4885 |
| 674 | Ga0395901_0042934 | 3300038443 | Bacteria | 4690 |
| 675 | Ga0395901_0043573 | 3300038443 | Bacteria | 4654 |
| 676 | Ga0395901_0043994 | 3300038443 | Bacteria | 4631 |
| 677 | Ga0395901_0054539 | 3300038443 | Bacteria | 4155 |
| 678 | Ga0395901_0058232 | 3300038443 | Bacteria | 4019 |
| 679 | Ga0395901_0078131 | 3300038443 | Bacteria | 3455 |
| 680 | Ga0395901_0084855 | 3300038443 | Bacteria | 3310 |
| 681 | Ga0395901_0088984 | 3300038443 | Bacteria | 3230 |
| 682 | Ga0395901_0146817 | 3300038443 | Bacteria | 2479 |
| 683 | Ga0395901_0181043 | 3300038443 | Bacteria | 2210 |
| 684 | Ga0395901_0223939 | 3300038443 | Bacteria | 1965 |
| 685 | Ga0395901_0229631 | 3300038443 | Bacteria | 1938 |
| 686 | Ga0395901_0344567 | 3300038443 | Bacteria | 1539 |
| 687 | Ga0395901_0949442 | 3300038443 | Bacteria | 839 |
| 688 | Ga0400489_30689 | 3300039093 | Unclassified | 1531 |
| 689 | Ga0436365_0006404 | 3300039437 | Bacteria | 1210 |
| 690 | Ga0436365_0432320 | 3300039437 | Bacteria | 3603 |
| 691 | Ga0451802_0341561 | 3300041460 | Bacteria | 968 |
| 692 | Ga0451853_2862384 | 3300041512 | Bacteria | 2365 |
| 693 | Ga0439437_003426 | 3300042000 | Bacteria | 1708 |
| 694 | Ga0439448_0090866 | 3300042005 | Bacteria | 1032 |
| 695 | Ga0451577_0018675 | 3300042876 | Bacteria | 6381 |
| 696 | Ga0466969_0018054 | 3300044656 | Bacteria | 3680 |
| 697 | Ga0466969_0032383 | 3300044656 | Bacteria | 2657 |
| 698 | Ga0466969_0179386 | 3300044656 | Bacteria | 969 |
| 699 | Ga0466965_0010523 | 3300044683 | Bacteria | 4321 |
| 700 | Ga0466966_0032124 | 3300044684 | Bacteria | 3404 |
| 701 | Ga0466966_0051301 | 3300044684 | Bacteria | 2622 |
| 702 | Ga0466966_0098784 | 3300044684 | Bacteria | 1807 |
| 703 | Ga0466961_0011516 | 3300044693 | Bacteria | 5656 |
| 704 | Ga0466961_0027253 | 3300044693 | Bacteria | 3674 |
| 705 | Ga0466961_0036895 | 3300044693 | Bacteria | 3137 |
| 706 | Ga0466961_0142964 | 3300044693 | Bacteria | 1497 |
| 707 | Ga0466963_0000102 | 3300044694 | Bacteria | 30465 |
| 708 | Ga0466963_0010890 | 3300044694 | Bacteria | 5521 |
| 709 | Ga0466963_0023100 | 3300044694 | Bacteria | 3943 |
| 710 | Ga0466963_0035996 | 3300044694 | Bacteria | 3226 |
| 711 | Ga0466963_0050205 | 3300044694 | Bacteria | 2761 |
| 712 | Ga0466963_0089031 | 3300044694 | Bacteria | 2099 |
| 713 | Ga0466963_0100144 | 3300044694 | Bacteria | 1983 |
| 714 | Ga0466963_0139083 | 3300044694 | Unclassified | 1681 |
| 715 | Ga0466963_0467939 | 3300044694 | Bacteria | 889 |
| 716 | Ga0466964_0000605 | 3300044706 | Bacteria | 11363 |
| 717 | Ga0466964_0023401 | 3300044706 | Bacteria | 2402 |
| 718 | Ga0466964_0028148 | 3300044706 | Bacteria | 2212 |
| 719 | Ga0466964_0069095 | 3300044706 | Bacteria | 1489 |
| 720 | Ga0466964_0191381 | 3300044706 | Bacteria | 976 |
| 721 | Ga0453684_0000010 | 3300044712 | Bacteria | 1133422 |
| 722 | Ga0453684_0010263 | 3300044712 | Bacteria | 16039 |
| 723 | Ga0453684_0381464 | 3300044712 | Bacteria | 1582 |
| 724 | Ga0453684_0491598 | 3300044712 | Bacteria | 1360 |
| 725 | Ga0453684_0870620 | 3300044712 | Bacteria | 967 |
| 726 | Ga0466971_0022304 | 3300044719 | Bacteria | 2820 |
| 727 | Ga0466971_0156309 | 3300044719 | Bacteria | 1066 |
| 728 | Ga0466968_0049152 | 3300044735 | Bacteria | 1796 |
| 729 | Ga0466957_0005999 | 3300044842 | Bacteria | 6851 |
| 730 | Ga0466957_0006707 | 3300044842 | Bacteria | 6509 |
| 731 | Ga0466957_0010804 | 3300044842 | Bacteria | 5250 |
| 732 | Ga0466957_0012459 | 3300044842 | Bacteria | 4922 |
| 733 | Ga0466957_0012815 | 3300044842 | Bacteria | 4859 |
| 734 | Ga0466957_0065348 | 3300044842 | Bacteria | 2240 |
| 735 | Ga0466957_0072172 | 3300044842 | Bacteria | 2137 |
| 736 | Ga0466960_0015688 | 3300044901 | Bacteria | 3272 |
| 737 | Ga0466960_0109198 | 3300044901 | Bacteria | 1435 |
| 738 | Ga0466959_0022676 | 3300045049 | Bacteria | 4642 |
| 739 | Ga0466959_0068222 | 3300045049 | Bacteria | 2577 |
| 740 | Ga0466959_0083506 | 3300045049 | Bacteria | 2300 |
| 741 | Ga0466959_0090588 | 3300045049 | Bacteria | 2196 |
| 742 | Ga0451576_0057448 | 3300045051 | Bacteria | 4067 |
| 743 | Ga0451576_0125429 | 3300045051 | Bacteria | 2675 |
| 744 | Ga0451576_0136515 | 3300045051 | Bacteria | 2558 |
| 745 | Ga0451576_0243935 | 3300045051 | Bacteria | 1877 |
| 746 | Ga0451576_0337033 | 3300045051 | Unclassified | 1579 |
| 747 | Ga0451576_0654822 | 3300045051 | Bacteria | 1104 |
| 748 | Ga0466958_0001499 | 3300045836 | Bacteria | 11159 |
| 749 | Ga0466958_0002621 | 3300045836 | Bacteria | 9096 |
| 750 | Ga0466958_0005793 | 3300045836 | Bacteria | 6681 |
| 751 | Ga0466958_0015119 | 3300045836 | Bacteria | 4416 |
| 752 | Ga0466958_0065024 | 3300045836 | Bacteria | 2225 |
| 753 | Ga0466958_0099629 | 3300045836 | Bacteria | 1806 |
| 754 | Ga0466958_0138481 | 3300045836 | Bacteria | 1532 |
| 755 | Ga0466958_0153432 | 3300045836 | Unclassified | 1453 |
| 756 | Ga0466958_0165947 | 3300045836 | Bacteria | 1397 |
| 757 | Ga0466967_0000094 | 3300045976 | Bacteria | 31562 |
| 758 | Ga0466967_0010173 | 3300045976 | Bacteria | 7036 |
| 759 | Ga0466967_0035333 | 3300045976 | Bacteria | 4253 |
| 760 | Ga0466967_0043805 | 3300045976 | Bacteria | 3877 |
| 761 | Ga0466967_0067412 | 3300045976 | Bacteria | 3192 |
| 762 | Ga0466967_0123222 | 3300045976 | Bacteria | 2398 |
| 763 | Ga0466967_0126701 | 3300045976 | Bacteria | 2366 |
| 764 | Ga0466967_0127512 | 3300045976 | Bacteria | 2358 |
| 765 | Ga0466967_0137764 | 3300045976 | Bacteria | 2271 |
| 766 | Ga0466967_0179443 | 3300045976 | Bacteria | 1997 |
| 767 | Ga0466967_0277968 | 3300045976 | Bacteria | 1606 |
| 768 | Ga0466967_0376842 | 3300045976 | Bacteria | 1377 |
| 769 | Ga0466967_0603432 | 3300045976 | Bacteria | 1083 |
| 770 | Ga0495592_0112190 | 3300046454 | Bacteria | 1928 |
| 771 | Ga0495592_0422016 | 3300046454 | Bacteria | 841 |
| 772 | Ga0495603_0004718 | 3300046455 | Bacteria | 8141 |
| 773 | Ga0495603_0056519 | 3300046455 | Bacteria | 2323 |
| 774 | Ga0495603_0059258 | 3300046455 | Bacteria | 2263 |
| 775 | Ga0495603_0128158 | 3300046455 | Bacteria | 1478 |
| 776 | Ga0495603_0147990 | 3300046455 | Bacteria | 1365 |
| 777 | Ga0495629_0007437 | 3300046459 | Bacteria | 8067 |
| 778 | Ga0495638_0023470 | 3300046460 | Bacteria | 4033 |
| 779 | Ga0495641_0037221 | 3300046461 | Bacteria | 2282 |
| 780 | Ga0495641_0038737 | 3300046461 | Bacteria | 2226 |
| 781 | Ga0495641_0149961 | 3300046461 | Bacteria | 1042 |
| 782 | Ga0495641_0197243 | 3300046461 | Bacteria | 902 |
| 783 | Ga0495651_0029097 | 3300046462 | Bacteria | 4309 |
| 784 | Ga0495651_0108670 | 3300046462 | Bacteria | 2054 |
| 785 | Ga0495651_0179920 | 3300046462 | Bacteria | 1497 |
| 786 | Ga0495651_0200190 | 3300046462 | Bacteria | 1398 |
| 787 | Ga0495651_0225714 | 3300046462 | Bacteria | 1293 |
| 788 | Ga0495653_0039078 | 3300046463 | Bacteria | 3720 |
| 789 | Ga0495653_0071013 | 3300046463 | Bacteria | 2604 |
| 790 | Ga0495653_0123569 | 3300046463 | Bacteria | 1841 |
| 791 | Ga0495653_0210297 | 3300046463 | Bacteria | 1314 |
| 792 | Ga0495653_0274616 | 3300046463 | Bacteria | 1109 |
| 793 | Ga0495580_0060092 | 3300046472 | Bacteria | 2671 |
| 794 | Ga0495580_0132076 | 3300046472 | Bacteria | 1732 |
| 795 | Ga0495582_0000276 | 3300046473 | Bacteria | 28706 |
| 796 | Ga0495582_0036843 | 3300046473 | Bacteria | 2691 |
| 797 | Ga0495582_0066259 | 3300046473 | Bacteria | 1995 |
| 798 | Ga0495582_0155464 | 3300046473 | Bacteria | 1299 |
| 799 | Ga0495639_0005164 | 3300046475 | Bacteria | 5609 |
| 800 | Ga0495662_0006130 | 3300046476 | Bacteria | 6009 |
| 801 | Ga0495662_0051842 | 3300046476 | Bacteria | 1980 |
| 802 | Ga0495662_0055270 | 3300046476 | Bacteria | 1918 |
| 803 | Ga0495664_0105841 | 3300046477 | Bacteria | 1696 |
| 804 | Ga0495664_0107502 | 3300046477 | Bacteria | 1683 |
| 805 | Ga0495664_0264328 | 3300046477 | Bacteria | 1040 |
| 806 | Ga0495584_0012744 | 3300046491 | Bacteria | 4292 |
| 807 | Ga0495594_0053587 | 3300046499 | Bacteria | 2222 |
| 808 | Ga0495596_0031419 | 3300046500 | Bacteria | 2121 |
| 809 | Ga0495608_0061490 | 3300046511 | Bacteria | 2469 |
| 810 | Ga0495608_0133276 | 3300046511 | Bacteria | 1589 |
| 811 | Ga0495608_0368316 | 3300046511 | Bacteria | 882 |
| 812 | Ga0495616_0087231 | 3300046513 | Bacteria | 1483 |
| 813 | Ga0495628_0159864 | 3300046516 | Bacteria | 1712 |
| 814 | Ga0495628_0268362 | 3300046516 | Bacteria | 1270 |
| 815 | Ga0495628_0273328 | 3300046516 | Bacteria | 1256 |
| 816 | Ga0495630_0021734 | 3300046517 | Bacteria | 4738 |
| 817 | Ga0495630_0112235 | 3300046517 | Bacteria | 2064 |
| 818 | Ga0495630_0230040 | 3300046517 | Bacteria | 1416 |
| 819 | Ga0495637_0029786 | 3300046520 | Bacteria | 2427 |
| 820 | Ga0495666_0021138 | 3300046526 | Bacteria | 3222 |
| 821 | Ga0495652_0103906 | 3300046529 | Bacteria | 2299 |
| 822 | Ga0495652_0127119 | 3300046529 | Bacteria | 2023 |
| 823 | Ga0495665_0000572 | 3300046531 | Bacteria | 18699 |
| 824 | Ga0495640_0083890 | 3300046533 | Bacteria | 2114 |
| 825 | Ga0495586_0002209 | 3300046535 | Bacteria | 10571 |
| 826 | Ga0495586_0028166 | 3300046535 | Bacteria | 3007 |
| 827 | Ga0495587_0053676 | 3300046536 | Bacteria | 2376 |
| 828 | Ga0495587_0068608 | 3300046536 | Bacteria | 2065 |
| 829 | Ga0495587_0257399 | 3300046536 | Bacteria | 981 |
| 830 | Ga0495609_0051064 | 3300046538 | Bacteria | 1842 |
| 831 | Ga0495609_0158928 | 3300046538 | Bacteria | 959 |
| 832 | Ga0495645_0021825 | 3300046543 | Bacteria | 4628 |
| 833 | Ga0495667_0045587 | 3300046559 | Bacteria | 2902 |
| 834 | Ga0495667_0051461 | 3300046559 | Bacteria | 2717 |
| 835 | Ga0495667_0113787 | 3300046559 | Bacteria | 1748 |
| 836 | Ga0495667_0137860 | 3300046559 | Bacteria | 1573 |
| 837 | Ga0495656_0015563 | 3300046615 | Bacteria | 2873 |
| 838 | Ga0495656_0028346 | 3300046615 | Bacteria | 2246 |
