F492102

General Info

Members Datasets Scaffolds Average Seq Length
1242 389 2484 150

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10014389|Ga0207692_100143892
Length 175
Sequence MATGSSLPRSFPDRRKLAAMIRSGGARDVPFLRDMLRHAFYWRTPVGEQEPPLTRYVNGWGRPGDRSLIVFDDFVPVGAAWYRLFTAEDPGFGFVDDQTPELAIAVVPSRRGRGFGRELLSALLDCARKDGFEAISLSVAKDNPAIHLYEGYGFEKVREDDGAVVMRAALQAEQA

Samples

Sample ID Description Type Environment
1 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
105 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
106 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
107 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
108 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
209 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
237 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
238 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
241 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
242 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
243 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
244 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
247 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
248 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
249 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
250 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
251 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
252 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
253 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
281 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
328 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 10.63
Rhizosphere 87.84
Stem 0
Stem Tuber 0
Unclassified 14.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207692_10014389 3300025898 Bacteria 3456
2 rootH1_10005646 3300003316 Unclassified 1115
3 JGI25404J52841_10054961 3300003659 Bacteria 835
4 Ga0070658_10021345 3300005327 Bacteria 5190
5 Ga0070683_100002028 3300005329 Bacteria 15924
6 Ga0070683_100003692 3300005329 Bacteria 12489
7 Ga0070683_100015521 3300005329 Bacteria 6695
8 Ga0070683_100022221 3300005329 Bacteria 5667
9 Ga0070683_100040458 3300005329 Unclassified 4286
10 Ga0070683_100057458 3300005329 Unclassified 3615
11 Ga0070683_100258342 3300005329 Bacteria 1657
12 Ga0070683_100531907 3300005329 Bacteria 1123
13 Ga0070683_100602152 3300005329 Bacteria 1052
14 Ga0070690_100682623 3300005330 Bacteria 787
15 Ga0070677_10438659 3300005333 Bacteria 696
16 Ga0068869_100872698 3300005334 Unclassified 777
17 Ga0070666_10255127 3300005335 Bacteria 1242
18 Ga0070680_100009405 3300005336 Bacteria 7508
19 Ga0070680_100043363 3300005336 Bacteria 3654
20 Ga0070680_100109751 3300005336 Bacteria 2296
21 Ga0070680_100415390 3300005336 Bacteria 1148
22 Ga0070680_100425643 3300005336 Bacteria 1133
23 Ga0070682_100009325 3300005337 Bacteria 5556
24 Ga0070682_100107417 3300005337 Bacteria 1853
25 Ga0070682_100325093 3300005337 Bacteria 1138
26 Ga0068868_100164775 3300005338 Bacteria 1833
27 Ga0068868_100172004 3300005338 Bacteria 1793
28 Ga0068868_100274542 3300005338 Bacteria 1425
29 Ga0068868_100608439 3300005338 Bacteria 969
30 Ga0070660_100023157 3300005339 Unclassified 4600
31 Ga0070660_100023680 3300005339 Bacteria 4551
32 Ga0070660_100051495 3300005339 Bacteria 3171
33 Ga0070660_100184559 3300005339 Bacteria 1688
34 Ga0070660_100895928 3300005339 Unclassified 748
35 Ga0070691_10510748 3300005341 Bacteria 696
36 Ga0070687_100589775 3300005343 Unclassified 762
37 Ga0070687_100845175 3300005343 Bacteria 652
38 Ga0070661_100326161 3300005344 Bacteria 1200
39 Ga0070661_100365454 3300005344 Bacteria 1135
40 Ga0070661_100951512 3300005344 Unclassified 711
41 Ga0070692_10382731 3300005345 Bacteria 883
42 Ga0070668_100046895 3300005347 Bacteria 3321
43 Ga0070668_101466329 3300005347 Unclassified 623
44 Ga0070669_101278948 3300005353 Bacteria 635
45 Ga0070675_100224565 3300005354 Bacteria 1637
46 Ga0070675_100662306 3300005354 Bacteria 949
47 Ga0070671_100206063 3300005355 Bacteria 1668
48 Ga0070671_100864941 3300005355 Bacteria 789
49 Ga0070674_100119163 3300005356 Bacteria 1952
50 Ga0070673_100223199 3300005364 Bacteria 1632
51 Ga0070673_100425798 3300005364 Bacteria 1191
52 Ga0070688_100135346 3300005365 Bacteria 1667
53 Ga0070688_100390695 3300005365 Bacteria 1028
54 Ga0070659_100251276 3300005366 Bacteria 1465
55 Ga0070703_10052110 3300005406 Bacteria 1312
56 Ga0070703_10179468 3300005406 Bacteria 817
57 Ga0070709_10155772 3300005434 Bacteria 1583
58 Ga0070709_10195423 3300005434 Bacteria 1430
59 Ga0070709_10297895 3300005434 Bacteria 1177
60 Ga0070709_10351321 3300005434 Unclassified 1089
61 Ga0070709_10798624 3300005434 Bacteria 740
62 Ga0070714_100019202 3300005435 Bacteria 5563
63 Ga0070714_100025597 3300005435 Bacteria 4870
64 Ga0070714_100092383 3300005435 Unclassified 2652
65 Ga0070714_100156647 3300005435 Bacteria 2057
66 Ga0070714_100257913 3300005435 Unclassified 1614
67 Ga0070714_100306859 3300005435 Bacteria 1481
68 Ga0070714_100409932 3300005435 Bacteria 1282
69 Ga0070714_101070279 3300005435 Bacteria 785
70 Ga0070713_100020271 3300005436 Bacteria 5094
71 Ga0070713_100235856 3300005436 Bacteria 1664
72 Ga0070713_100510729 3300005436 Bacteria 1135
73 Ga0070713_100526410 3300005436 Bacteria 1117
74 Ga0070713_100542227 3300005436 Bacteria 1101
75 Ga0070713_100562521 3300005436 Bacteria 1081
76 Ga0070713_101261404 3300005436 Unclassified 716
77 Ga0070710_10063266 3300005437 Bacteria 2113
78 Ga0070710_10293672 3300005437 Bacteria 1059
79 Ga0070710_10474477 3300005437 Bacteria 852
80 Ga0070710_10820213 3300005437 Unclassified 666
81 Ga0070701_10135903 3300005438 Bacteria 1401
82 Ga0070701_10395857 3300005438 Bacteria 874
83 Ga0070711_100365658 3300005439 Bacteria 1163
84 Ga0070711_100417331 3300005439 Bacteria 1093
85 Ga0070711_100874425 3300005439 Bacteria 766
86 Ga0070711_101461704 3300005439 Bacteria 596
87 Ga0070705_100066351 3300005440 Bacteria 2163
88 Ga0070705_100186542 3300005440 Bacteria 1410
89 Ga0070705_100872657 3300005440 Bacteria 722
90 Ga0070705_101383511 3300005440 Unclassified 586
91 Ga0070700_100074824 3300005441 Bacteria 2171
92 Ga0070694_100136793 3300005444 Bacteria 1776
93 Ga0070694_100199769 3300005444 Bacteria 1490
94 Ga0070694_100200548 3300005444 Unclassified 1487
95 Ga0070694_100377333 3300005444 Unclassified 1105
96 Ga0070694_100765061 3300005444 Bacteria 789
97 Ga0070708_100272974 3300005445 Bacteria 1590
98 Ga0070708_100499417 3300005445 Unclassified 1147
99 Ga0070663_100083991 3300005455 Bacteria 2346
100 Ga0070663_101669904 3300005455 Bacteria 569
101 Ga0070678_100065988 3300005456 Bacteria 2689
102 Ga0070678_100107974 3300005456 Bacteria 2172
103 Ga0070678_100240730 3300005456 Bacteria 1513
104 Ga0070678_101087341 3300005456 Bacteria 738
105 Ga0070662_100090256 3300005457 Bacteria 2299
106 Ga0070662_100266062 3300005457 Bacteria 1383
107 Ga0070662_100539055 3300005457 Bacteria 977
108 Ga0070662_100622709 3300005457 Bacteria 909
109 Ga0070662_100642077 3300005457 Bacteria 895
110 Ga0070681_10000616 3300005458 Bacteria 29195
111 Ga0070681_10045315 3300005458 Bacteria 4401
112 Ga0070681_10132525 3300005458 Bacteria 2424
113 Ga0070681_10201585 3300005458 Bacteria 1908
114 Ga0070681_10289533 3300005458 Bacteria 1548
115 Ga0070681_10292560 3300005458 Bacteria 1539
116 Ga0070681_10476389 3300005458 Bacteria 1161
117 Ga0070681_10515657 3300005458 Bacteria 1109
118 Ga0070681_10777832 3300005458 Bacteria 874
119 Ga0068867_100128451 3300005459 Bacteria 1967
120 Ga0070685_10439378 3300005466 Unclassified 912
121 Ga0070706_100296856 3300005467 Bacteria 1508
122 Ga0070706_100321525 3300005467 Bacteria 1443
123 Ga0070706_100504212 3300005467 Bacteria 1126
124 Ga0070706_101559868 3300005467 Bacteria 603
125 Ga0070706_101652602 3300005467 Archaea 584
126 Ga0070707_100003029 3300005468 Bacteria 15935
127 Ga0070707_100028647 3300005468 Bacteria 5300
128 Ga0070707_100188282 3300005468 Bacteria 2012
129 Ga0070707_100244856 3300005468 Bacteria 1745
130 Ga0070707_100645784 3300005468 Bacteria 1021
131 Ga0070707_100804550 3300005468 Bacteria 904
132 Ga0070707_100846754 3300005468 Bacteria 878
133 Ga0070707_101585857 3300005468 Bacteria 621
134 Ga0070707_101868373 3300005468 Bacteria 568
135 Ga0070698_100004541 3300005471 Bacteria 15252
136 Ga0070698_100037866 3300005471 Bacteria 4972
137 Ga0070698_100052435 3300005471 Bacteria 4149
138 Ga0070698_100225563 3300005471 Bacteria 1807
139 Ga0070698_101235921 3300005471 Bacteria 696
140 Ga0070699_100159960 3300005518 Bacteria 1993
141 Ga0070679_100002700 3300005530 Bacteria 16150
142 Ga0070679_100119808 3300005530 Bacteria 2617
143 Ga0070679_100148957 3300005530 Bacteria 2318
144 Ga0070679_100167777 3300005530 Bacteria 2168
145 Ga0070679_100363772 3300005530 Bacteria 1394
146 Ga0070679_100413262 3300005530 Bacteria 1295
147 Ga0070679_100520042 3300005530 Unclassified 1134
148 Ga0070679_100969114 3300005530 Bacteria 794
149 Ga0070684_100018945 3300005535 Bacteria 5683
150 Ga0070684_100019770 3300005535 Bacteria 5576
151 Ga0070684_100021310 3300005535 Bacteria 5391
152 Ga0070684_100060099 3300005535 Bacteria 3323
153 Ga0070684_100167666 3300005535 Bacteria 1994
154 Ga0070684_100167882 3300005535 Bacteria 1992
155 Ga0070684_100482260 3300005535 Bacteria 1148
156 Ga0070684_100691159 3300005535 Bacteria 951
157 Ga0070697_100143374 3300005536 Bacteria 2010
158 Ga0070697_100332036 3300005536 Bacteria 1311
159 Ga0070697_100354425 3300005536 Bacteria 1268
160 Ga0068853_100381730 3300005539 Bacteria 1316
161 Ga0070686_100026401 3300005544 Bacteria 3506
162 Ga0070686_100057795 3300005544 Bacteria 2493
163 Ga0070686_100239634 3300005544 Bacteria 1320
164 Ga0070686_100525816 3300005544 Bacteria 922
165 Ga0070695_100034181 3300005545 Bacteria 3185
166 Ga0070695_100040051 3300005545 Bacteria 2964
167 Ga0070695_100106414 3300005545 Bacteria 1897
168 Ga0070695_100305237 3300005545 Bacteria 1178
169 Ga0070696_100052107 3300005546 Bacteria 2846
170 Ga0070696_100137746 3300005546 Bacteria 1781
171 Ga0070696_100140397 3300005546 Bacteria 1765
172 Ga0070696_100175773 3300005546 Bacteria 1586
173 Ga0070696_101029575 3300005546 Bacteria 689
174 Ga0070693_100002681 3300005547 Bacteria 8190
175 Ga0070693_100035519 3300005547 Bacteria 2765
176 Ga0070693_100061681 3300005547 Bacteria 2180
177 Ga0070693_100291936 3300005547 Bacteria 1096
178 Ga0070693_101302612 3300005547 Archaea 562
179 Ga0070665_101615447 3300005548 Unclassified 656
180 Ga0070704_100351153 3300005549 Bacteria 1245
181 Ga0070704_100504044 3300005549 Bacteria 1051
182 Ga0070704_100697655 3300005549 Bacteria 900
183 Ga0068855_100552044 3300005563 Bacteria 1247
184 Ga0068855_100633736 3300005563 Bacteria 1150
185 Ga0068855_101454769 3300005563 Bacteria 705
186 Ga0070664_100217324 3300005564 Bacteria 1709
187 Ga0070664_100305274 3300005564 Bacteria 1439
188 Ga0070664_100557472 3300005564 Bacteria 1060
189 Ga0068857_100023736 3300005577 Bacteria 5399
190 Ga0068857_100393189 3300005577 Bacteria 1289
191 Ga0068857_100542334 3300005577 Bacteria 1095
192 Ga0068857_101935507 3300005577 Bacteria 578
193 Ga0068854_100652122 3300005578 Bacteria 904
194 Ga0068854_101383240 3300005578 Unclassified 636
195 Ga0068856_100092009 3300005614 Bacteria 3017
196 Ga0068856_100119488 3300005614 Unclassified 2637
197 Ga0068856_100134929 3300005614 Bacteria 2473
198 Ga0068856_100232774 3300005614 Bacteria 1857
199 Ga0068856_100414290 3300005614 Bacteria 1367
200 Ga0068856_100780009 3300005614 Unclassified 976
201 Ga0068856_100919393 3300005614 Bacteria 894
202 Ga0068856_101356382 3300005614 Bacteria 726
203 Ga0068856_101697074 3300005614 Bacteria 644
204 Ga0068856_101926976 3300005614 Unclassified 602
205 Ga0070702_100589310 3300005615 Bacteria 832
206 Ga0068852_100806853 3300005616 Bacteria 953
207 Ga0068852_101012135 3300005616 Bacteria 850
208 Ga0068864_100080980 3300005618 Bacteria 2846
209 Ga0068864_101294452 3300005618 Bacteria 729
210 Ga0068866_10106114 3300005718 Bacteria 1559
211 Ga0068861_100091730 3300005719 Unclassified 2399
212 Ga0068861_100672476 3300005719 Bacteria 959
213 Ga0068858_100970667 3300005842 Bacteria 832
214 Ga0068862_100299449 3300005844 Bacteria 1479
215 Ga0068862_101340907 3300005844 Bacteria 718
216 Ga0081455_10007511 3300005937 Bacteria 11466
217 Ga0081455_10023070 3300005937 Bacteria 5797
218 Ga0081455_10094023 3300005937 Bacteria 2422
219 Ga0081455_10101149 3300005937 Bacteria 2314
220 Ga0081455_10201776 3300005937 Bacteria 1489
221 Ga0081455_10369269 3300005937 Bacteria 1006
222 Ga0081538_10001520 3300005981 Bacteria 23798
223 Ga0081538_10015038 3300005981 Bacteria 6019
224 Ga0081538_10020089 3300005981 Bacteria 4934
225 Ga0081540_1003521 3300005983 Bacteria 12352
226 Ga0081540_1004841 3300005983 Bacteria 10144
227 Ga0081540_1005736 3300005983 Bacteria 9204
228 Ga0081539_10004400 3300005985 Bacteria 15613
229 Ga0081539_10009156 3300005985 Bacteria 8360
230 Ga0070717_10051942 3300006028 Bacteria 3375
231 Ga0070717_10114022 3300006028 Bacteria 2308
232 Ga0070717_10162376 3300006028 Bacteria 1939
233 Ga0070717_10680891 3300006028 Bacteria 934
234 Ga0075365_10163247 3300006038 Bacteria 1553
