F492102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1242 | 389 | 2484 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300025898|Ga0207692_10014389|Ga0207692_100143892 |
| Length | 175 |
| Sequence | MATGSSLPRSFPDRRKLAAMIRSGGARDVPFLRDMLRHAFYWRTPVGEQEPPLTRYVNGWGRPGDRSLIVFDDFVPVGAAWYRLFTAEDPGFGFVDDQTPELAIAVVPSRRGRGFGRELLSALLDCARKDGFEAISLSVAKDNPAIHLYEGYGFEKVREDDGAVVMRAALQAEQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 107 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 194 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 237 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 238 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 247 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 248 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 249 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 250 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 251 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 252 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 253 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 256 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 257 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 258 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 259 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.64 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 10.63 |
| Rhizosphere | 87.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207692_10014389 | 3300025898 | Bacteria | 3456 |
| 2 | rootH1_10005646 | 3300003316 | Unclassified | 1115 |
| 3 | JGI25404J52841_10054961 | 3300003659 | Bacteria | 835 |
| 4 | Ga0070658_10021345 | 3300005327 | Bacteria | 5190 |
| 5 | Ga0070683_100002028 | 3300005329 | Bacteria | 15924 |
| 6 | Ga0070683_100003692 | 3300005329 | Bacteria | 12489 |
| 7 | Ga0070683_100015521 | 3300005329 | Bacteria | 6695 |
| 8 | Ga0070683_100022221 | 3300005329 | Bacteria | 5667 |
| 9 | Ga0070683_100040458 | 3300005329 | Unclassified | 4286 |
| 10 | Ga0070683_100057458 | 3300005329 | Unclassified | 3615 |
| 11 | Ga0070683_100258342 | 3300005329 | Bacteria | 1657 |
| 12 | Ga0070683_100531907 | 3300005329 | Bacteria | 1123 |
| 13 | Ga0070683_100602152 | 3300005329 | Bacteria | 1052 |
| 14 | Ga0070690_100682623 | 3300005330 | Bacteria | 787 |
| 15 | Ga0070677_10438659 | 3300005333 | Bacteria | 696 |
| 16 | Ga0068869_100872698 | 3300005334 | Unclassified | 777 |
| 17 | Ga0070666_10255127 | 3300005335 | Bacteria | 1242 |
| 18 | Ga0070680_100009405 | 3300005336 | Bacteria | 7508 |
| 19 | Ga0070680_100043363 | 3300005336 | Bacteria | 3654 |
| 20 | Ga0070680_100109751 | 3300005336 | Bacteria | 2296 |
| 21 | Ga0070680_100415390 | 3300005336 | Bacteria | 1148 |
| 22 | Ga0070680_100425643 | 3300005336 | Bacteria | 1133 |
| 23 | Ga0070682_100009325 | 3300005337 | Bacteria | 5556 |
| 24 | Ga0070682_100107417 | 3300005337 | Bacteria | 1853 |
| 25 | Ga0070682_100325093 | 3300005337 | Bacteria | 1138 |
| 26 | Ga0068868_100164775 | 3300005338 | Bacteria | 1833 |
| 27 | Ga0068868_100172004 | 3300005338 | Bacteria | 1793 |
| 28 | Ga0068868_100274542 | 3300005338 | Bacteria | 1425 |
| 29 | Ga0068868_100608439 | 3300005338 | Bacteria | 969 |
| 30 | Ga0070660_100023157 | 3300005339 | Unclassified | 4600 |
| 31 | Ga0070660_100023680 | 3300005339 | Bacteria | 4551 |
| 32 | Ga0070660_100051495 | 3300005339 | Bacteria | 3171 |
| 33 | Ga0070660_100184559 | 3300005339 | Bacteria | 1688 |
| 34 | Ga0070660_100895928 | 3300005339 | Unclassified | 748 |
| 35 | Ga0070691_10510748 | 3300005341 | Bacteria | 696 |
| 36 | Ga0070687_100589775 | 3300005343 | Unclassified | 762 |
| 37 | Ga0070687_100845175 | 3300005343 | Bacteria | 652 |
| 38 | Ga0070661_100326161 | 3300005344 | Bacteria | 1200 |
| 39 | Ga0070661_100365454 | 3300005344 | Bacteria | 1135 |
| 40 | Ga0070661_100951512 | 3300005344 | Unclassified | 711 |
| 41 | Ga0070692_10382731 | 3300005345 | Bacteria | 883 |
| 42 | Ga0070668_100046895 | 3300005347 | Bacteria | 3321 |
| 43 | Ga0070668_101466329 | 3300005347 | Unclassified | 623 |
| 44 | Ga0070669_101278948 | 3300005353 | Bacteria | 635 |
| 45 | Ga0070675_100224565 | 3300005354 | Bacteria | 1637 |
| 46 | Ga0070675_100662306 | 3300005354 | Bacteria | 949 |
| 47 | Ga0070671_100206063 | 3300005355 | Bacteria | 1668 |
| 48 | Ga0070671_100864941 | 3300005355 | Bacteria | 789 |
| 49 | Ga0070674_100119163 | 3300005356 | Bacteria | 1952 |
| 50 | Ga0070673_100223199 | 3300005364 | Bacteria | 1632 |
| 51 | Ga0070673_100425798 | 3300005364 | Bacteria | 1191 |
| 52 | Ga0070688_100135346 | 3300005365 | Bacteria | 1667 |
| 53 | Ga0070688_100390695 | 3300005365 | Bacteria | 1028 |
| 54 | Ga0070659_100251276 | 3300005366 | Bacteria | 1465 |
| 55 | Ga0070703_10052110 | 3300005406 | Bacteria | 1312 |
| 56 | Ga0070703_10179468 | 3300005406 | Bacteria | 817 |
| 57 | Ga0070709_10155772 | 3300005434 | Bacteria | 1583 |
| 58 | Ga0070709_10195423 | 3300005434 | Bacteria | 1430 |
| 59 | Ga0070709_10297895 | 3300005434 | Bacteria | 1177 |
| 60 | Ga0070709_10351321 | 3300005434 | Unclassified | 1089 |
| 61 | Ga0070709_10798624 | 3300005434 | Bacteria | 740 |
| 62 | Ga0070714_100019202 | 3300005435 | Bacteria | 5563 |
| 63 | Ga0070714_100025597 | 3300005435 | Bacteria | 4870 |
| 64 | Ga0070714_100092383 | 3300005435 | Unclassified | 2652 |
| 65 | Ga0070714_100156647 | 3300005435 | Bacteria | 2057 |
| 66 | Ga0070714_100257913 | 3300005435 | Unclassified | 1614 |
| 67 | Ga0070714_100306859 | 3300005435 | Bacteria | 1481 |
| 68 | Ga0070714_100409932 | 3300005435 | Bacteria | 1282 |
| 69 | Ga0070714_101070279 | 3300005435 | Bacteria | 785 |
| 70 | Ga0070713_100020271 | 3300005436 | Bacteria | 5094 |
| 71 | Ga0070713_100235856 | 3300005436 | Bacteria | 1664 |
| 72 | Ga0070713_100510729 | 3300005436 | Bacteria | 1135 |
| 73 | Ga0070713_100526410 | 3300005436 | Bacteria | 1117 |
| 74 | Ga0070713_100542227 | 3300005436 | Bacteria | 1101 |
| 75 | Ga0070713_100562521 | 3300005436 | Bacteria | 1081 |
| 76 | Ga0070713_101261404 | 3300005436 | Unclassified | 716 |
| 77 | Ga0070710_10063266 | 3300005437 | Bacteria | 2113 |
| 78 | Ga0070710_10293672 | 3300005437 | Bacteria | 1059 |
| 79 | Ga0070710_10474477 | 3300005437 | Bacteria | 852 |
| 80 | Ga0070710_10820213 | 3300005437 | Unclassified | 666 |
| 81 | Ga0070701_10135903 | 3300005438 | Bacteria | 1401 |
| 82 | Ga0070701_10395857 | 3300005438 | Bacteria | 874 |
| 83 | Ga0070711_100365658 | 3300005439 | Bacteria | 1163 |
| 84 | Ga0070711_100417331 | 3300005439 | Bacteria | 1093 |
| 85 | Ga0070711_100874425 | 3300005439 | Bacteria | 766 |
| 86 | Ga0070711_101461704 | 3300005439 | Bacteria | 596 |
| 87 | Ga0070705_100066351 | 3300005440 | Bacteria | 2163 |
| 88 | Ga0070705_100186542 | 3300005440 | Bacteria | 1410 |
| 89 | Ga0070705_100872657 | 3300005440 | Bacteria | 722 |
| 90 | Ga0070705_101383511 | 3300005440 | Unclassified | 586 |
| 91 | Ga0070700_100074824 | 3300005441 | Bacteria | 2171 |
| 92 | Ga0070694_100136793 | 3300005444 | Bacteria | 1776 |
| 93 | Ga0070694_100199769 | 3300005444 | Bacteria | 1490 |
| 94 | Ga0070694_100200548 | 3300005444 | Unclassified | 1487 |
| 95 | Ga0070694_100377333 | 3300005444 | Unclassified | 1105 |
| 96 | Ga0070694_100765061 | 3300005444 | Bacteria | 789 |
| 97 | Ga0070708_100272974 | 3300005445 | Bacteria | 1590 |
| 98 | Ga0070708_100499417 | 3300005445 | Unclassified | 1147 |
| 99 | Ga0070663_100083991 | 3300005455 | Bacteria | 2346 |
| 100 | Ga0070663_101669904 | 3300005455 | Bacteria | 569 |
| 101 | Ga0070678_100065988 | 3300005456 | Bacteria | 2689 |
| 102 | Ga0070678_100107974 | 3300005456 | Bacteria | 2172 |
| 103 | Ga0070678_100240730 | 3300005456 | Bacteria | 1513 |
| 104 | Ga0070678_101087341 | 3300005456 | Bacteria | 738 |
| 105 | Ga0070662_100090256 | 3300005457 | Bacteria | 2299 |
| 106 | Ga0070662_100266062 | 3300005457 | Bacteria | 1383 |
| 107 | Ga0070662_100539055 | 3300005457 | Bacteria | 977 |
| 108 | Ga0070662_100622709 | 3300005457 | Bacteria | 909 |
| 109 | Ga0070662_100642077 | 3300005457 | Bacteria | 895 |
| 110 | Ga0070681_10000616 | 3300005458 | Bacteria | 29195 |
| 111 | Ga0070681_10045315 | 3300005458 | Bacteria | 4401 |
| 112 | Ga0070681_10132525 | 3300005458 | Bacteria | 2424 |
| 113 | Ga0070681_10201585 | 3300005458 | Bacteria | 1908 |
| 114 | Ga0070681_10289533 | 3300005458 | Bacteria | 1548 |
| 115 | Ga0070681_10292560 | 3300005458 | Bacteria | 1539 |
| 116 | Ga0070681_10476389 | 3300005458 | Bacteria | 1161 |
| 117 | Ga0070681_10515657 | 3300005458 | Bacteria | 1109 |
| 118 | Ga0070681_10777832 | 3300005458 | Bacteria | 874 |
| 119 | Ga0068867_100128451 | 3300005459 | Bacteria | 1967 |
| 120 | Ga0070685_10439378 | 3300005466 | Unclassified | 912 |
| 121 | Ga0070706_100296856 | 3300005467 | Bacteria | 1508 |
| 122 | Ga0070706_100321525 | 3300005467 | Bacteria | 1443 |
| 123 | Ga0070706_100504212 | 3300005467 | Bacteria | 1126 |
| 124 | Ga0070706_101559868 | 3300005467 | Bacteria | 603 |
| 125 | Ga0070706_101652602 | 3300005467 | Archaea | 584 |
| 126 | Ga0070707_100003029 | 3300005468 | Bacteria | 15935 |
| 127 | Ga0070707_100028647 | 3300005468 | Bacteria | 5300 |
| 128 | Ga0070707_100188282 | 3300005468 | Bacteria | 2012 |
| 129 | Ga0070707_100244856 | 3300005468 | Bacteria | 1745 |
| 130 | Ga0070707_100645784 | 3300005468 | Bacteria | 1021 |
| 131 | Ga0070707_100804550 | 3300005468 | Bacteria | 904 |
| 132 | Ga0070707_100846754 | 3300005468 | Bacteria | 878 |
| 133 | Ga0070707_101585857 | 3300005468 | Bacteria | 621 |
| 134 | Ga0070707_101868373 | 3300005468 | Bacteria | 568 |
| 135 | Ga0070698_100004541 | 3300005471 | Bacteria | 15252 |
| 136 | Ga0070698_100037866 | 3300005471 | Bacteria | 4972 |
| 137 | Ga0070698_100052435 | 3300005471 | Bacteria | 4149 |
| 138 | Ga0070698_100225563 | 3300005471 | Bacteria | 1807 |
| 139 | Ga0070698_101235921 | 3300005471 | Bacteria | 696 |
| 140 | Ga0070699_100159960 | 3300005518 | Bacteria | 1993 |
| 141 | Ga0070679_100002700 | 3300005530 | Bacteria | 16150 |
| 142 | Ga0070679_100119808 | 3300005530 | Bacteria | 2617 |
| 143 | Ga0070679_100148957 | 3300005530 | Bacteria | 2318 |
| 144 | Ga0070679_100167777 | 3300005530 | Bacteria | 2168 |
| 145 | Ga0070679_100363772 | 3300005530 | Bacteria | 1394 |
| 146 | Ga0070679_100413262 | 3300005530 | Bacteria | 1295 |
| 147 | Ga0070679_100520042 | 3300005530 | Unclassified | 1134 |
| 148 | Ga0070679_100969114 | 3300005530 | Bacteria | 794 |
| 149 | Ga0070684_100018945 | 3300005535 | Bacteria | 5683 |
| 150 | Ga0070684_100019770 | 3300005535 | Bacteria | 5576 |
| 151 | Ga0070684_100021310 | 3300005535 | Bacteria | 5391 |
| 152 | Ga0070684_100060099 | 3300005535 | Bacteria | 3323 |
| 153 | Ga0070684_100167666 | 3300005535 | Bacteria | 1994 |
| 154 | Ga0070684_100167882 | 3300005535 | Bacteria | 1992 |
| 155 | Ga0070684_100482260 | 3300005535 | Bacteria | 1148 |
| 156 | Ga0070684_100691159 | 3300005535 | Bacteria | 951 |
| 157 | Ga0070697_100143374 | 3300005536 | Bacteria | 2010 |
| 158 | Ga0070697_100332036 | 3300005536 | Bacteria | 1311 |
| 159 | Ga0070697_100354425 | 3300005536 | Bacteria | 1268 |
| 160 | Ga0068853_100381730 | 3300005539 | Bacteria | 1316 |
| 161 | Ga0070686_100026401 | 3300005544 | Bacteria | 3506 |
| 162 | Ga0070686_100057795 | 3300005544 | Bacteria | 2493 |
| 163 | Ga0070686_100239634 | 3300005544 | Bacteria | 1320 |
| 164 | Ga0070686_100525816 | 3300005544 | Bacteria | 922 |