| 839 | Ga0495656_0213418 | 3300046615 | Bacteria | 963 |
| 840 | Ga0495668_0315186 | 3300046616 | Bacteria | 858 |
| 841 | Ga0495634_0001787 | 3300046642 | Bacteria | 18578 |
| 842 | Ga0495634_0034641 | 3300046642 | Bacteria | 3463 |
| 843 | Ga0495634_0108820 | 3300046642 | Bacteria | 1784 |
| 844 | Ga0495634_0146058 | 3300046642 | Bacteria | 1498 |
| 845 | Ga0495634_0396591 | 3300046642 | Bacteria | 820 |
| 846 | Ga0495635_0037174 | 3300046663 | Bacteria | 3371 |
| 847 | Ga0495635_0137309 | 3300046663 | Bacteria | 1666 |
| 848 | Ga0495635_0245854 | 3300046663 | Bacteria | 1207 |
| 849 | Ga0495659_0028230 | 3300046664 | Bacteria | 1941 |
| 850 | Ga0495657_0066221 | 3300046675 | Bacteria | 2373 |
| 851 | Ga0495657_0099027 | 3300046675 | Bacteria | 1860 |
| 852 | Ga0495599_0041853 | 3300046678 | Bacteria | 2875 |
| 853 | Ga0495599_0140650 | 3300046678 | Bacteria | 1497 |
| 854 | Ga0495623_0192790 | 3300046679 | Bacteria | 1176 |
| 855 | Ga0495646_0057150 | 3300046680 | Bacteria | 2337 |
| 856 | Ga0495646_0071900 | 3300046680 | Bacteria | 2035 |
| 857 | Ga0495646_0148697 | 3300046680 | Bacteria | 1304 |
| 858 | Ga0495647_0009057 | 3300046681 | Bacteria | 3361 |
| 859 | Ga0495647_0014454 | 3300046681 | Bacteria | 2750 |
| 860 | Ga0495647_0073935 | 3300046681 | Bacteria | 1369 |
| 861 | Ga0495647_0109247 | 3300046681 | Bacteria | 1153 |
| 862 | Ga0495658_0001870 | 3300046683 | Bacteria | 10742 |
| 863 | Ga0495658_0004883 | 3300046683 | Bacteria | 6578 |
| 864 | Ga0495658_0047475 | 3300046683 | Bacteria | 2418 |
| 865 | Ga0495613_0004641 | 3300046689 | Bacteria | 10313 |
| 866 | Ga0495613_0036619 | 3300046689 | Bacteria | 3639 |
| 867 | Ga0495613_0126066 | 3300046689 | Bacteria | 1836 |
| 868 | Ga0495624_0025832 | 3300046690 | Bacteria | 3853 |
| 869 | Ga0495624_0077764 | 3300046690 | Bacteria | 2058 |
| 870 | Ga0495624_0078118 | 3300046690 | Bacteria | 2053 |
| 871 | Ga0495624_0293054 | 3300046690 | Bacteria | 982 |
| 872 | Ga0495589_0035843 | 3300046794 | Bacteria | 2487 |
| 873 | Ga0495589_0039947 | 3300046794 | Bacteria | 2344 |
| 874 | Ga0495589_0107643 | 3300046794 | Bacteria | 1347 |
| 875 | Ga0495600_0026476 | 3300046809 | Bacteria | 3743 |
| 876 | Ga0495600_0052616 | 3300046809 | Bacteria | 2659 |
| 877 | Ga0495581_0000299 | 3300047315 | Bacteria | 24150 |
| 878 | Ga0495581_0023666 | 3300047315 | Bacteria | 3559 |
| 879 | Ga0495581_0040548 | 3300047315 | Bacteria | 2694 |
| 880 | Ga0495604_0060636 | 3300047317 | Bacteria | 2896 |
| 881 | Ga0495604_0072873 | 3300047317 | Bacteria | 2594 |
| 882 | Ga0495636_0100590 | 3300047318 | Bacteria | 1264 |
| 883 | Ga0495674_0039020 | 3300047319 | Bacteria | 4258 |
| 884 | Ga0495674_0045597 | 3300047319 | Bacteria | 3893 |
| 885 | Ga0495674_0110392 | 3300047319 | Bacteria | 2332 |
| 886 | Ga0495674_0149599 | 3300047319 | Bacteria | 1958 |
| 887 | Ga0495674_0184882 | 3300047319 | Bacteria | 1734 |
| 888 | Ga0495674_0220606 | 3300047319 | Bacteria | 1567 |
| 889 | Ga0495676_0018113 | 3300047321 | Bacteria | 6212 |
| 890 | Ga0495676_0031701 | 3300047321 | Bacteria | 4466 |
| 891 | Ga0495676_0126366 | 3300047321 | Bacteria | 1853 |
| 892 | Ga0495676_0159147 | 3300047321 | Bacteria | 1599 |
| 893 | Ga0495676_0231967 | 3300047321 | Bacteria | 1267 |
| 894 | Ga0495680_0004661 | 3300047322 | Bacteria | 13055 |
| 895 | Ga0495680_0012355 | 3300047322 | Bacteria | 7518 |
| 896 | Ga0495680_0117888 | 3300047322 | Bacteria | 1962 |
| 897 | Ga0495680_0148298 | 3300047322 | Bacteria | 1712 |
| 898 | Ga0495680_0150864 | 3300047322 | Bacteria | 1695 |
| 899 | Ga0495680_0217052 | 3300047322 | Bacteria | 1367 |
| 900 | Ga0495680_0238748 | 3300047322 | Bacteria | 1291 |
| 901 | Ga0495679_087269 | 3300047446 | Bacteria | 879 |
| 902 | Ga0495684_0062775 | 3300047471 | Bacteria | 2825 |
| 903 | Ga0495684_0231631 | 3300047471 | Bacteria | 1351 |
| 904 | Ga0495593_0002593 | 3300047673 | Bacteria | 10864 |
| 905 | Ga0495593_0154571 | 3300047673 | Bacteria | 1160 |
| 906 | Ga0495602_0078572 | 3300048088 | Bacteria | 2787 |
| 907 | Ga0495614_0003312 | 3300048089 | Bacteria | 7203 |
| 908 | Ga0496100_0015305 | 3300048903 | Bacteria | 4478 |
| 909 | Ga0496100_0016429 | 3300048903 | Bacteria | 4347 |
| 910 | Ga0496100_0073446 | 3300048903 | Bacteria | 2289 |
| 911 | Ga0496100_0074014 | 3300048903 | Bacteria | 2281 |
| 912 | Ga0496100_0408351 | 3300048903 | Bacteria | 1035 |
| 913 | Ga0496100_0807802 | 3300048903 | Bacteria | 735 |
| 914 | Ga0496101_0004296 | 3300048904 | Bacteria | 8942 |
| 915 | Ga0496101_0008345 | 3300048904 | Bacteria | 6768 |
| 916 | Ga0496101_0009481 | 3300048904 | Bacteria | 6398 |
| 917 | Ga0496101_0089345 | 3300048904 | Bacteria | 2289 |
| 918 | Ga0496101_0167812 | 3300048904 | Bacteria | 1686 |
| 919 | Ga0496101_0202466 | 3300048904 | Bacteria | 1535 |
| 920 | Ga0496101_0204877 | 3300048904 | Bacteria | 1526 |
| 921 | Ga0496101_0306762 | 3300048904 | Bacteria | 1244 |
| 922 | Ga0496102_0008554 | 3300048905 | Bacteria | 8776 |
| 923 | Ga0496102_0012440 | 3300048905 | Bacteria | 7363 |
| 924 | Ga0496102_0077496 | 3300048905 | Bacteria | 3059 |
| 925 | Ga0496102_0120453 | 3300048905 | Bacteria | 2450 |
| 926 | Ga0496102_0186271 | 3300048905 | Bacteria | 1956 |
| 927 | Ga0496102_0834715 | 3300048905 | Bacteria | 844 |
| 928 | Ga0496103_0001580 | 3300048906 | Bacteria | 15016 |
| 929 | Ga0496103_0019582 | 3300048906 | Bacteria | 4063 |
| 930 | Ga0496103_0047344 | 3300048906 | Bacteria | 2657 |
| 931 | Ga0496103_0153094 | 3300048906 | Bacteria | 1477 |
| 932 | Ga0496103_0212265 | 3300048906 | Bacteria | 1245 |
| 933 | Ga0496104_0001139 | 3300048907 | Bacteria | 22770 |
| 934 | Ga0496104_0005108 | 3300048907 | Bacteria | 11453 |
| 935 | Ga0496104_0005360 | 3300048907 | Bacteria | 11225 |
| 936 | Ga0496104_0013132 | 3300048907 | Bacteria | 7465 |
| 937 | Ga0496104_0059626 | 3300048907 | Bacteria | 3613 |
| 938 | Ga0496104_0067172 | 3300048907 | Bacteria | 3406 |
| 939 | Ga0496104_0096680 | 3300048907 | Bacteria | 2826 |
| 940 | Ga0496104_0187291 | 3300048907 | Bacteria | 1980 |
| 941 | Ga0496104_0493287 | 3300048907 | Bacteria | 1136 |
| 942 | Ga0496105_0004028 | 3300048908 | Bacteria | 10995 |
| 943 | Ga0496105_0012369 | 3300048908 | Bacteria | 6756 |
| 944 | Ga0496105_0017229 | 3300048908 | Bacteria | 5787 |
| 945 | Ga0496105_0028056 | 3300048908 | Bacteria | 4603 |
| 946 | Ga0496105_0039024 | 3300048908 | Bacteria | 3913 |
| 947 | Ga0496105_0055166 | 3300048908 | Bacteria | 3281 |
| 948 | Ga0496105_0058366 | 3300048908 | Bacteria | 3185 |
| 949 | Ga0496105_0199542 | 3300048908 | Bacteria | 1633 |
| 950 | Ga0496106_0001856 | 3300048909 | Bacteria | 15812 |
| 951 | Ga0496106_0002999 | 3300048909 | Bacteria | 12571 |
| 952 | Ga0496106_0010072 | 3300048909 | Bacteria | 6980 |
| 953 | Ga0496106_0022175 | 3300048909 | Bacteria | 4715 |
| 954 | Ga0496106_0126590 | 3300048909 | Bacteria | 2001 |
| 955 | Ga0496106_0199445 | 3300048909 | Bacteria | 1592 |
| 956 | Ga0496106_0210232 | 3300048909 | Bacteria | 1550 |
| 957 | Ga0496106_0280407 | 3300048909 | Bacteria | 1335 |
| 958 | Ga0496106_0336393 | 3300048909 | Bacteria | 1212 |
| 959 | Ga0496107_0002448 | 3300048910 | Bacteria | 12036 |
| 960 | Ga0496107_0007725 | 3300048910 | Bacteria | 7426 |
| 961 | Ga0496107_0008691 | 3300048910 | Bacteria | 7034 |
| 962 | Ga0496107_0046508 | 3300048910 | Bacteria | 3123 |
| 963 | Ga0496107_0099236 | 3300048910 | Bacteria | 2134 |
| 964 | Ga0496107_0116330 | 3300048910 | Bacteria | 1968 |
| 965 | Ga0496107_0187509 | 3300048910 | Bacteria | 1536 |
| 966 | Ga0496107_0366541 | 3300048910 | Bacteria | 1072 |
| 967 | Ga0496108_0002749 | 3300048911 | Bacteria | 14085 |
| 968 | Ga0496108_0010043 | 3300048911 | Bacteria | 7677 |
| 969 | Ga0496108_0019012 | 3300048911 | Bacteria | 5635 |
| 970 | Ga0496108_0050552 | 3300048911 | Bacteria | 3479 |
| 971 | Ga0496108_0114934 | 3300048911 | Bacteria | 2304 |
| 972 | Ga0496108_0177397 | 3300048911 | Bacteria | 1845 |
| 973 | Ga0496108_0193582 | 3300048911 | Bacteria | 1763 |
| 974 | Ga0496108_0258950 | 3300048911 | Bacteria | 1514 |
| 975 | Ga0496108_0330562 | 3300048911 | Bacteria | 1329 |
| 976 | Ga0496108_0473395 | 3300048911 | Bacteria | 1094 |
| 977 | Ga0496109_0005622 | 3300048912 | Bacteria | 10487 |
| 978 | Ga0496109_0029299 | 3300048912 | Bacteria | 4930 |
| 979 | Ga0496109_0033503 | 3300048912 | Bacteria | 4622 |
| 980 | Ga0496109_0107010 | 3300048912 | Bacteria | 2597 |
| 981 | Ga0496109_0137368 | 3300048912 | Unclassified | 2285 |
| 982 | Ga0496109_0234187 | 3300048912 | Bacteria | 1728 |
| 983 | Ga0496109_0258433 | 3300048912 | Bacteria | 1640 |
| 984 | Ga0496109_0284801 | 3300048912 | Bacteria | 1557 |
| 985 | Ga0496109_0304721 | 3300048912 | Bacteria | 1502 |
| 986 | Ga0496109_0350730 | 3300048912 | Bacteria | 1394 |
| 987 | Ga0496109_0372164 | 3300048912 | Bacteria | 1350 |
| 988 | Ga0496109_0406508 | 3300048912 | Bacteria | 1286 |
| 989 | Ga0496110_0004665 | 3300048913 | Bacteria | 10654 |
| 990 | Ga0496110_0006563 | 3300048913 | Bacteria | 9237 |
| 991 | Ga0496110_0027322 | 3300048913 | Bacteria | 4891 |
| 992 | Ga0496110_0043565 | 3300048913 | Bacteria | 3919 |
| 993 | Ga0496110_0045118 | 3300048913 | Bacteria | 3851 |
| 994 | Ga0496110_0067328 | 3300048913 | Bacteria | 3168 |
| 995 | Ga0496110_0117958 | 3300048913 | Bacteria | 2390 |
| 996 | Ga0496110_0307680 | 3300048913 | Bacteria | 1443 |
| 997 | Ga0496111_0000288 | 3300048914 | Bacteria | 24472 |
| 998 | Ga0496111_0004255 | 3300048914 | Bacteria | 9020 |
| 999 | Ga0496111_0004710 | 3300048914 | Bacteria | 8653 |
| 1000 | Ga0496111_0027069 | 3300048914 | Bacteria | 4053 |
| 1001 | Ga0496111_0041781 | 3300048914 | Bacteria | 3291 |
| 1002 | Ga0496111_0139527 | 3300048914 | Bacteria | 1796 |