235 Ga0075432_10007543 3300006058 Bacteria 3706
236 Ga0075432_10206081 3300006058 Bacteria 780
237 Ga0075432_10262956 3300006058 Bacteria 704
238 Ga0070715_10001432 3300006163 Bacteria 6907
239 Ga0070715_10091023 3300006163 Bacteria 1404
240 Ga0070716_100007454 3300006173 Bacteria 5389
241 Ga0070716_100057189 3300006173 Bacteria 2240
242 Ga0070716_100093535 3300006173 Unclassified 1825
243 Ga0070716_100179184 3300006173 Bacteria 1390
244 Ga0070716_100443040 3300006173 Bacteria 945
245 Ga0070712_100030861 3300006175 Bacteria 3606
246 Ga0070712_100119030 3300006175 Bacteria 1984
247 Ga0070712_100131979 3300006175 Bacteria 1894
248 Ga0070712_100157941 3300006175 Bacteria 1748
249 Ga0070712_100340252 3300006175 Bacteria 1225
250 Ga0070712_101345197 3300006175 Bacteria 623
251 Ga0070712_101495734 3300006175 Bacteria 590
252 Ga0097621_100004581 3300006237 Bacteria 9646
253 Ga0068871_100010878 3300006358 Bacteria 6662
254 Ga0075428_100076499 3300006844 Bacteria 3654
255 Ga0075428_100091758 3300006844 Bacteria 3312
256 Ga0075428_100402164 3300006844 Bacteria 1468
257 Ga0075428_100475348 3300006844 Bacteria 1338
258 Ga0075428_100548781 3300006844 Unclassified 1235
259 Ga0075428_100622473 3300006844 Bacteria 1152
260 Ga0075428_100858072 3300006844 Bacteria 964
261 Ga0075430_100051989 3300006846 Bacteria 3450
262 Ga0075431_100120062 3300006847 Unclassified 2712
263 Ga0075431_100145004 3300006847 Bacteria 2447
264 Ga0075431_100338757 3300006847 Unclassified 1514
265 Ga0075431_100375133 3300006847 Bacteria 1427
266 Ga0075431_100460084 3300006847 Unclassified 1267
267 Ga0075431_100605146 3300006847 Bacteria 1080
268 Ga0075433_10105460 3300006852 Bacteria 2497
269 Ga0075433_10135561 3300006852 Unclassified 2188
270 Ga0075433_10170962 3300006852 Bacteria 1934
271 Ga0075433_10349539 3300006852 Bacteria 1307
272 Ga0075433_10364269 3300006852 Bacteria 1277
273 Ga0075433_10465645 3300006852 Bacteria 1114
274 Ga0075434_100037397 3300006871 Bacteria 4805
275 Ga0075434_100171687 3300006871 Unclassified 2188
276 Ga0075434_100172430 3300006871 Unclassified 2183
277 Ga0075434_100192823 3300006871 Bacteria 2058
278 Ga0075434_100677681 3300006871 Bacteria 1049
279 Ga0075434_100760639 3300006871 Unclassified 986
280 Ga0075434_101671256 3300006871 Unclassified 645
281 Ga0075429_100204890 3300006880 Bacteria 1728
282 Ga0068865_100179918 3300006881 Unclassified 1628
283 Ga0075436_100009822 3300006914 Bacteria 6544
284 Ga0075436_100099510 3300006914 Unclassified 2024
285 Ga0075436_100099809 3300006914 Bacteria 2021
286 Ga0075436_100202332 3300006914 Bacteria 1407
287 Ga0075436_100234624 3300006914 Bacteria 1304
288 Ga0075436_100557991 3300006914 Unclassified 841
289 Ga0075436_101493887 3300006914 Unclassified 513
290 Ga0075435_100120367 3300007076 Unclassified 2190
291 Ga0075435_100126128 3300007076 Unclassified 2139
292 Ga0075435_100298973 3300007076 Bacteria 1376
293 Ga0075435_100422093 3300007076 Bacteria 1149
294 Ga0075435_100543856 3300007076 Bacteria 1005
295 Ga0075435_100809438 3300007076 Bacteria 816
296 Ga0105240_10097691 3300009093 Bacteria 3578
297 Ga0105240_10124169 3300009093 Unclassified 3105
298 Ga0105240_10206929 3300009093 Bacteria 2296
299 Ga0105240_10217152 3300009093 Bacteria 2230
300 Ga0105240_10266972 3300009093 Bacteria 1972
301 Ga0111539_10030639 3300009094 Bacteria 6539
302 Ga0111539_10076953 3300009094 Bacteria 3928
303 Ga0111539_10114917 3300009094 Bacteria 3157
304 Ga0111539_10126418 3300009094 Unclassified 2995
305 Ga0111539_10228451 3300009094 Unclassified 2167
306 Ga0111539_10232618 3300009094 Unclassified 2146
307 Ga0111539_10296701 3300009094 Unclassified 1881
308 Ga0111539_10431633 3300009094 Bacteria 1534
309 Ga0111539_12568041 3300009094 Unclassified 591
310 Ga0105245_10007926 3300009098 Bacteria 9289
311 Ga0105245_10008291 3300009098 Bacteria 9079
312 Ga0105245_10026357 3300009098 Bacteria 5116
313 Ga0105245_10093597 3300009098 Bacteria 2769
314 Ga0105245_10218542 3300009098 Bacteria 1838
315 Ga0105245_10395855 3300009098 Bacteria 1379
316 Ga0105245_10405947 3300009098 Bacteria 1363
317 Ga0105245_10568236 3300009098 Bacteria 1157
318 Ga0105245_10778059 3300009098 Bacteria 994
319 Ga0105245_10959045 3300009098 Bacteria 898
320 Ga0105247_10643525 3300009101 Bacteria 791
321 Ga0114129_10033209 3300009147 Bacteria 7292
322 Ga0114129_10088938 3300009147 Bacteria 4281
323 Ga0114129_10139384 3300009147 Bacteria 3326
324 Ga0114129_10177421 3300009147 Bacteria 2901
325 Ga0114129_10441546 3300009147 Unclassified 1708
326 Ga0114129_10884093 3300009147 Bacteria 1133
327 Ga0105243_10118934 3300009148 Bacteria 2224
328 Ga0105243_10283088 3300009148 Bacteria 1494
329 Ga0105243_10432289 3300009148 Bacteria 1231
330 Ga0105243_11227973 3300009148 Bacteria 764
331 Ga0105241_10061816 3300009174 Bacteria 2885
332 Ga0105241_10254921 3300009174 Bacteria 1489
333 Ga0105241_11277974 3300009174 Unclassified 698
334 Ga0105242_10088446 3300009176 Bacteria 2602
335 Ga0105242_10096667 3300009176 Bacteria 2496
336 Ga0105242_10107711 3300009176 Bacteria 2371
337 Ga0105242_10126861 3300009176 Bacteria 2197
338 Ga0105242_10331340 3300009176 Bacteria 1400
339 Ga0105242_10700584 3300009176 Bacteria 991
340 Ga0105248_10436540 3300009177 Bacteria 1475
341 Ga0105248_11450750 3300009177 Bacteria 777
342 Ga0105248_11763870 3300009177 Bacteria 702
343 Ga0105237_11272068 3300009545 Bacteria 742
344 Ga0105237_11649394 3300009545 Unclassified 648
345 Ga0105238_10495828 3300009551 Bacteria 1222
346 Ga0105249_10127509 3300009553 Bacteria 2425
347 Ga0105249_10197361 3300009553 Bacteria 1967
348 Ga0105249_10277147 3300009553 Bacteria 1673
349 Ga0105249_10665464 3300009553 Bacteria 1099
350 Ga0105239_10171359 3300010375 Bacteria 2427
351 Ga0105239_10175522 3300010375 Unclassified 2396
352 Ga0105239_10183220 3300010375 Bacteria 2343
353 Ga0105239_10252879 3300010375 Bacteria 1979
354 Ga0105239_10340984 3300010375 Bacteria 1691
355 Ga0105239_10690499 3300010375 Bacteria 1167
356 Ga0105239_11056062 3300010375 Bacteria 935
357 Ga0105239_11688944 3300010375 Bacteria 733
358 Ga0105246_10219494 3300011119 Bacteria 1489
359 Ga0105246_10316013 3300011119 Bacteria 1267
360 Ga0105246_10911345 3300011119 Bacteria 789
361 Ga0157320_1022351 3300012481 Unclassified 586
362 Ga0157325_1022521 3300012485 Bacteria 574
363 Ga0157335_1008208 3300012492 Bacteria 796
364 Ga0157314_1028394 3300012500 Unclassified 615
365 Ga0157314_1033163 3300012500 Bacteria 590
366 Ga0157326_1014033 3300012513 Bacteria 929
367 Ga0157373_10250024 3300013100 Unclassified 1254
368 Ga0157373_10336544 3300013100 Bacteria 1075
369 Ga0157373_10881326 3300013100 Bacteria 663
370 Ga0157371_10189602 3300013102 Bacteria 1472
371 Ga0157371_10278725 3300013102 Bacteria 1207
372 Ga0157371_10425488 3300013102 Bacteria 974
373 Ga0157370_10238235 3300013104 Bacteria 1684
374 Ga0157370_10750006 3300013104 Unclassified 889
375 Ga0157369_10311567 3300013105 Bacteria 1637
376 Ga0157369_10478426 3300013105 Bacteria 1289
377 Ga0157369_10657150 3300013105 Bacteria 1081
378 Ga0157369_11072493 3300013105 Bacteria 824
379 Ga0157369_11243778 3300013105 Bacteria 759
380 Ga0157374_10070018 3300013296 Bacteria 3304
381 Ga0157374_11166948 3300013296 Bacteria 791
382 Ga0157374_11656427 3300013296 Unclassified 664
383 Ga0157378_10329329 3300013297 Bacteria 1486
384 Ga0157378_10460598 3300013297 Bacteria 1263
385 Ga0157378_13268364 3300013297 Bacteria 504
386 Ga0163162_10104789 3300013306 Bacteria 2923
387 Ga0163162_10264516 3300013306 Bacteria 1851
388 Ga0163162_10538765 3300013306 Bacteria 1296
389 Ga0157372_10394651 3300013307 Bacteria 1612
390 Ga0157372_10620350 3300013307 Bacteria 1260
391 Ga0157372_10704310 3300013307 Unclassified 1175
392 Ga0157372_12391553 3300013307 Unclassified 607
393 Ga0157372_12775560 3300013307 Bacteria 562
394 Ga0157375_10095382 3300013308 Bacteria 3045
395 Ga0157375_10195506 3300013308 Bacteria 2178
396 Ga0157375_10395948 3300013308 Bacteria 1548
397 Ga0157375_10765328 3300013308 Bacteria 1116
398 Ga0157375_11334706 3300013308 Bacteria 844
399 Ga0157375_12843690 3300013308 Bacteria 579
400 Ga0163163_10345950 3300014325 Bacteria 1542
401 Ga0182008_10007996 3300014497 Bacteria 5796
402 Ga0182008_10030573 3300014497 Bacteria 2714
403 Ga0182008_10234206 3300014497 Bacteria 943
404 Ga0182008_10470615 3300014497 Bacteria 686
405 Ga0157376_10152399 3300014969 Bacteria 2086
406 Ga0157376_10506755 3300014969 Bacteria 1187
407 Ga0157376_10599363 3300014969 Bacteria 1096
408 Ga0157376_12380331 3300014969 Unclassified 569
409 Ga0182006_1140307 3300015261 Bacteria 826
410 Ga0182007_10073485 3300015262 Bacteria 1120
411 Ga0163161_10053397 3300017792 Bacteria 2931
412 Ga0163161_10219632 3300017792 Bacteria 1471
413 Ga0163161_11094287 3300017792 Unclassified 685
414 Ga0206356_10899570 3300020070 Bacteria 1857
415 Ga0206356_11542665 3300020070 Bacteria 2161
416 Ga0206354_10762389 3300020081 Bacteria 577
417 Ga0206354_10957585 3300020081 Bacteria 1510
418 Ga0206354_11589080 3300020081 Unclassified 593
419 Ga0206353_10125552 3300020082 Bacteria 7745
420 Ga0206353_11044796 3300020082 Bacteria 1106
421 Ga0224712_10426978 3300022467 Unclassified 634
422 Ga0207653_10040743 3300025885 Unclassified 1523
423 Ga0207653_10085409 3300025885 Bacteria 1098
424 Ga0207692_10069317 3300025898 Bacteria 1852
425 Ga0207642_10495427 3300025899 Bacteria 747
426 Ga0207647_10544680 3300025904 Unclassified 644
427 Ga0207685_10004314 3300025905 Bacteria 3599
428 Ga0207685_10040005 3300025905 Bacteria 1744
429 Ga0207685_10305341 3300025905 Bacteria 789
430 Ga0207699_10113977 3300025906 Bacteria 1738
431 Ga0207699_10126905 3300025906 Bacteria 1658
432 Ga0207699_10213518 3300025906 Bacteria 1313
433 Ga0207699_10244174 3300025906 Bacteria 1235
434 Ga0207699_10514380 3300025906 Bacteria 865
435 Ga0207705_10254051 3300025909 Bacteria 1341
436 Ga0207705_10373979 3300025909 Bacteria 1100
437 Ga0207684_10118812 3300025910 Bacteria 2266
438 Ga0207684_10344774 3300025910 Bacteria 1283
439 Ga0207684_10445018 3300025910 Bacteria 1113
440 Ga0207684_11309656 3300025910 Bacteria 596
441 Ga0207707_10002240 3300025912 Bacteria 17485
442 Ga0207707_10007327 3300025912 Bacteria 9610
443 Ga0207707_10052433 3300025912 Bacteria 3552
444 Ga0207707_10086931 3300025912 Unclassified 2732
445 Ga0207707_10166580 3300025912 Bacteria 1926
446 Ga0207707_10177157 3300025912 Bacteria 1862
447 Ga0207707_10747028 3300025912 Unclassified 818
448 Ga0207707_10747474 3300025912 Bacteria 818
449 Ga0207695_10374530 3300025913 Bacteria 1310
450 Ga0207695_10516075 3300025913 Bacteria 1077
451 Ga0207695_10775729 3300025913 Unclassified 839
452 Ga0207695_11062905 3300025913 Unclassified 689
453 Ga0207671_10165105 3300025914 Bacteria 1716
454 Ga0207693_10001413 3300025915 Bacteria 21296
455 Ga0207693_10003121 3300025915 Bacteria 14264
456 Ga0207693_10013285 3300025915 Bacteria 6644
457 Ga0207693_10013689 3300025915 Bacteria 6535
458 Ga0207693_10017496 3300025915 Bacteria 5716
459 Ga0207693_10114733 3300025915 Bacteria 2114
460 Ga0207693_10133422 3300025915 Bacteria 1952
461 Ga0207693_10136163 3300025915 Bacteria 1931
462 Ga0207693_10255588 3300025915 Bacteria 1374
463 Ga0207693_10807937 3300025915 Unclassified 723
464 Ga0207663_10011530 3300025916 Bacteria 4748
465 Ga0207663_10153012 3300025916 Unclassified 1620
466 Ga0207663_10154712 3300025916 Bacteria 1612
467 Ga0207663_10164858 3300025916 Bacteria 1568
468 Ga0207663_10193643 3300025916 Bacteria 1461
469 Ga0207663_11293934 3300025916 Bacteria 587
470 Ga0207660_10025605 3300025917 Bacteria 4007
471 Ga0207660_10083463 3300025917 Bacteria 2353
472 Ga0207660_10143095 3300025917 Bacteria 1830
473 Ga0207660_10188300 3300025917 Bacteria 1606
474 Ga0207660_10230151 3300025917 Bacteria 1457
475 Ga0207660_10403758 3300025917 Bacteria 1101
476 Ga0207660_10677481 3300025917 Bacteria 841
477 Ga0207662_10195978 3300025918 Bacteria 1305
478 Ga0207657_10004596 3300025919 Bacteria 14587
479 Ga0207657_10007905 3300025919 Bacteria 10847
480 Ga0207657_10063649 3300025919 Bacteria 3152
481 Ga0207657_10066420 3300025919 Bacteria 3070
482 Ga0207657_10170731 3300025919 Bacteria 1762
483 Ga0207649_10135445 3300025920 Bacteria 1679
484 Ga0207649_10469451 3300025920 Bacteria 953
485 Ga0207649_10889868 3300025920 Unclassified 698
486 Ga0207649_10930468 3300025920 Bacteria 682
487 Ga0207652_10050250 3300025921 Bacteria 3572
488 Ga0207652_10060178 3300025921 Bacteria 3276
489 Ga0207652_10347002 3300025921 Bacteria 1340
490 Ga0207652_10983054 3300025921 Bacteria 742
491 Ga0207646_10023032 3300025922 Bacteria 5727
492 Ga0207646_10024884 3300025922 Bacteria 5479
493 Ga0207646_10127417 3300025922 Bacteria 2289
494 Ga0207646_10184044 3300025922 Bacteria 1887
495 Ga0207646_10227292 3300025922 Bacteria 1686
496 Ga0207646_10526807 3300025922 Bacteria 1064
497 Ga0207646_10819776 3300025922 Bacteria 828
498 Ga0207646_11208232 3300025922 Bacteria 663
499 Ga0207681_10440473 3300025923 Bacteria 1059
500 Ga0207659_10156308 3300025926 Bacteria 1786
501 Ga0207687_10005471 3300025927 Bacteria 8397
502 Ga0207687_10034631 3300025927 Bacteria 3429
503 Ga0207687_10036457 3300025927 Bacteria 3351