| 165 | Ga0070695_100034181 | 3300005545 | Bacteria | 3185 |
| 166 | Ga0070695_100040051 | 3300005545 | Bacteria | 2964 |
| 167 | Ga0070695_100106414 | 3300005545 | Bacteria | 1897 |
| 168 | Ga0070695_100305237 | 3300005545 | Bacteria | 1178 |
| 169 | Ga0070696_100052107 | 3300005546 | Bacteria | 2846 |
| 170 | Ga0070696_100137746 | 3300005546 | Bacteria | 1781 |
| 171 | Ga0070696_100140397 | 3300005546 | Bacteria | 1765 |
| 172 | Ga0070696_100175773 | 3300005546 | Bacteria | 1586 |
| 173 | Ga0070696_101029575 | 3300005546 | Bacteria | 689 |
| 174 | Ga0070693_100002681 | 3300005547 | Bacteria | 8190 |
| 175 | Ga0070693_100035519 | 3300005547 | Bacteria | 2765 |
| 176 | Ga0070693_100061681 | 3300005547 | Bacteria | 2180 |
| 177 | Ga0070693_100291936 | 3300005547 | Bacteria | 1096 |
| 178 | Ga0070693_101302612 | 3300005547 | Archaea | 562 |
| 179 | Ga0070665_101615447 | 3300005548 | Unclassified | 656 |
| 180 | Ga0070704_100351153 | 3300005549 | Bacteria | 1245 |
| 181 | Ga0070704_100504044 | 3300005549 | Bacteria | 1051 |
| 182 | Ga0070704_100697655 | 3300005549 | Bacteria | 900 |
| 183 | Ga0068855_100552044 | 3300005563 | Bacteria | 1247 |
| 184 | Ga0068855_100633736 | 3300005563 | Bacteria | 1150 |
| 185 | Ga0068855_101454769 | 3300005563 | Bacteria | 705 |
| 186 | Ga0070664_100217324 | 3300005564 | Bacteria | 1709 |
| 187 | Ga0070664_100305274 | 3300005564 | Bacteria | 1439 |
| 188 | Ga0070664_100557472 | 3300005564 | Bacteria | 1060 |
| 189 | Ga0068857_100023736 | 3300005577 | Bacteria | 5399 |
| 190 | Ga0068857_100393189 | 3300005577 | Bacteria | 1289 |
| 191 | Ga0068857_100542334 | 3300005577 | Bacteria | 1095 |
| 192 | Ga0068857_101935507 | 3300005577 | Bacteria | 578 |
| 193 | Ga0068854_100652122 | 3300005578 | Bacteria | 904 |
| 194 | Ga0068854_101383240 | 3300005578 | Unclassified | 636 |
| 195 | Ga0068856_100092009 | 3300005614 | Bacteria | 3017 |
| 196 | Ga0068856_100119488 | 3300005614 | Unclassified | 2637 |
| 197 | Ga0068856_100134929 | 3300005614 | Bacteria | 2473 |
| 198 | Ga0068856_100232774 | 3300005614 | Bacteria | 1857 |
| 199 | Ga0068856_100414290 | 3300005614 | Bacteria | 1367 |
| 200 | Ga0068856_100780009 | 3300005614 | Unclassified | 976 |
| 201 | Ga0068856_100919393 | 3300005614 | Bacteria | 894 |
| 202 | Ga0068856_101356382 | 3300005614 | Bacteria | 726 |
| 203 | Ga0068856_101697074 | 3300005614 | Bacteria | 644 |
| 204 | Ga0068856_101926976 | 3300005614 | Unclassified | 602 |
| 205 | Ga0070702_100589310 | 3300005615 | Bacteria | 832 |
| 206 | Ga0068852_100806853 | 3300005616 | Bacteria | 953 |
| 207 | Ga0068852_101012135 | 3300005616 | Bacteria | 850 |
| 208 | Ga0068864_100080980 | 3300005618 | Bacteria | 2846 |
| 209 | Ga0068864_101294452 | 3300005618 | Bacteria | 729 |
| 210 | Ga0068866_10106114 | 3300005718 | Bacteria | 1559 |
| 211 | Ga0068861_100091730 | 3300005719 | Unclassified | 2399 |
| 212 | Ga0068861_100672476 | 3300005719 | Bacteria | 959 |
| 213 | Ga0068858_100970667 | 3300005842 | Bacteria | 832 |
| 214 | Ga0068862_100299449 | 3300005844 | Bacteria | 1479 |
| 215 | Ga0068862_101340907 | 3300005844 | Bacteria | 718 |
| 216 | Ga0081455_10007511 | 3300005937 | Bacteria | 11466 |
| 217 | Ga0081455_10023070 | 3300005937 | Bacteria | 5797 |
| 218 | Ga0081455_10094023 | 3300005937 | Bacteria | 2422 |
| 219 | Ga0081455_10101149 | 3300005937 | Bacteria | 2314 |
| 220 | Ga0081455_10201776 | 3300005937 | Bacteria | 1489 |
| 221 | Ga0081455_10369269 | 3300005937 | Bacteria | 1006 |
| 222 | Ga0081538_10001520 | 3300005981 | Bacteria | 23798 |
| 223 | Ga0081538_10015038 | 3300005981 | Bacteria | 6019 |
| 224 | Ga0081538_10020089 | 3300005981 | Bacteria | 4934 |
| 225 | Ga0081540_1003521 | 3300005983 | Bacteria | 12352 |
| 226 | Ga0081540_1004841 | 3300005983 | Bacteria | 10144 |
| 227 | Ga0081540_1005736 | 3300005983 | Bacteria | 9204 |
| 228 | Ga0081539_10004400 | 3300005985 | Bacteria | 15613 |
| 229 | Ga0081539_10009156 | 3300005985 | Bacteria | 8360 |
| 230 | Ga0070717_10051942 | 3300006028 | Bacteria | 3375 |
| 231 | Ga0070717_10114022 | 3300006028 | Bacteria | 2308 |
| 232 | Ga0070717_10162376 | 3300006028 | Bacteria | 1939 |
| 233 | Ga0070717_10680891 | 3300006028 | Bacteria | 934 |
| 234 | Ga0075365_10163247 | 3300006038 | Bacteria | 1553 |
| 235 | Ga0075432_10007543 | 3300006058 | Bacteria | 3706 |
| 236 | Ga0075432_10206081 | 3300006058 | Bacteria | 780 |
| 237 | Ga0075432_10262956 | 3300006058 | Bacteria | 704 |
| 238 | Ga0070715_10001432 | 3300006163 | Bacteria | 6907 |
| 239 | Ga0070715_10091023 | 3300006163 | Bacteria | 1404 |
| 240 | Ga0070716_100007454 | 3300006173 | Bacteria | 5389 |
| 241 | Ga0070716_100057189 | 3300006173 | Bacteria | 2240 |
| 242 | Ga0070716_100093535 | 3300006173 | Unclassified | 1825 |
| 243 | Ga0070716_100179184 | 3300006173 | Bacteria | 1390 |
| 244 | Ga0070716_100443040 | 3300006173 | Bacteria | 945 |
| 245 | Ga0070712_100030861 | 3300006175 | Bacteria | 3606 |
| 246 | Ga0070712_100119030 | 3300006175 | Bacteria | 1984 |
| 247 | Ga0070712_100131979 | 3300006175 | Bacteria | 1894 |
| 248 | Ga0070712_100157941 | 3300006175 | Bacteria | 1748 |
| 249 | Ga0070712_100340252 | 3300006175 | Bacteria | 1225 |
| 250 | Ga0070712_101345197 | 3300006175 | Bacteria | 623 |
| 251 | Ga0070712_101495734 | 3300006175 | Bacteria | 590 |
| 252 | Ga0097621_100004581 | 3300006237 | Bacteria | 9646 |
| 253 | Ga0068871_100010878 | 3300006358 | Bacteria | 6662 |
| 254 | Ga0075428_100076499 | 3300006844 | Bacteria | 3654 |
| 255 | Ga0075428_100091758 | 3300006844 | Bacteria | 3312 |
| 256 | Ga0075428_100402164 | 3300006844 | Bacteria | 1468 |
| 257 | Ga0075428_100475348 | 3300006844 | Bacteria | 1338 |
| 258 | Ga0075428_100548781 | 3300006844 | Unclassified | 1235 |
| 259 | Ga0075428_100622473 | 3300006844 | Bacteria | 1152 |
| 260 | Ga0075428_100858072 | 3300006844 | Bacteria | 964 |
| 261 | Ga0075430_100051989 | 3300006846 | Bacteria | 3450 |
| 262 | Ga0075431_100120062 | 3300006847 | Unclassified | 2712 |
| 263 | Ga0075431_100145004 | 3300006847 | Bacteria | 2447 |
| 264 | Ga0075431_100338757 | 3300006847 | Unclassified | 1514 |
| 265 | Ga0075431_100375133 | 3300006847 | Bacteria | 1427 |
| 266 | Ga0075431_100460084 | 3300006847 | Unclassified | 1267 |
| 267 | Ga0075431_100605146 | 3300006847 | Bacteria | 1080 |
| 268 | Ga0075433_10105460 | 3300006852 | Bacteria | 2497 |
| 269 | Ga0075433_10135561 | 3300006852 | Unclassified | 2188 |
| 270 | Ga0075433_10170962 | 3300006852 | Bacteria | 1934 |
| 271 | Ga0075433_10349539 | 3300006852 | Bacteria | 1307 |
| 272 | Ga0075433_10364269 | 3300006852 | Bacteria | 1277 |
| 273 | Ga0075433_10465645 | 3300006852 | Bacteria | 1114 |
| 274 | Ga0075434_100037397 | 3300006871 | Bacteria | 4805 |
| 275 | Ga0075434_100171687 | 3300006871 | Unclassified | 2188 |
| 276 | Ga0075434_100172430 | 3300006871 | Unclassified | 2183 |
| 277 | Ga0075434_100192823 | 3300006871 | Bacteria | 2058 |
| 278 | Ga0075434_100677681 | 3300006871 | Bacteria | 1049 |
| 279 | Ga0075434_100760639 | 3300006871 | Unclassified | 986 |
| 280 | Ga0075434_101671256 | 3300006871 | Unclassified | 645 |
| 281 | Ga0075429_100204890 | 3300006880 | Bacteria | 1728 |
| 282 | Ga0068865_100179918 | 3300006881 | Unclassified | 1628 |
| 283 | Ga0075436_100009822 | 3300006914 | Bacteria | 6544 |
| 284 | Ga0075436_100099510 | 3300006914 | Unclassified | 2024 |
| 285 | Ga0075436_100099809 | 3300006914 | Bacteria | 2021 |
| 286 | Ga0075436_100202332 | 3300006914 | Bacteria | 1407 |
| 287 | Ga0075436_100234624 | 3300006914 | Bacteria | 1304 |
| 288 | Ga0075436_100557991 | 3300006914 | Unclassified | 841 |
| 289 | Ga0075436_101493887 | 3300006914 | Unclassified | 513 |
| 290 | Ga0075435_100120367 | 3300007076 | Unclassified | 2190 |
| 291 | Ga0075435_100126128 | 3300007076 | Unclassified | 2139 |
| 292 | Ga0075435_100298973 | 3300007076 | Bacteria | 1376 |
| 293 | Ga0075435_100422093 | 3300007076 | Bacteria | 1149 |
| 294 | Ga0075435_100543856 | 3300007076 | Bacteria | 1005 |
| 295 | Ga0075435_100809438 | 3300007076 | Bacteria | 816 |
| 296 | Ga0105240_10097691 | 3300009093 | Bacteria | 3578 |
| 297 | Ga0105240_10124169 | 3300009093 | Unclassified | 3105 |
| 298 | Ga0105240_10206929 | 3300009093 | Bacteria | 2296 |
| 299 | Ga0105240_10217152 | 3300009093 | Bacteria | 2230 |
| 300 | Ga0105240_10266972 | 3300009093 | Bacteria | 1972 |
| 301 | Ga0111539_10030639 | 3300009094 | Bacteria | 6539 |
| 302 | Ga0111539_10076953 | 3300009094 | Bacteria | 3928 |
| 303 | Ga0111539_10114917 | 3300009094 | Bacteria | 3157 |
| 304 | Ga0111539_10126418 | 3300009094 | Unclassified | 2995 |
| 305 | Ga0111539_10228451 | 3300009094 | Unclassified | 2167 |
| 306 | Ga0111539_10232618 | 3300009094 | Unclassified | 2146 |
| 307 | Ga0111539_10296701 | 3300009094 | Unclassified | 1881 |
| 308 | Ga0111539_10431633 | 3300009094 | Bacteria | 1534 |
| 309 | Ga0111539_12568041 | 3300009094 | Unclassified | 591 |
| 310 | Ga0105245_10007926 | 3300009098 | Bacteria | 9289 |
| 311 | Ga0105245_10008291 | 3300009098 | Bacteria | 9079 |
| 312 | Ga0105245_10026357 | 3300009098 | Bacteria | 5116 |
| 313 | Ga0105245_10093597 | 3300009098 | Bacteria | 2769 |
| 314 | Ga0105245_10218542 | 3300009098 | Bacteria | 1838 |
| 315 | Ga0105245_10395855 | 3300009098 | Bacteria | 1379 |
| 316 | Ga0105245_10405947 | 3300009098 | Bacteria | 1363 |
| 317 | Ga0105245_10568236 | 3300009098 | Bacteria | 1157 |
| 318 | Ga0105245_10778059 | 3300009098 | Bacteria | 994 |
| 319 | Ga0105245_10959045 | 3300009098 | Bacteria | 898 |
| 320 | Ga0105247_10643525 | 3300009101 | Bacteria | 791 |
| 321 | Ga0114129_10033209 | 3300009147 | Bacteria | 7292 |
| 322 | Ga0114129_10088938 | 3300009147 | Bacteria | 4281 |
| 323 | Ga0114129_10139384 | 3300009147 | Bacteria | 3326 |
| 324 | Ga0114129_10177421 | 3300009147 | Bacteria | 2901 |
| 325 | Ga0114129_10441546 | 3300009147 | Unclassified | 1708 |
| 326 | Ga0114129_10884093 | 3300009147 | Bacteria | 1133 |
| 327 | Ga0105243_10118934 | 3300009148 | Bacteria | 2224 |
| 328 | Ga0105243_10283088 | 3300009148 | Bacteria | 1494 |
| 329 | Ga0105243_10432289 | 3300009148 | Bacteria | 1231 |
| 330 | Ga0105243_11227973 | 3300009148 | Bacteria | 764 |
| 331 | Ga0105241_10061816 | 3300009174 | Bacteria | 2885 |
| 332 | Ga0105241_10254921 | 3300009174 | Bacteria | 1489 |
| 333 | Ga0105241_11277974 | 3300009174 | Unclassified | 698 |
| 334 | Ga0105242_10088446 | 3300009176 | Bacteria | 2602 |
| 335 | Ga0105242_10096667 | 3300009176 | Bacteria | 2496 |
| 336 | Ga0105242_10107711 | 3300009176 | Bacteria | 2371 |
| 337 | Ga0105242_10126861 | 3300009176 | Bacteria | 2197 |
| 338 | Ga0105242_10331340 | 3300009176 | Bacteria | 1400 |
| 339 | Ga0105242_10700584 | 3300009176 | Bacteria | 991 |
| 340 | Ga0105248_10436540 | 3300009177 | Bacteria | 1475 |
| 341 | Ga0105248_11450750 | 3300009177 | Bacteria | 777 |
| 342 | Ga0105248_11763870 | 3300009177 | Bacteria | 702 |
| 343 | Ga0105237_11272068 | 3300009545 | Bacteria | 742 |
| 344 | Ga0105237_11649394 | 3300009545 | Unclassified | 648 |
| 345 | Ga0105238_10495828 | 3300009551 | Bacteria | 1222 |
| 346 | Ga0105249_10127509 | 3300009553 | Bacteria | 2425 |
| 347 | Ga0105249_10197361 | 3300009553 | Bacteria | 1967 |
| 348 | Ga0105249_10277147 | 3300009553 | Bacteria | 1673 |
| 349 | Ga0105249_10665464 | 3300009553 | Bacteria | 1099 |
| 350 | Ga0105239_10171359 | 3300010375 | Bacteria | 2427 |