| 1003 | Ga0496111_0144299 | 3300048914 | Bacteria | 1764 |
| 1004 | Ga0496111_0152528 | 3300048914 | Bacteria | 1714 |
| 1005 | Ga0496111_0201249 | 3300048914 | Bacteria | 1480 |
| 1006 | Ga0496111_0481097 | 3300048914 | Bacteria | 915 |
| 1007 | Ga0496111_0599209 | 3300048914 | Bacteria | 807 |
| 1008 | Ga0496112_0002860 | 3300048915 | Bacteria | 14023 |
| 1009 | Ga0496112_0003099 | 3300048915 | Bacteria | 13632 |
| 1010 | Ga0496112_0005474 | 3300048915 | Bacteria | 10991 |
| 1011 | Ga0496112_0033615 | 3300048915 | Bacteria | 4986 |
| 1012 | Ga0496112_0053955 | 3300048915 | Bacteria | 3949 |
| 1013 | Ga0496112_0104963 | 3300048915 | Bacteria | 2795 |
| 1014 | Ga0496112_0379729 | 3300048915 | Bacteria | 1354 |
| 1015 | Ga0496113_0005587 | 3300048916 | Bacteria | 7860 |
| 1016 | Ga0496113_0015305 | 3300048916 | Bacteria | 5268 |
| 1017 | Ga0496113_0081834 | 3300048916 | Bacteria | 2475 |
| 1018 | Ga0496113_0185700 | 3300048916 | Bacteria | 1649 |
| 1019 | Ga0496113_0205569 | 3300048916 | Bacteria | 1566 |
| 1020 | Ga0496113_0419466 | 3300048916 | Bacteria | 1075 |
| 1021 | Ga0496114_0001648 | 3300048917 | Bacteria | 16935 |
| 1022 | Ga0496114_0018197 | 3300048917 | Bacteria | 5677 |
| 1023 | Ga0496114_0020804 | 3300048917 | Bacteria | 5326 |
| 1024 | Ga0496114_0026489 | 3300048917 | Bacteria | 4747 |
| 1025 | Ga0496114_0033298 | 3300048917 | Bacteria | 4245 |
| 1026 | Ga0496114_0161680 | 3300048917 | Bacteria | 1948 |
| 1027 | Ga0496114_0191337 | 3300048917 | Bacteria | 1790 |
| 1028 | Ga0496114_0209586 | 3300048917 | Bacteria | 1709 |
| 1029 | Ga0496114_0225858 | 3300048917 | Bacteria | 1644 |
| 1030 | Ga0496114_0267785 | 3300048917 | Bacteria | 1505 |
| 1031 | Ga0496114_0282425 | 3300048917 | Bacteria | 1464 |
| 1032 | Ga0496114_0815212 | 3300048917 | Bacteria | 812 |
| 1033 | Ga0496114_1102853 | 3300048917 | Bacteria | 678 |
| 1034 | Ga0496115_0002150 | 3300048918 | Bacteria | 14090 |
| 1035 | Ga0496115_0010406 | 3300048918 | Bacteria | 6948 |
| 1036 | Ga0496115_0013970 | 3300048918 | Bacteria | 6077 |
| 1037 | Ga0496115_0017777 | 3300048918 | Bacteria | 5444 |
| 1038 | Ga0496115_0336985 | 3300048918 | Bacteria | 1231 |
| 1039 | Ga0496115_0351860 | 3300048918 | Bacteria | 1201 |
| 1040 | Ga0496124_0017873 | 3300048927 | Bacteria | 6666 |
| 1041 | Ga0501031_0003598 | 3300049568 | Bacteria | 9962 |
| 1042 | Ga0501031_0110526 | 3300049568 | Bacteria | 1795 |
| 1043 | Ga0501032_0229668 | 3300049569 | Bacteria | 1207 |
| 1044 | Ga0501032_0353355 | 3300049569 | Bacteria | 947 |
| 1045 | Ga0501032_0355513 | 3300049569 | Bacteria | 943 |
| 1046 | Ga0501032_0376423 | 3300049569 | Bacteria | 913 |
| 1047 | Ga0501033_0079590 | 3300049570 | Bacteria | 2405 |
| 1048 | Ga0501033_0129627 | 3300049570 | Bacteria | 1828 |
| 1049 | Ga0501033_0159404 | 3300049570 | Bacteria | 1625 |
| 1050 | Ga0501034_0027696 | 3300049571 | Bacteria | 5763 |
| 1051 | Ga0501034_0286574 | 3300049571 | Bacteria | 1586 |
| 1052 | Ga0501036_0004190 | 3300049572 | Bacteria | 11619 |
| 1053 | Ga0501036_0013535 | 3300049572 | Bacteria | 6782 |
| 1054 | Ga0501036_0188178 | 3300049572 | Bacteria | 1737 |
| 1055 | Ga0501036_0226166 | 3300049572 | Bacteria | 1570 |
| 1056 | Ga0501037_0045139 | 3300049573 | Bacteria | 3235 |
| 1057 | Ga0501037_0085265 | 3300049573 | Bacteria | 2287 |
| 1058 | Ga0501037_0154833 | 3300049573 | Bacteria | 1636 |
| 1059 | Ga0501037_0379450 | 3300049573 | Bacteria | 972 |
| 1060 | Ga0501037_0428613 | 3300049573 | Bacteria | 904 |
| 1061 | Ga0501038_0000446 | 3300049574 | Bacteria | 36005 |
| 1062 | Ga0501038_0042057 | 3300049574 | Bacteria | 3982 |
| 1063 | Ga0501038_0112845 | 3300049574 | Bacteria | 2250 |
| 1064 | Ga0501038_0324391 | 3300049574 | Bacteria | 1204 |
| 1065 | Ga0501039_0023064 | 3300049575 | Bacteria | 4774 |
| 1066 | Ga0501039_0034063 | 3300049575 | Bacteria | 3930 |
| 1067 | Ga0501039_0071099 | 3300049575 | Bacteria | 2703 |
| 1068 | Ga0501039_0163950 | 3300049575 | Bacteria | 1747 |
| 1069 | Ga0501039_0188138 | 3300049575 | Bacteria | 1624 |
| 1070 | Ga0501039_0211760 | 3300049575 | Bacteria | 1524 |
| 1071 | Ga0501040_0012635 | 3300049576 | Bacteria | 5538 |
| 1072 | Ga0501040_0022097 | 3300049576 | Bacteria | 4255 |
| 1073 | Ga0501040_0039691 | 3300049576 | Bacteria | 3202 |
| 1074 | Ga0501040_0107088 | 3300049576 | Bacteria | 1953 |
| 1075 | Ga0501041_0043769 | 3300049577 | Bacteria | 2722 |
| 1076 | Ga0501041_0057511 | 3300049577 | Bacteria | 2378 |
| 1077 | Ga0501042_0015244 | 3300049578 | Bacteria | 5260 |
| 1078 | Ga0501042_0025305 | 3300049578 | Bacteria | 4167 |
| 1079 | Ga0501042_0048914 | 3300049578 | Unclassified | 3015 |
| 1080 | Ga0501042_0062232 | 3300049578 | Bacteria | 2666 |
| 1081 | Ga0501042_0069676 | 3300049578 | Bacteria | 2515 |
| 1082 | Ga0501042_0108619 | 3300049578 | Bacteria | 1997 |
| 1083 | Ga0501043_0086910 | 3300049579 | Bacteria | 2457 |
| 1084 | Ga0501043_0323559 | 3300049579 | Bacteria | 1175 |
| 1085 | Ga0501043_0590038 | 3300049579 | Bacteria | 822 |
| 1086 | Ga0501046_0010022 | 3300049580 | Bacteria | 8161 |
| 1087 | Ga0501046_0057770 | 3300049580 | Bacteria | 3043 |
| 1088 | Ga0501046_0172201 | 3300049580 | Bacteria | 1624 |
| 1089 | Ga0501046_0201453 | 3300049580 | Bacteria | 1481 |
| 1090 | Ga0501046_0208249 | 3300049580 | Unclassified | 1452 |
| 1091 | Ga0501048_0004532 | 3300049582 | Bacteria | 10576 |
| 1092 | Ga0501048_0027573 | 3300049582 | Bacteria | 4126 |
| 1093 | Ga0501048_0115205 | 3300049582 | Bacteria | 1899 |
| 1094 | Ga0501048_0382149 | 3300049582 | Bacteria | 1006 |
| 1095 | Ga0501067_0070381 | 3300049583 | Bacteria | 1937 |
| 1096 | Ga0501068_0025392 | 3300049584 | Bacteria | 3485 |
| 1097 | Ga0501068_0040678 | 3300049584 | Bacteria | 2791 |
| 1098 | Ga0501068_0048806 | 3300049584 | Bacteria | 2556 |
| 1099 | Ga0501068_0120808 | 3300049584 | Bacteria | 1633 |
| 1100 | Ga0501069_0081830 | 3300049585 | Bacteria | 1819 |
| 1101 | Ga0501069_0379120 | 3300049585 | Bacteria | 835 |
| 1102 | Ga0501070_0007864 | 3300049586 | Bacteria | 9035 |
| 1103 | Ga0501070_0025308 | 3300049586 | Bacteria | 4977 |
| 1104 | Ga0501070_0030446 | 3300049586 | Bacteria | 4522 |
| 1105 | Ga0501070_0146428 | 3300049586 | Unclassified | 1949 |
| 1106 | Ga0501070_0276070 | 3300049586 | Bacteria | 1372 |
| 1107 | Ga0501070_0526362 | 3300049586 | Bacteria | 948 |
| 1108 | Ga0501070_0654971 | 3300049586 | Bacteria | 833 |
| 1109 | Ga0501071_0005448 | 3300049587 | Bacteria | 8181 |
| 1110 | Ga0501071_0012845 | 3300049587 | Bacteria | 5694 |
| 1111 | Ga0501071_0042704 | 3300049587 | Bacteria | 3249 |
| 1112 | Ga0501071_0057442 | 3300049587 | Bacteria | 2812 |
| 1113 | Ga0501071_0058594 | 3300049587 | Unclassified | 2785 |
| 1114 | Ga0501071_0082261 | 3300049587 | Bacteria | 2357 |
| 1115 | Ga0501071_0137178 | 3300049587 | Bacteria | 1821 |
| 1116 | Ga0501071_0315851 | 3300049587 | Bacteria | 1186 |
| 1117 | Ga0501072_0006173 | 3300049588 | Bacteria | 9128 |
| 1118 | Ga0501072_0009485 | 3300049588 | Bacteria | 7400 |
| 1119 | Ga0501072_0012154 | 3300049588 | Bacteria | 6579 |
| 1120 | Ga0501072_0018769 | 3300049588 | Bacteria | 5333 |
| 1121 | Ga0501072_0043691 | 3300049588 | Bacteria | 3522 |
| 1122 | Ga0501072_0133557 | 3300049588 | Bacteria | 1979 |
| 1123 | Ga0501072_0144443 | 3300049588 | Unclassified | 1897 |
| 1124 | Ga0501072_0157113 | 3300049588 | Bacteria | 1813 |
| 1125 | Ga0501072_0171827 | 3300049588 | Bacteria | 1730 |
| 1126 | Ga0501072_0233106 | 3300049588 | Bacteria | 1466 |
| 1127 | Ga0501073_0026239 | 3300049589 | Bacteria | 4174 |
| 1128 | Ga0501073_0067079 | 3300049589 | Bacteria | 2501 |
| 1129 | Ga0501073_0163997 | 3300049589 | Bacteria | 1539 |
| 1130 | Ga0501073_0374212 | 3300049589 | Unclassified | 984 |
| 1131 | Ga0501074_0000736 | 3300049590 | Bacteria | 20545 |
| 1132 | Ga0501074_0030080 | 3300049590 | Bacteria | 3935 |
| 1133 | Ga0501074_0042310 | 3300049590 | Bacteria | 3296 |
| 1134 | Ga0501074_0046531 | 3300049590 | Bacteria | 3137 |
| 1135 | Ga0501074_0450324 | 3300049590 | Bacteria | 913 |
| 1136 | Ga0501075_0005948 | 3300049591 | Bacteria | 8350 |
| 1137 | Ga0501075_0007307 | 3300049591 | Bacteria | 7660 |
| 1138 | Ga0501075_0011862 | 3300049591 | Bacteria | 6182 |
| 1139 | Ga0501075_0026807 | 3300049591 | Bacteria | 4244 |
| 1140 | Ga0501075_0037718 | 3300049591 | Bacteria | 3611 |
| 1141 | Ga0501075_0055402 | 3300049591 | Bacteria | 2983 |
| 1142 | Ga0501075_0117877 | 3300049591 | Bacteria | 2018 |
| 1143 | Ga0501075_0323506 | 3300049591 | Bacteria | 1175 |
| 1144 | Ga0501075_0334482 | 3300049591 | Bacteria | 1154 |
| 1145 | Ga0501076_0001738 | 3300049592 | Bacteria | 14736 |
| 1146 | Ga0501076_0017433 | 3300049592 | Bacteria | 5459 |
| 1147 | Ga0501076_0269723 | 3300049592 | Unclassified | 1393 |
| 1148 | Ga0501076_0884023 | 3300049592 | Bacteria | 737 |
| 1149 | Ga0501077_0009606 | 3300049593 | Bacteria | 6013 |
| 1150 | Ga0501077_0031481 | 3300049593 | Bacteria | 3375 |
| 1151 | Ga0501077_0035827 | 3300049593 | Bacteria | 3159 |
| 1152 | Ga0501077_0065530 | 3300049593 | Bacteria | 2303 |
| 1153 | Ga0501077_0076067 | 3300049593 | Bacteria | 2126 |
| 1154 | Ga0501077_0099334 | 3300049593 | Bacteria | 1845 |
| 1155 | Ga0501079_0009682 | 3300049741 | Bacteria | 7306 |
| 1156 | Ga0501079_0014419 | 3300049741 | Bacteria | 6025 |
| 1157 | Ga0501079_0028311 | 3300049741 | Bacteria | 4298 |
| 1158 | Ga0501079_0042811 | 3300049741 | Bacteria | 3496 |
| 1159 | Ga0501079_0049923 | 3300049741 | Bacteria | 3230 |
| 1160 | Ga0501079_0114174 | 3300049741 | Bacteria | 2100 |
| 1161 | Ga0501079_0128038 | 3300049741 | Bacteria | 1975 |
| 1162 | Ga0501079_0143161 | 3300049741 | Bacteria | 1862 |
| 1163 | Ga0501079_0175157 | 3300049741 | Bacteria | 1673 |
| 1164 | Ga0501080_0000499 | 3300049742 | Bacteria | 30720 |