504 Ga0207687_10267586 3300025927 Bacteria 1365
505 Ga0207687_10505797 3300025927 Bacteria 1009
506 Ga0207700_10000004 3300025928 Bacteria 443409
507 Ga0207700_10163551 3300025928 Bacteria 1850
508 Ga0207700_10168395 3300025928 Bacteria 1825
509 Ga0207700_10262180 3300025928 Bacteria 1480
510 Ga0207700_10340745 3300025928 Bacteria 1303
511 Ga0207664_10034516 3300025929 Unclassified 3896
512 Ga0207664_10078694 3300025929 Bacteria 2674
513 Ga0207664_10154879 3300025929 Bacteria 1950
514 Ga0207664_10240571 3300025929 Bacteria 1576
515 Ga0207664_10255563 3300025929 Bacteria 1531
516 Ga0207664_10257255 3300025929 Bacteria 1526
517 Ga0207664_10268057 3300025929 Bacteria 1495
518 Ga0207664_10292632 3300025929 Bacteria 1431
519 Ga0207664_10632595 3300025929 Bacteria 961
520 Ga0207664_10758076 3300025929 Bacteria 873
521 Ga0207664_11270685 3300025929 Bacteria 655
522 Ga0207644_10464614 3300025931 Bacteria 1041
523 Ga0207644_11564444 3300025931 Bacteria 553
524 Ga0207690_10083851 3300025932 Bacteria 2233
525 Ga0207690_10252101 3300025932 Bacteria 1364
526 Ga0207706_10033829 3300025933 Bacteria 4549
527 Ga0207706_10134566 3300025933 Bacteria 2174
528 Ga0207706_10177781 3300025933 Bacteria 1869
529 Ga0207686_10020098 3300025934 Bacteria 3810
530 Ga0207686_10276017 3300025934 Bacteria 1239
531 Ga0207686_10474743 3300025934 Bacteria 966
532 Ga0207709_10020706 3300025935 Bacteria 3714
533 Ga0207709_10164136 3300025935 Bacteria 1552
534 Ga0207709_10346551 3300025935 Bacteria 1120
535 Ga0207709_10617949 3300025935 Unclassified 860
536 Ga0207709_10793775 3300025935 Bacteria 764
537 Ga0207709_11217769 3300025935 Bacteria 621
538 Ga0207669_10085042 3300025937 Bacteria 2041
539 Ga0207669_10389140 3300025937 Unclassified 1089
540 Ga0207665_10016651 3300025939 Bacteria 4828
541 Ga0207665_10058834 3300025939 Bacteria 2599
542 Ga0207665_10287137 3300025939 Bacteria 1226
543 Ga0207665_10555025 3300025939 Bacteria 893
544 Ga0207691_10942219 3300025940 Unclassified 722
545 Ga0207711_10160899 3300025941 Bacteria 2032
546 Ga0207711_11331653 3300025941 Bacteria 660
547 Ga0207661_10000267 3300025944 Bacteria 33777
548 Ga0207661_10023853 3300025944 Bacteria 4628
549 Ga0207661_10118816 3300025944 Bacteria 2248
550 Ga0207661_10151849 3300025944 Bacteria 2003
551 Ga0207661_10164965 3300025944 Bacteria 1924
552 Ga0207661_10629418 3300025944 Bacteria 986
553 Ga0207661_11023119 3300025944 Unclassified 761
554 Ga0207661_11085809 3300025944 Unclassified 737
555 Ga0207679_10129821 3300025945 Bacteria 2020
556 Ga0207679_10180148 3300025945 Bacteria 1747
557 Ga0207679_10585304 3300025945 Bacteria 1004
558 Ga0207667_10034152 3300025949 Bacteria 5464
559 Ga0207667_10199263 3300025949 Bacteria 2054
560 Ga0207667_10361565 3300025949 Bacteria 1480
561 Ga0207667_10567920 3300025949 Bacteria 1146
562 Ga0207651_10466537 3300025960 Bacteria 1086
563 Ga0207651_11432738 3300025960 Unclassified 622
564 Ga0207712_10250341 3300025961 Bacteria 1432
565 Ga0207668_10059047 3300025972 Bacteria 2685
566 Ga0207668_10136707 3300025972 Bacteria 1879
567 Ga0207668_11026282 3300025972 Unclassified 738
568 Ga0207640_10303974 3300025981 Bacteria 1263
569 Ga0207640_10514689 3300025981 Bacteria 999
570 Ga0207658_10771610 3300025986 Bacteria 872
571 Ga0207677_10099992 3300026023 Bacteria 2131
572 Ga0207677_10243874 3300026023 Bacteria 1455
573 Ga0207677_10280573 3300026023 Bacteria 1367
574 Ga0207677_10870810 3300026023 Bacteria 810
575 Ga0207677_10912224 3300026023 Bacteria 792
576 Ga0207677_11053573 3300026023 Bacteria 739
577 Ga0207639_10410316 3300026041 Bacteria 1222
578 Ga0207678_10181432 3300026067 Bacteria 1797
579 Ga0207678_10512200 3300026067 Bacteria 1047
580 Ga0207678_10615382 3300026067 Bacteria 953
581 Ga0207678_11068513 3300026067 Unclassified 715
582 Ga0207708_10043614 3300026075 Bacteria 3418
583 Ga0207708_10179395 3300026075 Bacteria 1681
584 Ga0207708_10325686 3300026075 Bacteria 1255
585 Ga0207708_10683329 3300026075 Unclassified 876
586 Ga0207702_10023561 3300026078 Bacteria 5106
587 Ga0207702_10112732 3300026078 Bacteria 2421
588 Ga0207702_10158677 3300026078 Bacteria 2064
589 Ga0207702_10273976 3300026078 Bacteria 1593
590 Ga0207702_10316545 3300026078 Bacteria 1485
591 Ga0207702_10344658 3300026078 Bacteria 1424
592 Ga0207702_10521171 3300026078 Bacteria 1160
593 Ga0207702_10775871 3300026078 Bacteria 947
594 Ga0207702_10849098 3300026078 Bacteria 904
595 Ga0207702_10960818 3300026078 Unclassified 847
596 Ga0207702_11545579 3300026078 Bacteria 657
597 Ga0207648_10141020 3300026089 Bacteria 2124
598 Ga0207648_10298118 3300026089 Bacteria 1445
599 Ga0207676_10107189 3300026095 Bacteria 2330
600 Ga0207674_10002797 3300026116 Bacteria 21726
601 Ga0207674_10123097 3300026116 Bacteria 2559
602 Ga0207674_10380690 3300026116 Unclassified 1364
603 Ga0207674_10545070 3300026116 Bacteria 1121
604 Ga0207675_100103035 3300026118 Bacteria 2689
605 Ga0207675_100125783 3300026118 Unclassified 2428
606 Ga0207675_100176725 3300026118 Bacteria 2043
607 Ga0207683_10015292 3300026121 Bacteria 6532
608 Ga0207683_10060043 3300026121 Bacteria 3341
609 Ga0207683_10249982 3300026121 Bacteria 1618
610 Ga0207683_10783881 3300026121 Bacteria 885
611 Ga0207698_10177255 3300026142 Bacteria 1884
612 Ga0207698_11415995 3300026142 Bacteria 710
613 Ga0207428_10005283 3300027907 Bacteria 12063
614 Ga0207428_10060435 3300027907 Unclassified 3003
615 Ga0207428_10066174 3300027907 Bacteria 2848
616 Ga0268265_10204197 3300028380 Bacteria 1717
617 Ga0268265_10570981 3300028380 Unclassified 1077
618 Ga0268265_10864491 3300028380 Bacteria 886
619 Ga0265337_1033484 3300028556 Bacteria 1516
620 Ga0265319_1000701 3300028563 Bacteria 21865
621 Ga0265319_1003960 3300028563 Bacteria 7519
622 Ga0265319_1011867 3300028563 Bacteria 3546
623 Ga0265334_10001490 3300028573 Bacteria 11295
624 Ga0265334_10017585 3300028573 Bacteria 2951
625 Ga0265334_10325638 3300028573 Bacteria 526
626 Ga0265318_10000400 3300028577 Bacteria 33867
627 Ga0265318_10006430 3300028577 Bacteria 5410
628 Ga0265318_10066769 3300028577 Bacteria 1336
629 Ga0265322_10007571 3300028654 Bacteria 3165
630 Ga0265336_10015536 3300028666 Bacteria 2501
631 Ga0265336_10022494 3300028666 Bacteria 2007
632 Ga0265338_10004790 3300028800 Bacteria 18080
633 Ga0265338_10007252 3300028800 Bacteria 13838
634 Ga0265324_10021766 3300029957 Bacteria 2297
635 Ga0265330_10001899 3300031235 Bacteria 11622
636 Ga0265330_10022449 3300031235 Bacteria 2871
637 Ga0265330_10205768 3300031235 Bacteria 832
638 Ga0265332_10003587 3300031238 Bacteria 7443
639 Ga0265332_10123366 3300031238 Bacteria 1088
640 Ga0265328_10004911 3300031239 Bacteria 5760
641 Ga0265328_10087007 3300031239 Bacteria 1154
642 Ga0265320_10016387 3300031240 Unclassified 4154
643 Ga0265320_10077209 3300031240 Bacteria 1559
644 Ga0265325_10004124 3300031241 Bacteria 9242
645 Ga0265325_10060946 3300031241 Bacteria 1915
646 Ga0265329_10004136 3300031242 Bacteria 6129
647 Ga0265340_10012992 3300031247 Bacteria 4386
648 Ga0265340_10062734 3300031247 Bacteria 1774
649 Ga0265339_10006743 3300031249 Bacteria 7497
650 Ga0265339_10018324 3300031249 Bacteria 4127
651 Ga0265339_10234252 3300031249 Bacteria 894
652 Ga0265331_10016699 3300031250 Unclassified 3846
653 Ga0265327_10011945 3300031251 Bacteria 5918
654 Ga0265327_10016620 3300031251 Bacteria 4662
655 Ga0265316_10009256 3300031344 Bacteria 9069
656 Ga0265316_10013876 3300031344 Bacteria 7129
657 Ga0265316_10047506 3300031344 Bacteria 3395
658 Ga0265316_10323392 3300031344 Bacteria 1120
659 Ga0265313_10011443 3300031595 Bacteria 5514
660 Ga0265313_10200340 3300031595 Bacteria 831
661 Ga0265314_10025003 3300031711 Bacteria 4514
662 Ga0265314_10114538 3300031711 Bacteria 1708
663 Ga0265342_10011944 3300031712 Bacteria 5902
664 Ga0265342_10096550 3300031712 Bacteria 1689
665 Ga0307406_10032550 3300031901 Bacteria 3184
666 Ga0307406_10333844 3300031901 Bacteria 1178
667 Ga0307409_100318484 3300031995 Unclassified 1454
668 Ga0307416_100094801 3300032002 Bacteria 2575
669 Ga0307416_100394910 3300032002 Bacteria 1418
670 Ga0307416_100805392 3300032002 Bacteria 1035
671 Ga0307411_10341940 3300032005 Bacteria 1216
672 Ga0307415_100082901 3300032126 Bacteria 2295
673 Ga0307415_100084225 3300032126 Bacteria 2281
674 Ga0307415_100114369 3300032126 Bacteria 2009
675 Ga0373948_0001030 3300034817 Bacteria 3751
676 Ga0373950_0001374 3300034818 Bacteria 3163
677 Ga0373959_0016523 3300034820 Bacteria 1368
678 Ga0373959_0194784 3300034820 Bacteria 533
679 Ga0373928_0009302 3300035084 Bacteria 1918
680 Ga0373928_0043252 3300035084 Bacteria 1042
681 Ga0373929_0174764 3300035085 Bacteria 589
682 Ga0373944_0006430 3300035089 Bacteria 3121
683 Ga0373949_0002456 3300035090 Bacteria 4758
684 Ga0373951_0010117 3300035091 Bacteria 2117
685 Ga0373932_0006861 3300035112 Bacteria 2704
686 Ga0373932_0102548 3300035112 Bacteria 933
687 Ga0373945_0013670 3300035116 Bacteria 2712
688 Ga0373953_0514112 3300035117 Bacteria 531
689 Ga0373960_0000659 3300035121 Bacteria 7106
690 Ga0373960_0082049 3300035121 Bacteria 1017
691 Ga0373960_0161335 3300035121 Unclassified 772
692 Ga0373943_0044893 3300035170 Bacteria 2152
693 Ga0373943_0090860 3300035170 Bacteria 1581
694 Ga0373946_0025050 3300035171 Bacteria 2344
695 Ga0373942_0033826 3300035207 Bacteria 1365
696 Ga0373942_0245166 3300035207 Bacteria 607
697 Ga0373961_0004945 3300035241 Bacteria 3202
698 Ga0373961_0022155 3300035241 Bacteria 1698
699 Ga0373962_0021984 3300035242 Bacteria 1687
700 Ga0373935_0059860 3300035692 Bacteria 2436
701 Ga0373935_0149648 3300035692 Bacteria 1583
702 Ga0373935_0337221 3300035692 Bacteria 1073
703 Ga0373927_0178107 3300035695 Bacteria 1394
704 Ga0373947_0008709 3300035725 Bacteria 5839
705 Ga0373925_0001380 3300037068 Bacteria 21135
706 Ga0373925_0258569 3300037068 Bacteria 1398
707 Ga0373925_1575372 3300037068 Bacteria 537
708 Ga0395899_0002522 3300037312 Bacteria 14832
709 Ga0395899_0002768 3300037312 Bacteria 14153
710 Ga0395899_0010024 3300037312 Bacteria 7265
711 Ga0395899_0029486 3300037312 Bacteria 4127
712 Ga0395899_0031542 3300037312 Bacteria 3982
713 Ga0395899_0066853 3300037312 Bacteria 2639
714 Ga0395899_0277901 3300037312 Bacteria 1140
715 Ga0395899_0301650 3300037312 Bacteria 1084
716 Ga0395899_0305049 3300037312 Unclassified 1076
717 Ga0395899_0352887 3300037312 Unclassified 983
718 Ga0395899_0515976 3300037312 Bacteria 773
719 Ga0395899_0918796 3300037312 Unclassified 533
720 Ga0395900_0004816 3300037418 Bacteria 14214
721 Ga0395900_0008116 3300037418 Bacteria 10810
722 Ga0395900_0013683 3300037418 Bacteria 8284
723 Ga0395900_0015373 3300037418 Bacteria 7801
724 Ga0395900_0015535 3300037418 Bacteria 7759
725 Ga0395900_0020954 3300037418 Bacteria 6681
726 Ga0395900_0026748 3300037418 Bacteria 5906
727 Ga0395900_0027465 3300037418 Bacteria 5830
728 Ga0395900_0046433 3300037418 Bacteria 4472
729 Ga0395900_0062783 3300037418 Bacteria 3818
730 Ga0395900_0100089 3300037418 Bacteria 2977
731 Ga0395900_0114957 3300037418 Bacteria 2762
732 Ga0395900_0172194 3300037418 Bacteria 2203
733 Ga0395900_0290128 3300037418 Bacteria 1625
734 Ga0395900_0351192 3300037418 Bacteria 1448
735 Ga0395900_0363073 3300037418 Bacteria 1419
736 Ga0395900_0430394 3300037418 Bacteria 1279
737 Ga0395900_0664599 3300037418 Bacteria 978
738 Ga0395900_0981838 3300037418 Bacteria 765
739 Ga0395900_1457410 3300037418 Unclassified 597
740 Ga0395900_1886758 3300037418 Bacteria 508
741 Ga0395898_0000635 3300037466 Bacteria 64060
742 Ga0395898_0004222 3300037466 Bacteria 15747
743 Ga0395898_0012120 3300037466 Bacteria 8924
744 Ga0395898_0013333 3300037466 Bacteria 8464
745 Ga0395898_0018206 3300037466 Bacteria 7165
746 Ga0395898_0019228 3300037466 Bacteria 6953
747 Ga0395898_0043451 3300037466 Bacteria 4428
748 Ga0395898_0058150 3300037466 Bacteria 3765
749 Ga0395898_0068002 3300037466 Bacteria 3448
750 Ga0395898_0070716 3300037466 Unclassified 3373
751 Ga0395898_0092297 3300037466 Bacteria 2912
752 Ga0395898_0093719 3300037466 Bacteria 2886
753 Ga0395898_0117809 3300037466 Bacteria 2544
754 Ga0395898_0167641 3300037466 Bacteria 2099
755 Ga0395898_0183903 3300037466 Bacteria 1997
756 Ga0395898_0277130 3300037466 Unclassified 1600
757 Ga0395898_0313132 3300037466 Bacteria 1497
758 Ga0395898_0350755 3300037466 Bacteria 1407
759 Ga0395898_0567589 3300037466 Bacteria 1077
760 Ga0395898_0757508 3300037466 Unclassified 912
761 Ga0395898_0764494 3300037466 Bacteria 907
762 Ga0395898_0829694 3300037466 Bacteria 864
763 Ga0395898_0936656 3300037466 Unclassified 804
764 Ga0395898_1328667 3300037466 Unclassified 648
765 Ga0395898_1481907 3300037466 Bacteria 605
766 Ga0395905_0006804 3300037471 Bacteria 11450
767 Ga0395905_0009799 3300037471 Bacteria 9339
768 Ga0395905_0024697 3300037471 Bacteria 5671
769 Ga0395905_0026941 3300037471 Bacteria 5420
770 Ga0395905_0032364 3300037471 Bacteria 4918
771 Ga0395905_0045678 3300037471 Bacteria 4108
772 Ga0395905_0046418 3300037471 Unclassified 4073
773 Ga0395905_0068297 3300037471 Bacteria 3329
774 Ga0395905_0102974 3300037471 Bacteria 2680
775 Ga0395905_0125458 3300037471 Bacteria 2414
776 Ga0395905_0274139 3300037471 Bacteria 1573