| 351 | Ga0105239_10175522 | 3300010375 | Unclassified | 2396 |
| 352 | Ga0105239_10183220 | 3300010375 | Bacteria | 2343 |
| 353 | Ga0105239_10252879 | 3300010375 | Bacteria | 1979 |
| 354 | Ga0105239_10340984 | 3300010375 | Bacteria | 1691 |
| 355 | Ga0105239_10690499 | 3300010375 | Bacteria | 1167 |
| 356 | Ga0105239_11056062 | 3300010375 | Bacteria | 935 |
| 357 | Ga0105239_11688944 | 3300010375 | Bacteria | 733 |
| 358 | Ga0105246_10219494 | 3300011119 | Bacteria | 1489 |
| 359 | Ga0105246_10316013 | 3300011119 | Bacteria | 1267 |
| 360 | Ga0105246_10911345 | 3300011119 | Bacteria | 789 |
| 361 | Ga0157320_1022351 | 3300012481 | Unclassified | 586 |
| 362 | Ga0157325_1022521 | 3300012485 | Bacteria | 574 |
| 363 | Ga0157335_1008208 | 3300012492 | Bacteria | 796 |
| 364 | Ga0157314_1028394 | 3300012500 | Unclassified | 615 |
| 365 | Ga0157314_1033163 | 3300012500 | Bacteria | 590 |
| 366 | Ga0157326_1014033 | 3300012513 | Bacteria | 929 |
| 367 | Ga0157373_10250024 | 3300013100 | Unclassified | 1254 |
| 368 | Ga0157373_10336544 | 3300013100 | Bacteria | 1075 |
| 369 | Ga0157373_10881326 | 3300013100 | Bacteria | 663 |
| 370 | Ga0157371_10189602 | 3300013102 | Bacteria | 1472 |
| 371 | Ga0157371_10278725 | 3300013102 | Bacteria | 1207 |
| 372 | Ga0157371_10425488 | 3300013102 | Bacteria | 974 |
| 373 | Ga0157370_10238235 | 3300013104 | Bacteria | 1684 |
| 374 | Ga0157370_10750006 | 3300013104 | Unclassified | 889 |
| 375 | Ga0157369_10311567 | 3300013105 | Bacteria | 1637 |
| 376 | Ga0157369_10478426 | 3300013105 | Bacteria | 1289 |
| 377 | Ga0157369_10657150 | 3300013105 | Bacteria | 1081 |
| 378 | Ga0157369_11072493 | 3300013105 | Bacteria | 824 |
| 379 | Ga0157369_11243778 | 3300013105 | Bacteria | 759 |
| 380 | Ga0157374_10070018 | 3300013296 | Bacteria | 3304 |
| 381 | Ga0157374_11166948 | 3300013296 | Bacteria | 791 |
| 382 | Ga0157374_11656427 | 3300013296 | Unclassified | 664 |
| 383 | Ga0157378_10329329 | 3300013297 | Bacteria | 1486 |
| 384 | Ga0157378_10460598 | 3300013297 | Bacteria | 1263 |
| 385 | Ga0157378_13268364 | 3300013297 | Bacteria | 504 |
| 386 | Ga0163162_10104789 | 3300013306 | Bacteria | 2923 |
| 387 | Ga0163162_10264516 | 3300013306 | Bacteria | 1851 |
| 388 | Ga0163162_10538765 | 3300013306 | Bacteria | 1296 |
| 389 | Ga0157372_10394651 | 3300013307 | Bacteria | 1612 |
| 390 | Ga0157372_10620350 | 3300013307 | Bacteria | 1260 |
| 391 | Ga0157372_10704310 | 3300013307 | Unclassified | 1175 |
| 392 | Ga0157372_12391553 | 3300013307 | Unclassified | 607 |
| 393 | Ga0157372_12775560 | 3300013307 | Bacteria | 562 |
| 394 | Ga0157375_10095382 | 3300013308 | Bacteria | 3045 |
| 395 | Ga0157375_10195506 | 3300013308 | Bacteria | 2178 |
| 396 | Ga0157375_10395948 | 3300013308 | Bacteria | 1548 |
| 397 | Ga0157375_10765328 | 3300013308 | Bacteria | 1116 |
| 398 | Ga0157375_11334706 | 3300013308 | Bacteria | 844 |
| 399 | Ga0157375_12843690 | 3300013308 | Bacteria | 579 |
| 400 | Ga0163163_10345950 | 3300014325 | Bacteria | 1542 |
| 401 | Ga0182008_10007996 | 3300014497 | Bacteria | 5796 |
| 402 | Ga0182008_10030573 | 3300014497 | Bacteria | 2714 |
| 403 | Ga0182008_10234206 | 3300014497 | Bacteria | 943 |
| 404 | Ga0182008_10470615 | 3300014497 | Bacteria | 686 |
| 405 | Ga0157376_10152399 | 3300014969 | Bacteria | 2086 |
| 406 | Ga0157376_10506755 | 3300014969 | Bacteria | 1187 |
| 407 | Ga0157376_10599363 | 3300014969 | Bacteria | 1096 |
| 408 | Ga0157376_12380331 | 3300014969 | Unclassified | 569 |
| 409 | Ga0182006_1140307 | 3300015261 | Bacteria | 826 |
| 410 | Ga0182007_10073485 | 3300015262 | Bacteria | 1120 |
| 411 | Ga0163161_10053397 | 3300017792 | Bacteria | 2931 |
| 412 | Ga0163161_10219632 | 3300017792 | Bacteria | 1471 |
| 413 | Ga0163161_11094287 | 3300017792 | Unclassified | 685 |
| 414 | Ga0206356_10899570 | 3300020070 | Bacteria | 1857 |
| 415 | Ga0206356_11542665 | 3300020070 | Bacteria | 2161 |
| 416 | Ga0206354_10762389 | 3300020081 | Bacteria | 577 |
| 417 | Ga0206354_10957585 | 3300020081 | Bacteria | 1510 |
| 418 | Ga0206354_11589080 | 3300020081 | Unclassified | 593 |
| 419 | Ga0206353_10125552 | 3300020082 | Bacteria | 7745 |
| 420 | Ga0206353_11044796 | 3300020082 | Bacteria | 1106 |
| 421 | Ga0224712_10426978 | 3300022467 | Unclassified | 634 |
| 422 | Ga0207653_10040743 | 3300025885 | Unclassified | 1523 |
| 423 | Ga0207653_10085409 | 3300025885 | Bacteria | 1098 |
| 424 | Ga0207692_10069317 | 3300025898 | Bacteria | 1852 |
| 425 | Ga0207642_10495427 | 3300025899 | Bacteria | 747 |
| 426 | Ga0207647_10544680 | 3300025904 | Unclassified | 644 |
| 427 | Ga0207685_10004314 | 3300025905 | Bacteria | 3599 |
| 428 | Ga0207685_10040005 | 3300025905 | Bacteria | 1744 |
| 429 | Ga0207685_10305341 | 3300025905 | Bacteria | 789 |
| 430 | Ga0207699_10113977 | 3300025906 | Bacteria | 1738 |
| 431 | Ga0207699_10126905 | 3300025906 | Bacteria | 1658 |
| 432 | Ga0207699_10213518 | 3300025906 | Bacteria | 1313 |
| 433 | Ga0207699_10244174 | 3300025906 | Bacteria | 1235 |
| 434 | Ga0207699_10514380 | 3300025906 | Bacteria | 865 |
| 435 | Ga0207705_10254051 | 3300025909 | Bacteria | 1341 |
| 436 | Ga0207705_10373979 | 3300025909 | Bacteria | 1100 |
| 437 | Ga0207684_10118812 | 3300025910 | Bacteria | 2266 |
| 438 | Ga0207684_10344774 | 3300025910 | Bacteria | 1283 |
| 439 | Ga0207684_10445018 | 3300025910 | Bacteria | 1113 |
| 440 | Ga0207684_11309656 | 3300025910 | Bacteria | 596 |
| 441 | Ga0207707_10002240 | 3300025912 | Bacteria | 17485 |
| 442 | Ga0207707_10007327 | 3300025912 | Bacteria | 9610 |
| 443 | Ga0207707_10052433 | 3300025912 | Bacteria | 3552 |
| 444 | Ga0207707_10086931 | 3300025912 | Unclassified | 2732 |
| 445 | Ga0207707_10166580 | 3300025912 | Bacteria | 1926 |
| 446 | Ga0207707_10177157 | 3300025912 | Bacteria | 1862 |
| 447 | Ga0207707_10747028 | 3300025912 | Unclassified | 818 |
| 448 | Ga0207707_10747474 | 3300025912 | Bacteria | 818 |
| 449 | Ga0207695_10374530 | 3300025913 | Bacteria | 1310 |
| 450 | Ga0207695_10516075 | 3300025913 | Bacteria | 1077 |
| 451 | Ga0207695_10775729 | 3300025913 | Unclassified | 839 |
| 452 | Ga0207695_11062905 | 3300025913 | Unclassified | 689 |
| 453 | Ga0207671_10165105 | 3300025914 | Bacteria | 1716 |
| 454 | Ga0207693_10001413 | 3300025915 | Bacteria | 21296 |
| 455 | Ga0207693_10003121 | 3300025915 | Bacteria | 14264 |
| 456 | Ga0207693_10013285 | 3300025915 | Bacteria | 6644 |
| 457 | Ga0207693_10013689 | 3300025915 | Bacteria | 6535 |
| 458 | Ga0207693_10017496 | 3300025915 | Bacteria | 5716 |
| 459 | Ga0207693_10114733 | 3300025915 | Bacteria | 2114 |
| 460 | Ga0207693_10133422 | 3300025915 | Bacteria | 1952 |
| 461 | Ga0207693_10136163 | 3300025915 | Bacteria | 1931 |
| 462 | Ga0207693_10255588 | 3300025915 | Bacteria | 1374 |
| 463 | Ga0207693_10807937 | 3300025915 | Unclassified | 723 |
| 464 | Ga0207663_10011530 | 3300025916 | Bacteria | 4748 |
| 465 | Ga0207663_10153012 | 3300025916 | Unclassified | 1620 |
| 466 | Ga0207663_10154712 | 3300025916 | Bacteria | 1612 |
| 467 | Ga0207663_10164858 | 3300025916 | Bacteria | 1568 |
| 468 | Ga0207663_10193643 | 3300025916 | Bacteria | 1461 |
| 469 | Ga0207663_11293934 | 3300025916 | Bacteria | 587 |
| 470 | Ga0207660_10025605 | 3300025917 | Bacteria | 4007 |
| 471 | Ga0207660_10083463 | 3300025917 | Bacteria | 2353 |
| 472 | Ga0207660_10143095 | 3300025917 | Bacteria | 1830 |
| 473 | Ga0207660_10188300 | 3300025917 | Bacteria | 1606 |
| 474 | Ga0207660_10230151 | 3300025917 | Bacteria | 1457 |
| 475 | Ga0207660_10403758 | 3300025917 | Bacteria | 1101 |
| 476 | Ga0207660_10677481 | 3300025917 | Bacteria | 841 |
| 477 | Ga0207662_10195978 | 3300025918 | Bacteria | 1305 |
| 478 | Ga0207657_10004596 | 3300025919 | Bacteria | 14587 |
| 479 | Ga0207657_10007905 | 3300025919 | Bacteria | 10847 |
| 480 | Ga0207657_10063649 | 3300025919 | Bacteria | 3152 |
| 481 | Ga0207657_10066420 | 3300025919 | Bacteria | 3070 |
| 482 | Ga0207657_10170731 | 3300025919 | Bacteria | 1762 |
| 483 | Ga0207649_10135445 | 3300025920 | Bacteria | 1679 |
| 484 | Ga0207649_10469451 | 3300025920 | Bacteria | 953 |
| 485 | Ga0207649_10889868 | 3300025920 | Unclassified | 698 |
| 486 | Ga0207649_10930468 | 3300025920 | Bacteria | 682 |
| 487 | Ga0207652_10050250 | 3300025921 | Bacteria | 3572 |
| 488 | Ga0207652_10060178 | 3300025921 | Bacteria | 3276 |
| 489 | Ga0207652_10347002 | 3300025921 | Bacteria | 1340 |
| 490 | Ga0207652_10983054 | 3300025921 | Bacteria | 742 |
| 491 | Ga0207646_10023032 | 3300025922 | Bacteria | 5727 |
| 492 | Ga0207646_10024884 | 3300025922 | Bacteria | 5479 |
| 493 | Ga0207646_10127417 | 3300025922 | Bacteria | 2289 |
| 494 | Ga0207646_10184044 | 3300025922 | Bacteria | 1887 |
| 495 | Ga0207646_10227292 | 3300025922 | Bacteria | 1686 |
| 496 | Ga0207646_10526807 | 3300025922 | Bacteria | 1064 |
| 497 | Ga0207646_10819776 | 3300025922 | Bacteria | 828 |
| 498 | Ga0207646_11208232 | 3300025922 | Bacteria | 663 |
| 499 | Ga0207681_10440473 | 3300025923 | Bacteria | 1059 |
| 500 | Ga0207659_10156308 | 3300025926 | Bacteria | 1786 |
| 501 | Ga0207687_10005471 | 3300025927 | Bacteria | 8397 |
| 502 | Ga0207687_10034631 | 3300025927 | Bacteria | 3429 |
| 503 | Ga0207687_10036457 | 3300025927 | Bacteria | 3351 |
| 504 | Ga0207687_10267586 | 3300025927 | Bacteria | 1365 |
| 505 | Ga0207687_10505797 | 3300025927 | Bacteria | 1009 |
| 506 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 507 | Ga0207700_10163551 | 3300025928 | Bacteria | 1850 |
| 508 | Ga0207700_10168395 | 3300025928 | Bacteria | 1825 |
| 509 | Ga0207700_10262180 | 3300025928 | Bacteria | 1480 |
| 510 | Ga0207700_10340745 | 3300025928 | Bacteria | 1303 |
| 511 | Ga0207664_10034516 | 3300025929 | Unclassified | 3896 |
| 512 | Ga0207664_10078694 | 3300025929 | Bacteria | 2674 |
| 513 | Ga0207664_10154879 | 3300025929 | Bacteria | 1950 |
| 514 | Ga0207664_10240571 | 3300025929 | Bacteria | 1576 |
| 515 | Ga0207664_10255563 | 3300025929 | Bacteria | 1531 |
| 516 | Ga0207664_10257255 | 3300025929 | Bacteria | 1526 |
| 517 | Ga0207664_10268057 | 3300025929 | Bacteria | 1495 |
| 518 | Ga0207664_10292632 | 3300025929 | Bacteria | 1431 |
| 519 | Ga0207664_10632595 | 3300025929 | Bacteria | 961 |
| 520 | Ga0207664_10758076 | 3300025929 | Bacteria | 873 |
| 521 | Ga0207664_11270685 | 3300025929 | Bacteria | 655 |
| 522 | Ga0207644_10464614 | 3300025931 | Bacteria | 1041 |
| 523 | Ga0207644_11564444 | 3300025931 | Bacteria | 553 |
| 524 | Ga0207690_10083851 | 3300025932 | Bacteria | 2233 |
| 525 | Ga0207690_10252101 | 3300025932 | Bacteria | 1364 |
| 526 | Ga0207706_10033829 | 3300025933 | Bacteria | 4549 |
| 527 | Ga0207706_10134566 | 3300025933 | Bacteria | 2174 |
| 528 | Ga0207706_10177781 | 3300025933 | Bacteria | 1869 |
| 529 | Ga0207686_10020098 | 3300025934 | Bacteria | 3810 |
| 530 | Ga0207686_10276017 | 3300025934 | Bacteria | 1239 |
| 531 | Ga0207686_10474743 | 3300025934 | Bacteria | 966 |
| 532 | Ga0207709_10020706 | 3300025935 | Bacteria | 3714 |
| 533 | Ga0207709_10164136 | 3300025935 | Bacteria | 1552 |
| 534 | Ga0207709_10346551 | 3300025935 | Bacteria | 1120 |
| 535 | Ga0207709_10617949 | 3300025935 | Unclassified | 860 |
| 536 | Ga0207709_10793775 | 3300025935 | Bacteria | 764 |
| 537 | Ga0207709_11217769 | 3300025935 | Bacteria | 621 |
| 538 | Ga0207669_10085042 | 3300025937 | Bacteria | 2041 |