| 1165 | Ga0501080_0001199 | 3300049742 | Bacteria | 21483 |
| 1166 | Ga0501080_0010935 | 3300049742 | Bacteria | 8304 |
| 1167 | Ga0501080_0024873 | 3300049742 | Bacteria | 5553 |
| 1168 | Ga0501080_0039582 | 3300049742 | Bacteria | 4399 |
| 1169 | Ga0501080_0161958 | 3300049742 | Bacteria | 2066 |
| 1170 | Ga0501080_0162004 | 3300049742 | Bacteria | 2065 |
| 1171 | Ga0501080_0193981 | 3300049742 | Bacteria | 1866 |
| 1172 | Ga0501080_0313926 | 3300049742 | Bacteria | 1420 |
| 1173 | Ga0501081_0011438 | 3300049743 | Bacteria | 5806 |
| 1174 | Ga0501081_0056041 | 3300049743 | Bacteria | 2723 |
| 1175 | Ga0501081_0060936 | 3300049743 | Bacteria | 2615 |
| 1176 | Ga0501081_0134015 | 3300049743 | Bacteria | 1772 |
| 1177 | Ga0501081_0151605 | 3300049743 | Unclassified | 1665 |
| 1178 | Ga0501081_0484051 | 3300049743 | Bacteria | 921 |
| 1179 | Ga0501083_0000893 | 3300049744 | Bacteria | 19783 |
| 1180 | Ga0501083_0028348 | 3300049744 | Bacteria | 3859 |
| 1181 | Ga0501083_0161018 | 3300049744 | Bacteria | 1468 |
| 1182 | Ga0501035_0146125 | 3300049822 | Bacteria | 2053 |
| 1183 | Ga0501035_0331103 | 3300049822 | Bacteria | 1278 |
| 1184 | Ga0501045_0015035 | 3300049824 | Bacteria | 5493 |
| 1185 | Ga0501045_0083774 | 3300049824 | Bacteria | 2352 |
| 1186 | Ga0501045_0264864 | 3300049824 | Unclassified | 1279 |
| 1187 | nmdc:mga00v17_9903_c2 | 3300050491 | Bacteria | 4503 |
| 1188 | nmdc:mga05p37_19183_c1 | 3300050507 | Bacteria | 8271 |
| 1189 | nmdc:mga05p37_22454_c1 | 3300050507 | Bacteria | 7651 |
| 1190 | nmdc:mga05p37_677078_c1 | 3300050507 | Bacteria | 1150 |
| 1191 | nmdc:mga05p37_835825_c1 | 3300050507 | Bacteria | 1002 |
| 1192 | nmdc:mga09592_139208_c1 | 3300050508 | Bacteria | 2091 |
| 1193 | nmdc:mga09592_307391_c1 | 3300050508 | Bacteria | 1374 |
| 1194 | nmdc:mga09592_86732_c1 | 3300050508 | Bacteria | 2671 |
| 1195 | nmdc:mga0qj67_158054_c1 | 3300050509 | Bacteria | 1840 |
| 1196 | nmdc:mga0qj67_41497_c1 | 3300050509 | Bacteria | 3619 |
| 1197 | nmdc:mga0qj67_45717_c1 | 3300050509 | Unclassified | 1958 |
| 1198 | nmdc:mga06r32_1531_c1 | 3300050510 | Bacteria | 20797 |
| 1199 | nmdc:mga06r32_231842_c1 | 3300050510 | Bacteria | 1834 |
| 1200 | nmdc:mga06r32_79884_c1 | 3300050510 | Bacteria | 3182 |
| 1201 | nmdc:mga08y16_117386_c1 | 3300050511 | Bacteria | 2770 |
| 1202 | nmdc:mga08y16_129588_c1 | 3300050511 | Bacteria | 2624 |
| 1203 | nmdc:mga08y16_16439_c2 | 3300050511 | Bacteria | 6799 |
| 1204 | nmdc:mga08y16_398209_c1 | 3300050511 | Bacteria | 1410 |
| 1205 | nmdc:mga0n895_45303_c1 | 3300050512 | Bacteria | 4292 |
| 1206 | nmdc:mga0n895_520946_c1 | 3300050512 | Bacteria | 1196 |
| 1207 | nmdc:mga0a205_34513_c1 | 3300050515 | Bacteria | 4852 |
| 1208 | nmdc:mga0a205_448547_c1 | 3300050515 | Bacteria | 1150 |
| 1209 | nmdc:mga0a205_94809_c1 | 3300050515 | Bacteria | 2883 |
| 1210 | Ga0495601_0092972 | 3300053077 | Bacteria | 1942 |
| 1211 | Ga0495601_0179663 | 3300053077 | Bacteria | 1384 |
| 1212 | Ga0495601_0183535 | 3300053077 | Bacteria | 1367 |
| 1213 | Ga0495601_0359774 | 3300053077 | Bacteria | 946 |
| 1214 | Ga0495595_0088098 | 3300053084 | Bacteria | 1486 |
| 1215 | Ga0495595_0094024 | 3300053084 | Bacteria | 1441 |
| 1216 | Ga0495619_0012071 | 3300053085 | Bacteria | 5443 |
| 1217 | Ga0495619_0064972 | 3300053085 | Bacteria | 2434 |
| 1218 | Ga0495619_0204738 | 3300053085 | Bacteria | 1366 |
| 1219 | Ga0501084_0000882 | 3300054114 | Bacteria | 23193 |
| 1220 | Ga0501084_0006516 | 3300054114 | Bacteria | 9594 |
| 1221 | Ga0501084_0011050 | 3300054114 | Bacteria | 7476 |
| 1222 | Ga0501084_0032711 | 3300054114 | Bacteria | 4351 |
| 1223 | Ga0501084_0044692 | 3300054114 | Bacteria | 3708 |
| 1224 | Ga0501084_0194957 | 3300054114 | Bacteria | 1709 |
| 1225 | Ga0501084_0207069 | 3300054114 | Bacteria | 1655 |
| 1226 | Ga0501084_0701530 | 3300054114 | Bacteria | 853 |
| 1227 | Ga0501082_0011480 | 3300060353 | Bacteria | 7624 |
| 1228 | Ga0501082_0015445 | 3300060353 | Bacteria | 6571 |
| 1229 | Ga0501082_0019263 | 3300060353 | Bacteria | 5882 |
| 1230 | Ga0501082_0046016 | 3300060353 | Bacteria | 3762 |
| 1231 | Ga0501082_0048095 | 3300060353 | Bacteria | 3676 |
| 1232 | Ga0501082_0068482 | 3300060353 | Bacteria | 3056 |
| 1233 | Ga0501082_0083439 | 3300060353 | Bacteria | 2757 |
| 1234 | Ga0501082_0315124 | 3300060353 | Unclassified | 1362 |
| 1235 | Ga0501082_0586875 | 3300060353 | Bacteria | 975 |
| 1236 | Ga0466962_0000666 | 3300061719 | Bacteria | 15245 |
| 1237 | Ga0466962_0007569 | 3300061719 | Bacteria | 5210 |
| 1238 | Ga0466962_0016170 | 3300061719 | Bacteria | 3599 |
| 1239 | Ga0466962_0265260 | 3300061719 | Bacteria | 846 |
| 1240 | Ga0530510_0000865 | 3300061734 | Bacteria | 19956 |
| 1241 | Ga0530510_0023469 | 3300061734 | Bacteria | 4396 |
| 1242 | Ga0530510_0041037 | 3300061734 | Bacteria | 3341 |
| 1243 | Ga0530510_0051785 | 3300061734 | Bacteria | 2967 |
| 1244 | Ga0530510_0058132 | 3300061734 | Bacteria | 2795 |
| 1245 | Ga0530510_0066894 | 3300061734 | Bacteria | 2606 |
| 1246 | Ga0530510_0190190 | 3300061734 | Bacteria | 1524 |
| 1247 | Ga0530510_0226282 | 3300061734 | Bacteria | 1391 |
| 1248 | Ga0496114_0122093 | |||
| 1249 | ARcpr5oldR_c007068 | |||
| 1250 | ARSoilOldRDRAFT_c004193 | |||
| 1251 | JGI24746J21847_1004841 | |||
| 1252 | JGI24748J21848_1014522 | |||
| 1253 | JGI24738J21930_10000536 | |||
| 1254 | JGI24742J22300_10012387 | |||
| 1255 | JGI25406J46586_10010133 | |||
| 1256 | Ga0058861_10137482 | |||
| 1257 | Ga0065712_10161647 | |||
| 1258 | Ga0065707_10232890 | |||
| 1259 | Ga0065707_10269423 | |||
| 1260 | Ga0070658_10026196 | |||
| 1261 | Ga0070658_10048277 | |||
| 1262 | Ga0070658_10079753 | |||
| 1263 | Ga0070658_10618236 | |||
| 1264 | Ga0070683_100007038 | |||
| 1265 | Ga0070683_100012866 | |||
| 1266 | Ga0070683_100025624 | |||
| 1267 | Ga0070683_100040855 | |||
| 1268 | Ga0070683_100045798 | |||
| 1269 | Ga0070683_100046267 | |||
| 1270 | Ga0070683_100052394 | |||
| 1271 | Ga0070683_100073451 | |||
| 1272 | Ga0070683_100105879 | |||
| 1273 | Ga0070683_100110237 | |||
| 1274 | Ga0070683_100146871 | |||
| 1275 | Ga0070683_100211226 | |||
| 1276 | Ga0070683_100494262 | |||
| 1277 | Ga0070690_100399288 | |||
| 1278 | Ga0070670_100117879 | |||
| 1279 | Ga0068869_100027430 | |||
| 1280 | Ga0070680_100014576 | |||
| 1281 | Ga0070680_100030031 | |||
| 1282 | Ga0070680_100090743 | |||
| 1283 | Ga0070680_100111995 | |||
| 1284 | Ga0070680_100158780 | |||
| 1285 | Ga0070680_100375212 | |||
| 1286 | Ga0070680_100392085 | |||
| 1287 | Ga0070682_100001353 | |||
| 1288 | Ga0070682_100007910 | |||
| 1289 | Ga0070682_100018051 | |||
| 1290 | Ga0070682_100023542 | |||
| 1291 | Ga0070682_100041918 | |||
| 1292 | Ga0070682_100130539 | |||
| 1293 | Ga0068868_100005041 | |||
| 1294 | Ga0068868_100040136 | |||
| 1295 | Ga0068868_100367957 | |||
| 1296 | Ga0070660_100000720 | |||
| 1297 | Ga0070660_100001920 | |||
| 1298 | Ga0070660_100006496 | |||
| 1299 | Ga0070660_100013436 | |||
| 1300 | Ga0070660_100022102 | |||
| 1301 | Ga0070660_100117548 | |||
| 1302 | Ga0070689_100024550 | |||
| 1303 | Ga0070691_10014143 | |||
| 1304 | Ga0070691_10032167 | |||
| 1305 | Ga0070687_100039215 | |||
| 1306 | Ga0070661_100004013 | |||
| 1307 | Ga0070661_100019730 | |||
| 1308 | Ga0070661_100031756 | |||
| 1309 | Ga0070661_100141722 | |||
| 1310 | Ga0070661_100150444 | |||
| 1311 | Ga0070692_10000930 | |||
| 1312 | Ga0070692_10003306 | |||
| 1313 | Ga0070692_10093300 | |||
| 1314 | Ga0070668_100096165 | |||
| 1315 | Ga0070669_100110266 | |||
| 1316 | Ga0070669_100555339 | |||
| 1317 | Ga0070675_100051942 | |||
| 1318 | Ga0070675_100076785 | |||
| 1319 | Ga0070675_100215134 | |||
| 1320 | Ga0070671_100011250 | |||
| 1321 | Ga0070671_100093396 | |||
| 1322 | Ga0070671_100475225 | |||
| 1323 | Ga0070674_100000011 | |||
| 1324 | Ga0070674_100002258 | |||
| 1325 | Ga0070674_100042686 | |||
| 1326 | Ga0070674_100097182 | |||
| 1327 | Ga0070674_100114517 | |||
| 1328 | Ga0070673_100071001 | |||
| 1329 | Ga0070688_100014636 | |||
| 1330 | Ga0070688_100074260 | |||
| 1331 | Ga0070659_100001903 | |||
| 1332 | Ga0070659_100140303 | |||
| 1333 | Ga0070659_100248284 | |||
| 1334 | Ga0070667_100098837 | |||
| 1335 | Ga0070703_10010148 | |||
| 1336 | Ga0070709_10003121 | |||
| 1337 | Ga0070709_10317981 | |||
| 1338 | Ga0070709_10385380 | |||
| 1339 | Ga0070714_100072299 | |||
| 1340 | Ga0070714_100074075 | |||
| 1341 | Ga0070714_100093033 | |||
| 1342 | Ga0070714_100284729 | |||
| 1343 | Ga0070713_100016357 | |||
| 1344 | Ga0070713_100021279 | |||
| 1345 | Ga0070713_100159483 | |||
| 1346 | Ga0070713_100237263 | |||
| 1347 | Ga0070713_100374392 | |||
| 1348 | Ga0070713_100603630 | |||
| 1349 | Ga0070710_10006790 | |||
| 1350 | Ga0070710_10021256 | |||
| 1351 | Ga0070710_10023167 | |||
| 1352 | Ga0070710_10060770 | |||
| 1353 | Ga0070701_10019177 | |||
| 1354 | Ga0070701_10027515 | |||
| 1355 | Ga0070711_100002187 | |||
| 1356 | Ga0070711_100026552 | |||
| 1357 | Ga0070711_100122937 | |||
| 1358 | Ga0070711_100153974 | |||
| 1359 | Ga0070711_100340256 | |||
| 1360 | Ga0070705_100022527 | |||
| 1361 | Ga0070705_100374765 | |||
| 1362 | Ga0070700_100004058 | |||
| 1363 | Ga0070694_100078132 | |||
| 1364 | Ga0070694_100081959 | |||
| 1365 | Ga0070694_100123774 | |||
| 1366 | Ga0070694_100365935 | |||
| 1367 | Ga0070708_100003637 | |||
| 1368 | Ga0070708_100102959 | |||
| 1369 | Ga0070708_100142365 | |||
| 1370 | Ga0070708_100183683 | |||
| 1371 | Ga0070708_100344102 | |||
| 1372 | Ga0070708_100501545 | |||
| 1373 | Ga0070708_100604824 | |||
| 1374 | Ga0070663_100008888 | |||
| 1375 | Ga0070663_100053859 | |||
| 1376 | Ga0070663_100182502 | |||
| 1377 | Ga0070678_100128924 | |||
| 1378 | Ga0070678_100139231 | |||
| 1379 | Ga0070678_100156214 | |||