777 Ga0395905_0420491 3300037471 Bacteria 1232
778 Ga0395905_0687857 3300037471 Unclassified 925
779 Ga0395905_0740466 3300037471 Bacteria 885
780 Ga0395905_0812550 3300037471 Bacteria 838
781 Ga0395905_1010807 3300037471 Bacteria 735
782 Ga0395905_1129397 3300037471 Bacteria 687
783 Ga0395905_1134535 3300037471 Bacteria 685
784 Ga0395901_0002544 3300038443 Bacteria 18471
785 Ga0395901_0006552 3300038443 Bacteria 11777
786 Ga0395901_0008779 3300038443 Bacteria 10223
787 Ga0395901_0010232 3300038443 Bacteria 9503
788 Ga0395901_0014478 3300038443 Bacteria 8023
789 Ga0395901_0016360 3300038443 Bacteria 7552
790 Ga0395901_0016913 3300038443 Bacteria 7434
791 Ga0395901_0019082 3300038443 Bacteria 7011
792 Ga0395901_0058458 3300038443 Bacteria 4010
793 Ga0395901_0060988 3300038443 Bacteria 3925
794 Ga0395901_0066787 3300038443 Bacteria 3745
795 Ga0395901_0095980 3300038443 Bacteria 3107
796 Ga0395901_0117869 3300038443 Bacteria 2790
797 Ga0395901_0126868 3300038443 Bacteria 2681
798 Ga0395901_0142940 3300038443 Bacteria 2515
799 Ga0395901_0177673 3300038443 Bacteria 2232
800 Ga0395901_0212055 3300038443 Bacteria 2027
801 Ga0395901_0302082 3300038443 Bacteria 1659
802 Ga0395901_0369595 3300038443 Bacteria 1477
803 Ga0395901_0393199 3300038443 Bacteria 1425
804 Ga0395901_0395172 3300038443 Bacteria 1421
805 Ga0395901_0406680 3300038443 Bacteria 1398
806 Ga0395901_0778085 3300038443 Bacteria 948
807 Ga0395901_1327255 3300038443 Unclassified 680
808 Ga0395901_1750139 3300038443 Bacteria 572
809 Ga0395901_1778174 3300038443 Unclassified 566
810 Ga0242420_145225 3300038996 Bacteria 530
811 Ga0436365_0307627 3300039437 Bacteria 1372
812 Ga0439453_0028297 3300041408 Bacteria 1049
813 Ga0439453_0063875 3300041408 Bacteria 767
814 Ga0439466_0062803 3300041411 Bacteria 1193
815 Ga0451789_0339081 3300041443 Bacteria 1220
816 Ga0451789_1312427 3300041443 Unclassified 564
817 Ga0451793_0317672 3300041452 Bacteria 2087
818 Ga0451795_0027106 3300041456 Bacteria 2205
819 Ga0451798_0263104 3300041458 Bacteria 985
820 Ga0451800_1462570 3300041459 Bacteria 2210
821 Ga0451802_1524512 3300041460 Unclassified 2036
822 Ga0451802_2028705 3300041460 Unclassified 620
823 Ga0451804_0321035 3300041463 Unclassified 685
824 Ga0451807_0330186 3300041486 Bacteria 1790
825 Ga0451835_0161116 3300041492 Bacteria 1705
826 Ga0451835_0538146 3300041492 Unclassified 692
827 Ga0451839_0726782 3300041496 Bacteria 1063
828 Ga0451841_1061094 3300041498 Bacteria 1053
829 Ga0451845_0482713 3300041501 Bacteria 843
830 Ga0451845_0862811 3300041501 Unclassified 550
831 Ga0451847_0449104 3300041503 Bacteria 1318
832 Ga0451849_0691407 3300041505 Bacteria 1273
833 Ga0451849_0945287 3300041505 Bacteria 1681
834 Ga0451851_0768897 3300041507 Unclassified 917
835 Ga0451851_0904337 3300041507 Bacteria 1000
836 Ga0451855_1065849 3300041511 Bacteria 1184
837 Ga0451853_0167061 3300041512 Unclassified 1901
838 Ga0451853_0460319 3300041512 Bacteria 5875
839 Ga0451853_0801509 3300041512 Bacteria 1734
840 Ga0439448_0015925 3300042005 Bacteria 2283
841 Ga0439448_0232723 3300042005 Bacteria 649
842 Ga0439455_0007025 3300042012 Bacteria 2366
843 Ga0439455_0109878 3300042012 Bacteria 766
844 Ga0439463_063743 3300042016 Bacteria 942
845 Ga0439458_0090197 3300042157 Bacteria 788
846 Ga0439458_0149503 3300042157 Bacteria 625
847 Ga0450916_021282 3300042530 Bacteria 892
848 Ga0466965_0082223 3300044683 Unclassified 1629
849 Ga0466966_0046003 3300044684 Bacteria 2788
850 Ga0466966_0256009 3300044684 Bacteria 1054
851 Ga0466966_0631076 3300044684 Bacteria 645
852 Ga0466961_0097942 3300044693 Bacteria 1849
853 Ga0466963_0002756 3300044694 Bacteria 9910
854 Ga0466963_0072458 3300044694 Bacteria 2321
855 Ga0466963_0133691 3300044694 Bacteria 1715
856 Ga0466963_0249010 3300044694 Bacteria 1247
857 Ga0466963_0346030 3300044694 Bacteria 1047
858 Ga0466963_0461383 3300044694 Bacteria 896
859 Ga0466963_0577936 3300044694 Bacteria 794
860 Ga0466963_0808718 3300044694 Bacteria 661
861 Ga0466963_1280354 3300044694 Bacteria 515
862 Ga0466964_0002141 3300044706 Bacteria 6966
863 Ga0466964_0008934 3300044706 Bacteria 3769
864 Ga0466964_0287689 3300044706 Bacteria 824
865 Ga0466971_0025187 3300044719 Bacteria 2657
866 Ga0466971_0045201 3300044719 Bacteria 1978
867 Ga0466971_0306612 3300044719 Bacteria 763
868 Ga0466968_0060322 3300044735 Bacteria 1635
869 Ga0466957_0236711 3300044842 Bacteria 1210
870 Ga0466957_0768038 3300044842 Unclassified 683
871 Ga0466960_0031717 3300044901 Bacteria 2440
872 Ga0466960_0059978 3300044901 Bacteria 1863
873 Ga0466960_0309132 3300044901 Bacteria 893
874 Ga0466959_0012573 3300045049 Bacteria 6121
875 Ga0466959_0879196 3300045049 Unclassified 598
876 Ga0451576_0013374 3300045051 Bacteria 9184
877 Ga0451576_1141280 3300045051 Unclassified 815
878 Ga0466958_0031410 3300045836 Bacteria 3156
879 Ga0466958_0073966 3300045836 Bacteria 2088
880 Ga0466958_0107860 3300045836 Bacteria 1737
881 Ga0466958_0203590 3300045836 Bacteria 1260
882 Ga0466958_0359906 3300045836 Bacteria 937
883 Ga0466958_0575394 3300045836 Bacteria 732
884 Ga0466967_0002982 3300045976 Bacteria 10836
885 Ga0466967_0051946 3300045976 Bacteria 3595
886 Ga0466967_0068765 3300045976 Bacteria 3163
887 Ga0466967_0131822 3300045976 Bacteria 2321
888 Ga0466967_0159179 3300045976 Bacteria 2118
889 Ga0466967_0164778 3300045976 Bacteria 2082
890 Ga0466967_0231230 3300045976 Bacteria 1760
891 Ga0466967_0231462 3300045976 Bacteria 1760
892 Ga0466967_0355525 3300045976 Bacteria 1418
893 Ga0466967_0823387 3300045976 Bacteria 922
894 Ga0466967_1065500 3300045976 Bacteria 805
895 Ga0466967_1187418 3300045976 Bacteria 760
896 Ga0466967_1224003 3300045976 Bacteria 748
897 Ga0495592_0526773 3300046454 Bacteria 730
898 Ga0495603_0066776 3300046455 Bacteria 2118
899 Ga0495629_0079911 3300046459 Bacteria 2283
900 Ga0495629_0169606 3300046459 Bacteria 1515
901 Ga0495641_0001074 3300046461 Bacteria 23533
902 Ga0495641_0077242 3300046461 Bacteria 1493
903 Ga0495641_0122736 3300046461 Bacteria 1159
904 Ga0495641_0147684 3300046461 Bacteria 1050
905 Ga0495651_0379822 3300046462 Bacteria 927
906 Ga0495651_0526482 3300046462 Bacteria 754
907 Ga0495653_0075281 3300046463 Bacteria 2513
908 Ga0495653_0149157 3300046463 Bacteria 1636
909 Ga0495580_0050268 3300046472 Bacteria 2948
910 Ga0495582_0025909 3300046473 Bacteria 3213
911 Ga0495582_0065275 3300046473 Bacteria 2011
912 Ga0495605_0343545 3300046474 Unclassified 627
913 Ga0495639_0149702 3300046475 Bacteria 1125
914 Ga0495664_0451082 3300046477 Bacteria 770
915 Ga0495664_0493925 3300046477 Bacteria 731
916 Ga0495584_0055679 3300046491 Bacteria 1990
917 Ga0495585_0230235 3300046492 Bacteria 932
918 Ga0495594_0002224 3300046499 Bacteria 10090
919 Ga0495594_0463034 3300046499 Bacteria 721
920 Ga0495596_0214632 3300046500 Unclassified 747
921 Ga0495596_0221112 3300046500 Unclassified 736
922 Ga0495607_0132391 3300046501 Bacteria 1296
923 Ga0495607_0155424 3300046501 Bacteria 1167
924 Ga0495607_0510900 3300046501 Bacteria 532
925 Ga0495608_0656559 3300046511 Bacteria 626
926 Ga0495618_0207417 3300046514 Bacteria 1239
927 Ga0495618_0663682 3300046514 Unclassified 616
928 Ga0495630_0144463 3300046517 Bacteria 1809
929 Ga0495630_0236754 3300046517 Bacteria 1395
930 Ga0495630_0346218 3300046517 Bacteria 1137
931 Ga0495631_0167572 3300046518 Bacteria 942
932 Ga0495637_0169922 3300046520 Bacteria 814
933 Ga0495644_0032720 3300046523 Bacteria 1965
934 Ga0495644_0157154 3300046523 Unclassified 871
935 Ga0495644_0253258 3300046523 Bacteria 684
936 Ga0495663_0152700 3300046525 Unclassified 789
937 Ga0495663_0338114 3300046525 Bacteria 547
938 Ga0495666_0034432 3300046526 Bacteria 2472
939 Ga0495642_0121695 3300046528 Unclassified 1120
940 Ga0495642_0298542 3300046528 Unclassified 706
941 Ga0495665_0070197 3300046531 Bacteria 1846
942 Ga0495640_0482123 3300046533 Bacteria 756
943 Ga0495640_0522499 3300046533 Bacteria 721
944 Ga0495598_0061117 3300046537 Bacteria 1163
945 Ga0495609_0206439 3300046538 Bacteria 820
946 Ga0495609_0258174 3300046538 Unclassified 716
947 Ga0495645_0536073 3300046543 Bacteria 727
948 Ga0495667_0065362 3300046559 Bacteria 2379
949 Ga0495656_0024935 3300046615 Bacteria 2367
950 Ga0495656_0044402 3300046615 Bacteria 1871
951 Ga0495656_0303518 3300046615 Bacteria 819
952 Ga0495656_0387114 3300046615 Unclassified 730
953 Ga0495668_0562155 3300046616 Bacteria 630
954 Ga0495668_0804061 3300046616 Unclassified 521
955 Ga0495634_0465866 3300046642 Bacteria 744
956 Ga0495611_0131629 3300046648 Unclassified 1167
957 Ga0495635_0547324 3300046663 Bacteria 759
958 Ga0495659_0194215 3300046664 Unclassified 830
959 Ga0495588_0000390 3300046674 Bacteria 24919
960 Ga0495588_0196323 3300046674 Unclassified 1066
961 Ga0495657_0068189 3300046675 Bacteria 2332
962 Ga0495657_0315612 3300046675 Bacteria 930
963 Ga0495599_0546378 3300046678 Bacteria 679
964 Ga0495647_0216042 3300046681 Bacteria 845
965 Ga0495658_0262499 3300046683 Bacteria 1087
966 Ga0495658_0423071 3300046683 Bacteria 850
967 Ga0495669_0607960 3300046684 Bacteria 532
968 Ga0495613_0065200 3300046689 Bacteria 2662
969 Ga0495613_0099395 3300046689 Bacteria 2102
970 Ga0495670_0323987 3300046691 Unclassified 827
971 Ga0495670_0832544 3300046691 Unclassified 504
972 Ga0495589_0381721 3300046794 Bacteria 648
973 Ga0495600_0043700 3300046809 Bacteria 2922
974 Ga0495600_0218419 3300046809 Bacteria 1220
975 Ga0495660_0115494 3300046810 Bacteria 1365
976 Ga0495581_0019596 3300047315 Bacteria 3926
977 Ga0495581_0095755 3300047315 Bacteria 1724
978 Ga0495636_0060526 3300047318 Bacteria 1600
979 Ga0495674_0469515 3300047319 Bacteria 1009
980 Ga0495676_0000419 3300047321 Bacteria 34533
981 Ga0495676_0039368 3300047321 Bacteria 3915
982 Ga0495676_0051089 3300047321 Bacteria 3310
983 Ga0495676_0346794 3300047321 Unclassified 993
984 Ga0495676_0748915 3300047321 Unclassified 631
985 Ga0495680_0152718 3300047322 Bacteria 1682
986 Ga0495680_0407119 3300047322 Unclassified 938
987 Ga0495677_0225389 3300047445 Bacteria 731
988 Ga0495679_051780 3300047446 Unclassified 1230
989 Ga0495685_213922 3300047447 Bacteria 616
990 Ga0495684_0600936 3300047471 Unclassified 742
991 Ga0495614_0422813 3300048089 Bacteria 628
992 Ga0495615_0061153 3300048090 Bacteria 994
993 Ga0496100_0062123 3300048903 Bacteria 2464
994 Ga0496100_0099904 3300048903 Bacteria 1997
995 Ga0496100_0222547 3300048903 Bacteria 1386
996 Ga0496100_0490643 3300048903 Bacteria 945
997 Ga0496100_0729353 3300048903 Bacteria 774
998 Ga0496101_0006797 3300048904 Bacteria 7377
999 Ga0496101_0057373 3300048904 Bacteria 2816
1000 Ga0496101_0353852 3300048904 Bacteria 1154
1001 Ga0496101_0403928 3300048904 Bacteria 1076
1002 Ga0496101_0624119 3300048904 Bacteria 852
1003 Ga0496101_0648102 3300048904 Bacteria 834
1004 Ga0496102_0021405 3300048905 Bacteria 5718
1005 Ga0496102_0097220 3300048905 Bacteria 2731
1006 Ga0496102_0158310 3300048905 Bacteria 2129
1007 Ga0496102_0187258 3300048905 Bacteria 1951
1008 Ga0496102_0270804 3300048905 Bacteria 1601
1009 Ga0496102_1361634 3300048905 Unclassified 629
1010 Ga0496103_0004888 3300048906 Bacteria 8090
1011 Ga0496103_0009732 3300048906 Bacteria 5691
1012 Ga0496103_0035474 3300048906 Bacteria 3053
1013 Ga0496103_0044941 3300048906 Bacteria 2724
1014 Ga0496103_0119414 3300048906 Bacteria 1679
1015 Ga0496103_0150713 3300048906 Bacteria 1490
1016 Ga0496103_0213230 3300048906 Bacteria 1242
1017 Ga0496104_0000407 3300048907 Bacteria 37689
1018 Ga0496104_0002003 3300048907 Bacteria 17677
1019 Ga0496104_0002189 3300048907 Bacteria 16918
1020 Ga0496104_0061377 3300048907 Bacteria 3564
1021 Ga0496104_0389930 3300048907 Bacteria 1305
1022 Ga0496104_0489064 3300048907 Bacteria 1142
1023 Ga0496104_0830134 3300048907 Bacteria 830
1024 Ga0496104_0967613 3300048907 Unclassified 755
1025 Ga0496104_1767110 3300048907 Unclassified 521
1026 Ga0496105_0003606 3300048908 Bacteria 11495
1027 Ga0496105_0153981 3300048908 Bacteria 1888
1028 Ga0496105_0231013 3300048908 Bacteria 1503
1029 Ga0496105_0281950 3300048908 Bacteria 1339
1030 Ga0496105_0452005 3300048908 Bacteria 1014
1031 Ga0496105_0611523 3300048908 Bacteria 845
1032 Ga0496106_0022850 3300048909 Bacteria 4645
1033 Ga0496106_0043319 3300048909 Bacteria 3377
1034 Ga0496106_0044607 3300048909 Unclassified 3328
1035 Ga0496106_0174881 3300048909 Bacteria 1703
1036 Ga0496106_0300865 3300048909 Bacteria 1286
1037 Ga0496106_0743770 3300048909 Bacteria 780
1038 Ga0496107_0017059 3300048910 Bacteria 5105
1039 Ga0496107_0044202 3300048910 Bacteria 3202
1040 Ga0496107_0069024 3300048910 Bacteria 2565
1041 Ga0496107_0357669 3300048910 Bacteria 1086
1042 Ga0496107_0535351 3300048910 Bacteria 868
1043 Ga0496107_0716969 3300048910 Bacteria 735
1044 Ga0496108_0005212 3300048911 Bacteria 10498
1045 Ga0496108_0122629 3300048911 Bacteria 2230
1046 Ga0496108_0134632 3300048911 Bacteria 2125
1047 Ga0496108_0207670 3300048911 Bacteria 1700
1048 Ga0496108_0220141 3300048911 Bacteria 1649
1049 Ga0496108_0908223 3300048911 Bacteria 756
1050 Ga0496109_0002745 3300048912 Bacteria 14769
1051 Ga0496109_0004241 3300048912 Bacteria 11970
1052 Ga0496109_0015213 3300048912 Bacteria 6698