| 539 | Ga0207669_10389140 | 3300025937 | Unclassified | 1089 |
| 540 | Ga0207665_10016651 | 3300025939 | Bacteria | 4828 |
| 541 | Ga0207665_10058834 | 3300025939 | Bacteria | 2599 |
| 542 | Ga0207665_10287137 | 3300025939 | Bacteria | 1226 |
| 543 | Ga0207665_10555025 | 3300025939 | Bacteria | 893 |
| 544 | Ga0207691_10942219 | 3300025940 | Unclassified | 722 |
| 545 | Ga0207711_10160899 | 3300025941 | Bacteria | 2032 |
| 546 | Ga0207711_11331653 | 3300025941 | Bacteria | 660 |
| 547 | Ga0207661_10000267 | 3300025944 | Bacteria | 33777 |
| 548 | Ga0207661_10023853 | 3300025944 | Bacteria | 4628 |
| 549 | Ga0207661_10118816 | 3300025944 | Bacteria | 2248 |
| 550 | Ga0207661_10151849 | 3300025944 | Bacteria | 2003 |
| 551 | Ga0207661_10164965 | 3300025944 | Bacteria | 1924 |
| 552 | Ga0207661_10629418 | 3300025944 | Bacteria | 986 |
| 553 | Ga0207661_11023119 | 3300025944 | Unclassified | 761 |
| 554 | Ga0207661_11085809 | 3300025944 | Unclassified | 737 |
| 555 | Ga0207679_10129821 | 3300025945 | Bacteria | 2020 |
| 556 | Ga0207679_10180148 | 3300025945 | Bacteria | 1747 |
| 557 | Ga0207679_10585304 | 3300025945 | Bacteria | 1004 |
| 558 | Ga0207667_10034152 | 3300025949 | Bacteria | 5464 |
| 559 | Ga0207667_10199263 | 3300025949 | Bacteria | 2054 |
| 560 | Ga0207667_10361565 | 3300025949 | Bacteria | 1480 |
| 561 | Ga0207667_10567920 | 3300025949 | Bacteria | 1146 |
| 562 | Ga0207651_10466537 | 3300025960 | Bacteria | 1086 |
| 563 | Ga0207651_11432738 | 3300025960 | Unclassified | 622 |
| 564 | Ga0207712_10250341 | 3300025961 | Bacteria | 1432 |
| 565 | Ga0207668_10059047 | 3300025972 | Bacteria | 2685 |
| 566 | Ga0207668_10136707 | 3300025972 | Bacteria | 1879 |
| 567 | Ga0207668_11026282 | 3300025972 | Unclassified | 738 |
| 568 | Ga0207640_10303974 | 3300025981 | Bacteria | 1263 |
| 569 | Ga0207640_10514689 | 3300025981 | Bacteria | 999 |
| 570 | Ga0207658_10771610 | 3300025986 | Bacteria | 872 |
| 571 | Ga0207677_10099992 | 3300026023 | Bacteria | 2131 |
| 572 | Ga0207677_10243874 | 3300026023 | Bacteria | 1455 |
| 573 | Ga0207677_10280573 | 3300026023 | Bacteria | 1367 |
| 574 | Ga0207677_10870810 | 3300026023 | Bacteria | 810 |
| 575 | Ga0207677_10912224 | 3300026023 | Bacteria | 792 |
| 576 | Ga0207677_11053573 | 3300026023 | Bacteria | 739 |
| 577 | Ga0207639_10410316 | 3300026041 | Bacteria | 1222 |
| 578 | Ga0207678_10181432 | 3300026067 | Bacteria | 1797 |
| 579 | Ga0207678_10512200 | 3300026067 | Bacteria | 1047 |
| 580 | Ga0207678_10615382 | 3300026067 | Bacteria | 953 |
| 581 | Ga0207678_11068513 | 3300026067 | Unclassified | 715 |
| 582 | Ga0207708_10043614 | 3300026075 | Bacteria | 3418 |
| 583 | Ga0207708_10179395 | 3300026075 | Bacteria | 1681 |
| 584 | Ga0207708_10325686 | 3300026075 | Bacteria | 1255 |
| 585 | Ga0207708_10683329 | 3300026075 | Unclassified | 876 |
| 586 | Ga0207702_10023561 | 3300026078 | Bacteria | 5106 |
| 587 | Ga0207702_10112732 | 3300026078 | Bacteria | 2421 |
| 588 | Ga0207702_10158677 | 3300026078 | Bacteria | 2064 |
| 589 | Ga0207702_10273976 | 3300026078 | Bacteria | 1593 |
| 590 | Ga0207702_10316545 | 3300026078 | Bacteria | 1485 |
| 591 | Ga0207702_10344658 | 3300026078 | Bacteria | 1424 |
| 592 | Ga0207702_10521171 | 3300026078 | Bacteria | 1160 |
| 593 | Ga0207702_10775871 | 3300026078 | Bacteria | 947 |
| 594 | Ga0207702_10849098 | 3300026078 | Bacteria | 904 |
| 595 | Ga0207702_10960818 | 3300026078 | Unclassified | 847 |
| 596 | Ga0207702_11545579 | 3300026078 | Bacteria | 657 |
| 597 | Ga0207648_10141020 | 3300026089 | Bacteria | 2124 |
| 598 | Ga0207648_10298118 | 3300026089 | Bacteria | 1445 |
| 599 | Ga0207676_10107189 | 3300026095 | Bacteria | 2330 |
| 600 | Ga0207674_10002797 | 3300026116 | Bacteria | 21726 |
| 601 | Ga0207674_10123097 | 3300026116 | Bacteria | 2559 |
| 602 | Ga0207674_10380690 | 3300026116 | Unclassified | 1364 |
| 603 | Ga0207674_10545070 | 3300026116 | Bacteria | 1121 |
| 604 | Ga0207675_100103035 | 3300026118 | Bacteria | 2689 |
| 605 | Ga0207675_100125783 | 3300026118 | Unclassified | 2428 |
| 606 | Ga0207675_100176725 | 3300026118 | Bacteria | 2043 |
| 607 | Ga0207683_10015292 | 3300026121 | Bacteria | 6532 |
| 608 | Ga0207683_10060043 | 3300026121 | Bacteria | 3341 |
| 609 | Ga0207683_10249982 | 3300026121 | Bacteria | 1618 |
| 610 | Ga0207683_10783881 | 3300026121 | Bacteria | 885 |
| 611 | Ga0207698_10177255 | 3300026142 | Bacteria | 1884 |
| 612 | Ga0207698_11415995 | 3300026142 | Bacteria | 710 |
| 613 | Ga0207428_10005283 | 3300027907 | Bacteria | 12063 |
| 614 | Ga0207428_10060435 | 3300027907 | Unclassified | 3003 |
| 615 | Ga0207428_10066174 | 3300027907 | Bacteria | 2848 |
| 616 | Ga0268265_10204197 | 3300028380 | Bacteria | 1717 |
| 617 | Ga0268265_10570981 | 3300028380 | Unclassified | 1077 |
| 618 | Ga0268265_10864491 | 3300028380 | Bacteria | 886 |
| 619 | Ga0265337_1033484 | 3300028556 | Bacteria | 1516 |
| 620 | Ga0265319_1000701 | 3300028563 | Bacteria | 21865 |
| 621 | Ga0265319_1003960 | 3300028563 | Bacteria | 7519 |
| 622 | Ga0265319_1011867 | 3300028563 | Bacteria | 3546 |
| 623 | Ga0265334_10001490 | 3300028573 | Bacteria | 11295 |
| 624 | Ga0265334_10017585 | 3300028573 | Bacteria | 2951 |
| 625 | Ga0265334_10325638 | 3300028573 | Bacteria | 526 |
| 626 | Ga0265318_10000400 | 3300028577 | Bacteria | 33867 |
| 627 | Ga0265318_10006430 | 3300028577 | Bacteria | 5410 |
| 628 | Ga0265318_10066769 | 3300028577 | Bacteria | 1336 |
| 629 | Ga0265322_10007571 | 3300028654 | Bacteria | 3165 |
| 630 | Ga0265336_10015536 | 3300028666 | Bacteria | 2501 |
| 631 | Ga0265336_10022494 | 3300028666 | Bacteria | 2007 |
| 632 | Ga0265338_10004790 | 3300028800 | Bacteria | 18080 |
| 633 | Ga0265338_10007252 | 3300028800 | Bacteria | 13838 |
| 634 | Ga0265324_10021766 | 3300029957 | Bacteria | 2297 |
| 635 | Ga0265330_10001899 | 3300031235 | Bacteria | 11622 |
| 636 | Ga0265330_10022449 | 3300031235 | Bacteria | 2871 |
| 637 | Ga0265330_10205768 | 3300031235 | Bacteria | 832 |
| 638 | Ga0265332_10003587 | 3300031238 | Bacteria | 7443 |
| 639 | Ga0265332_10123366 | 3300031238 | Bacteria | 1088 |
| 640 | Ga0265328_10004911 | 3300031239 | Bacteria | 5760 |
| 641 | Ga0265328_10087007 | 3300031239 | Bacteria | 1154 |
| 642 | Ga0265320_10016387 | 3300031240 | Unclassified | 4154 |
| 643 | Ga0265320_10077209 | 3300031240 | Bacteria | 1559 |
| 644 | Ga0265325_10004124 | 3300031241 | Bacteria | 9242 |
| 645 | Ga0265325_10060946 | 3300031241 | Bacteria | 1915 |
| 646 | Ga0265329_10004136 | 3300031242 | Bacteria | 6129 |
| 647 | Ga0265340_10012992 | 3300031247 | Bacteria | 4386 |
| 648 | Ga0265340_10062734 | 3300031247 | Bacteria | 1774 |
| 649 | Ga0265339_10006743 | 3300031249 | Bacteria | 7497 |
| 650 | Ga0265339_10018324 | 3300031249 | Bacteria | 4127 |
| 651 | Ga0265339_10234252 | 3300031249 | Bacteria | 894 |
| 652 | Ga0265331_10016699 | 3300031250 | Unclassified | 3846 |
| 653 | Ga0265327_10011945 | 3300031251 | Bacteria | 5918 |
| 654 | Ga0265327_10016620 | 3300031251 | Bacteria | 4662 |
| 655 | Ga0265316_10009256 | 3300031344 | Bacteria | 9069 |
| 656 | Ga0265316_10013876 | 3300031344 | Bacteria | 7129 |
| 657 | Ga0265316_10047506 | 3300031344 | Bacteria | 3395 |
| 658 | Ga0265316_10323392 | 3300031344 | Bacteria | 1120 |
| 659 | Ga0265313_10011443 | 3300031595 | Bacteria | 5514 |
| 660 | Ga0265313_10200340 | 3300031595 | Bacteria | 831 |
| 661 | Ga0265314_10025003 | 3300031711 | Bacteria | 4514 |
| 662 | Ga0265314_10114538 | 3300031711 | Bacteria | 1708 |
| 663 | Ga0265342_10011944 | 3300031712 | Bacteria | 5902 |
| 664 | Ga0265342_10096550 | 3300031712 | Bacteria | 1689 |
| 665 | Ga0307406_10032550 | 3300031901 | Bacteria | 3184 |
| 666 | Ga0307406_10333844 | 3300031901 | Bacteria | 1178 |
| 667 | Ga0307409_100318484 | 3300031995 | Unclassified | 1454 |
| 668 | Ga0307416_100094801 | 3300032002 | Bacteria | 2575 |
| 669 | Ga0307416_100394910 | 3300032002 | Bacteria | 1418 |
| 670 | Ga0307416_100805392 | 3300032002 | Bacteria | 1035 |
| 671 | Ga0307411_10341940 | 3300032005 | Bacteria | 1216 |
| 672 | Ga0307415_100082901 | 3300032126 | Bacteria | 2295 |
| 673 | Ga0307415_100084225 | 3300032126 | Bacteria | 2281 |
| 674 | Ga0307415_100114369 | 3300032126 | Bacteria | 2009 |
| 675 | Ga0373948_0001030 | 3300034817 | Bacteria | 3751 |
| 676 | Ga0373950_0001374 | 3300034818 | Bacteria | 3163 |
| 677 | Ga0373959_0016523 | 3300034820 | Bacteria | 1368 |
| 678 | Ga0373959_0194784 | 3300034820 | Bacteria | 533 |
| 679 | Ga0373928_0009302 | 3300035084 | Bacteria | 1918 |
| 680 | Ga0373928_0043252 | 3300035084 | Bacteria | 1042 |
| 681 | Ga0373929_0174764 | 3300035085 | Bacteria | 589 |
| 682 | Ga0373944_0006430 | 3300035089 | Bacteria | 3121 |
| 683 | Ga0373949_0002456 | 3300035090 | Bacteria | 4758 |
| 684 | Ga0373951_0010117 | 3300035091 | Bacteria | 2117 |
| 685 | Ga0373932_0006861 | 3300035112 | Bacteria | 2704 |
| 686 | Ga0373932_0102548 | 3300035112 | Bacteria | 933 |
| 687 | Ga0373945_0013670 | 3300035116 | Bacteria | 2712 |
| 688 | Ga0373953_0514112 | 3300035117 | Bacteria | 531 |
| 689 | Ga0373960_0000659 | 3300035121 | Bacteria | 7106 |
| 690 | Ga0373960_0082049 | 3300035121 | Bacteria | 1017 |
| 691 | Ga0373960_0161335 | 3300035121 | Unclassified | 772 |
| 692 | Ga0373943_0044893 | 3300035170 | Bacteria | 2152 |
| 693 | Ga0373943_0090860 | 3300035170 | Bacteria | 1581 |
| 694 | Ga0373946_0025050 | 3300035171 | Bacteria | 2344 |
| 695 | Ga0373942_0033826 | 3300035207 | Bacteria | 1365 |
| 696 | Ga0373942_0245166 | 3300035207 | Bacteria | 607 |
| 697 | Ga0373961_0004945 | 3300035241 | Bacteria | 3202 |
| 698 | Ga0373961_0022155 | 3300035241 | Bacteria | 1698 |
| 699 | Ga0373962_0021984 | 3300035242 | Bacteria | 1687 |
| 700 | Ga0373935_0059860 | 3300035692 | Bacteria | 2436 |
| 701 | Ga0373935_0149648 | 3300035692 | Bacteria | 1583 |
| 702 | Ga0373935_0337221 | 3300035692 | Bacteria | 1073 |
| 703 | Ga0373927_0178107 | 3300035695 | Bacteria | 1394 |
| 704 | Ga0373947_0008709 | 3300035725 | Bacteria | 5839 |
| 705 | Ga0373925_0001380 | 3300037068 | Bacteria | 21135 |
| 706 | Ga0373925_0258569 | 3300037068 | Bacteria | 1398 |
| 707 | Ga0373925_1575372 | 3300037068 | Bacteria | 537 |
| 708 | Ga0395899_0002522 | 3300037312 | Bacteria | 14832 |
| 709 | Ga0395899_0002768 | 3300037312 | Bacteria | 14153 |
| 710 | Ga0395899_0010024 | 3300037312 | Bacteria | 7265 |
| 711 | Ga0395899_0029486 | 3300037312 | Bacteria | 4127 |
| 712 | Ga0395899_0031542 | 3300037312 | Bacteria | 3982 |
| 713 | Ga0395899_0066853 | 3300037312 | Bacteria | 2639 |
| 714 | Ga0395899_0277901 | 3300037312 | Bacteria | 1140 |
| 715 | Ga0395899_0301650 | 3300037312 | Bacteria | 1084 |
| 716 | Ga0395899_0305049 | 3300037312 | Unclassified | 1076 |
| 717 | Ga0395899_0352887 | 3300037312 | Unclassified | 983 |
| 718 | Ga0395899_0515976 | 3300037312 | Bacteria | 773 |
| 719 | Ga0395899_0918796 | 3300037312 | Unclassified | 533 |
| 720 | Ga0395900_0004816 | 3300037418 | Bacteria | 14214 |
| 721 | Ga0395900_0008116 | 3300037418 | Bacteria | 10810 |
| 722 | Ga0395900_0013683 | 3300037418 | Bacteria | 8284 |
| 723 | Ga0395900_0015373 | 3300037418 | Bacteria | 7801 |
| 724 | Ga0395900_0015535 | 3300037418 | Bacteria | 7759 |
| 725 | Ga0395900_0020954 | 3300037418 | Bacteria | 6681 |
| 726 | Ga0395900_0026748 | 3300037418 | Bacteria | 5906 |
| 727 | Ga0395900_0027465 | 3300037418 | Bacteria | 5830 |