| 1380 | Ga0070662_100012271 | |||
| 1381 | Ga0070662_100101322 | |||
| 1382 | Ga0070662_100411385 | |||
| 1383 | Ga0070681_10023372 | |||
| 1384 | Ga0070681_10034789 | |||
| 1385 | Ga0070681_10065376 | |||
| 1386 | Ga0070681_10069243 | |||
| 1387 | Ga0070681_10079364 | |||
| 1388 | Ga0070681_10173624 | |||
| 1389 | Ga0068867_100000550 | |||
| 1390 | Ga0068867_100007373 | |||
| 1391 | Ga0068867_100100636 | |||
| 1392 | Ga0068867_100180621 | |||
| 1393 | Ga0070685_10017914 | |||
| 1394 | Ga0070685_10045149 | |||
| 1395 | Ga0070685_10061574 | |||
| 1396 | Ga0070706_100019895 | |||
| 1397 | Ga0070706_100088621 | |||
| 1398 | Ga0070707_100039227 | |||
| 1399 | Ga0070707_100739972 | |||
| 1400 | Ga0070698_100050319 | |||
| 1401 | Ga0070698_100112491 | |||
| 1402 | Ga0070698_100232753 | |||
| 1403 | Ga0070698_100328580 | |||
| 1404 | Ga0070699_100217491 | |||
| 1405 | Ga0070699_100576681 | |||
| 1406 | Ga0070699_100626035 | |||
| 1407 | Ga0070679_100012528 | |||
| 1408 | Ga0070679_100053382 | |||
| 1409 | Ga0070679_100066486 | |||
| 1410 | Ga0070679_100086866 | |||
| 1411 | Ga0070679_100133357 | |||
| 1412 | Ga0070679_100204945 | |||
| 1413 | Ga0070684_100025741 | |||
| 1414 | Ga0070684_100039805 | |||
| 1415 | Ga0070684_100040881 | |||
| 1416 | Ga0070684_100077890 | |||
| 1417 | Ga0070684_100102363 | |||
| 1418 | Ga0070684_100128557 | |||
| 1419 | Ga0070684_100147819 | |||
| 1420 | Ga0070684_100174374 | |||
| 1421 | Ga0070684_100242889 | |||
| 1422 | Ga0070684_100314237 | |||
| 1423 | Ga0070684_100315168 | |||
| 1424 | Ga0070697_100128080 | |||
| 1425 | Ga0070697_100148103 | |||
| 1426 | Ga0068853_100013271 | |||
| 1427 | Ga0068853_100039604 | |||
| 1428 | Ga0068853_100108622 | |||
| 1429 | Ga0068853_100224728 | |||
| 1430 | Ga0070672_100202982 | |||
| 1431 | Ga0070686_100001971 | |||
| 1432 | Ga0070686_100035673 | |||
| 1433 | Ga0070686_100076861 | |||
| 1434 | Ga0070695_100006405 | |||
| 1435 | Ga0070695_100020931 | |||
| 1436 | Ga0070695_100032959 | |||
| 1437 | Ga0070696_100002924 | |||
| 1438 | Ga0070696_100022984 | |||
| 1439 | Ga0070696_100074392 | |||
| 1440 | Ga0070696_100095358 | |||
| 1441 | Ga0070696_100133709 | |||
| 1442 | Ga0070693_100003652 | |||
| 1443 | Ga0070693_100165253 | |||
| 1444 | Ga0070693_100170473 | |||
| 1445 | Ga0070665_100062632 | |||
| 1446 | Ga0070665_100099247 | |||
| 1447 | Ga0070704_100001647 | |||
| 1448 | Ga0070704_100014996 | |||
| 1449 | Ga0068855_100017877 | |||
| 1450 | Ga0068855_100115281 | |||
| 1451 | Ga0068855_100380173 | |||
| 1452 | Ga0068855_100418815 | |||
| 1453 | Ga0068855_100483922 | |||
| 1454 | Ga0068855_100959190 | |||
| 1455 | Ga0070664_100016484 | |||
| 1456 | Ga0070664_100311475 | |||
| 1457 | Ga0070664_100417311 | |||
| 1458 | Ga0068857_100001566 | |||
| 1459 | Ga0068857_100045252 | |||
| 1460 | Ga0068857_100305286 | |||
| 1461 | Ga0068857_100474726 | |||
| 1462 | Ga0068854_100002923 | |||
| 1463 | Ga0068854_100395647 | |||
| 1464 | Ga0068856_100072817 | |||
| 1465 | Ga0068856_100121449 | |||
| 1466 | Ga0068856_100126393 | |||
| 1467 | Ga0068856_100164868 | |||
| 1468 | Ga0070702_100083241 | |||
| 1469 | Ga0070702_100268889 | |||
| 1470 | Ga0068852_100002137 | |||
| 1471 | Ga0068852_100024660 | |||
| 1472 | Ga0068852_100646360 | |||
| 1473 | Ga0068852_100656025 | |||
| 1474 | Ga0068852_100684723 | |||
| 1475 | Ga0068859_100080311 | |||
| 1476 | Ga0068864_100072287 | |||
| 1477 | Ga0068864_100371775 | |||
| 1478 | Ga0068864_100602782 | |||
| 1479 | Ga0068866_10004786 | |||
| 1480 | Ga0068866_10013817 | |||
| 1481 | Ga0068866_10063629 | |||
| 1482 | Ga0068861_100039499 | |||
| 1483 | Ga0068851_10006756 | |||
| 1484 | Ga0068870_10044961 | |||
| 1485 | Ga0068870_10054354 | |||
| 1486 | Ga0068870_10309100 | |||
| 1487 | Ga0068863_100165571 | |||
| 1488 | Ga0068858_100024014 | |||
| 1489 | Ga0068860_100019254 | |||
| 1490 | Ga0068860_100070171 | |||
| 1491 | Ga0068860_100357542 | |||
| 1492 | Ga0068860_100383937 | |||
| 1493 | Ga0081455_10004052 | |||
| 1494 | Ga0081455_10011861 | |||
| 1495 | Ga0081455_10022948 | |||
| 1496 | Ga0081455_10023031 | |||
| 1497 | Ga0081455_10146332 | |||
| 1498 | Ga0081538_10000053 | |||
| 1499 | Ga0081538_10000820 | |||
| 1500 | Ga0081538_10005518 | |||
| 1501 | Ga0081540_1009278 | |||
| 1502 | Ga0081539_10000095 | |||
| 1503 | Ga0081539_10000103 | |||
| 1504 | Ga0070717_10005225 | |||
| 1505 | Ga0070717_10008934 | |||
| 1506 | Ga0070717_10020482 | |||
| 1507 | Ga0070717_10084473 | |||
| 1508 | Ga0075365_10121062 | |||
| 1509 | Ga0075364_10077751 | |||
| 1510 | Ga0075432_10001731 | |||
| 1511 | Ga0070715_10000015 | |||
| 1512 | Ga0070715_10000893 | |||
| 1513 | Ga0070716_100008868 | |||
| 1514 | Ga0070712_100010819 | |||
| 1515 | Ga0070712_100050144 | |||
| 1516 | Ga0070712_100068085 | |||
| 1517 | Ga0097621_100011037 | |||
| 1518 | Ga0097621_100023026 | |||
| 1519 | Ga0097621_100139960 | |||
| 1520 | Ga0097621_100408386 | |||
| 1521 | Ga0068871_100037920 | |||
| 1522 | Ga0075428_100000411 | |||
| 1523 | Ga0075428_100331787 | |||
| 1524 | Ga0075428_100341676 | |||
| 1525 | Ga0075430_100148597 | |||
| 1526 | Ga0075430_100190423 | |||
| 1527 | Ga0075431_100000960 | |||
| 1528 | Ga0075431_100305768 | |||
| 1529 | Ga0075433_10126139 | |||
| 1530 | Ga0075434_100016788 | |||
| 1531 | Ga0075434_100441183 | |||
| 1532 | Ga0075429_100218718 | |||
| 1533 | Ga0075429_100450270 | |||
| 1534 | Ga0075429_100467319 | |||
| 1535 | Ga0068865_100000227 | |||
| 1536 | Ga0068865_100042812 | |||
| 1537 | Ga0068865_100357919 | |||
| 1538 | Ga0097620_100080305 | |||
| 1539 | Ga0075435_100046409 | |||
| 1540 | Ga0075435_100188888 | |||
| 1541 | Ga0105240_10006133 | |||
| 1542 | Ga0105240_10035533 | |||
| 1543 | Ga0105240_10061530 | |||
| 1544 | Ga0105240_10515544 | |||
| 1545 | Ga0111539_10005465 | |||
| 1546 | Ga0111539_10006234 | |||
| 1547 | Ga0111539_10049963 | |||
| 1548 | Ga0111539_10788722 | |||
| 1549 | Ga0105245_10007056 | |||
| 1550 | Ga0105245_10022523 | |||
| 1551 | Ga0105245_10027048 | |||
| 1552 | Ga0105245_10057048 | |||
| 1553 | Ga0105245_10110725 | |||
| 1554 | Ga0105245_10194557 | |||
| 1555 | Ga0105245_10354874 | |||
| 1556 | Ga0105247_10000208 | |||
| 1557 | Ga0105247_10086033 | |||
| 1558 | Ga0105247_10264272 | |||
| 1559 | Ga0114129_10006651 | |||
| 1560 | Ga0114129_10007066 | |||
| 1561 | Ga0114129_10075771 | |||
| 1562 | Ga0114129_10079691 | |||
| 1563 | Ga0114129_10184899 | |||
| 1564 | Ga0114129_10720142 | |||
| 1565 | Ga0114129_10822170 | |||
| 1566 | Ga0114129_10877191 | |||
| 1567 | Ga0105243_10004254 | |||
| 1568 | Ga0105243_10008349 | |||
| 1569 | Ga0105243_10010370 | |||
| 1570 | Ga0105243_10121129 | |||
| 1571 | Ga0105241_10092793 | |||
| 1572 | Ga0105242_10001454 | |||
| 1573 | Ga0105242_10007667 | |||
| 1574 | Ga0105242_10055335 | |||
| 1575 | Ga0105242_10135334 | |||
| 1576 | Ga0105242_10273873 | |||
| 1577 | Ga0105248_10048033 | |||
| 1578 | Ga0105248_10058439 | |||
| 1579 | Ga0105248_10103565 | |||
| 1580 | Ga0105248_10170556 | |||
| 1581 | Ga0105248_10232540 | |||
| 1582 | Ga0105237_10070666 | |||
| 1583 | Ga0105238_10009784 | |||
| 1584 | Ga0105238_10646094 | |||
| 1585 | Ga0105238_11147573 | |||
| 1586 | Ga0105249_10275329 | |||
| 1587 | Ga0105239_10001933 | |||
| 1588 | Ga0105239_10028738 | |||
| 1589 | Ga0105239_10042107 | |||
| 1590 | Ga0105239_10177802 | |||
| 1591 | Ga0105246_10379125 | |||
| 1592 | Ga0105246_10565690 | |||
| 1593 | Ga0157371_10005732 | |||
| 1594 | Ga0157371_10132089 | |||
| 1595 | Ga0157371_10277063 | |||
| 1596 | Ga0157371_10424443 | |||
| 1597 | Ga0157370_10006583 | |||
| 1598 | Ga0157370_10015558 | |||
| 1599 | Ga0157370_10053772 | |||
| 1600 | Ga0157370_10222307 | |||
| 1601 | Ga0157370_10373302 | |||
| 1602 | Ga0157370_10481934 | |||
| 1603 | Ga0157369_10021753 | |||
| 1604 | Ga0157369_10179693 | |||
| 1605 | Ga0157369_10405821 | |||
| 1606 | Ga0157369_10634345 | |||
| 1607 | Ga0157369_10805237 | |||
| 1608 | Ga0157374_10057906 | |||
| 1609 | Ga0157374_10095952 | |||
| 1610 | Ga0157378_10002034 | |||
| 1611 | Ga0157378_10498583 | |||
| 1612 | Ga0163162_10002291 | |||
| 1613 | Ga0163162_10030608 | |||
| 1614 | Ga0163162_10450111 | |||
| 1615 | Ga0163162_10579299 | |||
| 1616 | Ga0157372_10107318 | |||
| 1617 | Ga0157372_10116885 | |||
| 1618 | Ga0157375_10011702 | |||
| 1619 | Ga0157375_10122700 | |||
| 1620 | Ga0157375_10249313 | |||
| 1621 | Ga0157375_10593993 | |||
| 1622 | Ga0163163_10068194 | |||
| 1623 | Ga0163163_11038771 | |||
| 1624 | Ga0157380_10015154 | |||
| 1625 | Ga0157380_10021386 | |||
| 1626 | Ga0157380_10085352 | |||
| 1627 | Ga0157377_10009312 | |||
| 1628 | Ga0157377_10100084 | |||
| 1629 | Ga0157377_10164237 | |||
| 1630 | Ga0157377_10267632 | |||
| 1631 | Ga0157379_10060567 | |||
| 1632 | Ga0157379_10414978 | |||
| 1633 | Ga0157376_10018276 | |||
| 1634 | Ga0157376_10029082 | |||
| 1635 | Ga0157376_10148059 | |||
| 1636 | Ga0157376_10283854 | |||
| 1637 | Ga0157376_10393269 | |||
| 1638 | Ga0163161_10250503 | |||
| 1639 | Ga0206356_10529424 | |||
| 1640 | Ga0206356_11382338 | |||
| 1641 | Ga0206356_11420625 | |||
| 1642 | Ga0206356_11545740 | |||
| 1643 | Ga0206356_11774698 | |||
| 1644 | Ga0206351_10131195 | |||
| 1645 | Ga0206354_11548271 | |||
| 1646 | Ga0206353_10112688 | |||
| 1647 | Ga0206353_10288702 | |||
| 1648 | Ga0206353_11412727 | |||
| 1649 | Ga0206353_11781830 | |||
| 1650 | Ga0154015_1107111 | |||
| 1651 | Ga0213876_10266106 | |||
| 1652 | Ga0207656_10004075 | |||
| 1653 | Ga0207653_10006879 | |||
| 1654 | Ga0207682_10102858 | |||
| 1655 | Ga0207692_10004842 | |||
| 1656 | Ga0207692_10018561 | |||
| 1657 | Ga0207692_10024091 | |||
| 1658 | Ga0207692_10289704 | |||
| 1659 | Ga0207642_10007951 | |||
| 1660 | Ga0207710_10150880 | |||
| 1661 | Ga0207688_10020622 | |||