1053 Ga0496109_0047176 3300048912 Bacteria 3916
1054 Ga0496109_0079090 3300048912 Bacteria 3028
1055 Ga0496109_0090059 3300048912 Bacteria 2837
1056 Ga0496109_0194256 3300048912 Bacteria 1907
1057 Ga0496109_0207893 3300048912 Bacteria 1840
1058 Ga0496109_0271841 3300048912 Bacteria 1597
1059 Ga0496109_0706730 3300048912 Bacteria 945
1060 Ga0496109_0718984 3300048912 Bacteria 936
1061 Ga0496109_0852572 3300048912 Bacteria 849
1062 Ga0496109_1202745 3300048912 Unclassified 694
1063 Ga0496109_1519541 3300048912 Bacteria 604
1064 Ga0496109_1595495 3300048912 Unclassified 587
1065 Ga0496109_1784227 3300048912 Bacteria 548
1066 Ga0496109_1810066 3300048912 Unclassified 544
1067 Ga0496110_0000628 3300048913 Bacteria 24128
1068 Ga0496110_0002493 3300048913 Bacteria 13811
1069 Ga0496110_0014421 3300048913 Bacteria 6561
1070 Ga0496110_0028794 3300048913 Bacteria 4774
1071 Ga0496110_0090381 3300048913 Bacteria 2738
1072 Ga0496110_0163802 3300048913 Unclassified 2016
1073 Ga0496110_0180210 3300048913 Bacteria 1918
1074 Ga0496110_0341840 3300048913 Bacteria 1363
1075 Ga0496110_0408017 3300048913 Bacteria 1239
1076 Ga0496110_0479556 3300048913 Bacteria 1133
1077 Ga0496110_0760680 3300048913 Bacteria 872
1078 Ga0496111_0002892 3300048914 Bacteria 10484
1079 Ga0496111_0003525 3300048914 Bacteria 9681
1080 Ga0496111_0024101 3300048914 Bacteria 4280
1081 Ga0496111_0025685 3300048914 Bacteria 4156
1082 Ga0496111_0045172 3300048914 Bacteria 3169
1083 Ga0496111_0131354 3300048914 Bacteria 1853
1084 Ga0496111_0369790 3300048914 Unclassified 1061
1085 Ga0496111_0532908 3300048914 Bacteria 863
1086 Ga0496111_0658484 3300048914 Unclassified 764
1087 Ga0496111_0689981 3300048914 Bacteria 743
1088 Ga0496111_0795438 3300048914 Bacteria 685
1089 Ga0496112_0002231 3300048915 Bacteria 15467
1090 Ga0496112_0004088 3300048915 Bacteria 12255
1091 Ga0496112_0016721 3300048915 Bacteria 6878
1092 Ga0496112_0019773 3300048915 Bacteria 6367
1093 Ga0496112_0047973 3300048915 Bacteria 4189
1094 Ga0496112_0203607 3300048915 Bacteria 1938
1095 Ga0496112_0284351 3300048915 Bacteria 1600
1096 Ga0496112_0539759 3300048915 Bacteria 1100
1097 Ga0496112_0581257 3300048915 Unclassified 1053
1098 Ga0496112_0625357 3300048915 Unclassified 1007
1099 Ga0496112_0707761 3300048915 Bacteria 935
1100 Ga0496112_0905620 3300048915 Bacteria 804
1101 Ga0496112_1918524 3300048915 Unclassified 504
1102 Ga0496113_0035059 3300048916 Bacteria 3666
1103 Ga0496113_0103248 3300048916 Bacteria 2211
1104 Ga0496113_0120026 3300048916 Bacteria 2054
1105 Ga0496113_0120386 3300048916 Bacteria 2051
1106 Ga0496113_1026541 3300048916 Bacteria 649
1107 Ga0496114_0002506 3300048917 Bacteria 14021
1108 Ga0496114_0002854 3300048917 Bacteria 13246
1109 Ga0496114_0039143 3300048917 Bacteria 3923
1110 Ga0496114_0053819 3300048917 Bacteria 3355
1111 Ga0496114_0123461 3300048917 Bacteria 2229
1112 Ga0496114_0225050 3300048917 Bacteria 1647
1113 Ga0496114_0297247 3300048917 Bacteria 1425
1114 Ga0496114_1491785 3300048917 Bacteria 564
1115 Ga0501031_0903874 3300049568 Bacteria 565
1116 Ga0501034_0009184 3300049571 Bacteria 10373
1117 Ga0501036_0640608 3300049572 Bacteria 880
1118 Ga0501039_0137895 3300049575 Bacteria 1916
1119 Ga0501040_0366469 3300049576 Unclassified 1033
1120 Ga0501040_0446171 3300049576 Bacteria 931
1121 Ga0501040_0526411 3300049576 Unclassified 853
1122 Ga0501041_0118470 3300049577 Bacteria 1644
1123 Ga0501042_0001033 3300049578 Bacteria 15872
1124 Ga0501043_0014874 3300049579 Bacteria 6091
1125 Ga0501043_0636164 3300049579 Bacteria 785
1126 Ga0501047_0106545 3300049581 Bacteria 2684
1127 Ga0501048_0004658 3300049582 Bacteria 10438
1128 Ga0501048_0519772 3300049582 Bacteria 854
1129 Ga0501048_1039227 3300049582 Unclassified 589
1130 Ga0501067_0002416 3300049583 Bacteria 10320
1131 Ga0501067_0031798 3300049583 Bacteria 2928
1132 Ga0501067_0087271 3300049583 Bacteria 1731
1133 Ga0501067_0724965 3300049583 Bacteria 559
1134 Ga0501068_0013558 3300049584 Bacteria 4640
1135 Ga0501069_0001655 3300049585 Bacteria 11073
1136 Ga0501069_0210633 3300049585 Bacteria 1128
1137 Ga0501069_0404621 3300049585 Bacteria 808
1138 Ga0501069_0468963 3300049585 Bacteria 749
1139 Ga0501069_0684328 3300049585 Unclassified 618
1140 Ga0501070_0013996 3300049586 Bacteria 6753
1141 Ga0501070_0079576 3300049586 Bacteria 2712
1142 Ga0501070_0307423 3300049586 Bacteria 1291
1143 Ga0501071_0741910 3300049587 Unclassified 756
1144 Ga0501071_0824240 3300049587 Bacteria 715
1145 Ga0501072_0011327 3300049588 Bacteria 6814
1146 Ga0501072_0093455 3300049588 Bacteria 2389
1147 Ga0501073_0074391 3300049589 Bacteria 2365
1148 Ga0501074_0122081 3300049590 Bacteria 1863
1149 Ga0501074_0344050 3300049590 Bacteria 1058
1150 Ga0501074_0560556 3300049590 Unclassified 809
1151 Ga0501075_0133739 3300049591 Bacteria 1889
1152 Ga0501075_0701641 3300049591 Unclassified 771
1153 Ga0501076_0148379 3300049592 Bacteria 1907
1154 Ga0501076_0861812 3300049592 Unclassified 747
1155 Ga0501077_0065470 3300049593 Unclassified 2304
1156 Ga0501079_0056730 3300049741 Bacteria 3022
1157 Ga0501079_0200471 3300049741 Bacteria 1559
1158 Ga0501079_0451488 3300049741 Bacteria 1010
1159 Ga0501079_0647692 3300049741 Unclassified 832
1160 Ga0501080_0052034 3300049742 Bacteria 3811
1161 Ga0501080_0216787 3300049742 Bacteria 1752
1162 Ga0501083_0004863 3300049744 Bacteria 9498
1163 Ga0501035_0063637 3300049822 Unclassified 3280
1164 Ga0501044_0253934 3300049823 Unclassified 1698
1165 Ga0501045_0152924 3300049824 Bacteria 1717
1166 Ga0501045_0666262 3300049824 Bacteria 769
1167 nmdc:mga05p37_163020_c1 3300050507 Bacteria 2722
1168 nmdc:mga05p37_182865_c1 3300050507 Bacteria 2550
1169 nmdc:mga05p37_307721_c2 3300050507 Bacteria 1413
1170 nmdc:mga05p37_41140_c1 3300050507 Bacteria 5675
1171 nmdc:mga05p37_47682_c1 3300050507 Bacteria 5268
1172 nmdc:mga05p37_585963_c1 3300050507 Unclassified 1262
1173 nmdc:mga06r32_114013_c1 3300050510 Unclassified 2661
1174 nmdc:mga06r32_147876_c1 3300050510 Bacteria 2327
1175 nmdc:mga06r32_179801_c1 3300050510 Bacteria 2100
1176 nmdc:mga06r32_572977_c1 3300050510 Bacteria 1101
1177 nmdc:mga06r32_806662_c1 3300050510 Unclassified 899
1178 nmdc:mga06r32_914519_c1 3300050510 Bacteria 833
1179 nmdc:mga08y16_115402_c1 3300050511 Unclassified 2796
1180 nmdc:mga08y16_188725_c1 3300050511 Bacteria 2138
1181 nmdc:mga08y16_28005_c1 3300050511 Bacteria 5941
1182 nmdc:mga08y16_375609_c1 3300050511 Bacteria 1457
1183 nmdc:mga08y16_534799_c1 3300050511 Bacteria 1187
1184 nmdc:mga08y16_788766_c1 3300050511 Bacteria 944
1185 nmdc:mga0n895_281331_c1 3300050512 Bacteria 1687
1186 nmdc:mga0n895_283975_c1 3300050512 Bacteria 1678
1187 nmdc:mga0n895_317239_c1 3300050512 Unclassified 1580
1188 nmdc:mga0n895_323214_c1 3300050512 Bacteria 1564
1189 nmdc:mga0n895_71102_c1 3300050512 Bacteria 3450
1190 nmdc:mga0n895_78268_c1 3300050512 Unclassified 3291
1191 nmdc:mga0n895_849394_c1 3300050512 Bacteria 901
1192 nmdc:mga0rr50_204575_c1 3300050513 Bacteria 1624
1193 nmdc:mga0rr50_268411_c1 3300050513 Bacteria 1421
1194 nmdc:mga0rr50_30069_c1 3300050513 Bacteria 3841
1195 nmdc:mga0rr50_635395_c1 3300050513 Bacteria 911
1196 nmdc:mga0rr50_669481_c1 3300050513 Bacteria 886
1197 nmdc:mga0rr50_773192_c1 3300050513 Bacteria 820
1198 nmdc:mga0rr50_78138_c1 3300050513 Unclassified 2546
1199 nmdc:mga0rr50_78220_c1 3300050513 Bacteria 2545
1200 nmdc:mga0rr50_946401_c1 3300050513 Bacteria 734
1201 nmdc:mga08x19_160527_c2 3300050514 Bacteria 1153
1202 nmdc:mga08x19_197983_c1 3300050514 Bacteria 1376
1203 nmdc:mga08x19_236981_c1 3300050514 Bacteria 1257
1204 nmdc:mga08x19_278988_c1 3300050514 Bacteria 1158
1205 nmdc:mga08x19_44260_c1 3300050514 Bacteria 2842
1206 nmdc:mga0a205_13455_c1 3300050515 Bacteria 7619
1207 nmdc:mga0a205_193150_c1 3300050515 Bacteria 1927
1208 nmdc:mga0a205_200979_c1 3300050515 Bacteria 1883
1209 nmdc:mga0a205_393207_c1 3300050515 Bacteria 1250
1210 nmdc:mga0a205_55411_c1 3300050515 Bacteria 3829
1211 nmdc:mga0a205_62734_c1 3300050515 Bacteria 3591
1212 nmdc:mga0a205_74755_c1 3300050515 Bacteria 3274
1213 nmdc:mga0a205_80222_c1 3300050515 Unclassified 3154
1214 Ga0495601_0140954 3300053077 Bacteria 1572
1215 Ga0495601_0637846 3300053077 Bacteria 682
1216 Ga0495655_0044935 3300053083 Bacteria 1145
1217 Ga0495655_0123376 3300053083 Unclassified 791
1218 Ga0495595_0173923 3300053084 Bacteria 1066
1219 Ga0495595_0267750 3300053084 Bacteria 857
1220 Ga0495595_0429290 3300053084 Unclassified 671
1221 Ga0495619_0128266 3300053085 Unclassified 1742
1222 Ga0495619_0293910 3300053085 Bacteria 1125
1223 Ga0495619_0470526 3300053085 Unclassified 866
1224 Ga0500641_0069612 3300053096 Unclassified 1479
1225 Ga0501084_0294861 3300054114 Bacteria 1370
1226 Ga0501084_0388932 3300054114 Bacteria 1178
1227 Ga0501084_0424147 3300054114 Bacteria 1124
1228 Ga0501084_0779266 3300054114 Bacteria 806
1229 Ga0501082_0066191 3300060353 Unclassified 3111
1230 Ga0501082_0092113 3300060353 Unclassified 2618
1231 Ga0501082_0593359 3300060353 Bacteria 969
1232 Ga0466962_0039991 3300061719 Bacteria 2245
1233 Ga0466962_0227466 3300061719 Bacteria 914
1234 Ga0466962_0266435 3300061719 Unclassified 844
1235 Ga0466962_0306074 3300061719 Bacteria 787
1236 Ga0466962_0481123 3300061719 Bacteria 627
1237 Ga0466962_0617109 3300061719 Unclassified 553
1238 Ga0530510_0015329 3300061734 Bacteria 5415
1239 Ga0530510_0137253 3300061734 Bacteria 1801
1240 Ga0530510_0489699 3300061734 Unclassified 932
1241 Ga0530510_0602163 3300061734 Bacteria 836
1242 Ga0530510_0812387 3300061734 Bacteria 714
1243 Ga0207692_10014389
1244 rootH1_10005646
1245 JGI25404J52841_10054961
1246 Ga0070658_10021345
1247 Ga0070683_100002028
1248 Ga0070683_100003692
1249 Ga0070683_100015521
1250 Ga0070683_100022221
1251 Ga0070683_100040458
1252 Ga0070683_100057458
1253 Ga0070683_100258342
1254 Ga0070683_100531907
1255 Ga0070683_100602152
1256 Ga0070690_100682623
1257 Ga0070677_10438659
1258 Ga0068869_100872698
1259 Ga0070666_10255127
1260 Ga0070680_100009405
1261 Ga0070680_100043363
1262 Ga0070680_100109751
1263 Ga0070680_100415390
1264 Ga0070680_100425643
1265 Ga0070682_100009325
1266 Ga0070682_100107417
1267 Ga0070682_100325093
1268 Ga0068868_100164775
1269 Ga0068868_100172004
1270 Ga0068868_100274542
1271 Ga0068868_100608439
1272 Ga0070660_100023157
1273 Ga0070660_100023680
1274 Ga0070660_100051495
1275 Ga0070660_100184559
1276 Ga0070660_100895928
1277 Ga0070691_10510748
1278 Ga0070687_100589775
1279 Ga0070687_100845175
1280 Ga0070661_100326161
1281 Ga0070661_100365454
1282 Ga0070661_100951512
1283 Ga0070692_10382731
1284 Ga0070668_100046895
1285 Ga0070668_101466329
1286 Ga0070669_101278948
1287 Ga0070675_100224565
1288 Ga0070675_100662306
1289 Ga0070671_100206063
1290 Ga0070671_100864941
1291 Ga0070674_100119163
1292 Ga0070673_100223199
1293 Ga0070673_100425798
1294 Ga0070688_100135346
1295 Ga0070688_100390695
1296 Ga0070659_100251276
1297 Ga0070703_10052110
1298 Ga0070703_10179468
1299 Ga0070709_10155772
1300 Ga0070709_10195423
1301 Ga0070709_10297895
1302 Ga0070709_10351321
1303 Ga0070709_10798624
1304 Ga0070714_100019202
1305 Ga0070714_100025597
1306 Ga0070714_100092383
1307 Ga0070714_100156647
1308 Ga0070714_100257913
1309 Ga0070714_100306859
1310 Ga0070714_100409932
1311 Ga0070714_101070279
1312 Ga0070713_100020271
1313 Ga0070713_100235856
1314 Ga0070713_100510729
1315 Ga0070713_100526410
1316 Ga0070713_100542227
1317 Ga0070713_100562521
1318 Ga0070713_101261404
1319 Ga0070710_10063266
1320 Ga0070710_10293672
1321 Ga0070710_10474477
1322 Ga0070710_10820213
1323 Ga0070701_10135903
1324 Ga0070701_10395857
1325 Ga0070711_100365658
1326 Ga0070711_100417331
1327 Ga0070711_100874425
1328 Ga0070711_101461704
1329 Ga0070705_100066351
1330 Ga0070705_100186542
1331 Ga0070705_100872657
1332 Ga0070705_101383511
1333 Ga0070700_100074824
1334 Ga0070694_100136793
1335 Ga0070694_100199769
1336 Ga0070694_100200548
1337 Ga0070694_100377333
1338 Ga0070694_100765061
1339 Ga0070708_100272974
1340 Ga0070708_100499417
1341 Ga0070663_100083991
1342 Ga0070663_101669904
1343 Ga0070678_100065988
1344 Ga0070678_100107974
1345 Ga0070678_100240730
1346 Ga0070678_101087341
1347 Ga0070662_100090256
1348 Ga0070662_100266062
1349 Ga0070662_100539055
1350 Ga0070662_100622709
1351 Ga0070662_100642077
1352 Ga0070681_10000616
1353 Ga0070681_10045315
1354 Ga0070681_10132525
1355 Ga0070681_10201585
1356 Ga0070681_10289533
1357 Ga0070681_10292560
1358 Ga0070681_10476389
1359 Ga0070681_10515657
1360 Ga0070681_10777832
1361 Ga0068867_100128451
1362 Ga0070685_10439378
1363 Ga0070706_100296856
1364 Ga0070706_100321525
1365 Ga0070706_100504212
1366 Ga0070706_101559868
1367 Ga0070706_101652602
1368 Ga0070707_100003029
1369 Ga0070707_100028647
1370 Ga0070707_100188282
1371 Ga0070707_100244856
1372 Ga0070707_100645784
1373 Ga0070707_100804550
1374 Ga0070707_100846754
1375 Ga0070707_101585857
1376 Ga0070707_101868373
1377 Ga0070698_100004541
1378 Ga0070698_100037866
1379 Ga0070698_100052435
1380 Ga0070698_100225563
1381 Ga0070698_101235921
1382 Ga0070699_100159960
1383 Ga0070679_100002700
1384 Ga0070679_100119808
1385 Ga0070679_100148957
1386 Ga0070679_100167777