| 728 | Ga0395900_0046433 | 3300037418 | Bacteria | 4472 |
| 729 | Ga0395900_0062783 | 3300037418 | Bacteria | 3818 |
| 730 | Ga0395900_0100089 | 3300037418 | Bacteria | 2977 |
| 731 | Ga0395900_0114957 | 3300037418 | Bacteria | 2762 |
| 732 | Ga0395900_0172194 | 3300037418 | Bacteria | 2203 |
| 733 | Ga0395900_0290128 | 3300037418 | Bacteria | 1625 |
| 734 | Ga0395900_0351192 | 3300037418 | Bacteria | 1448 |
| 735 | Ga0395900_0363073 | 3300037418 | Bacteria | 1419 |
| 736 | Ga0395900_0430394 | 3300037418 | Bacteria | 1279 |
| 737 | Ga0395900_0664599 | 3300037418 | Bacteria | 978 |
| 738 | Ga0395900_0981838 | 3300037418 | Bacteria | 765 |
| 739 | Ga0395900_1457410 | 3300037418 | Unclassified | 597 |
| 740 | Ga0395900_1886758 | 3300037418 | Bacteria | 508 |
| 741 | Ga0395898_0000635 | 3300037466 | Bacteria | 64060 |
| 742 | Ga0395898_0004222 | 3300037466 | Bacteria | 15747 |
| 743 | Ga0395898_0012120 | 3300037466 | Bacteria | 8924 |
| 744 | Ga0395898_0013333 | 3300037466 | Bacteria | 8464 |
| 745 | Ga0395898_0018206 | 3300037466 | Bacteria | 7165 |
| 746 | Ga0395898_0019228 | 3300037466 | Bacteria | 6953 |
| 747 | Ga0395898_0043451 | 3300037466 | Bacteria | 4428 |
| 748 | Ga0395898_0058150 | 3300037466 | Bacteria | 3765 |
| 749 | Ga0395898_0068002 | 3300037466 | Bacteria | 3448 |
| 750 | Ga0395898_0070716 | 3300037466 | Unclassified | 3373 |
| 751 | Ga0395898_0092297 | 3300037466 | Bacteria | 2912 |
| 752 | Ga0395898_0093719 | 3300037466 | Bacteria | 2886 |
| 753 | Ga0395898_0117809 | 3300037466 | Bacteria | 2544 |
| 754 | Ga0395898_0167641 | 3300037466 | Bacteria | 2099 |
| 755 | Ga0395898_0183903 | 3300037466 | Bacteria | 1997 |
| 756 | Ga0395898_0277130 | 3300037466 | Unclassified | 1600 |
| 757 | Ga0395898_0313132 | 3300037466 | Bacteria | 1497 |
| 758 | Ga0395898_0350755 | 3300037466 | Bacteria | 1407 |
| 759 | Ga0395898_0567589 | 3300037466 | Bacteria | 1077 |
| 760 | Ga0395898_0757508 | 3300037466 | Unclassified | 912 |
| 761 | Ga0395898_0764494 | 3300037466 | Bacteria | 907 |
| 762 | Ga0395898_0829694 | 3300037466 | Bacteria | 864 |
| 763 | Ga0395898_0936656 | 3300037466 | Unclassified | 804 |
| 764 | Ga0395898_1328667 | 3300037466 | Unclassified | 648 |
| 765 | Ga0395898_1481907 | 3300037466 | Bacteria | 605 |
| 766 | Ga0395905_0006804 | 3300037471 | Bacteria | 11450 |
| 767 | Ga0395905_0009799 | 3300037471 | Bacteria | 9339 |
| 768 | Ga0395905_0024697 | 3300037471 | Bacteria | 5671 |
| 769 | Ga0395905_0026941 | 3300037471 | Bacteria | 5420 |
| 770 | Ga0395905_0032364 | 3300037471 | Bacteria | 4918 |
| 771 | Ga0395905_0045678 | 3300037471 | Bacteria | 4108 |
| 772 | Ga0395905_0046418 | 3300037471 | Unclassified | 4073 |
| 773 | Ga0395905_0068297 | 3300037471 | Bacteria | 3329 |
| 774 | Ga0395905_0102974 | 3300037471 | Bacteria | 2680 |
| 775 | Ga0395905_0125458 | 3300037471 | Bacteria | 2414 |
| 776 | Ga0395905_0274139 | 3300037471 | Bacteria | 1573 |
| 777 | Ga0395905_0420491 | 3300037471 | Bacteria | 1232 |
| 778 | Ga0395905_0687857 | 3300037471 | Unclassified | 925 |
| 779 | Ga0395905_0740466 | 3300037471 | Bacteria | 885 |
| 780 | Ga0395905_0812550 | 3300037471 | Bacteria | 838 |
| 781 | Ga0395905_1010807 | 3300037471 | Bacteria | 735 |
| 782 | Ga0395905_1129397 | 3300037471 | Bacteria | 687 |
| 783 | Ga0395905_1134535 | 3300037471 | Bacteria | 685 |
| 784 | Ga0395901_0002544 | 3300038443 | Bacteria | 18471 |
| 785 | Ga0395901_0006552 | 3300038443 | Bacteria | 11777 |
| 786 | Ga0395901_0008779 | 3300038443 | Bacteria | 10223 |
| 787 | Ga0395901_0010232 | 3300038443 | Bacteria | 9503 |
| 788 | Ga0395901_0014478 | 3300038443 | Bacteria | 8023 |
| 789 | Ga0395901_0016360 | 3300038443 | Bacteria | 7552 |
| 790 | Ga0395901_0016913 | 3300038443 | Bacteria | 7434 |
| 791 | Ga0395901_0019082 | 3300038443 | Bacteria | 7011 |
| 792 | Ga0395901_0058458 | 3300038443 | Bacteria | 4010 |
| 793 | Ga0395901_0060988 | 3300038443 | Bacteria | 3925 |
| 794 | Ga0395901_0066787 | 3300038443 | Bacteria | 3745 |
| 795 | Ga0395901_0095980 | 3300038443 | Bacteria | 3107 |
| 796 | Ga0395901_0117869 | 3300038443 | Bacteria | 2790 |
| 797 | Ga0395901_0126868 | 3300038443 | Bacteria | 2681 |
| 798 | Ga0395901_0142940 | 3300038443 | Bacteria | 2515 |
| 799 | Ga0395901_0177673 | 3300038443 | Bacteria | 2232 |
| 800 | Ga0395901_0212055 | 3300038443 | Bacteria | 2027 |
| 801 | Ga0395901_0302082 | 3300038443 | Bacteria | 1659 |
| 802 | Ga0395901_0369595 | 3300038443 | Bacteria | 1477 |
| 803 | Ga0395901_0393199 | 3300038443 | Bacteria | 1425 |
| 804 | Ga0395901_0395172 | 3300038443 | Bacteria | 1421 |
| 805 | Ga0395901_0406680 | 3300038443 | Bacteria | 1398 |
| 806 | Ga0395901_0778085 | 3300038443 | Bacteria | 948 |
| 807 | Ga0395901_1327255 | 3300038443 | Unclassified | 680 |
| 808 | Ga0395901_1750139 | 3300038443 | Bacteria | 572 |
| 809 | Ga0395901_1778174 | 3300038443 | Unclassified | 566 |
| 810 | Ga0242420_145225 | 3300038996 | Bacteria | 530 |
| 811 | Ga0436365_0307627 | 3300039437 | Bacteria | 1372 |
| 812 | Ga0439453_0028297 | 3300041408 | Bacteria | 1049 |
| 813 | Ga0439453_0063875 | 3300041408 | Bacteria | 767 |
| 814 | Ga0439466_0062803 | 3300041411 | Bacteria | 1193 |
| 815 | Ga0451789_0339081 | 3300041443 | Bacteria | 1220 |
| 816 | Ga0451789_1312427 | 3300041443 | Unclassified | 564 |
| 817 | Ga0451793_0317672 | 3300041452 | Bacteria | 2087 |
| 818 | Ga0451795_0027106 | 3300041456 | Bacteria | 2205 |
| 819 | Ga0451798_0263104 | 3300041458 | Bacteria | 985 |
| 820 | Ga0451800_1462570 | 3300041459 | Bacteria | 2210 |
| 821 | Ga0451802_1524512 | 3300041460 | Unclassified | 2036 |
| 822 | Ga0451802_2028705 | 3300041460 | Unclassified | 620 |
| 823 | Ga0451804_0321035 | 3300041463 | Unclassified | 685 |
| 824 | Ga0451807_0330186 | 3300041486 | Bacteria | 1790 |
| 825 | Ga0451835_0161116 | 3300041492 | Bacteria | 1705 |
| 826 | Ga0451835_0538146 | 3300041492 | Unclassified | 692 |
| 827 | Ga0451839_0726782 | 3300041496 | Bacteria | 1063 |
| 828 | Ga0451841_1061094 | 3300041498 | Bacteria | 1053 |
| 829 | Ga0451845_0482713 | 3300041501 | Bacteria | 843 |
| 830 | Ga0451845_0862811 | 3300041501 | Unclassified | 550 |
| 831 | Ga0451847_0449104 | 3300041503 | Bacteria | 1318 |
| 832 | Ga0451849_0691407 | 3300041505 | Bacteria | 1273 |
| 833 | Ga0451849_0945287 | 3300041505 | Bacteria | 1681 |
| 834 | Ga0451851_0768897 | 3300041507 | Unclassified | 917 |
| 835 | Ga0451851_0904337 | 3300041507 | Bacteria | 1000 |
| 836 | Ga0451855_1065849 | 3300041511 | Bacteria | 1184 |
| 837 | Ga0451853_0167061 | 3300041512 | Unclassified | 1901 |
| 838 | Ga0451853_0460319 | 3300041512 | Bacteria | 5875 |
| 839 | Ga0451853_0801509 | 3300041512 | Bacteria | 1734 |
| 840 | Ga0439448_0015925 | 3300042005 | Bacteria | 2283 |
| 841 | Ga0439448_0232723 | 3300042005 | Bacteria | 649 |
| 842 | Ga0439455_0007025 | 3300042012 | Bacteria | 2366 |
| 843 | Ga0439455_0109878 | 3300042012 | Bacteria | 766 |
| 844 | Ga0439463_063743 | 3300042016 | Bacteria | 942 |
| 845 | Ga0439458_0090197 | 3300042157 | Bacteria | 788 |
| 846 | Ga0439458_0149503 | 3300042157 | Bacteria | 625 |
| 847 | Ga0450916_021282 | 3300042530 | Bacteria | 892 |
| 848 | Ga0466965_0082223 | 3300044683 | Unclassified | 1629 |
| 849 | Ga0466966_0046003 | 3300044684 | Bacteria | 2788 |
| 850 | Ga0466966_0256009 | 3300044684 | Bacteria | 1054 |
| 851 | Ga0466966_0631076 | 3300044684 | Bacteria | 645 |
| 852 | Ga0466961_0097942 | 3300044693 | Bacteria | 1849 |
| 853 | Ga0466963_0002756 | 3300044694 | Bacteria | 9910 |
| 854 | Ga0466963_0072458 | 3300044694 | Bacteria | 2321 |
| 855 | Ga0466963_0133691 | 3300044694 | Bacteria | 1715 |
| 856 | Ga0466963_0249010 | 3300044694 | Bacteria | 1247 |
| 857 | Ga0466963_0346030 | 3300044694 | Bacteria | 1047 |
| 858 | Ga0466963_0461383 | 3300044694 | Bacteria | 896 |
| 859 | Ga0466963_0577936 | 3300044694 | Bacteria | 794 |
| 860 | Ga0466963_0808718 | 3300044694 | Bacteria | 661 |
| 861 | Ga0466963_1280354 | 3300044694 | Bacteria | 515 |
| 862 | Ga0466964_0002141 | 3300044706 | Bacteria | 6966 |
| 863 | Ga0466964_0008934 | 3300044706 | Bacteria | 3769 |
| 864 | Ga0466964_0287689 | 3300044706 | Bacteria | 824 |
| 865 | Ga0466971_0025187 | 3300044719 | Bacteria | 2657 |
| 866 | Ga0466971_0045201 | 3300044719 | Bacteria | 1978 |
| 867 | Ga0466971_0306612 | 3300044719 | Bacteria | 763 |
| 868 | Ga0466968_0060322 | 3300044735 | Bacteria | 1635 |
| 869 | Ga0466957_0236711 | 3300044842 | Bacteria | 1210 |
| 870 | Ga0466957_0768038 | 3300044842 | Unclassified | 683 |
| 871 | Ga0466960_0031717 | 3300044901 | Bacteria | 2440 |
| 872 | Ga0466960_0059978 | 3300044901 | Bacteria | 1863 |
| 873 | Ga0466960_0309132 | 3300044901 | Bacteria | 893 |
| 874 | Ga0466959_0012573 | 3300045049 | Bacteria | 6121 |
| 875 | Ga0466959_0879196 | 3300045049 | Unclassified | 598 |
| 876 | Ga0451576_0013374 | 3300045051 | Bacteria | 9184 |
| 877 | Ga0451576_1141280 | 3300045051 | Unclassified | 815 |
| 878 | Ga0466958_0031410 | 3300045836 | Bacteria | 3156 |
| 879 | Ga0466958_0073966 | 3300045836 | Bacteria | 2088 |
| 880 | Ga0466958_0107860 | 3300045836 | Bacteria | 1737 |
| 881 | Ga0466958_0203590 | 3300045836 | Bacteria | 1260 |
| 882 | Ga0466958_0359906 | 3300045836 | Bacteria | 937 |
| 883 | Ga0466958_0575394 | 3300045836 | Bacteria | 732 |
| 884 | Ga0466967_0002982 | 3300045976 | Bacteria | 10836 |
| 885 | Ga0466967_0051946 | 3300045976 | Bacteria | 3595 |
| 886 | Ga0466967_0068765 | 3300045976 | Bacteria | 3163 |
| 887 | Ga0466967_0131822 | 3300045976 | Bacteria | 2321 |
| 888 | Ga0466967_0159179 | 3300045976 | Bacteria | 2118 |
| 889 | Ga0466967_0164778 | 3300045976 | Bacteria | 2082 |
| 890 | Ga0466967_0231230 | 3300045976 | Bacteria | 1760 |
| 891 | Ga0466967_0231462 | 3300045976 | Bacteria | 1760 |
| 892 | Ga0466967_0355525 | 3300045976 | Bacteria | 1418 |
| 893 | Ga0466967_0823387 | 3300045976 | Bacteria | 922 |
| 894 | Ga0466967_1065500 | 3300045976 | Bacteria | 805 |
| 895 | Ga0466967_1187418 | 3300045976 | Bacteria | 760 |
| 896 | Ga0466967_1224003 | 3300045976 | Bacteria | 748 |
| 897 | Ga0495592_0526773 | 3300046454 | Bacteria | 730 |
| 898 | Ga0495603_0066776 | 3300046455 | Bacteria | 2118 |
| 899 | Ga0495629_0079911 | 3300046459 | Bacteria | 2283 |
| 900 | Ga0495629_0169606 | 3300046459 | Bacteria | 1515 |
| 901 | Ga0495641_0001074 | 3300046461 | Bacteria | 23533 |
| 902 | Ga0495641_0077242 | 3300046461 | Bacteria | 1493 |
| 903 | Ga0495641_0122736 | 3300046461 | Bacteria | 1159 |
| 904 | Ga0495641_0147684 | 3300046461 | Bacteria | 1050 |
| 905 | Ga0495651_0379822 | 3300046462 | Bacteria | 927 |
| 906 | Ga0495651_0526482 | 3300046462 | Bacteria | 754 |
| 907 | Ga0495653_0075281 | 3300046463 | Bacteria | 2513 |
| 908 | Ga0495653_0149157 | 3300046463 | Bacteria | 1636 |
| 909 | Ga0495580_0050268 | 3300046472 | Bacteria | 2948 |
| 910 | Ga0495582_0025909 | 3300046473 | Bacteria | 3213 |
| 911 | Ga0495582_0065275 | 3300046473 | Bacteria | 2011 |
| 912 | Ga0495605_0343545 | 3300046474 | Unclassified | 627 |
| 913 | Ga0495639_0149702 | 3300046475 | Bacteria | 1125 |
| 914 | Ga0495664_0451082 | 3300046477 | Bacteria | 770 |
| 915 | Ga0495664_0493925 | 3300046477 | Bacteria | 731 |
| 916 | Ga0495584_0055679 | 3300046491 | Bacteria | 1990 |
| 917 | Ga0495585_0230235 | 3300046492 | Bacteria | 932 |
| 918 | Ga0495594_0002224 | 3300046499 | Bacteria | 10090 |