| 1662 | Ga0207688_10027728 | |||
| 1663 | Ga0207688_10099143 | |||
| 1664 | Ga0207688_10222831 | |||
| 1665 | Ga0207680_10013547 | |||
| 1666 | Ga0207699_10017845 | |||
| 1667 | Ga0207699_10045246 | |||
| 1668 | Ga0207699_10158973 | |||
| 1669 | Ga0207643_10236096 | |||
| 1670 | Ga0207705_10030069 | |||
| 1671 | Ga0207705_10040237 | |||
| 1672 | Ga0207705_10042505 | |||
| 1673 | Ga0207705_10093559 | |||
| 1674 | Ga0207684_10017250 | |||
| 1675 | Ga0207684_10107949 | |||
| 1676 | Ga0207707_10021198 | |||
| 1677 | Ga0207707_10055604 | |||
| 1678 | Ga0207707_10065163 | |||
| 1679 | Ga0207707_10086838 | |||
| 1680 | Ga0207707_10124757 | |||
| 1681 | Ga0207707_10158157 | |||
| 1682 | Ga0207695_10037165 | |||
| 1683 | Ga0207695_10037539 | |||
| 1684 | Ga0207693_10000282 | |||
| 1685 | Ga0207693_10016283 | |||
| 1686 | Ga0207693_10046432 | |||
| 1687 | Ga0207693_10329325 | |||
| 1688 | Ga0207663_10001508 | |||
| 1689 | Ga0207663_10006327 | |||
| 1690 | Ga0207663_10017905 | |||
| 1691 | Ga0207663_10127032 | |||
| 1692 | Ga0207663_10163398 | |||
| 1693 | Ga0207663_10208650 | |||
| 1694 | Ga0207660_10005405 | |||
| 1695 | Ga0207660_10148744 | |||
| 1696 | Ga0207660_10344245 | |||
| 1697 | Ga0207657_10005534 | |||
| 1698 | Ga0207657_10006847 | |||
| 1699 | Ga0207657_10009681 | |||
| 1700 | Ga0207657_10015976 | |||
| 1701 | Ga0207657_10034935 | |||
| 1702 | Ga0207657_10057550 | |||
| 1703 | Ga0207657_10357017 | |||
| 1704 | Ga0207657_10388564 | |||
| 1705 | Ga0207649_10012383 | |||
| 1706 | Ga0207649_10018770 | |||
| 1707 | Ga0207649_10121994 | |||
| 1708 | Ga0207649_10228589 | |||
| 1709 | Ga0207652_10017797 | |||
| 1710 | Ga0207652_10028339 | |||
| 1711 | Ga0207652_10063692 | |||
| 1712 | Ga0207652_10085958 | |||
| 1713 | Ga0207652_10556936 | |||
| 1714 | Ga0207652_10566564 | |||
| 1715 | Ga0207646_10001031 | |||
| 1716 | Ga0207646_10008000 | |||
| 1717 | Ga0207646_10067184 | |||
| 1718 | Ga0207646_10191518 | |||
| 1719 | Ga0207646_10631997 | |||
| 1720 | Ga0207681_10030389 | |||
| 1721 | Ga0207681_10406795 | |||
| 1722 | Ga0207650_10104444 | |||
| 1723 | Ga0207659_10172656 | |||
| 1724 | Ga0207659_10226632 | |||
| 1725 | Ga0207687_10000011 | |||
| 1726 | Ga0207687_10004375 | |||
| 1727 | Ga0207687_10006749 | |||
| 1728 | Ga0207687_10043708 | |||
| 1729 | Ga0207687_10076285 | |||
| 1730 | Ga0207687_10104709 | |||
| 1731 | Ga0207700_10024533 | |||
| 1732 | Ga0207700_10030363 | |||
| 1733 | Ga0207700_10118551 | |||
| 1734 | Ga0207700_10387683 | |||
| 1735 | Ga0207700_10512045 | |||
| 1736 | Ga0207664_10002945 | |||
| 1737 | Ga0207664_10004602 | |||
| 1738 | Ga0207664_10029077 | |||
| 1739 | Ga0207664_10081819 | |||
| 1740 | Ga0207664_10568443 | |||
| 1741 | Ga0207644_10046368 | |||
| 1742 | Ga0207690_10038484 | |||
| 1743 | Ga0207690_10115273 | |||
| 1744 | Ga0207690_10332468 | |||
| 1745 | Ga0207706_10017885 | |||
| 1746 | Ga0207706_10075373 | |||
| 1747 | Ga0207706_10087752 | |||
| 1748 | Ga0207706_10436817 | |||
| 1749 | Ga0207686_10002081 | |||
| 1750 | Ga0207686_10049986 | |||
| 1751 | Ga0207686_10085876 | |||
| 1752 | Ga0207709_10000390 | |||
| 1753 | Ga0207709_10013978 | |||
| 1754 | Ga0207709_10023116 | |||
| 1755 | Ga0207709_10298635 | |||
| 1756 | Ga0207670_10101027 | |||
| 1757 | Ga0207670_10115281 | |||
| 1758 | Ga0207669_10001870 | |||
| 1759 | Ga0207669_10017282 | |||
| 1760 | Ga0207704_10001726 | |||
| 1761 | Ga0207704_10011263 | |||
| 1762 | Ga0207704_10041968 | |||
| 1763 | Ga0207704_10059007 | |||
| 1764 | Ga0207665_10000835 | |||
| 1765 | Ga0207665_10004227 | |||
| 1766 | Ga0207691_10005205 | |||
| 1767 | Ga0207691_10037892 | |||
| 1768 | Ga0207691_10096191 | |||
| 1769 | Ga0207691_10160354 | |||
| 1770 | Ga0207691_10325566 | |||
| 1771 | Ga0207711_10023885 | |||
| 1772 | Ga0207711_10127111 | |||
| 1773 | Ga0207711_10550274 | |||
| 1774 | Ga0207689_10041643 | |||
| 1775 | Ga0207689_10075939 | |||
| 1776 | Ga0207689_10166991 | |||
| 1777 | Ga0207661_10000504 | |||
| 1778 | Ga0207661_10026253 | |||
| 1779 | Ga0207661_10039314 | |||
| 1780 | Ga0207661_10039530 | |||
| 1781 | Ga0207661_10056402 | |||
| 1782 | Ga0207661_10061472 | |||
| 1783 | Ga0207661_10062555 | |||
| 1784 | Ga0207661_10131487 | |||
| 1785 | Ga0207661_10159565 | |||
| 1786 | Ga0207661_10269653 | |||
| 1787 | Ga0207661_10546174 | |||
| 1788 | Ga0207679_10001100 | |||
| 1789 | Ga0207679_10014748 | |||
| 1790 | Ga0207679_10130466 | |||
| 1791 | Ga0207667_10212082 | |||
| 1792 | Ga0207667_10278448 | |||
| 1793 | Ga0207667_10293733 | |||
| 1794 | Ga0207667_10329241 | |||
| 1795 | Ga0207667_10389560 | |||
| 1796 | Ga0207651_10053639 | |||
| 1797 | Ga0207651_10133280 | |||
| 1798 | Ga0207651_10299412 | |||
| 1799 | Ga0207712_10381413 | |||
| 1800 | Ga0207668_10059222 | |||
| 1801 | Ga0207640_10045593 | |||
| 1802 | Ga0207640_10067181 | |||
| 1803 | Ga0207640_10077812 | |||
| 1804 | Ga0207677_10023374 | |||
| 1805 | Ga0207677_10366166 | |||
| 1806 | Ga0207677_10443856 | |||
| 1807 | Ga0207677_10527746 | |||
| 1808 | Ga0207703_10049019 | |||
| 1809 | Ga0207639_10014663 | |||
| 1810 | Ga0207639_10048831 | |||
| 1811 | Ga0207639_10227118 | |||
| 1812 | Ga0207678_10007853 | |||
| 1813 | Ga0207678_10024434 | |||
| 1814 | Ga0207678_10051635 | |||
| 1815 | Ga0207708_10000175 | |||
| 1816 | Ga0207708_10089767 | |||
| 1817 | Ga0207708_10135907 | |||
| 1818 | Ga0207702_10019694 | |||
| 1819 | Ga0207702_10084112 | |||
| 1820 | Ga0207702_10154572 | |||
| 1821 | Ga0207702_10246517 | |||
| 1822 | Ga0207702_10270949 | |||
| 1823 | Ga0207702_10408071 | |||
| 1824 | Ga0207641_10035482 | |||
| 1825 | Ga0207641_10145617 | |||
| 1826 | Ga0207641_10192191 | |||
| 1827 | Ga0207648_10000082 | |||
| 1828 | Ga0207648_10041723 | |||
| 1829 | Ga0207648_10061064 | |||
| 1830 | Ga0207648_10117837 | |||
| 1831 | Ga0207674_10058638 | |||
| 1832 | Ga0207674_10070519 | |||
| 1833 | Ga0207674_10105994 | |||
| 1834 | Ga0207674_10457940 | |||
| 1835 | Ga0207675_100023549 | |||
| 1836 | Ga0207675_100073656 | |||
| 1837 | Ga0207683_10004007 | |||
| 1838 | Ga0207683_10021708 | |||
| 1839 | Ga0207683_10105954 | |||
| 1840 | Ga0207683_10166364 | |||
| 1841 | Ga0207683_10739915 | |||
| 1842 | Ga0207698_10002832 | |||
| 1843 | Ga0207698_10052636 | |||
| 1844 | Ga0207428_10000108 | |||
| 1845 | Ga0207428_10031692 | |||
| 1846 | Ga0207428_10103059 | |||
| 1847 | Ga0207428_10214187 | |||
| 1848 | Ga0268266_10089148 | |||
| 1849 | Ga0268266_10409098 | |||
| 1850 | Ga0268265_10188027 | |||
| 1851 | Ga0268265_10207436 | |||
| 1852 | Ga0268264_10089329 | |||
| 1853 | Ga0268264_10140021 | |||
| 1854 | Ga0265323_10003734 | |||
| 1855 | Ga0265322_10000301 | |||
| 1856 | Ga0265338_10076833 | |||
| 1857 | Ga0265330_10046997 | |||
| 1858 | Ga0265329_10034595 | |||
| 1859 | Ga0265316_10158535 | |||
| 1860 | Ga0316576_10000132 | |||
| 1861 | Ga0307409_100089397 | |||
| 1862 | Ga0307416_100563222 | |||
| 1863 | Ga0316583_10083472 | |||
| 1864 | Ga0373930_0004511 | |||
| 1865 | Ga0373959_0021525 | |||
| 1866 | Ga0373934_0101289 | |||
| 1867 | Ga0373940_0109544 | |||
| 1868 | Ga0373944_0000544 | |||
| 1869 | Ga0373949_0018502 | |||
| 1870 | Ga0373949_0070105 | |||
| 1871 | Ga0373951_0014861 | |||
| 1872 | Ga0373951_0043560 | |||
| 1873 | Ga0373939_0017221 | |||
| 1874 | Ga0373945_0009294 | |||
| 1875 | Ga0373943_0016651 | |||
| 1876 | Ga0373946_0158954 | |||
| 1877 | Ga0373961_0033330 | |||
| 1878 | Ga0316574_0033526 | |||
| 1879 | Ga0373924_0035860 | |||
| 1880 | Ga0373924_0050263 | |||
| 1881 | Ga0373931_0091333 | |||
| 1882 | Ga0373931_0118835 | |||
| 1883 | Ga0373931_0187880 | |||
| 1884 | Ga0373931_0378823 | |||
| 1885 | Ga0373935_0141778 | |||
| 1886 | Ga0373947_0000716 | |||
| 1887 | Ga0373947_0003510 | |||
| 1888 | Ga0373937_0086726 | |||
| 1889 | Ga0373937_0147973 | |||
| 1890 | Ga0373925_0022170 | |||
| 1891 | Ga0373925_0156980 | |||
| 1892 | Ga0373925_0498904 | |||
| 1893 | Ga0395899_0118116 | |||
| 1894 | Ga0395899_0198643 | |||
| 1895 | Ga0395899_0361197 | |||
| 1896 | Ga0395900_0012967 | |||
| 1897 | Ga0395900_0077987 | |||
| 1898 | Ga0395900_0169269 | |||
| 1899 | Ga0395900_0200385 | |||
| 1900 | Ga0395900_0259569 | |||
| 1901 | Ga0395900_0268261 | |||
| 1902 | Ga0395900_0355888 | |||
| 1903 | Ga0395900_0370475 | |||
| 1904 | Ga0395898_0016830 | |||
| 1905 | Ga0395898_0066497 | |||
| 1906 | Ga0395898_0069532 | |||
| 1907 | Ga0395898_0119027 | |||
| 1908 | Ga0395898_0138899 | |||
| 1909 | Ga0395905_0004086 | |||
| 1910 | Ga0395905_0017117 | |||
| 1911 | Ga0395905_0070299 | |||
| 1912 | Ga0395905_0101994 | |||
| 1913 | Ga0395905_0198439 | |||
| 1914 | Ga0395905_0208010 | |||
| 1915 | Ga0395905_0278442 | |||
| 1916 | Ga0395905_0594559 | |||
| 1917 | Ga0436364_0777213 | |||
| 1918 | Ga0395901_0009118 | |||
| 1919 | Ga0395901_0032690 | |||
| 1920 | Ga0395901_0039481 | |||
| 1921 | Ga0395901_0042934 | |||
| 1922 | Ga0395901_0043573 | |||
| 1923 | Ga0395901_0043994 | |||
| 1924 | Ga0395901_0054539 | |||
| 1925 | Ga0395901_0058232 | |||
| 1926 | Ga0395901_0078131 | |||
| 1927 | Ga0395901_0084855 | |||
| 1928 | Ga0395901_0088984 | |||
| 1929 | Ga0395901_0146817 | |||
| 1930 | Ga0395901_0181043 | |||
| 1931 | Ga0395901_0223939 | |||
| 1932 | Ga0395901_0229631 | |||
| 1933 | Ga0395901_0344567 | |||
| 1934 | Ga0395901_0949442 | |||
| 1935 | Ga0400489_30689 | |||
| 1936 | Ga0436365_0006404 | |||
| 1937 | Ga0436365_0432320 | |||
| 1938 | Ga0451802_0341561 | |||
| 1939 | Ga0451853_2862384 | |||
| 1940 | Ga0439437_003426 | |||
| 1941 | Ga0439448_0090866 | |||
| 1942 | Ga0451577_0018675 | |||
| 1943 | Ga0466969_0018054 | |||
| 1944 | Ga0466969_0032383 | |||
| 1945 | Ga0466969_0179386 | |||
| 1946 | Ga0466965_0010523 | |||
| 1947 | Ga0466966_0032124 | |||
| 1948 | Ga0466966_0051301 | |||
| 1949 | Ga0466966_0098784 | |||
| 1950 | Ga0466961_0011516 | |||