1387 Ga0070679_100363772
1388 Ga0070679_100413262
1389 Ga0070679_100520042
1390 Ga0070679_100969114
1391 Ga0070684_100018945
1392 Ga0070684_100019770
1393 Ga0070684_100021310
1394 Ga0070684_100060099
1395 Ga0070684_100167666
1396 Ga0070684_100167882
1397 Ga0070684_100482260
1398 Ga0070684_100691159
1399 Ga0070697_100143374
1400 Ga0070697_100332036
1401 Ga0070697_100354425
1402 Ga0068853_100381730
1403 Ga0070686_100026401
1404 Ga0070686_100057795
1405 Ga0070686_100239634
1406 Ga0070686_100525816
1407 Ga0070695_100034181
1408 Ga0070695_100040051
1409 Ga0070695_100106414
1410 Ga0070695_100305237
1411 Ga0070696_100052107
1412 Ga0070696_100137746
1413 Ga0070696_100140397
1414 Ga0070696_100175773
1415 Ga0070696_101029575
1416 Ga0070693_100002681
1417 Ga0070693_100035519
1418 Ga0070693_100061681
1419 Ga0070693_100291936
1420 Ga0070693_101302612
1421 Ga0070665_101615447
1422 Ga0070704_100351153
1423 Ga0070704_100504044
1424 Ga0070704_100697655
1425 Ga0068855_100552044
1426 Ga0068855_100633736
1427 Ga0068855_101454769
1428 Ga0070664_100217324
1429 Ga0070664_100305274
1430 Ga0070664_100557472
1431 Ga0068857_100023736
1432 Ga0068857_100393189
1433 Ga0068857_100542334
1434 Ga0068857_101935507
1435 Ga0068854_100652122
1436 Ga0068854_101383240
1437 Ga0068856_100092009
1438 Ga0068856_100119488
1439 Ga0068856_100134929
1440 Ga0068856_100232774
1441 Ga0068856_100414290
1442 Ga0068856_100780009
1443 Ga0068856_100919393
1444 Ga0068856_101356382
1445 Ga0068856_101697074
1446 Ga0068856_101926976
1447 Ga0070702_100589310
1448 Ga0068852_100806853
1449 Ga0068852_101012135
1450 Ga0068864_100080980
1451 Ga0068864_101294452
1452 Ga0068866_10106114
1453 Ga0068861_100091730
1454 Ga0068861_100672476
1455 Ga0068858_100970667
1456 Ga0068862_100299449
1457 Ga0068862_101340907
1458 Ga0081455_10007511
1459 Ga0081455_10023070
1460 Ga0081455_10094023
1461 Ga0081455_10101149
1462 Ga0081455_10201776
1463 Ga0081455_10369269
1464 Ga0081538_10001520
1465 Ga0081538_10015038
1466 Ga0081538_10020089
1467 Ga0081540_1003521
1468 Ga0081540_1004841
1469 Ga0081540_1005736
1470 Ga0081539_10004400
1471 Ga0081539_10009156
1472 Ga0070717_10051942
1473 Ga0070717_10114022
1474 Ga0070717_10162376
1475 Ga0070717_10680891
1476 Ga0075365_10163247
1477 Ga0075432_10007543
1478 Ga0075432_10206081
1479 Ga0075432_10262956
1480 Ga0070715_10001432
1481 Ga0070715_10091023
1482 Ga0070716_100007454
1483 Ga0070716_100057189
1484 Ga0070716_100093535
1485 Ga0070716_100179184
1486 Ga0070716_100443040
1487 Ga0070712_100030861
1488 Ga0070712_100119030
1489 Ga0070712_100131979
1490 Ga0070712_100157941
1491 Ga0070712_100340252
1492 Ga0070712_101345197
1493 Ga0070712_101495734
1494 Ga0097621_100004581
1495 Ga0068871_100010878
1496 Ga0075428_100076499
1497 Ga0075428_100091758
1498 Ga0075428_100402164
1499 Ga0075428_100475348
1500 Ga0075428_100548781
1501 Ga0075428_100622473
1502 Ga0075428_100858072
1503 Ga0075430_100051989
1504 Ga0075431_100120062
1505 Ga0075431_100145004
1506 Ga0075431_100338757
1507 Ga0075431_100375133
1508 Ga0075431_100460084
1509 Ga0075431_100605146
1510 Ga0075433_10105460
1511 Ga0075433_10135561
1512 Ga0075433_10170962
1513 Ga0075433_10349539
1514 Ga0075433_10364269
1515 Ga0075433_10465645
1516 Ga0075434_100037397
1517 Ga0075434_100171687
1518 Ga0075434_100172430
1519 Ga0075434_100192823
1520 Ga0075434_100677681
1521 Ga0075434_100760639
1522 Ga0075434_101671256
1523 Ga0075429_100204890
1524 Ga0068865_100179918
1525 Ga0075436_100009822
1526 Ga0075436_100099510
1527 Ga0075436_100099809
1528 Ga0075436_100202332
1529 Ga0075436_100234624
1530 Ga0075436_100557991
1531 Ga0075436_101493887
1532 Ga0075435_100120367
1533 Ga0075435_100126128
1534 Ga0075435_100298973
1535 Ga0075435_100422093
1536 Ga0075435_100543856
1537 Ga0075435_100809438
1538 Ga0105240_10097691
1539 Ga0105240_10124169
1540 Ga0105240_10206929
1541 Ga0105240_10217152
1542 Ga0105240_10266972
1543 Ga0111539_10030639
1544 Ga0111539_10076953
1545 Ga0111539_10114917
1546 Ga0111539_10126418
1547 Ga0111539_10228451
1548 Ga0111539_10232618
1549 Ga0111539_10296701
1550 Ga0111539_10431633
1551 Ga0111539_12568041
1552 Ga0105245_10007926
1553 Ga0105245_10008291
1554 Ga0105245_10026357
1555 Ga0105245_10093597
1556 Ga0105245_10218542
1557 Ga0105245_10395855
1558 Ga0105245_10405947
1559 Ga0105245_10568236
1560 Ga0105245_10778059
1561 Ga0105245_10959045
1562 Ga0105247_10643525
1563 Ga0114129_10033209
1564 Ga0114129_10088938
1565 Ga0114129_10139384
1566 Ga0114129_10177421
1567 Ga0114129_10441546
1568 Ga0114129_10884093
1569 Ga0105243_10118934
1570 Ga0105243_10283088
1571 Ga0105243_10432289
1572 Ga0105243_11227973
1573 Ga0105241_10061816
1574 Ga0105241_10254921
1575 Ga0105241_11277974
1576 Ga0105242_10088446
1577 Ga0105242_10096667
1578 Ga0105242_10107711
1579 Ga0105242_10126861
1580 Ga0105242_10331340
1581 Ga0105242_10700584
1582 Ga0105248_10436540
1583 Ga0105248_11450750
1584 Ga0105248_11763870
1585 Ga0105237_11272068
1586 Ga0105237_11649394
1587 Ga0105238_10495828
1588 Ga0105249_10127509
1589 Ga0105249_10197361
1590 Ga0105249_10277147
1591 Ga0105249_10665464
1592 Ga0105239_10171359
1593 Ga0105239_10175522
1594 Ga0105239_10183220
1595 Ga0105239_10252879
1596 Ga0105239_10340984
1597 Ga0105239_10690499
1598 Ga0105239_11056062
1599 Ga0105239_11688944
1600 Ga0105246_10219494
1601 Ga0105246_10316013
1602 Ga0105246_10911345
1603 Ga0157320_1022351
1604 Ga0157325_1022521
1605 Ga0157335_1008208
1606 Ga0157314_1028394
1607 Ga0157314_1033163
1608 Ga0157326_1014033
1609 Ga0157373_10250024
1610 Ga0157373_10336544
1611 Ga0157373_10881326
1612 Ga0157371_10189602
1613 Ga0157371_10278725
1614 Ga0157371_10425488
1615 Ga0157370_10238235
1616 Ga0157370_10750006
1617 Ga0157369_10311567
1618 Ga0157369_10478426
1619 Ga0157369_10657150
1620 Ga0157369_11072493
1621 Ga0157369_11243778
1622 Ga0157374_10070018
1623 Ga0157374_11166948
1624 Ga0157374_11656427
1625 Ga0157378_10329329
1626 Ga0157378_10460598
1627 Ga0157378_13268364
1628 Ga0163162_10104789
1629 Ga0163162_10264516
1630 Ga0163162_10538765
1631 Ga0157372_10394651
1632 Ga0157372_10620350
1633 Ga0157372_10704310
1634 Ga0157372_12391553
1635 Ga0157372_12775560
1636 Ga0157375_10095382
1637 Ga0157375_10195506
1638 Ga0157375_10395948
1639 Ga0157375_10765328
1640 Ga0157375_11334706
1641 Ga0157375_12843690
1642 Ga0163163_10345950
1643 Ga0182008_10007996
1644 Ga0182008_10030573
1645 Ga0182008_10234206
1646 Ga0182008_10470615
1647 Ga0157376_10152399
1648 Ga0157376_10506755
1649 Ga0157376_10599363
1650 Ga0157376_12380331
1651 Ga0182006_1140307
1652 Ga0182007_10073485
1653 Ga0163161_10053397
1654 Ga0163161_10219632
1655 Ga0163161_11094287
1656 Ga0206356_10899570
1657 Ga0206356_11542665
1658 Ga0206354_10762389
1659 Ga0206354_10957585
1660 Ga0206354_11589080
1661 Ga0206353_10125552
1662 Ga0206353_11044796
1663 Ga0224712_10426978
1664 Ga0207653_10040743
1665 Ga0207653_10085409
1666 Ga0207692_10069317
1667 Ga0207642_10495427
1668 Ga0207647_10544680
1669 Ga0207685_10004314
1670 Ga0207685_10040005
1671 Ga0207685_10305341
1672 Ga0207699_10113977
1673 Ga0207699_10126905
1674 Ga0207699_10213518
1675 Ga0207699_10244174
1676 Ga0207699_10514380
1677 Ga0207705_10254051
1678 Ga0207705_10373979
1679 Ga0207684_10118812
1680 Ga0207684_10344774
1681 Ga0207684_10445018
1682 Ga0207684_11309656
1683 Ga0207707_10002240
1684 Ga0207707_10007327
1685 Ga0207707_10052433
1686 Ga0207707_10086931
1687 Ga0207707_10166580
1688 Ga0207707_10177157
1689 Ga0207707_10747028
1690 Ga0207707_10747474
1691 Ga0207695_10374530
1692 Ga0207695_10516075
1693 Ga0207695_10775729
1694 Ga0207695_11062905
1695 Ga0207671_10165105
1696 Ga0207693_10001413
1697 Ga0207693_10003121
1698 Ga0207693_10013285
1699 Ga0207693_10013689
1700 Ga0207693_10017496
1701 Ga0207693_10114733
1702 Ga0207693_10133422
1703 Ga0207693_10136163
1704 Ga0207693_10255588
1705 Ga0207693_10807937
1706 Ga0207663_10011530
1707 Ga0207663_10153012
1708 Ga0207663_10154712
1709 Ga0207663_10164858
1710 Ga0207663_10193643
1711 Ga0207663_11293934
1712 Ga0207660_10025605
1713 Ga0207660_10083463
1714 Ga0207660_10143095
1715 Ga0207660_10188300
1716 Ga0207660_10230151
1717 Ga0207660_10403758
1718 Ga0207660_10677481
1719 Ga0207662_10195978
1720 Ga0207657_10004596
1721 Ga0207657_10007905
1722 Ga0207657_10063649
1723 Ga0207657_10066420
1724 Ga0207657_10170731
1725 Ga0207649_10135445
1726 Ga0207649_10469451
1727 Ga0207649_10889868
1728 Ga0207649_10930468
1729 Ga0207652_10050250
1730 Ga0207652_10060178
1731 Ga0207652_10347002
1732 Ga0207652_10983054
1733 Ga0207646_10023032
1734 Ga0207646_10024884
1735 Ga0207646_10127417
1736 Ga0207646_10184044
1737 Ga0207646_10227292
1738 Ga0207646_10526807
1739 Ga0207646_10819776
1740 Ga0207646_11208232
1741 Ga0207681_10440473
1742 Ga0207659_10156308
1743 Ga0207687_10005471
1744 Ga0207687_10034631
1745 Ga0207687_10036457
1746 Ga0207687_10267586
1747 Ga0207687_10505797
1748 Ga0207700_10000004
1749 Ga0207700_10163551
1750 Ga0207700_10168395
1751 Ga0207700_10262180
1752 Ga0207700_10340745
1753 Ga0207664_10034516
1754 Ga0207664_10078694
1755 Ga0207664_10154879
1756 Ga0207664_10240571
1757 Ga0207664_10255563
1758 Ga0207664_10257255
1759 Ga0207664_10268057
1760 Ga0207664_10292632
1761 Ga0207664_10632595
1762 Ga0207664_10758076
1763 Ga0207664_11270685
1764 Ga0207644_10464614
1765 Ga0207644_11564444
1766 Ga0207690_10083851
1767 Ga0207690_10252101
1768 Ga0207706_10033829
1769 Ga0207706_10134566
1770 Ga0207706_10177781
1771 Ga0207686_10020098
1772 Ga0207686_10276017
1773 Ga0207686_10474743
1774 Ga0207709_10020706
1775 Ga0207709_10164136
1776 Ga0207709_10346551
1777 Ga0207709_10617949
1778 Ga0207709_10793775
1779 Ga0207709_11217769
1780 Ga0207669_10085042
1781 Ga0207669_10389140
1782 Ga0207665_10016651
1783 Ga0207665_10058834
1784 Ga0207665_10287137
1785 Ga0207665_10555025
1786 Ga0207691_10942219
1787 Ga0207711_10160899
1788 Ga0207711_11331653
1789 Ga0207661_10000267
1790 Ga0207661_10023853
1791 Ga0207661_10118816
1792 Ga0207661_10151849
1793 Ga0207661_10164965
1794 Ga0207661_10629418
1795 Ga0207661_11023119
1796 Ga0207661_11085809
1797 Ga0207679_10129821
1798 Ga0207679_10180148
1799 Ga0207679_10585304
1800 Ga0207667_10034152
1801 Ga0207667_10199263
1802 Ga0207667_10361565
1803 Ga0207667_10567920
1804 Ga0207651_10466537
1805 Ga0207651_11432738
1806 Ga0207712_10250341
1807 Ga0207668_10059047
1808 Ga0207668_10136707
1809 Ga0207668_11026282
1810 Ga0207640_10303974
1811 Ga0207640_10514689
1812 Ga0207658_10771610
1813 Ga0207677_10099992
1814 Ga0207677_10243874
1815 Ga0207677_10280573
1816 Ga0207677_10870810
1817 Ga0207677_10912224
1818 Ga0207677_11053573
1819 Ga0207639_10410316
1820 Ga0207678_10181432
1821 Ga0207678_10512200
1822 Ga0207678_10615382
1823 Ga0207678_11068513
1824 Ga0207708_10043614
1825 Ga0207708_10179395
1826 Ga0207708_10325686
1827 Ga0207708_10683329
1828 Ga0207702_10023561
1829 Ga0207702_10112732
1830 Ga0207702_10158677
1831 Ga0207702_10273976
1832 Ga0207702_10316545
1833 Ga0207702_10344658
1834 Ga0207702_10521171
1835 Ga0207702_10775871
1836 Ga0207702_10849098
1837 Ga0207702_10960818
1838 Ga0207702_11545579
1839 Ga0207648_10141020
1840 Ga0207648_10298118
1841 Ga0207676_10107189
1842 Ga0207674_10002797
1843 Ga0207674_10123097
1844 Ga0207674_10380690
1845 Ga0207674_10545070
1846 Ga0207675_100103035
1847 Ga0207675_100125783
1848 Ga0207675_100176725
1849 Ga0207683_10015292
1850 Ga0207683_10060043
1851 Ga0207683_10249982
1852 Ga0207683_10783881
1853 Ga0207698_10177255
1854 Ga0207698_11415995
1855 Ga0207428_10005283
1856 Ga0207428_10060435
1857 Ga0207428_10066174
1858 Ga0268265_10204197
1859 Ga0268265_10570981
1860 Ga0268265_10864491
1861 Ga0265337_1033484
1862 Ga0265319_1000701
1863 Ga0265319_1003960
1864 Ga0265319_1011867
1865 Ga0265334_10001490
1866 Ga0265334_10017585
1867 Ga0265334_10325638
1868 Ga0265318_10000400
1869 Ga0265318_10006430
1870 Ga0265318_10066769
1871 Ga0265322_10007571
1872 Ga0265336_10015536
1873 Ga0265336_10022494
1874 Ga0265338_10004790
1875 Ga0265338_10007252
1876 Ga0265324_10021766
1877 Ga0265330_10001899
1878 Ga0265330_10022449
1879 Ga0265330_10205768
1880 Ga0265332_10003587
1881 Ga0265332_10123366
1882 Ga0265328_10004911
1883 Ga0265328_10087007
1884 Ga0265320_10016387
1885 Ga0265320_10077209
1886 Ga0265325_10004124
1887 Ga0265325_10060946
1888 Ga0265329_10004136
1889 Ga0265340_10012992
1890 Ga0265340_10062734
1891 Ga0265339_10006743
1892 Ga0265339_10018324
1893 Ga0265339_10234252
1894 Ga0265331_10016699
1895 Ga0265327_10011945
1896 Ga0265327_10016620
1897 Ga0265316_10009256
1898 Ga0265316_10013876
1899 Ga0265316_10047506
1900 Ga0265316_10323392
1901 Ga0265313_10011443
1902 Ga0265313_10200340
1903 Ga0265314_10025003
1904 Ga0265314_10114538
1905 Ga0265342_10011944
1906 Ga0265342_10096550
1907 Ga0307406_10032550
1908 Ga0307406_10333844
1909 Ga0307409_100318484
1910 Ga0307416_100094801
1911 Ga0307416_100394910
1912 Ga0307416_100805392
1913 Ga0307411_10341940
1914 Ga0307415_100082901
1915 Ga0307415_100084225
1916 Ga0307415_100114369
1917 Ga0373948_0001030
1918 Ga0373950_0001374
1919 Ga0373959_0016523
1920 Ga0373959_0194784
1921 Ga0373928_0009302
1922 Ga0373928_0043252
1923 Ga0373929_0174764
1924 Ga0373944_0006430
1925 Ga0373949_0002456
1926 Ga0373951_0010117
1927 Ga0373932_0006861