| 919 | Ga0495594_0463034 | 3300046499 | Bacteria | 721 |
| 920 | Ga0495596_0214632 | 3300046500 | Unclassified | 747 |
| 921 | Ga0495596_0221112 | 3300046500 | Unclassified | 736 |
| 922 | Ga0495607_0132391 | 3300046501 | Bacteria | 1296 |
| 923 | Ga0495607_0155424 | 3300046501 | Bacteria | 1167 |
| 924 | Ga0495607_0510900 | 3300046501 | Bacteria | 532 |
| 925 | Ga0495608_0656559 | 3300046511 | Bacteria | 626 |
| 926 | Ga0495618_0207417 | 3300046514 | Bacteria | 1239 |
| 927 | Ga0495618_0663682 | 3300046514 | Unclassified | 616 |
| 928 | Ga0495630_0144463 | 3300046517 | Bacteria | 1809 |
| 929 | Ga0495630_0236754 | 3300046517 | Bacteria | 1395 |
| 930 | Ga0495630_0346218 | 3300046517 | Bacteria | 1137 |
| 931 | Ga0495631_0167572 | 3300046518 | Bacteria | 942 |
| 932 | Ga0495637_0169922 | 3300046520 | Bacteria | 814 |
| 933 | Ga0495644_0032720 | 3300046523 | Bacteria | 1965 |
| 934 | Ga0495644_0157154 | 3300046523 | Unclassified | 871 |
| 935 | Ga0495644_0253258 | 3300046523 | Bacteria | 684 |
| 936 | Ga0495663_0152700 | 3300046525 | Unclassified | 789 |
| 937 | Ga0495663_0338114 | 3300046525 | Bacteria | 547 |
| 938 | Ga0495666_0034432 | 3300046526 | Bacteria | 2472 |
| 939 | Ga0495642_0121695 | 3300046528 | Unclassified | 1120 |
| 940 | Ga0495642_0298542 | 3300046528 | Unclassified | 706 |
| 941 | Ga0495665_0070197 | 3300046531 | Bacteria | 1846 |
| 942 | Ga0495640_0482123 | 3300046533 | Bacteria | 756 |
| 943 | Ga0495640_0522499 | 3300046533 | Bacteria | 721 |
| 944 | Ga0495598_0061117 | 3300046537 | Bacteria | 1163 |
| 945 | Ga0495609_0206439 | 3300046538 | Bacteria | 820 |
| 946 | Ga0495609_0258174 | 3300046538 | Unclassified | 716 |
| 947 | Ga0495645_0536073 | 3300046543 | Bacteria | 727 |
| 948 | Ga0495667_0065362 | 3300046559 | Bacteria | 2379 |
| 949 | Ga0495656_0024935 | 3300046615 | Bacteria | 2367 |
| 950 | Ga0495656_0044402 | 3300046615 | Bacteria | 1871 |
| 951 | Ga0495656_0303518 | 3300046615 | Bacteria | 819 |
| 952 | Ga0495656_0387114 | 3300046615 | Unclassified | 730 |
| 953 | Ga0495668_0562155 | 3300046616 | Bacteria | 630 |
| 954 | Ga0495668_0804061 | 3300046616 | Unclassified | 521 |
| 955 | Ga0495634_0465866 | 3300046642 | Bacteria | 744 |
| 956 | Ga0495611_0131629 | 3300046648 | Unclassified | 1167 |
| 957 | Ga0495635_0547324 | 3300046663 | Bacteria | 759 |
| 958 | Ga0495659_0194215 | 3300046664 | Unclassified | 830 |
| 959 | Ga0495588_0000390 | 3300046674 | Bacteria | 24919 |
| 960 | Ga0495588_0196323 | 3300046674 | Unclassified | 1066 |
| 961 | Ga0495657_0068189 | 3300046675 | Bacteria | 2332 |
| 962 | Ga0495657_0315612 | 3300046675 | Bacteria | 930 |
| 963 | Ga0495599_0546378 | 3300046678 | Bacteria | 679 |
| 964 | Ga0495647_0216042 | 3300046681 | Bacteria | 845 |
| 965 | Ga0495658_0262499 | 3300046683 | Bacteria | 1087 |
| 966 | Ga0495658_0423071 | 3300046683 | Bacteria | 850 |
| 967 | Ga0495669_0607960 | 3300046684 | Bacteria | 532 |
| 968 | Ga0495613_0065200 | 3300046689 | Bacteria | 2662 |
| 969 | Ga0495613_0099395 | 3300046689 | Bacteria | 2102 |
| 970 | Ga0495670_0323987 | 3300046691 | Unclassified | 827 |
| 971 | Ga0495670_0832544 | 3300046691 | Unclassified | 504 |
| 972 | Ga0495589_0381721 | 3300046794 | Bacteria | 648 |
| 973 | Ga0495600_0043700 | 3300046809 | Bacteria | 2922 |
| 974 | Ga0495600_0218419 | 3300046809 | Bacteria | 1220 |
| 975 | Ga0495660_0115494 | 3300046810 | Bacteria | 1365 |
| 976 | Ga0495581_0019596 | 3300047315 | Bacteria | 3926 |
| 977 | Ga0495581_0095755 | 3300047315 | Bacteria | 1724 |
| 978 | Ga0495636_0060526 | 3300047318 | Bacteria | 1600 |
| 979 | Ga0495674_0469515 | 3300047319 | Bacteria | 1009 |
| 980 | Ga0495676_0000419 | 3300047321 | Bacteria | 34533 |
| 981 | Ga0495676_0039368 | 3300047321 | Bacteria | 3915 |
| 982 | Ga0495676_0051089 | 3300047321 | Bacteria | 3310 |
| 983 | Ga0495676_0346794 | 3300047321 | Unclassified | 993 |
| 984 | Ga0495676_0748915 | 3300047321 | Unclassified | 631 |
| 985 | Ga0495680_0152718 | 3300047322 | Bacteria | 1682 |
| 986 | Ga0495680_0407119 | 3300047322 | Unclassified | 938 |
| 987 | Ga0495677_0225389 | 3300047445 | Bacteria | 731 |
| 988 | Ga0495679_051780 | 3300047446 | Unclassified | 1230 |
| 989 | Ga0495685_213922 | 3300047447 | Bacteria | 616 |
| 990 | Ga0495684_0600936 | 3300047471 | Unclassified | 742 |
| 991 | Ga0495614_0422813 | 3300048089 | Bacteria | 628 |
| 992 | Ga0495615_0061153 | 3300048090 | Bacteria | 994 |
| 993 | Ga0496100_0062123 | 3300048903 | Bacteria | 2464 |
| 994 | Ga0496100_0099904 | 3300048903 | Bacteria | 1997 |
| 995 | Ga0496100_0222547 | 3300048903 | Bacteria | 1386 |
| 996 | Ga0496100_0490643 | 3300048903 | Bacteria | 945 |
| 997 | Ga0496100_0729353 | 3300048903 | Bacteria | 774 |
| 998 | Ga0496101_0006797 | 3300048904 | Bacteria | 7377 |
| 999 | Ga0496101_0057373 | 3300048904 | Bacteria | 2816 |
| 1000 | Ga0496101_0353852 | 3300048904 | Bacteria | 1154 |
| 1001 | Ga0496101_0403928 | 3300048904 | Bacteria | 1076 |
| 1002 | Ga0496101_0624119 | 3300048904 | Bacteria | 852 |
| 1003 | Ga0496101_0648102 | 3300048904 | Bacteria | 834 |
| 1004 | Ga0496102_0021405 | 3300048905 | Bacteria | 5718 |
| 1005 | Ga0496102_0097220 | 3300048905 | Bacteria | 2731 |
| 1006 | Ga0496102_0158310 | 3300048905 | Bacteria | 2129 |
| 1007 | Ga0496102_0187258 | 3300048905 | Bacteria | 1951 |
| 1008 | Ga0496102_0270804 | 3300048905 | Bacteria | 1601 |
| 1009 | Ga0496102_1361634 | 3300048905 | Unclassified | 629 |
| 1010 | Ga0496103_0004888 | 3300048906 | Bacteria | 8090 |
| 1011 | Ga0496103_0009732 | 3300048906 | Bacteria | 5691 |
| 1012 | Ga0496103_0035474 | 3300048906 | Bacteria | 3053 |
| 1013 | Ga0496103_0044941 | 3300048906 | Bacteria | 2724 |
| 1014 | Ga0496103_0119414 | 3300048906 | Bacteria | 1679 |
| 1015 | Ga0496103_0150713 | 3300048906 | Bacteria | 1490 |
| 1016 | Ga0496103_0213230 | 3300048906 | Bacteria | 1242 |
| 1017 | Ga0496104_0000407 | 3300048907 | Bacteria | 37689 |
| 1018 | Ga0496104_0002003 | 3300048907 | Bacteria | 17677 |
| 1019 | Ga0496104_0002189 | 3300048907 | Bacteria | 16918 |
| 1020 | Ga0496104_0061377 | 3300048907 | Bacteria | 3564 |
| 1021 | Ga0496104_0389930 | 3300048907 | Bacteria | 1305 |
| 1022 | Ga0496104_0489064 | 3300048907 | Bacteria | 1142 |
| 1023 | Ga0496104_0830134 | 3300048907 | Bacteria | 830 |
| 1024 | Ga0496104_0967613 | 3300048907 | Unclassified | 755 |
| 1025 | Ga0496104_1767110 | 3300048907 | Unclassified | 521 |
| 1026 | Ga0496105_0003606 | 3300048908 | Bacteria | 11495 |
| 1027 | Ga0496105_0153981 | 3300048908 | Bacteria | 1888 |
| 1028 | Ga0496105_0231013 | 3300048908 | Bacteria | 1503 |
| 1029 | Ga0496105_0281950 | 3300048908 | Bacteria | 1339 |
| 1030 | Ga0496105_0452005 | 3300048908 | Bacteria | 1014 |
| 1031 | Ga0496105_0611523 | 3300048908 | Bacteria | 845 |
| 1032 | Ga0496106_0022850 | 3300048909 | Bacteria | 4645 |
| 1033 | Ga0496106_0043319 | 3300048909 | Bacteria | 3377 |
| 1034 | Ga0496106_0044607 | 3300048909 | Unclassified | 3328 |
| 1035 | Ga0496106_0174881 | 3300048909 | Bacteria | 1703 |
| 1036 | Ga0496106_0300865 | 3300048909 | Bacteria | 1286 |
| 1037 | Ga0496106_0743770 | 3300048909 | Bacteria | 780 |
| 1038 | Ga0496107_0017059 | 3300048910 | Bacteria | 5105 |
| 1039 | Ga0496107_0044202 | 3300048910 | Bacteria | 3202 |
| 1040 | Ga0496107_0069024 | 3300048910 | Bacteria | 2565 |
| 1041 | Ga0496107_0357669 | 3300048910 | Bacteria | 1086 |
| 1042 | Ga0496107_0535351 | 3300048910 | Bacteria | 868 |
| 1043 | Ga0496107_0716969 | 3300048910 | Bacteria | 735 |
| 1044 | Ga0496108_0005212 | 3300048911 | Bacteria | 10498 |
| 1045 | Ga0496108_0122629 | 3300048911 | Bacteria | 2230 |
| 1046 | Ga0496108_0134632 | 3300048911 | Bacteria | 2125 |
| 1047 | Ga0496108_0207670 | 3300048911 | Bacteria | 1700 |
| 1048 | Ga0496108_0220141 | 3300048911 | Bacteria | 1649 |
| 1049 | Ga0496108_0908223 | 3300048911 | Bacteria | 756 |
| 1050 | Ga0496109_0002745 | 3300048912 | Bacteria | 14769 |
| 1051 | Ga0496109_0004241 | 3300048912 | Bacteria | 11970 |
| 1052 | Ga0496109_0015213 | 3300048912 | Bacteria | 6698 |
| 1053 | Ga0496109_0047176 | 3300048912 | Bacteria | 3916 |
| 1054 | Ga0496109_0079090 | 3300048912 | Bacteria | 3028 |
| 1055 | Ga0496109_0090059 | 3300048912 | Bacteria | 2837 |
| 1056 | Ga0496109_0194256 | 3300048912 | Bacteria | 1907 |
| 1057 | Ga0496109_0207893 | 3300048912 | Bacteria | 1840 |
| 1058 | Ga0496109_0271841 | 3300048912 | Bacteria | 1597 |
| 1059 | Ga0496109_0706730 | 3300048912 | Bacteria | 945 |
| 1060 | Ga0496109_0718984 | 3300048912 | Bacteria | 936 |
| 1061 | Ga0496109_0852572 | 3300048912 | Bacteria | 849 |
| 1062 | Ga0496109_1202745 | 3300048912 | Unclassified | 694 |
| 1063 | Ga0496109_1519541 | 3300048912 | Bacteria | 604 |
| 1064 | Ga0496109_1595495 | 3300048912 | Unclassified | 587 |
| 1065 | Ga0496109_1784227 | 3300048912 | Bacteria | 548 |
| 1066 | Ga0496109_1810066 | 3300048912 | Unclassified | 544 |
| 1067 | Ga0496110_0000628 | 3300048913 | Bacteria | 24128 |
| 1068 | Ga0496110_0002493 | 3300048913 | Bacteria | 13811 |
| 1069 | Ga0496110_0014421 | 3300048913 | Bacteria | 6561 |
| 1070 | Ga0496110_0028794 | 3300048913 | Bacteria | 4774 |
| 1071 | Ga0496110_0090381 | 3300048913 | Bacteria | 2738 |
| 1072 | Ga0496110_0163802 | 3300048913 | Unclassified | 2016 |
| 1073 | Ga0496110_0180210 | 3300048913 | Bacteria | 1918 |
| 1074 | Ga0496110_0341840 | 3300048913 | Bacteria | 1363 |
| 1075 | Ga0496110_0408017 | 3300048913 | Bacteria | 1239 |
| 1076 | Ga0496110_0479556 | 3300048913 | Bacteria | 1133 |
| 1077 | Ga0496110_0760680 | 3300048913 | Bacteria | 872 |
| 1078 | Ga0496111_0002892 | 3300048914 | Bacteria | 10484 |
| 1079 | Ga0496111_0003525 | 3300048914 | Bacteria | 9681 |
| 1080 | Ga0496111_0024101 | 3300048914 | Bacteria | 4280 |
| 1081 | Ga0496111_0025685 | 3300048914 | Bacteria | 4156 |
| 1082 | Ga0496111_0045172 | 3300048914 | Bacteria | 3169 |
| 1083 | Ga0496111_0131354 | 3300048914 | Bacteria | 1853 |
| 1084 | Ga0496111_0369790 | 3300048914 | Unclassified | 1061 |
| 1085 | Ga0496111_0532908 | 3300048914 | Bacteria | 863 |
| 1086 | Ga0496111_0658484 | 3300048914 | Unclassified | 764 |
| 1087 | Ga0496111_0689981 | 3300048914 | Bacteria | 743 |
| 1088 | Ga0496111_0795438 | 3300048914 | Bacteria | 685 |
| 1089 | Ga0496112_0002231 | 3300048915 | Bacteria | 15467 |
| 1090 | Ga0496112_0004088 | 3300048915 | Bacteria | 12255 |
| 1091 | Ga0496112_0016721 | 3300048915 | Bacteria | 6878 |
| 1092 | Ga0496112_0019773 | 3300048915 | Bacteria | 6367 |
| 1093 | Ga0496112_0047973 | 3300048915 | Bacteria | 4189 |
| 1094 | Ga0496112_0203607 | 3300048915 | Bacteria | 1938 |
| 1095 | Ga0496112_0284351 | 3300048915 | Bacteria | 1600 |
| 1096 | Ga0496112_0539759 | 3300048915 | Bacteria | 1100 |
| 1097 | Ga0496112_0581257 | 3300048915 | Unclassified | 1053 |
| 1098 | Ga0496112_0625357 | 3300048915 | Unclassified | 1007 |
| 1099 | Ga0496112_0707761 | 3300048915 | Bacteria | 935 |
| 1100 | Ga0496112_0905620 | 3300048915 | Bacteria | 804 |
| 1101 | Ga0496112_1918524 | 3300048915 | Unclassified | 504 |
| 1102 | Ga0496113_0035059 | 3300048916 | Bacteria | 3666 |
| 1103 | Ga0496113_0103248 | 3300048916 | Bacteria | 2211 |
| 1104 | Ga0496113_0120026 | 3300048916 | Bacteria | 2054 |
| 1105 | Ga0496113_0120386 | 3300048916 | Bacteria | 2051 |
| 1106 | Ga0496113_1026541 | 3300048916 | Bacteria | 649 |
| 1107 | Ga0496114_0002506 | 3300048917 | Bacteria | 14021 |