| 1951 | Ga0466961_0027253 | |||
| 1952 | Ga0466961_0036895 | |||
| 1953 | Ga0466961_0142964 | |||
| 1954 | Ga0466963_0000102 | |||
| 1955 | Ga0466963_0010890 | |||
| 1956 | Ga0466963_0023100 | |||
| 1957 | Ga0466963_0035996 | |||
| 1958 | Ga0466963_0050205 | |||
| 1959 | Ga0466963_0089031 | |||
| 1960 | Ga0466963_0100144 | |||
| 1961 | Ga0466963_0139083 | |||
| 1962 | Ga0466963_0467939 | |||
| 1963 | Ga0466964_0000605 | |||
| 1964 | Ga0466964_0023401 | |||
| 1965 | Ga0466964_0028148 | |||
| 1966 | Ga0466964_0069095 | |||
| 1967 | Ga0466964_0191381 | |||
| 1968 | Ga0453684_0000010 | |||
| 1969 | Ga0453684_0010263 | |||
| 1970 | Ga0453684_0381464 | |||
| 1971 | Ga0453684_0491598 | |||
| 1972 | Ga0453684_0870620 | |||
| 1973 | Ga0466971_0022304 | |||
| 1974 | Ga0466971_0156309 | |||
| 1975 | Ga0466968_0049152 | |||
| 1976 | Ga0466957_0005999 | |||
| 1977 | Ga0466957_0006707 | |||
| 1978 | Ga0466957_0010804 | |||
| 1979 | Ga0466957_0012459 | |||
| 1980 | Ga0466957_0012815 | |||
| 1981 | Ga0466957_0065348 | |||
| 1982 | Ga0466957_0072172 | |||
| 1983 | Ga0466960_0015688 | |||
| 1984 | Ga0466960_0109198 | |||
| 1985 | Ga0466959_0022676 | |||
| 1986 | Ga0466959_0068222 | |||
| 1987 | Ga0466959_0083506 | |||
| 1988 | Ga0466959_0090588 | |||
| 1989 | Ga0451576_0057448 | |||
| 1990 | Ga0451576_0125429 | |||
| 1991 | Ga0451576_0136515 | |||
| 1992 | Ga0451576_0243935 | |||
| 1993 | Ga0451576_0337033 | |||
| 1994 | Ga0451576_0654822 | |||
| 1995 | Ga0466958_0001499 | |||
| 1996 | Ga0466958_0002621 | |||
| 1997 | Ga0466958_0005793 | |||
| 1998 | Ga0466958_0015119 | |||
| 1999 | Ga0466958_0065024 | |||
| 2000 | Ga0466958_0099629 | |||
| 2001 | Ga0466958_0138481 | |||
| 2002 | Ga0466958_0153432 | |||
| 2003 | Ga0466958_0165947 | |||
| 2004 | Ga0466967_0000094 | |||
| 2005 | Ga0466967_0010173 | |||
| 2006 | Ga0466967_0035333 | |||
| 2007 | Ga0466967_0043805 | |||
| 2008 | Ga0466967_0067412 | |||
| 2009 | Ga0466967_0123222 | |||
| 2010 | Ga0466967_0126701 | |||
| 2011 | Ga0466967_0127512 | |||
| 2012 | Ga0466967_0137764 | |||
| 2013 | Ga0466967_0179443 | |||
| 2014 | Ga0466967_0277968 | |||
| 2015 | Ga0466967_0376842 | |||
| 2016 | Ga0466967_0603432 | |||
| 2017 | Ga0495592_0112190 | |||
| 2018 | Ga0495592_0422016 | |||
| 2019 | Ga0495603_0004718 | |||
| 2020 | Ga0495603_0056519 | |||
| 2021 | Ga0495603_0059258 | |||
| 2022 | Ga0495603_0128158 | |||
| 2023 | Ga0495603_0147990 | |||
| 2024 | Ga0495629_0007437 | |||
| 2025 | Ga0495638_0023470 | |||
| 2026 | Ga0495641_0037221 | |||
| 2027 | Ga0495641_0038737 | |||
| 2028 | Ga0495641_0149961 | |||
| 2029 | Ga0495641_0197243 | |||
| 2030 | Ga0495651_0029097 | |||
| 2031 | Ga0495651_0108670 | |||
| 2032 | Ga0495651_0179920 | |||
| 2033 | Ga0495651_0200190 | |||
| 2034 | Ga0495651_0225714 | |||
| 2035 | Ga0495653_0039078 | |||
| 2036 | Ga0495653_0071013 | |||
| 2037 | Ga0495653_0123569 | |||
| 2038 | Ga0495653_0210297 | |||
| 2039 | Ga0495653_0274616 | |||
| 2040 | Ga0495580_0060092 | |||
| 2041 | Ga0495580_0132076 | |||
| 2042 | Ga0495582_0000276 | |||
| 2043 | Ga0495582_0036843 | |||
| 2044 | Ga0495582_0066259 | |||
| 2045 | Ga0495582_0155464 | |||
| 2046 | Ga0495639_0005164 | |||
| 2047 | Ga0495662_0006130 | |||
| 2048 | Ga0495662_0051842 | |||
| 2049 | Ga0495662_0055270 | |||
| 2050 | Ga0495664_0105841 | |||
| 2051 | Ga0495664_0107502 | |||
| 2052 | Ga0495664_0264328 | |||
| 2053 | Ga0495584_0012744 | |||
| 2054 | Ga0495594_0053587 | |||
| 2055 | Ga0495596_0031419 | |||
| 2056 | Ga0495608_0061490 | |||
| 2057 | Ga0495608_0133276 | |||
| 2058 | Ga0495608_0368316 | |||
| 2059 | Ga0495616_0087231 | |||
| 2060 | Ga0495628_0159864 | |||
| 2061 | Ga0495628_0268362 | |||
| 2062 | Ga0495628_0273328 | |||
| 2063 | Ga0495630_0021734 | |||
| 2064 | Ga0495630_0112235 | |||
| 2065 | Ga0495630_0230040 | |||
| 2066 | Ga0495637_0029786 | |||
| 2067 | Ga0495666_0021138 | |||
| 2068 | Ga0495652_0103906 | |||
| 2069 | Ga0495652_0127119 | |||
| 2070 | Ga0495665_0000572 | |||
| 2071 | Ga0495640_0083890 | |||
| 2072 | Ga0495586_0002209 | |||
| 2073 | Ga0495586_0028166 | |||
| 2074 | Ga0495587_0053676 | |||
| 2075 | Ga0495587_0068608 | |||
| 2076 | Ga0495587_0257399 | |||
| 2077 | Ga0495609_0051064 | |||
| 2078 | Ga0495609_0158928 | |||
| 2079 | Ga0495645_0021825 | |||
| 2080 | Ga0495667_0045587 | |||
| 2081 | Ga0495667_0051461 | |||
| 2082 | Ga0495667_0113787 | |||
| 2083 | Ga0495667_0137860 | |||
| 2084 | Ga0495656_0015563 | |||
| 2085 | Ga0495656_0028346 | |||
| 2086 | Ga0495656_0213418 | |||
| 2087 | Ga0495668_0315186 | |||
| 2088 | Ga0495634_0001787 | |||
| 2089 | Ga0495634_0034641 | |||
| 2090 | Ga0495634_0108820 | |||
| 2091 | Ga0495634_0146058 | |||
| 2092 | Ga0495634_0396591 | |||
| 2093 | Ga0495635_0037174 | |||
| 2094 | Ga0495635_0137309 | |||
| 2095 | Ga0495635_0245854 | |||
| 2096 | Ga0495659_0028230 | |||
| 2097 | Ga0495657_0066221 | |||
| 2098 | Ga0495657_0099027 | |||
| 2099 | Ga0495599_0041853 | |||
| 2100 | Ga0495599_0140650 | |||
| 2101 | Ga0495623_0192790 | |||
| 2102 | Ga0495646_0057150 | |||
| 2103 | Ga0495646_0071900 | |||
| 2104 | Ga0495646_0148697 | |||
| 2105 | Ga0495647_0009057 | |||
| 2106 | Ga0495647_0014454 | |||
| 2107 | Ga0495647_0073935 | |||
| 2108 | Ga0495647_0109247 | |||
| 2109 | Ga0495658_0001870 | |||
| 2110 | Ga0495658_0004883 | |||
| 2111 | Ga0495658_0047475 | |||
| 2112 | Ga0495613_0004641 | |||
| 2113 | Ga0495613_0036619 | |||
| 2114 | Ga0495613_0126066 | |||
| 2115 | Ga0495624_0025832 | |||
| 2116 | Ga0495624_0077764 | |||
| 2117 | Ga0495624_0078118 | |||
| 2118 | Ga0495624_0293054 | |||
| 2119 | Ga0495589_0035843 | |||
| 2120 | Ga0495589_0039947 | |||
| 2121 | Ga0495589_0107643 | |||
| 2122 | Ga0495600_0026476 | |||
| 2123 | Ga0495600_0052616 | |||
| 2124 | Ga0495581_0000299 | |||
| 2125 | Ga0495581_0023666 | |||
| 2126 | Ga0495581_0040548 | |||
| 2127 | Ga0495604_0060636 | |||
| 2128 | Ga0495604_0072873 | |||
| 2129 | Ga0495636_0100590 | |||
| 2130 | Ga0495674_0039020 | |||
| 2131 | Ga0495674_0045597 | |||
| 2132 | Ga0495674_0110392 | |||
| 2133 | Ga0495674_0149599 | |||
| 2134 | Ga0495674_0184882 | |||
| 2135 | Ga0495674_0220606 | |||
| 2136 | Ga0495676_0018113 | |||
| 2137 | Ga0495676_0031701 | |||
| 2138 | Ga0495676_0126366 | |||
| 2139 | Ga0495676_0159147 | |||
| 2140 | Ga0495676_0231967 | |||
| 2141 | Ga0495680_0004661 | |||
| 2142 | Ga0495680_0012355 | |||
| 2143 | Ga0495680_0117888 | |||
| 2144 | Ga0495680_0148298 | |||
| 2145 | Ga0495680_0150864 | |||
| 2146 | Ga0495680_0217052 | |||
| 2147 | Ga0495680_0238748 | |||
| 2148 | Ga0495679_087269 | |||
| 2149 | Ga0495684_0062775 | |||
| 2150 | Ga0495684_0231631 | |||
| 2151 | Ga0495593_0002593 | |||
| 2152 | Ga0495593_0154571 | |||
| 2153 | Ga0495602_0078572 | |||
| 2154 | Ga0495614_0003312 | |||
| 2155 | Ga0496100_0015305 | |||
| 2156 | Ga0496100_0016429 | |||
| 2157 | Ga0496100_0073446 | |||
| 2158 | Ga0496100_0074014 | |||
| 2159 | Ga0496100_0408351 | |||
| 2160 | Ga0496100_0807802 | |||
| 2161 | Ga0496101_0004296 | |||
| 2162 | Ga0496101_0008345 | |||
| 2163 | Ga0496101_0009481 | |||
| 2164 | Ga0496101_0089345 | |||
| 2165 | Ga0496101_0167812 | |||
| 2166 | Ga0496101_0202466 | |||
| 2167 | Ga0496101_0204877 | |||
| 2168 | Ga0496101_0306762 | |||
| 2169 | Ga0496102_0008554 | |||
| 2170 | Ga0496102_0012440 | |||
| 2171 | Ga0496102_0077496 | |||
| 2172 | Ga0496102_0120453 | |||
| 2173 | Ga0496102_0186271 | |||
| 2174 | Ga0496102_0834715 | |||
| 2175 | Ga0496103_0001580 | |||
| 2176 | Ga0496103_0019582 | |||
| 2177 | Ga0496103_0047344 | |||
| 2178 | Ga0496103_0153094 | |||
| 2179 | Ga0496103_0212265 | |||
| 2180 | Ga0496104_0001139 | |||
| 2181 | Ga0496104_0005108 | |||
| 2182 | Ga0496104_0005360 | |||
| 2183 | Ga0496104_0013132 | |||
| 2184 | Ga0496104_0059626 | |||
| 2185 | Ga0496104_0067172 | |||
| 2186 | Ga0496104_0096680 | |||
| 2187 | Ga0496104_0187291 | |||
| 2188 | Ga0496104_0493287 | |||
| 2189 | Ga0496105_0004028 | |||
| 2190 | Ga0496105_0012369 | |||
| 2191 | Ga0496105_0017229 | |||
| 2192 | Ga0496105_0028056 | |||
| 2193 | Ga0496105_0039024 | |||
| 2194 | Ga0496105_0055166 | |||
| 2195 | Ga0496105_0058366 | |||
| 2196 | Ga0496105_0199542 | |||
| 2197 | Ga0496106_0001856 | |||
| 2198 | Ga0496106_0002999 | |||
| 2199 | Ga0496106_0010072 | |||
| 2200 | Ga0496106_0022175 | |||
| 2201 | Ga0496106_0126590 | |||
| 2202 | Ga0496106_0199445 | |||
| 2203 | Ga0496106_0210232 | |||
| 2204 | Ga0496106_0280407 | |||
| 2205 | Ga0496106_0336393 | |||
| 2206 | Ga0496107_0002448 | |||
| 2207 | Ga0496107_0007725 | |||
| 2208 | Ga0496107_0008691 | |||
| 2209 | Ga0496107_0046508 | |||
| 2210 | Ga0496107_0099236 | |||
| 2211 | Ga0496107_0116330 | |||
| 2212 | Ga0496107_0187509 | |||
| 2213 | Ga0496107_0366541 | |||
| 2214 | Ga0496108_0002749 | |||
| 2215 | Ga0496108_0010043 | |||
| 2216 | Ga0496108_0019012 | |||
| 2217 | Ga0496108_0050552 | |||
| 2218 | Ga0496108_0114934 | |||
| 2219 | Ga0496108_0177397 | |||
| 2220 | Ga0496108_0193582 | |||
| 2221 | Ga0496108_0258950 | |||
| 2222 | Ga0496108_0330562 | |||
| 2223 | Ga0496108_0473395 | |||
| 2224 | Ga0496109_0005622 | |||
| 2225 | Ga0496109_0029299 | |||
| 2226 | Ga0496109_0033503 | |||
| 2227 | Ga0496109_0107010 | |||
| 2228 | Ga0496109_0137368 | |||
| 2229 | Ga0496109_0234187 | |||
| 2230 | Ga0496109_0258433 | |||
| 2231 | Ga0496109_0284801 | |||
| 2232 | Ga0496109_0304721 | |||
| 2233 | Ga0496109_0350730 | |||
| 2234 | Ga0496109_0372164 | |||
| 2235 | Ga0496109_0406508 | |||
| 2236 | Ga0496110_0004665 | |||
| 2237 | Ga0496110_0006563 | |||
| 2238 | Ga0496110_0027322 | |||
| 2239 | Ga0496110_0043565 | |||
| 2240 | Ga0496110_0045118 | |||
| 2241 | Ga0496110_0067328 | |||
| 2242 | Ga0496110_0117958 | |||
| 2243 | Ga0496110_0307680 | |||
| 2244 | Ga0496111_0000288 | |||
| 2245 | Ga0496111_0004255 | |||