1928 Ga0373932_0102548
1929 Ga0373945_0013670
1930 Ga0373953_0514112
1931 Ga0373960_0000659
1932 Ga0373960_0082049
1933 Ga0373960_0161335
1934 Ga0373943_0044893
1935 Ga0373943_0090860
1936 Ga0373946_0025050
1937 Ga0373942_0033826
1938 Ga0373942_0245166
1939 Ga0373961_0004945
1940 Ga0373961_0022155
1941 Ga0373962_0021984
1942 Ga0373935_0059860
1943 Ga0373935_0149648
1944 Ga0373935_0337221
1945 Ga0373927_0178107
1946 Ga0373947_0008709
1947 Ga0373925_0001380
1948 Ga0373925_0258569
1949 Ga0373925_1575372
1950 Ga0395899_0002522
1951 Ga0395899_0002768
1952 Ga0395899_0010024
1953 Ga0395899_0029486
1954 Ga0395899_0031542
1955 Ga0395899_0066853
1956 Ga0395899_0277901
1957 Ga0395899_0301650
1958 Ga0395899_0305049
1959 Ga0395899_0352887
1960 Ga0395899_0515976
1961 Ga0395899_0918796
1962 Ga0395900_0004816
1963 Ga0395900_0008116
1964 Ga0395900_0013683
1965 Ga0395900_0015373
1966 Ga0395900_0015535
1967 Ga0395900_0020954
1968 Ga0395900_0026748
1969 Ga0395900_0027465
1970 Ga0395900_0046433
1971 Ga0395900_0062783
1972 Ga0395900_0100089
1973 Ga0395900_0114957
1974 Ga0395900_0172194
1975 Ga0395900_0290128
1976 Ga0395900_0351192
1977 Ga0395900_0363073
1978 Ga0395900_0430394
1979 Ga0395900_0664599
1980 Ga0395900_0981838
1981 Ga0395900_1457410
1982 Ga0395900_1886758
1983 Ga0395898_0000635
1984 Ga0395898_0004222
1985 Ga0395898_0012120
1986 Ga0395898_0013333
1987 Ga0395898_0018206
1988 Ga0395898_0019228
1989 Ga0395898_0043451
1990 Ga0395898_0058150
1991 Ga0395898_0068002
1992 Ga0395898_0070716
1993 Ga0395898_0092297
1994 Ga0395898_0093719
1995 Ga0395898_0117809
1996 Ga0395898_0167641
1997 Ga0395898_0183903
1998 Ga0395898_0277130
1999 Ga0395898_0313132
2000 Ga0395898_0350755
2001 Ga0395898_0567589
2002 Ga0395898_0757508
2003 Ga0395898_0764494
2004 Ga0395898_0829694
2005 Ga0395898_0936656
2006 Ga0395898_1328667
2007 Ga0395898_1481907
2008 Ga0395905_0006804
2009 Ga0395905_0009799
2010 Ga0395905_0024697
2011 Ga0395905_0026941
2012 Ga0395905_0032364
2013 Ga0395905_0045678
2014 Ga0395905_0046418
2015 Ga0395905_0068297
2016 Ga0395905_0102974
2017 Ga0395905_0125458
2018 Ga0395905_0274139
2019 Ga0395905_0420491
2020 Ga0395905_0687857
2021 Ga0395905_0740466
2022 Ga0395905_0812550
2023 Ga0395905_1010807
2024 Ga0395905_1129397
2025 Ga0395905_1134535
2026 Ga0395901_0002544
2027 Ga0395901_0006552
2028 Ga0395901_0008779
2029 Ga0395901_0010232
2030 Ga0395901_0014478
2031 Ga0395901_0016360
2032 Ga0395901_0016913
2033 Ga0395901_0019082
2034 Ga0395901_0058458
2035 Ga0395901_0060988
2036 Ga0395901_0066787
2037 Ga0395901_0095980
2038 Ga0395901_0117869
2039 Ga0395901_0126868
2040 Ga0395901_0142940
2041 Ga0395901_0177673
2042 Ga0395901_0212055
2043 Ga0395901_0302082
2044 Ga0395901_0369595
2045 Ga0395901_0393199
2046 Ga0395901_0395172
2047 Ga0395901_0406680
2048 Ga0395901_0778085
2049 Ga0395901_1327255
2050 Ga0395901_1750139
2051 Ga0395901_1778174
2052 Ga0242420_145225
2053 Ga0436365_0307627
2054 Ga0439453_0028297
2055 Ga0439453_0063875
2056 Ga0439466_0062803
2057 Ga0451789_0339081
2058 Ga0451789_1312427
2059 Ga0451793_0317672
2060 Ga0451795_0027106
2061 Ga0451798_0263104
2062 Ga0451800_1462570
2063 Ga0451802_1524512
2064 Ga0451802_2028705
2065 Ga0451804_0321035
2066 Ga0451807_0330186
2067 Ga0451835_0161116
2068 Ga0451835_0538146
2069 Ga0451839_0726782
2070 Ga0451841_1061094
2071 Ga0451845_0482713
2072 Ga0451845_0862811
2073 Ga0451847_0449104
2074 Ga0451849_0691407
2075 Ga0451849_0945287
2076 Ga0451851_0768897
2077 Ga0451851_0904337
2078 Ga0451855_1065849
2079 Ga0451853_0167061
2080 Ga0451853_0460319
2081 Ga0451853_0801509
2082 Ga0439448_0015925
2083 Ga0439448_0232723
2084 Ga0439455_0007025
2085 Ga0439455_0109878
2086 Ga0439463_063743
2087 Ga0439458_0090197
2088 Ga0439458_0149503
2089 Ga0450916_021282
2090 Ga0466965_0082223
2091 Ga0466966_0046003
2092 Ga0466966_0256009
2093 Ga0466966_0631076
2094 Ga0466961_0097942
2095 Ga0466963_0002756
2096 Ga0466963_0072458
2097 Ga0466963_0133691
2098 Ga0466963_0249010
2099 Ga0466963_0346030
2100 Ga0466963_0461383
2101 Ga0466963_0577936
2102 Ga0466963_0808718
2103 Ga0466963_1280354
2104 Ga0466964_0002141
2105 Ga0466964_0008934
2106 Ga0466964_0287689
2107 Ga0466971_0025187
2108 Ga0466971_0045201
2109 Ga0466971_0306612
2110 Ga0466968_0060322
2111 Ga0466957_0236711
2112 Ga0466957_0768038
2113 Ga0466960_0031717
2114 Ga0466960_0059978
2115 Ga0466960_0309132
2116 Ga0466959_0012573
2117 Ga0466959_0879196
2118 Ga0451576_0013374
2119 Ga0451576_1141280
2120 Ga0466958_0031410
2121 Ga0466958_0073966
2122 Ga0466958_0107860
2123 Ga0466958_0203590
2124 Ga0466958_0359906
2125 Ga0466958_0575394
2126 Ga0466967_0002982
2127 Ga0466967_0051946
2128 Ga0466967_0068765
2129 Ga0466967_0131822
2130 Ga0466967_0159179
2131 Ga0466967_0164778
2132 Ga0466967_0231230
2133 Ga0466967_0231462
2134 Ga0466967_0355525
2135 Ga0466967_0823387
2136 Ga0466967_1065500
2137 Ga0466967_1187418
2138 Ga0466967_1224003
2139 Ga0495592_0526773
2140 Ga0495603_0066776
2141 Ga0495629_0079911
2142 Ga0495629_0169606
2143 Ga0495641_0001074
2144 Ga0495641_0077242
2145 Ga0495641_0122736
2146 Ga0495641_0147684
2147 Ga0495651_0379822
2148 Ga0495651_0526482
2149 Ga0495653_0075281
2150 Ga0495653_0149157
2151 Ga0495580_0050268
2152 Ga0495582_0025909
2153 Ga0495582_0065275
2154 Ga0495605_0343545
2155 Ga0495639_0149702
2156 Ga0495664_0451082
2157 Ga0495664_0493925
2158 Ga0495584_0055679
2159 Ga0495585_0230235
2160 Ga0495594_0002224
2161 Ga0495594_0463034
2162 Ga0495596_0214632
2163 Ga0495596_0221112
2164 Ga0495607_0132391
2165 Ga0495607_0155424
2166 Ga0495607_0510900
2167 Ga0495608_0656559
2168 Ga0495618_0207417
2169 Ga0495618_0663682
2170 Ga0495630_0144463
2171 Ga0495630_0236754
2172 Ga0495630_0346218
2173 Ga0495631_0167572
2174 Ga0495637_0169922
2175 Ga0495644_0032720
2176 Ga0495644_0157154
2177 Ga0495644_0253258
2178 Ga0495663_0152700
2179 Ga0495663_0338114
2180 Ga0495666_0034432
2181 Ga0495642_0121695
2182 Ga0495642_0298542
2183 Ga0495665_0070197
2184 Ga0495640_0482123
2185 Ga0495640_0522499
2186 Ga0495598_0061117
2187 Ga0495609_0206439
2188 Ga0495609_0258174
2189 Ga0495645_0536073
2190 Ga0495667_0065362
2191 Ga0495656_0024935
2192 Ga0495656_0044402
2193 Ga0495656_0303518
2194 Ga0495656_0387114
2195 Ga0495668_0562155
2196 Ga0495668_0804061
2197 Ga0495634_0465866
2198 Ga0495611_0131629
2199 Ga0495635_0547324
2200 Ga0495659_0194215
2201 Ga0495588_0000390
2202 Ga0495588_0196323
2203 Ga0495657_0068189
2204 Ga0495657_0315612
2205 Ga0495599_0546378
2206 Ga0495647_0216042
2207 Ga0495658_0262499
2208 Ga0495658_0423071
2209 Ga0495669_0607960
2210 Ga0495613_0065200
2211 Ga0495613_0099395
2212 Ga0495670_0323987
2213 Ga0495670_0832544
2214 Ga0495589_0381721
2215 Ga0495600_0043700
2216 Ga0495600_0218419
2217 Ga0495660_0115494
2218 Ga0495581_0019596
2219 Ga0495581_0095755
2220 Ga0495636_0060526
2221 Ga0495674_0469515
2222 Ga0495676_0000419
2223 Ga0495676_0039368
2224 Ga0495676_0051089
2225 Ga0495676_0346794
2226 Ga0495676_0748915
2227 Ga0495680_0152718
2228 Ga0495680_0407119
2229 Ga0495677_0225389
2230 Ga0495679_051780
2231 Ga0495685_213922
2232 Ga0495684_0600936
2233 Ga0495614_0422813
2234 Ga0495615_0061153
2235 Ga0496100_0062123
2236 Ga0496100_0099904
2237 Ga0496100_0222547
2238 Ga0496100_0490643
2239 Ga0496100_0729353
2240 Ga0496101_0006797
2241 Ga0496101_0057373
2242 Ga0496101_0353852
2243 Ga0496101_0403928
2244 Ga0496101_0624119
2245 Ga0496101_0648102
2246 Ga0496102_0021405
2247 Ga0496102_0097220
2248 Ga0496102_0158310
2249 Ga0496102_0187258
2250 Ga0496102_0270804
2251 Ga0496102_1361634
2252 Ga0496103_0004888
2253 Ga0496103_0009732
2254 Ga0496103_0035474
2255 Ga0496103_0044941
2256 Ga0496103_0119414
2257 Ga0496103_0150713
2258 Ga0496103_0213230
2259 Ga0496104_0000407
2260 Ga0496104_0002003
2261 Ga0496104_0002189
2262 Ga0496104_0061377
2263 Ga0496104_0389930
2264 Ga0496104_0489064
2265 Ga0496104_0830134
2266 Ga0496104_0967613
2267 Ga0496104_1767110
2268 Ga0496105_0003606
2269 Ga0496105_0153981
2270 Ga0496105_0231013
2271 Ga0496105_0281950
2272 Ga0496105_0452005
2273 Ga0496105_0611523
2274 Ga0496106_0022850
2275 Ga0496106_0043319
2276 Ga0496106_0044607
2277 Ga0496106_0174881
2278 Ga0496106_0300865
2279 Ga0496106_0743770
2280 Ga0496107_0017059
2281 Ga0496107_0044202
2282 Ga0496107_0069024
2283 Ga0496107_0357669
2284 Ga0496107_0535351
2285 Ga0496107_0716969
2286 Ga0496108_0005212
2287 Ga0496108_0122629
2288 Ga0496108_0134632
2289 Ga0496108_0207670
2290 Ga0496108_0220141
2291 Ga0496108_0908223
2292 Ga0496109_0002745
2293 Ga0496109_0004241
2294 Ga0496109_0015213
2295 Ga0496109_0047176
2296 Ga0496109_0079090
2297 Ga0496109_0090059
2298 Ga0496109_0194256
2299 Ga0496109_0207893
2300 Ga0496109_0271841
2301 Ga0496109_0706730
2302 Ga0496109_0718984
2303 Ga0496109_0852572
2304 Ga0496109_1202745
2305 Ga0496109_1519541
2306 Ga0496109_1595495
2307 Ga0496109_1784227
2308 Ga0496109_1810066
2309 Ga0496110_0000628
2310 Ga0496110_0002493
2311 Ga0496110_0014421
2312 Ga0496110_0028794
2313 Ga0496110_0090381
2314 Ga0496110_0163802
2315 Ga0496110_0180210
2316 Ga0496110_0341840
2317 Ga0496110_0408017
2318 Ga0496110_0479556
2319 Ga0496110_0760680
2320 Ga0496111_0002892
2321 Ga0496111_0003525
2322 Ga0496111_0024101
2323 Ga0496111_0025685
2324 Ga0496111_0045172
2325 Ga0496111_0131354
2326 Ga0496111_0369790
2327 Ga0496111_0532908
2328 Ga0496111_0658484
2329 Ga0496111_0689981
2330 Ga0496111_0795438
2331 Ga0496112_0002231
2332 Ga0496112_0004088
2333 Ga0496112_0016721
2334 Ga0496112_0019773
2335 Ga0496112_0047973
2336 Ga0496112_0203607
2337 Ga0496112_0284351
2338 Ga0496112_0539759
2339 Ga0496112_0581257
2340 Ga0496112_0625357
2341 Ga0496112_0707761
2342 Ga0496112_0905620
2343 Ga0496112_1918524
2344 Ga0496113_0035059
2345 Ga0496113_0103248
2346 Ga0496113_0120026
2347 Ga0496113_0120386
2348 Ga0496113_1026541
2349 Ga0496114_0002506
2350 Ga0496114_0002854
2351 Ga0496114_0039143
2352 Ga0496114_0053819
2353 Ga0496114_0123461
2354 Ga0496114_0225050
2355 Ga0496114_0297247
2356 Ga0496114_1491785
2357 Ga0501031_0903874
2358 Ga0501034_0009184
2359 Ga0501036_0640608
2360 Ga0501039_0137895
2361 Ga0501040_0366469
2362 Ga0501040_0446171
2363 Ga0501040_0526411
2364 Ga0501041_0118470
2365 Ga0501042_0001033
2366 Ga0501043_0014874
2367 Ga0501043_0636164
2368 Ga0501047_0106545
2369 Ga0501048_0004658
2370 Ga0501048_0519772
2371 Ga0501048_1039227
2372 Ga0501067_0002416
2373 Ga0501067_0031798
2374 Ga0501067_0087271
2375 Ga0501067_0724965
2376 Ga0501068_0013558
2377 Ga0501069_0001655
2378 Ga0501069_0210633
2379 Ga0501069_0404621
2380 Ga0501069_0468963
2381 Ga0501069_0684328
2382 Ga0501070_0013996
2383 Ga0501070_0079576
2384 Ga0501070_0307423
2385 Ga0501071_0741910
2386 Ga0501071_0824240
2387 Ga0501072_0011327
2388 Ga0501072_0093455
2389 Ga0501073_0074391
2390 Ga0501074_0122081
2391 Ga0501074_0344050
2392 Ga0501074_0560556
2393 Ga0501075_0133739
2394 Ga0501075_0701641
2395 Ga0501076_0148379
2396 Ga0501076_0861812
2397 Ga0501077_0065470
2398 Ga0501079_0056730
2399 Ga0501079_0200471
2400 Ga0501079_0451488
2401 Ga0501079_0647692
2402 Ga0501080_0052034
2403 Ga0501080_0216787
2404 Ga0501083_0004863
2405 Ga0501035_0063637
2406 Ga0501044_0253934
2407 Ga0501045_0152924
2408 Ga0501045_0666262
2409 nmdc:mga05p37_163020_c1
2410 nmdc:mga05p37_182865_c1
2411 nmdc:mga05p37_307721_c2
2412 nmdc:mga05p37_41140_c1
2413 nmdc:mga05p37_47682_c1
2414 nmdc:mga05p37_585963_c1
2415 nmdc:mga06r32_114013_c1
2416 nmdc:mga06r32_147876_c1
2417 nmdc:mga06r32_179801_c1
2418 nmdc:mga06r32_572977_c1
2419 nmdc:mga06r32_806662_c1
2420 nmdc:mga06r32_914519_c1
2421 nmdc:mga08y16_115402_c1
2422 nmdc:mga08y16_188725_c1
2423 nmdc:mga08y16_28005_c1
2424 nmdc:mga08y16_375609_c1
2425 nmdc:mga08y16_534799_c1
2426 nmdc:mga08y16_788766_c1
2427 nmdc:mga0n895_281331_c1
2428 nmdc:mga0n895_283975_c1
2429 nmdc:mga0n895_317239_c1
2430 nmdc:mga0n895_323214_c1
2431 nmdc:mga0n895_71102_c1
2432 nmdc:mga0n895_78268_c1
2433 nmdc:mga0n895_849394_c1
2434 nmdc:mga0rr50_204575_c1
2435 nmdc:mga0rr50_268411_c1
2436 nmdc:mga0rr50_30069_c1
2437 nmdc:mga0rr50_635395_c1
2438 nmdc:mga0rr50_669481_c1
2439 nmdc:mga0rr50_773192_c1
2440 nmdc:mga0rr50_78138_c1
2441 nmdc:mga0rr50_78220_c1
2442 nmdc:mga0rr50_946401_c1
2443 nmdc:mga08x19_160527_c2
2444 nmdc:mga08x19_197983_c1
2445 nmdc:mga08x19_236981_c1
2446 nmdc:mga08x19_278988_c1
2447 nmdc:mga08x19_44260_c1
2448 nmdc:mga0a205_13455_c1
2449 nmdc:mga0a205_193150_c1
2450 nmdc:mga0a205_200979_c1
2451 nmdc:mga0a205_393207_c1
2452 nmdc:mga0a205_55411_c1
2453 nmdc:mga0a205_62734_c1
2454 nmdc:mga0a205_74755_c1
2455 nmdc:mga0a205_80222_c1
2456 Ga0495601_0140954
2457 Ga0495601_0637846
2458 Ga0495655_0044935
2459 Ga0495655_0123376
2460 Ga0495595_0173923
2461 Ga0495595_0267750
2462 Ga0495595_0429290
2463 Ga0495619_0128266
2464 Ga0495619_0293910
2465 Ga0495619_0470526
2466 Ga0500641_0069612
2467 Ga0501084_0294861
2468 Ga0501084_0388932
2469 Ga0501084_0424147
2470 Ga0501084_0779266
2471 Ga0501082_0066191
2472 Ga0501082_0092113
2473 Ga0501082_0593359
2474 Ga0466962_0039991
2475 Ga0466962_0227466
2476 Ga0466962_0266435
2477 Ga0466962_0306074
2478 Ga0466962_0481123
2479 Ga0466962_0617109
2480 Ga0530510_0015329
2481 Ga0530510_0137253
2482 Ga0530510_0489699
2483 Ga0530510_0602163
2484 Ga0530510_0812387