| 1108 | Ga0496114_0002854 | 3300048917 | Bacteria | 13246 |
| 1109 | Ga0496114_0039143 | 3300048917 | Bacteria | 3923 |
| 1110 | Ga0496114_0053819 | 3300048917 | Bacteria | 3355 |
| 1111 | Ga0496114_0123461 | 3300048917 | Bacteria | 2229 |
| 1112 | Ga0496114_0225050 | 3300048917 | Bacteria | 1647 |
| 1113 | Ga0496114_0297247 | 3300048917 | Bacteria | 1425 |
| 1114 | Ga0496114_1491785 | 3300048917 | Bacteria | 564 |
| 1115 | Ga0501031_0903874 | 3300049568 | Bacteria | 565 |
| 1116 | Ga0501034_0009184 | 3300049571 | Bacteria | 10373 |
| 1117 | Ga0501036_0640608 | 3300049572 | Bacteria | 880 |
| 1118 | Ga0501039_0137895 | 3300049575 | Bacteria | 1916 |
| 1119 | Ga0501040_0366469 | 3300049576 | Unclassified | 1033 |
| 1120 | Ga0501040_0446171 | 3300049576 | Bacteria | 931 |
| 1121 | Ga0501040_0526411 | 3300049576 | Unclassified | 853 |
| 1122 | Ga0501041_0118470 | 3300049577 | Bacteria | 1644 |
| 1123 | Ga0501042_0001033 | 3300049578 | Bacteria | 15872 |
| 1124 | Ga0501043_0014874 | 3300049579 | Bacteria | 6091 |
| 1125 | Ga0501043_0636164 | 3300049579 | Bacteria | 785 |
| 1126 | Ga0501047_0106545 | 3300049581 | Bacteria | 2684 |
| 1127 | Ga0501048_0004658 | 3300049582 | Bacteria | 10438 |
| 1128 | Ga0501048_0519772 | 3300049582 | Bacteria | 854 |
| 1129 | Ga0501048_1039227 | 3300049582 | Unclassified | 589 |
| 1130 | Ga0501067_0002416 | 3300049583 | Bacteria | 10320 |
| 1131 | Ga0501067_0031798 | 3300049583 | Bacteria | 2928 |
| 1132 | Ga0501067_0087271 | 3300049583 | Bacteria | 1731 |
| 1133 | Ga0501067_0724965 | 3300049583 | Bacteria | 559 |
| 1134 | Ga0501068_0013558 | 3300049584 | Bacteria | 4640 |
| 1135 | Ga0501069_0001655 | 3300049585 | Bacteria | 11073 |
| 1136 | Ga0501069_0210633 | 3300049585 | Bacteria | 1128 |
| 1137 | Ga0501069_0404621 | 3300049585 | Bacteria | 808 |
| 1138 | Ga0501069_0468963 | 3300049585 | Bacteria | 749 |
| 1139 | Ga0501069_0684328 | 3300049585 | Unclassified | 618 |
| 1140 | Ga0501070_0013996 | 3300049586 | Bacteria | 6753 |
| 1141 | Ga0501070_0079576 | 3300049586 | Bacteria | 2712 |
| 1142 | Ga0501070_0307423 | 3300049586 | Bacteria | 1291 |
| 1143 | Ga0501071_0741910 | 3300049587 | Unclassified | 756 |
| 1144 | Ga0501071_0824240 | 3300049587 | Bacteria | 715 |
| 1145 | Ga0501072_0011327 | 3300049588 | Bacteria | 6814 |
| 1146 | Ga0501072_0093455 | 3300049588 | Bacteria | 2389 |
| 1147 | Ga0501073_0074391 | 3300049589 | Bacteria | 2365 |
| 1148 | Ga0501074_0122081 | 3300049590 | Bacteria | 1863 |
| 1149 | Ga0501074_0344050 | 3300049590 | Bacteria | 1058 |
| 1150 | Ga0501074_0560556 | 3300049590 | Unclassified | 809 |
| 1151 | Ga0501075_0133739 | 3300049591 | Bacteria | 1889 |
| 1152 | Ga0501075_0701641 | 3300049591 | Unclassified | 771 |
| 1153 | Ga0501076_0148379 | 3300049592 | Bacteria | 1907 |
| 1154 | Ga0501076_0861812 | 3300049592 | Unclassified | 747 |
| 1155 | Ga0501077_0065470 | 3300049593 | Unclassified | 2304 |
| 1156 | Ga0501079_0056730 | 3300049741 | Bacteria | 3022 |
| 1157 | Ga0501079_0200471 | 3300049741 | Bacteria | 1559 |
| 1158 | Ga0501079_0451488 | 3300049741 | Bacteria | 1010 |
| 1159 | Ga0501079_0647692 | 3300049741 | Unclassified | 832 |
| 1160 | Ga0501080_0052034 | 3300049742 | Bacteria | 3811 |
| 1161 | Ga0501080_0216787 | 3300049742 | Bacteria | 1752 |
| 1162 | Ga0501083_0004863 | 3300049744 | Bacteria | 9498 |
| 1163 | Ga0501035_0063637 | 3300049822 | Unclassified | 3280 |
| 1164 | Ga0501044_0253934 | 3300049823 | Unclassified | 1698 |
| 1165 | Ga0501045_0152924 | 3300049824 | Bacteria | 1717 |
| 1166 | Ga0501045_0666262 | 3300049824 | Bacteria | 769 |
| 1167 | nmdc:mga05p37_163020_c1 | 3300050507 | Bacteria | 2722 |
| 1168 | nmdc:mga05p37_182865_c1 | 3300050507 | Bacteria | 2550 |
| 1169 | nmdc:mga05p37_307721_c2 | 3300050507 | Bacteria | 1413 |
| 1170 | nmdc:mga05p37_41140_c1 | 3300050507 | Bacteria | 5675 |
| 1171 | nmdc:mga05p37_47682_c1 | 3300050507 | Bacteria | 5268 |
| 1172 | nmdc:mga05p37_585963_c1 | 3300050507 | Unclassified | 1262 |
| 1173 | nmdc:mga06r32_114013_c1 | 3300050510 | Unclassified | 2661 |
| 1174 | nmdc:mga06r32_147876_c1 | 3300050510 | Bacteria | 2327 |
| 1175 | nmdc:mga06r32_179801_c1 | 3300050510 | Bacteria | 2100 |
| 1176 | nmdc:mga06r32_572977_c1 | 3300050510 | Bacteria | 1101 |
| 1177 | nmdc:mga06r32_806662_c1 | 3300050510 | Unclassified | 899 |
| 1178 | nmdc:mga06r32_914519_c1 | 3300050510 | Bacteria | 833 |
| 1179 | nmdc:mga08y16_115402_c1 | 3300050511 | Unclassified | 2796 |
| 1180 | nmdc:mga08y16_188725_c1 | 3300050511 | Bacteria | 2138 |
| 1181 | nmdc:mga08y16_28005_c1 | 3300050511 | Bacteria | 5941 |
| 1182 | nmdc:mga08y16_375609_c1 | 3300050511 | Bacteria | 1457 |
| 1183 | nmdc:mga08y16_534799_c1 | 3300050511 | Bacteria | 1187 |
| 1184 | nmdc:mga08y16_788766_c1 | 3300050511 | Bacteria | 944 |
| 1185 | nmdc:mga0n895_281331_c1 | 3300050512 | Bacteria | 1687 |
| 1186 | nmdc:mga0n895_283975_c1 | 3300050512 | Bacteria | 1678 |
| 1187 | nmdc:mga0n895_317239_c1 | 3300050512 | Unclassified | 1580 |
| 1188 | nmdc:mga0n895_323214_c1 | 3300050512 | Bacteria | 1564 |
| 1189 | nmdc:mga0n895_71102_c1 | 3300050512 | Bacteria | 3450 |
| 1190 | nmdc:mga0n895_78268_c1 | 3300050512 | Unclassified | 3291 |
| 1191 | nmdc:mga0n895_849394_c1 | 3300050512 | Bacteria | 901 |
| 1192 | nmdc:mga0rr50_204575_c1 | 3300050513 | Bacteria | 1624 |
| 1193 | nmdc:mga0rr50_268411_c1 | 3300050513 | Bacteria | 1421 |
| 1194 | nmdc:mga0rr50_30069_c1 | 3300050513 | Bacteria | 3841 |
| 1195 | nmdc:mga0rr50_635395_c1 | 3300050513 | Bacteria | 911 |
| 1196 | nmdc:mga0rr50_669481_c1 | 3300050513 | Bacteria | 886 |
| 1197 | nmdc:mga0rr50_773192_c1 | 3300050513 | Bacteria | 820 |
| 1198 | nmdc:mga0rr50_78138_c1 | 3300050513 | Unclassified | 2546 |
| 1199 | nmdc:mga0rr50_78220_c1 | 3300050513 | Bacteria | 2545 |
| 1200 | nmdc:mga0rr50_946401_c1 | 3300050513 | Bacteria | 734 |
| 1201 | nmdc:mga08x19_160527_c2 | 3300050514 | Bacteria | 1153 |
| 1202 | nmdc:mga08x19_197983_c1 | 3300050514 | Bacteria | 1376 |
| 1203 | nmdc:mga08x19_236981_c1 | 3300050514 | Bacteria | 1257 |
| 1204 | nmdc:mga08x19_278988_c1 | 3300050514 | Bacteria | 1158 |
| 1205 | nmdc:mga08x19_44260_c1 | 3300050514 | Bacteria | 2842 |
| 1206 | nmdc:mga0a205_13455_c1 | 3300050515 | Bacteria | 7619 |
| 1207 | nmdc:mga0a205_193150_c1 | 3300050515 | Bacteria | 1927 |
| 1208 | nmdc:mga0a205_200979_c1 | 3300050515 | Bacteria | 1883 |
| 1209 | nmdc:mga0a205_393207_c1 | 3300050515 | Bacteria | 1250 |
| 1210 | nmdc:mga0a205_55411_c1 | 3300050515 | Bacteria | 3829 |
| 1211 | nmdc:mga0a205_62734_c1 | 3300050515 | Bacteria | 3591 |
| 1212 | nmdc:mga0a205_74755_c1 | 3300050515 | Bacteria | 3274 |
| 1213 | nmdc:mga0a205_80222_c1 | 3300050515 | Unclassified | 3154 |
| 1214 | Ga0495601_0140954 | 3300053077 | Bacteria | 1572 |
| 1215 | Ga0495601_0637846 | 3300053077 | Bacteria | 682 |
| 1216 | Ga0495655_0044935 | 3300053083 | Bacteria | 1145 |
| 1217 | Ga0495655_0123376 | 3300053083 | Unclassified | 791 |
| 1218 | Ga0495595_0173923 | 3300053084 | Bacteria | 1066 |
| 1219 | Ga0495595_0267750 | 3300053084 | Bacteria | 857 |
| 1220 | Ga0495595_0429290 | 3300053084 | Unclassified | 671 |
| 1221 | Ga0495619_0128266 | 3300053085 | Unclassified | 1742 |
| 1222 | Ga0495619_0293910 | 3300053085 | Bacteria | 1125 |
| 1223 | Ga0495619_0470526 | 3300053085 | Unclassified | 866 |
| 1224 | Ga0500641_0069612 | 3300053096 | Unclassified | 1479 |
| 1225 | Ga0501084_0294861 | 3300054114 | Bacteria | 1370 |
| 1226 | Ga0501084_0388932 | 3300054114 | Bacteria | 1178 |
| 1227 | Ga0501084_0424147 | 3300054114 | Bacteria | 1124 |
| 1228 | Ga0501084_0779266 | 3300054114 | Bacteria | 806 |
| 1229 | Ga0501082_0066191 | 3300060353 | Unclassified | 3111 |
| 1230 | Ga0501082_0092113 | 3300060353 | Unclassified | 2618 |
| 1231 | Ga0501082_0593359 | 3300060353 | Bacteria | 969 |
| 1232 | Ga0466962_0039991 | 3300061719 | Bacteria | 2245 |
| 1233 | Ga0466962_0227466 | 3300061719 | Bacteria | 914 |
| 1234 | Ga0466962_0266435 | 3300061719 | Unclassified | 844 |
| 1235 | Ga0466962_0306074 | 3300061719 | Bacteria | 787 |
| 1236 | Ga0466962_0481123 | 3300061719 | Bacteria | 627 |
| 1237 | Ga0466962_0617109 | 3300061719 | Unclassified | 553 |
| 1238 | Ga0530510_0015329 | 3300061734 | Bacteria | 5415 |
| 1239 | Ga0530510_0137253 | 3300061734 | Bacteria | 1801 |
| 1240 | Ga0530510_0489699 | 3300061734 | Unclassified | 932 |
| 1241 | Ga0530510_0602163 | 3300061734 | Bacteria | 836 |
| 1242 | Ga0530510_0812387 | 3300061734 | Bacteria | 714 |
| 1243 | Ga0207692_10014389 | |||
| 1244 | rootH1_10005646 | |||
| 1245 | JGI25404J52841_10054961 | |||
| 1246 | Ga0070658_10021345 | |||
| 1247 | Ga0070683_100002028 | |||
| 1248 | Ga0070683_100003692 | |||
| 1249 | Ga0070683_100015521 | |||
| 1250 | Ga0070683_100022221 | |||
| 1251 | Ga0070683_100040458 | |||
| 1252 | Ga0070683_100057458 | |||
| 1253 | Ga0070683_100258342 | |||
| 1254 | Ga0070683_100531907 | |||
| 1255 | Ga0070683_100602152 | |||
| 1256 | Ga0070690_100682623 | |||
| 1257 | Ga0070677_10438659 | |||
| 1258 | Ga0068869_100872698 | |||
| 1259 | Ga0070666_10255127 | |||
| 1260 | Ga0070680_100009405 | |||
| 1261 | Ga0070680_100043363 | |||
| 1262 | Ga0070680_100109751 | |||
| 1263 | Ga0070680_100415390 | |||
| 1264 | Ga0070680_100425643 | |||
| 1265 | Ga0070682_100009325 | |||
| 1266 | Ga0070682_100107417 | |||
| 1267 | Ga0070682_100325093 | |||
| 1268 | Ga0068868_100164775 | |||
| 1269 | Ga0068868_100172004 | |||
| 1270 | Ga0068868_100274542 | |||
| 1271 | Ga0068868_100608439 | |||
| 1272 | Ga0070660_100023157 | |||
| 1273 | Ga0070660_100023680 | |||
| 1274 | Ga0070660_100051495 | |||
| 1275 | Ga0070660_100184559 | |||
| 1276 | Ga0070660_100895928 | |||
| 1277 | Ga0070691_10510748 | |||
| 1278 | Ga0070687_100589775 | |||
| 1279 | Ga0070687_100845175 | |||
| 1280 | Ga0070661_100326161 | |||
| 1281 | Ga0070661_100365454 | |||
| 1282 | Ga0070661_100951512 | |||
| 1283 | Ga0070692_10382731 | |||
| 1284 | Ga0070668_100046895 | |||
| 1285 | Ga0070668_101466329 | |||
| 1286 | Ga0070669_101278948 | |||
| 1287 | Ga0070675_100224565 | |||
| 1288 | Ga0070675_100662306 | |||
| 1289 | Ga0070671_100206063 | |||
| 1290 | Ga0070671_100864941 | |||
| 1291 | Ga0070674_100119163 | |||
| 1292 | Ga0070673_100223199 | |||
| 1293 | Ga0070673_100425798 | |||
| 1294 | Ga0070688_100135346 | |||
| 1295 | Ga0070688_100390695 | |||
| 1296 | Ga0070659_100251276 | |||
| 1297 | Ga0070703_10052110 | |||
| 1298 | Ga0070703_10179468 | |||
| 1299 | Ga0070709_10155772 | |||
| 1300 | Ga0070709_10195423 | |||
| 1301 | Ga0070709_10297895 | |||
| 1302 | Ga0070709_10351321 | |||
| 1303 | Ga0070709_10798624 | |||
| 1304 | Ga0070714_100019202 | |||
| 1305 | Ga0070714_100025597 | |||
| 1306 | Ga0070714_100092383 | |||
| 1307 | Ga0070714_100156647 | |||
| 1308 | Ga0070714_100257913 | |||
| 1309 | Ga0070714_100306859 | |||
| 1310 | Ga0070714_100409932 | |||
| 1311 | Ga0070714_101070279 | |||
| 1312 | Ga0070713_100020271 | |||
| 1313 | Ga0070713_100235856 | |||
| 1314 | Ga0070713_100510729 | |||
| 1315 | Ga0070713_100526410 | |||
| 1316 | Ga0070713_100542227 | |||
| 1317 | Ga0070713_100562521 | |||
| 1318 | Ga0070713_101261404 | |||
| 1319 | Ga0070710_10063266 | |||
| 1320 | Ga0070710_10293672 | |||
| 1321 | Ga0070710_10474477 | |||
| 1322 | Ga0070710_10820213 | |||
| 1323 | Ga0070701_10135903 | |||
| 1324 | Ga0070701_10395857 | |||
| 1325 | Ga0070711_100365658 | |||