| 2246 | Ga0496111_0004710 | |||
| 2247 | Ga0496111_0027069 | |||
| 2248 | Ga0496111_0041781 | |||
| 2249 | Ga0496111_0139527 | |||
| 2250 | Ga0496111_0144299 | |||
| 2251 | Ga0496111_0152528 | |||
| 2252 | Ga0496111_0201249 | |||
| 2253 | Ga0496111_0481097 | |||
| 2254 | Ga0496111_0599209 | |||
| 2255 | Ga0496112_0002860 | |||
| 2256 | Ga0496112_0003099 | |||
| 2257 | Ga0496112_0005474 | |||
| 2258 | Ga0496112_0033615 | |||
| 2259 | Ga0496112_0053955 | |||
| 2260 | Ga0496112_0104963 | |||
| 2261 | Ga0496112_0379729 | |||
| 2262 | Ga0496113_0005587 | |||
| 2263 | Ga0496113_0015305 | |||
| 2264 | Ga0496113_0081834 | |||
| 2265 | Ga0496113_0185700 | |||
| 2266 | Ga0496113_0205569 | |||
| 2267 | Ga0496113_0419466 | |||
| 2268 | Ga0496114_0001648 | |||
| 2269 | Ga0496114_0018197 | |||
| 2270 | Ga0496114_0020804 | |||
| 2271 | Ga0496114_0026489 | |||
| 2272 | Ga0496114_0033298 | |||
| 2273 | Ga0496114_0161680 | |||
| 2274 | Ga0496114_0191337 | |||
| 2275 | Ga0496114_0209586 | |||
| 2276 | Ga0496114_0225858 | |||
| 2277 | Ga0496114_0267785 | |||
| 2278 | Ga0496114_0282425 | |||
| 2279 | Ga0496114_0815212 | |||
| 2280 | Ga0496114_1102853 | |||
| 2281 | Ga0496115_0002150 | |||
| 2282 | Ga0496115_0010406 | |||
| 2283 | Ga0496115_0013970 | |||
| 2284 | Ga0496115_0017777 | |||
| 2285 | Ga0496115_0336985 | |||
| 2286 | Ga0496115_0351860 | |||
| 2287 | Ga0496124_0017873 | |||
| 2288 | Ga0501031_0003598 | |||
| 2289 | Ga0501031_0110526 | |||
| 2290 | Ga0501032_0229668 | |||
| 2291 | Ga0501032_0353355 | |||
| 2292 | Ga0501032_0355513 | |||
| 2293 | Ga0501032_0376423 | |||
| 2294 | Ga0501033_0079590 | |||
| 2295 | Ga0501033_0129627 | |||
| 2296 | Ga0501033_0159404 | |||
| 2297 | Ga0501034_0027696 | |||
| 2298 | Ga0501034_0286574 | |||
| 2299 | Ga0501036_0004190 | |||
| 2300 | Ga0501036_0013535 | |||
| 2301 | Ga0501036_0188178 | |||
| 2302 | Ga0501036_0226166 | |||
| 2303 | Ga0501037_0045139 | |||
| 2304 | Ga0501037_0085265 | |||
| 2305 | Ga0501037_0154833 | |||
| 2306 | Ga0501037_0379450 | |||
| 2307 | Ga0501037_0428613 | |||
| 2308 | Ga0501038_0000446 | |||
| 2309 | Ga0501038_0042057 | |||
| 2310 | Ga0501038_0112845 | |||
| 2311 | Ga0501038_0324391 | |||
| 2312 | Ga0501039_0023064 | |||
| 2313 | Ga0501039_0034063 | |||
| 2314 | Ga0501039_0071099 | |||
| 2315 | Ga0501039_0163950 | |||
| 2316 | Ga0501039_0188138 | |||
| 2317 | Ga0501039_0211760 | |||
| 2318 | Ga0501040_0012635 | |||
| 2319 | Ga0501040_0022097 | |||
| 2320 | Ga0501040_0039691 | |||
| 2321 | Ga0501040_0107088 | |||
| 2322 | Ga0501041_0043769 | |||
| 2323 | Ga0501041_0057511 | |||
| 2324 | Ga0501042_0015244 | |||
| 2325 | Ga0501042_0025305 | |||
| 2326 | Ga0501042_0048914 | |||
| 2327 | Ga0501042_0062232 | |||
| 2328 | Ga0501042_0069676 | |||
| 2329 | Ga0501042_0108619 | |||
| 2330 | Ga0501043_0086910 | |||
| 2331 | Ga0501043_0323559 | |||
| 2332 | Ga0501043_0590038 | |||
| 2333 | Ga0501046_0010022 | |||
| 2334 | Ga0501046_0057770 | |||
| 2335 | Ga0501046_0172201 | |||
| 2336 | Ga0501046_0201453 | |||
| 2337 | Ga0501046_0208249 | |||
| 2338 | Ga0501048_0004532 | |||
| 2339 | Ga0501048_0027573 | |||
| 2340 | Ga0501048_0115205 | |||
| 2341 | Ga0501048_0382149 | |||
| 2342 | Ga0501067_0070381 | |||
| 2343 | Ga0501068_0025392 | |||
| 2344 | Ga0501068_0040678 | |||
| 2345 | Ga0501068_0048806 | |||
| 2346 | Ga0501068_0120808 | |||
| 2347 | Ga0501069_0081830 | |||
| 2348 | Ga0501069_0379120 | |||
| 2349 | Ga0501070_0007864 | |||
| 2350 | Ga0501070_0025308 | |||
| 2351 | Ga0501070_0030446 | |||
| 2352 | Ga0501070_0146428 | |||
| 2353 | Ga0501070_0276070 | |||
| 2354 | Ga0501070_0526362 | |||
| 2355 | Ga0501070_0654971 | |||
| 2356 | Ga0501071_0005448 | |||
| 2357 | Ga0501071_0012845 | |||
| 2358 | Ga0501071_0042704 | |||
| 2359 | Ga0501071_0057442 | |||
| 2360 | Ga0501071_0058594 | |||
| 2361 | Ga0501071_0082261 | |||
| 2362 | Ga0501071_0137178 | |||
| 2363 | Ga0501071_0315851 | |||
| 2364 | Ga0501072_0006173 | |||
| 2365 | Ga0501072_0009485 | |||
| 2366 | Ga0501072_0012154 | |||
| 2367 | Ga0501072_0018769 | |||
| 2368 | Ga0501072_0043691 | |||
| 2369 | Ga0501072_0133557 | |||
| 2370 | Ga0501072_0144443 | |||
| 2371 | Ga0501072_0157113 | |||
| 2372 | Ga0501072_0171827 | |||
| 2373 | Ga0501072_0233106 | |||
| 2374 | Ga0501073_0026239 | |||
| 2375 | Ga0501073_0067079 | |||
| 2376 | Ga0501073_0163997 | |||
| 2377 | Ga0501073_0374212 | |||
| 2378 | Ga0501074_0000736 | |||
| 2379 | Ga0501074_0030080 | |||
| 2380 | Ga0501074_0042310 | |||
| 2381 | Ga0501074_0046531 | |||
| 2382 | Ga0501074_0450324 | |||
| 2383 | Ga0501075_0005948 | |||
| 2384 | Ga0501075_0007307 | |||
| 2385 | Ga0501075_0011862 | |||
| 2386 | Ga0501075_0026807 | |||
| 2387 | Ga0501075_0037718 | |||
| 2388 | Ga0501075_0055402 | |||
| 2389 | Ga0501075_0117877 | |||
| 2390 | Ga0501075_0323506 | |||
| 2391 | Ga0501075_0334482 | |||
| 2392 | Ga0501076_0001738 | |||
| 2393 | Ga0501076_0017433 | |||
| 2394 | Ga0501076_0269723 | |||
| 2395 | Ga0501076_0884023 | |||
| 2396 | Ga0501077_0009606 | |||
| 2397 | Ga0501077_0031481 | |||
| 2398 | Ga0501077_0035827 | |||
| 2399 | Ga0501077_0065530 | |||
| 2400 | Ga0501077_0076067 | |||
| 2401 | Ga0501077_0099334 | |||
| 2402 | Ga0501079_0009682 | |||
| 2403 | Ga0501079_0014419 | |||
| 2404 | Ga0501079_0028311 | |||
| 2405 | Ga0501079_0042811 | |||
| 2406 | Ga0501079_0049923 | |||
| 2407 | Ga0501079_0114174 | |||
| 2408 | Ga0501079_0128038 | |||
| 2409 | Ga0501079_0143161 | |||
| 2410 | Ga0501079_0175157 | |||
| 2411 | Ga0501080_0000499 | |||
| 2412 | Ga0501080_0001199 | |||
| 2413 | Ga0501080_0010935 | |||
| 2414 | Ga0501080_0024873 | |||
| 2415 | Ga0501080_0039582 | |||
| 2416 | Ga0501080_0161958 | |||
| 2417 | Ga0501080_0162004 | |||
| 2418 | Ga0501080_0193981 | |||
| 2419 | Ga0501080_0313926 | |||
| 2420 | Ga0501081_0011438 | |||
| 2421 | Ga0501081_0056041 | |||
| 2422 | Ga0501081_0060936 | |||
| 2423 | Ga0501081_0134015 | |||
| 2424 | Ga0501081_0151605 | |||
| 2425 | Ga0501081_0484051 | |||
| 2426 | Ga0501083_0000893 | |||
| 2427 | Ga0501083_0028348 | |||
| 2428 | Ga0501083_0161018 | |||
| 2429 | Ga0501035_0146125 | |||
| 2430 | Ga0501035_0331103 | |||
| 2431 | Ga0501045_0015035 | |||
| 2432 | Ga0501045_0083774 | |||
| 2433 | Ga0501045_0264864 | |||
| 2434 | nmdc:mga00v17_9903_c2 | |||
| 2435 | nmdc:mga05p37_19183_c1 | |||
| 2436 | nmdc:mga05p37_22454_c1 | |||
| 2437 | nmdc:mga05p37_677078_c1 | |||
| 2438 | nmdc:mga05p37_835825_c1 | |||
| 2439 | nmdc:mga09592_139208_c1 | |||
| 2440 | nmdc:mga09592_307391_c1 | |||
| 2441 | nmdc:mga09592_86732_c1 | |||
| 2442 | nmdc:mga0qj67_158054_c1 | |||
| 2443 | nmdc:mga0qj67_41497_c1 | |||
| 2444 | nmdc:mga0qj67_45717_c1 | |||
| 2445 | nmdc:mga06r32_1531_c1 | |||
| 2446 | nmdc:mga06r32_231842_c1 | |||
| 2447 | nmdc:mga06r32_79884_c1 | |||
| 2448 | nmdc:mga08y16_117386_c1 | |||
| 2449 | nmdc:mga08y16_129588_c1 | |||
| 2450 | nmdc:mga08y16_16439_c2 | |||
| 2451 | nmdc:mga08y16_398209_c1 | |||
| 2452 | nmdc:mga0n895_45303_c1 | |||
| 2453 | nmdc:mga0n895_520946_c1 | |||
| 2454 | nmdc:mga0a205_34513_c1 | |||
| 2455 | nmdc:mga0a205_448547_c1 | |||
| 2456 | nmdc:mga0a205_94809_c1 | |||
| 2457 | Ga0495601_0092972 | |||
| 2458 | Ga0495601_0179663 | |||
| 2459 | Ga0495601_0183535 | |||
| 2460 | Ga0495601_0359774 | |||
| 2461 | Ga0495595_0088098 | |||
| 2462 | Ga0495595_0094024 | |||
| 2463 | Ga0495619_0012071 | |||
| 2464 | Ga0495619_0064972 | |||
| 2465 | Ga0495619_0204738 | |||
| 2466 | Ga0501084_0000882 | |||
| 2467 | Ga0501084_0006516 | |||
| 2468 | Ga0501084_0011050 | |||
| 2469 | Ga0501084_0032711 | |||
| 2470 | Ga0501084_0044692 | |||
| 2471 | Ga0501084_0194957 | |||
| 2472 | Ga0501084_0207069 | |||
| 2473 | Ga0501084_0701530 | |||
| 2474 | Ga0501082_0011480 | |||
| 2475 | Ga0501082_0015445 | |||
| 2476 | Ga0501082_0019263 | |||
| 2477 | Ga0501082_0046016 | |||
| 2478 | Ga0501082_0048095 | |||
| 2479 | Ga0501082_0068482 | |||
| 2480 | Ga0501082_0083439 | |||
| 2481 | Ga0501082_0315124 | |||
| 2482 | Ga0501082_0586875 | |||
| 2483 | Ga0466962_0000666 | |||
| 2484 | Ga0466962_0007569 | |||
| 2485 | Ga0466962_0016170 | |||
| 2486 | Ga0466962_0265260 | |||
| 2487 | Ga0530510_0000865 | |||
| 2488 | Ga0530510_0023469 | |||
| 2489 | Ga0530510_0041037 | |||
| 2490 | Ga0530510_0051785 | |||
| 2491 | Ga0530510_0058132 | |||
| 2492 | Ga0530510_0066894 | |||
| 2493 | Ga0530510_0190190 | |||
| 2494 | Ga0530510_0226282 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.8724 | 2 | 234 |
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.856 | 2 | 234 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.8198 | 2 | 234 |
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.8121 | 2 | 234 |
| 7msk-assembly1.cif.gz_B | thus glycosin s-glycosyltransferase | 0.7693 | 2 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9471 | 2 | 234 | 3.90.550.10 |
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9276 | 2 | 234 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.863 | 2 | 223 | 3.90.550.10 |
| af_A0A0R0GWU7_24_252_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8596 | 2 | 220 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8524 | 2 | 228 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9KKX8-F1-model_v4 | Polyprenol monophosphomannose synthase | 0.9845 | 2 | 193 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A0K2R2Z2-F1-model_v4 | deleted | 0.9799 | 2 | 204 |
|
| AF-A0A2G6JG59-F1-model_v4 | Dolichyl-phosphate beta-D-mannosyltransferase | 0.9791 | 2 | 229 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A1W9N2M7-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9759 | 2 | 227 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A7V0IGF1-F1-model_v4 | Polyprenol monophosphomannose synthase | 0.9757 | 2 | 235 |
GO:0004582
GO:0009247 GO:0016020 |