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

95

161

0.94

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

90

166

0.93

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

30

154

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

67

156

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbp-assembly1.cif.gz_B crystal structure of the ampcpr-bound atnudt7 0.9005 98 147
3fxt-assembly1.cif.gz_A crystal structure of the n-terminal domain of human nudt6 0.8523 97 148
4zb3-assembly1.cif.gz_A-2 crystal structure of the apo atnudt7 0.8311 98 147
4zbp-assembly2.cif.gz_C-2 crystal structure of the ampcpr-bound atnudt7 0.8254 98 147
1b6b-assembly2.cif.gz_B melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism 0.8019 47 148
ID Description Score Start End Superfamily
af_K7M4C3_11_92_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9057 98 147 3.40.630.30
af_Q9SJC4_7_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8921 99 147 3.40.630.30
af_Q54U83_110_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8825 97 148 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.839 98 148 3.40.630.30
af_Q9LR91_165_296_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8385 55 148 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537THW4-F1-model_v4 GNAT family N-acetyltransferase 0.9882 38 148 GO:0016747
AF-A0A537THW4-F1-model_v4 GNAT family N-acetyltransferase 0.9707 38 148 GO:0016747
AF-A0A537WXQ4-F1-model_v4 GNAT family N-acetyltransferase 0.9698 1 148 GO:0016747
AF-A0A7W1JY93-F1-model_v4 GNAT family N-acetyltransferase 0.9684 16 148 GO:0016747
AF-A0A427SVV1-F1-model_v4 GNAT family N-acetyltransferase 0.9667 32 148 GO:0016747

Map