| 1326 | Ga0070711_100417331 | |||
| 1327 | Ga0070711_100874425 | |||
| 1328 | Ga0070711_101461704 | |||
| 1329 | Ga0070705_100066351 | |||
| 1330 | Ga0070705_100186542 | |||
| 1331 | Ga0070705_100872657 | |||
| 1332 | Ga0070705_101383511 | |||
| 1333 | Ga0070700_100074824 | |||
| 1334 | Ga0070694_100136793 | |||
| 1335 | Ga0070694_100199769 | |||
| 1336 | Ga0070694_100200548 | |||
| 1337 | Ga0070694_100377333 | |||
| 1338 | Ga0070694_100765061 | |||
| 1339 | Ga0070708_100272974 | |||
| 1340 | Ga0070708_100499417 | |||
| 1341 | Ga0070663_100083991 | |||
| 1342 | Ga0070663_101669904 | |||
| 1343 | Ga0070678_100065988 | |||
| 1344 | Ga0070678_100107974 | |||
| 1345 | Ga0070678_100240730 | |||
| 1346 | Ga0070678_101087341 | |||
| 1347 | Ga0070662_100090256 | |||
| 1348 | Ga0070662_100266062 | |||
| 1349 | Ga0070662_100539055 | |||
| 1350 | Ga0070662_100622709 | |||
| 1351 | Ga0070662_100642077 | |||
| 1352 | Ga0070681_10000616 | |||
| 1353 | Ga0070681_10045315 | |||
| 1354 | Ga0070681_10132525 | |||
| 1355 | Ga0070681_10201585 | |||
| 1356 | Ga0070681_10289533 | |||
| 1357 | Ga0070681_10292560 | |||
| 1358 | Ga0070681_10476389 | |||
| 1359 | Ga0070681_10515657 | |||
| 1360 | Ga0070681_10777832 | |||
| 1361 | Ga0068867_100128451 | |||
| 1362 | Ga0070685_10439378 | |||
| 1363 | Ga0070706_100296856 | |||
| 1364 | Ga0070706_100321525 | |||
| 1365 | Ga0070706_100504212 | |||
| 1366 | Ga0070706_101559868 | |||
| 1367 | Ga0070706_101652602 | |||
| 1368 | Ga0070707_100003029 | |||
| 1369 | Ga0070707_100028647 | |||
| 1370 | Ga0070707_100188282 | |||
| 1371 | Ga0070707_100244856 | |||
| 1372 | Ga0070707_100645784 | |||
| 1373 | Ga0070707_100804550 | |||
| 1374 | Ga0070707_100846754 | |||
| 1375 | Ga0070707_101585857 | |||
| 1376 | Ga0070707_101868373 | |||
| 1377 | Ga0070698_100004541 | |||
| 1378 | Ga0070698_100037866 | |||
| 1379 | Ga0070698_100052435 | |||
| 1380 | Ga0070698_100225563 | |||
| 1381 | Ga0070698_101235921 | |||
| 1382 | Ga0070699_100159960 | |||
| 1383 | Ga0070679_100002700 | |||
| 1384 | Ga0070679_100119808 | |||
| 1385 | Ga0070679_100148957 | |||
| 1386 | Ga0070679_100167777 | |||
| 1387 | Ga0070679_100363772 | |||
| 1388 | Ga0070679_100413262 | |||
| 1389 | Ga0070679_100520042 | |||
| 1390 | Ga0070679_100969114 | |||
| 1391 | Ga0070684_100018945 | |||
| 1392 | Ga0070684_100019770 | |||
| 1393 | Ga0070684_100021310 | |||
| 1394 | Ga0070684_100060099 | |||
| 1395 | Ga0070684_100167666 | |||
| 1396 | Ga0070684_100167882 | |||
| 1397 | Ga0070684_100482260 | |||
| 1398 | Ga0070684_100691159 | |||
| 1399 | Ga0070697_100143374 | |||
| 1400 | Ga0070697_100332036 | |||
| 1401 | Ga0070697_100354425 | |||
| 1402 | Ga0068853_100381730 | |||
| 1403 | Ga0070686_100026401 | |||
| 1404 | Ga0070686_100057795 | |||
| 1405 | Ga0070686_100239634 | |||
| 1406 | Ga0070686_100525816 | |||
| 1407 | Ga0070695_100034181 | |||
| 1408 | Ga0070695_100040051 | |||
| 1409 | Ga0070695_100106414 | |||
| 1410 | Ga0070695_100305237 | |||
| 1411 | Ga0070696_100052107 | |||
| 1412 | Ga0070696_100137746 | |||
| 1413 | Ga0070696_100140397 | |||
| 1414 | Ga0070696_100175773 | |||
| 1415 | Ga0070696_101029575 | |||
| 1416 | Ga0070693_100002681 | |||
| 1417 | Ga0070693_100035519 | |||
| 1418 | Ga0070693_100061681 | |||
| 1419 | Ga0070693_100291936 | |||
| 1420 | Ga0070693_101302612 | |||
| 1421 | Ga0070665_101615447 | |||
| 1422 | Ga0070704_100351153 | |||
| 1423 | Ga0070704_100504044 | |||
| 1424 | Ga0070704_100697655 | |||
| 1425 | Ga0068855_100552044 | |||
| 1426 | Ga0068855_100633736 | |||
| 1427 | Ga0068855_101454769 | |||
| 1428 | Ga0070664_100217324 | |||
| 1429 | Ga0070664_100305274 | |||
| 1430 | Ga0070664_100557472 | |||
| 1431 | Ga0068857_100023736 | |||
| 1432 | Ga0068857_100393189 | |||
| 1433 | Ga0068857_100542334 | |||
| 1434 | Ga0068857_101935507 | |||
| 1435 | Ga0068854_100652122 | |||
| 1436 | Ga0068854_101383240 | |||
| 1437 | Ga0068856_100092009 | |||
| 1438 | Ga0068856_100119488 | |||
| 1439 | Ga0068856_100134929 | |||
| 1440 | Ga0068856_100232774 | |||
| 1441 | Ga0068856_100414290 | |||
| 1442 | Ga0068856_100780009 | |||
| 1443 | Ga0068856_100919393 | |||
| 1444 | Ga0068856_101356382 | |||
| 1445 | Ga0068856_101697074 | |||
| 1446 | Ga0068856_101926976 | |||
| 1447 | Ga0070702_100589310 | |||
| 1448 | Ga0068852_100806853 | |||
| 1449 | Ga0068852_101012135 | |||
| 1450 | Ga0068864_100080980 | |||
| 1451 | Ga0068864_101294452 | |||
| 1452 | Ga0068866_10106114 | |||
| 1453 | Ga0068861_100091730 | |||
| 1454 | Ga0068861_100672476 | |||
| 1455 | Ga0068858_100970667 | |||
| 1456 | Ga0068862_100299449 | |||
| 1457 | Ga0068862_101340907 | |||
| 1458 | Ga0081455_10007511 | |||
| 1459 | Ga0081455_10023070 | |||
| 1460 | Ga0081455_10094023 | |||
| 1461 | Ga0081455_10101149 | |||
| 1462 | Ga0081455_10201776 | |||
| 1463 | Ga0081455_10369269 | |||
| 1464 | Ga0081538_10001520 | |||
| 1465 | Ga0081538_10015038 | |||
| 1466 | Ga0081538_10020089 | |||
| 1467 | Ga0081540_1003521 | |||
| 1468 | Ga0081540_1004841 | |||
| 1469 | Ga0081540_1005736 | |||
| 1470 | Ga0081539_10004400 | |||
| 1471 | Ga0081539_10009156 | |||
| 1472 | Ga0070717_10051942 | |||
| 1473 | Ga0070717_10114022 | |||
| 1474 | Ga0070717_10162376 | |||
| 1475 | Ga0070717_10680891 | |||
| 1476 | Ga0075365_10163247 | |||
| 1477 | Ga0075432_10007543 | |||
| 1478 | Ga0075432_10206081 | |||
| 1479 | Ga0075432_10262956 | |||
| 1480 | Ga0070715_10001432 | |||
| 1481 | Ga0070715_10091023 | |||
| 1482 | Ga0070716_100007454 | |||
| 1483 | Ga0070716_100057189 | |||
| 1484 | Ga0070716_100093535 | |||
| 1485 | Ga0070716_100179184 | |||
| 1486 | Ga0070716_100443040 | |||
| 1487 | Ga0070712_100030861 | |||
| 1488 | Ga0070712_100119030 | |||
| 1489 | Ga0070712_100131979 | |||
| 1490 | Ga0070712_100157941 | |||
| 1491 | Ga0070712_100340252 | |||
| 1492 | Ga0070712_101345197 | |||
| 1493 | Ga0070712_101495734 | |||
| 1494 | Ga0097621_100004581 | |||
| 1495 | Ga0068871_100010878 | |||
| 1496 | Ga0075428_100076499 | |||
| 1497 | Ga0075428_100091758 | |||
| 1498 | Ga0075428_100402164 | |||
| 1499 | Ga0075428_100475348 | |||
| 1500 | Ga0075428_100548781 | |||
| 1501 | Ga0075428_100622473 | |||
| 1502 | Ga0075428_100858072 | |||
| 1503 | Ga0075430_100051989 | |||
| 1504 | Ga0075431_100120062 | |||
| 1505 | Ga0075431_100145004 | |||
| 1506 | Ga0075431_100338757 | |||
| 1507 | Ga0075431_100375133 | |||
| 1508 | Ga0075431_100460084 | |||
| 1509 | Ga0075431_100605146 | |||
| 1510 | Ga0075433_10105460 | |||
| 1511 | Ga0075433_10135561 | |||
| 1512 | Ga0075433_10170962 | |||
| 1513 | Ga0075433_10349539 | |||
| 1514 | Ga0075433_10364269 | |||
| 1515 | Ga0075433_10465645 | |||
| 1516 | Ga0075434_100037397 | |||
| 1517 | Ga0075434_100171687 | |||
| 1518 | Ga0075434_100172430 | |||
| 1519 | Ga0075434_100192823 | |||
| 1520 | Ga0075434_100677681 | |||
| 1521 | Ga0075434_100760639 | |||
| 1522 | Ga0075434_101671256 | |||
| 1523 | Ga0075429_100204890 | |||
| 1524 | Ga0068865_100179918 | |||
| 1525 | Ga0075436_100009822 | |||
| 1526 | Ga0075436_100099510 | |||
| 1527 | Ga0075436_100099809 | |||
| 1528 | Ga0075436_100202332 | |||
| 1529 | Ga0075436_100234624 | |||
| 1530 | Ga0075436_100557991 | |||
| 1531 | Ga0075436_101493887 | |||
| 1532 | Ga0075435_100120367 | |||
| 1533 | Ga0075435_100126128 | |||
| 1534 | Ga0075435_100298973 | |||
| 1535 | Ga0075435_100422093 | |||
| 1536 | Ga0075435_100543856 | |||
| 1537 | Ga0075435_100809438 | |||
| 1538 | Ga0105240_10097691 | |||
| 1539 | Ga0105240_10124169 | |||
| 1540 | Ga0105240_10206929 | |||
| 1541 | Ga0105240_10217152 | |||
| 1542 | Ga0105240_10266972 | |||
| 1543 | Ga0111539_10030639 | |||
| 1544 | Ga0111539_10076953 | |||
| 1545 | Ga0111539_10114917 | |||
| 1546 | Ga0111539_10126418 | |||
| 1547 | Ga0111539_10228451 | |||
| 1548 | Ga0111539_10232618 | |||
| 1549 | Ga0111539_10296701 | |||
| 1550 | Ga0111539_10431633 | |||
| 1551 | Ga0111539_12568041 | |||
| 1552 | Ga0105245_10007926 | |||
| 1553 | Ga0105245_10008291 | |||
| 1554 | Ga0105245_10026357 | |||
| 1555 | Ga0105245_10093597 | |||
| 1556 | Ga0105245_10218542 | |||
| 1557 | Ga0105245_10395855 | |||
| 1558 | Ga0105245_10405947 | |||
| 1559 | Ga0105245_10568236 | |||
| 1560 | Ga0105245_10778059 | |||
| 1561 | Ga0105245_10959045 | |||
| 1562 | Ga0105247_10643525 | |||
| 1563 | Ga0114129_10033209 | |||
| 1564 | Ga0114129_10088938 | |||
| 1565 | Ga0114129_10139384 | |||
| 1566 | Ga0114129_10177421 | |||
| 1567 | Ga0114129_10441546 | |||
| 1568 | Ga0114129_10884093 | |||
| 1569 | Ga0105243_10118934 | |||
| 1570 | Ga0105243_10283088 | |||
| 1571 | Ga0105243_10432289 | |||
| 1572 | Ga0105243_11227973 | |||
| 1573 | Ga0105241_10061816 | |||
| 1574 | Ga0105241_10254921 | |||
| 1575 | Ga0105241_11277974 | |||
| 1576 | Ga0105242_10088446 | |||
| 1577 | Ga0105242_10096667 | |||
| 1578 | Ga0105242_10107711 | |||
| 1579 | Ga0105242_10126861 | |||
| 1580 | Ga0105242_10331340 | |||
| 1581 | Ga0105242_10700584 | |||
| 1582 | Ga0105248_10436540 | |||
| 1583 | Ga0105248_11450750 | |||
| 1584 | Ga0105248_11763870 | |||
| 1585 | Ga0105237_11272068 | |||
| 1586 | Ga0105237_11649394 | |||
| 1587 | Ga0105238_10495828 | |||
| 1588 | Ga0105249_10127509 | |||
| 1589 | Ga0105249_10197361 | |||
| 1590 | Ga0105249_10277147 | |||
| 1591 | Ga0105249_10665464 | |||
| 1592 | Ga0105239_10171359 | |||
| 1593 | Ga0105239_10175522 | |||
| 1594 | Ga0105239_10183220 | |||
| 1595 | Ga0105239_10252879 | |||
| 1596 | Ga0105239_10340984 | |||
| 1597 | Ga0105239_10690499 | |||
| 1598 | Ga0105239_11056062 | |||
| 1599 | Ga0105239_11688944 | |||
| 1600 | Ga0105246_10219494 | |||
| 1601 | Ga0105246_10316013 | |||
| 1602 | Ga0105246_10911345 | |||
| 1603 | Ga0157320_1022351 | |||
| 1604 | Ga0157325_1022521 | |||
| 1605 | Ga0157335_1008208 | |||
| 1606 | Ga0157314_1028394 | |||
| 1607 | Ga0157314_1033163 | |||
| 1608 | Ga0157326_1014033 | |||
| 1609 | Ga0157373_10250024 | |||
| 1610 | Ga0157373_10336544 | |||
| 1611 | Ga0157373_10881326 | |||
| 1612 | Ga0157371_10189602 | |||
| 1613 | Ga0157371_10278725 | |||
| 1614 | Ga0157371_10425488 | |||
| 1615 | Ga0157370_10238235 | |||
| 1616 | Ga0157370_10750006 | |||
| 1617 | Ga0157369_10311567 | |||
| 1618 | Ga0157369_10478426 | |||
| 1619 | Ga0157369_10657150 | |||
| 1620 | Ga0157369_11072493 | |||
| 1621 | Ga0157369_11243778 | |||
| 1622 | Ga0157374_10070018 | |||
| 1623 | Ga0157374_11166948 | |||
| 1624 | Ga0157374_11656427 | |||
| 1625 | Ga0157378_10329329 | |||
| 1626 | Ga0157378_10460598 | |||
| 1627 | Ga0157378_13268364 | |||
| 1628 | Ga0163162_10104789 | |||
| 1629 | Ga0163162_10264516 | |||
| 1630 | Ga0163162_10538765 | |||
| 1631 | Ga0157372_10394651 | |||
| 1632 | Ga0157372_10620350 | |||
| 1633 | Ga0157372_10704310 | |||
| 1634 | Ga0157372_12391553 | |||
| 1635 | Ga0157372_12775560 | |||
| 1636 | Ga0157375_10095382 | |||
| 1637 | Ga0157375_10195506 | |||
| 1638 | Ga0157375_10395948 | |||
| 1639 | Ga0157375_10765328 | |||
| 1640 | Ga0157375_11334706 | |||
| 1641 | Ga0157375_12843690 | |||
| 1642 | Ga0163163_10345950 | |||
| 1643 | Ga0182008_10007996 | |||
| 1644 | Ga0182008_10030573 | |||
| 1645 | Ga0182008_10234206 | |||
| 1646 | Ga0182008_10470615 | |||
| 1647 | Ga0157376_10152399 | |||
| 1648 | Ga0157376_10506755 | |||
| 1649 | Ga0157376_10599363 | |||
| 1650 | Ga0157376_12380331 | |||
| 1651 | Ga0182006_1140307 | |||
| 1652 | Ga0182007_10073485 | |||
| 1653 | Ga0163161_10053397 | |||
| 1654 | Ga0163161_10219632 | |||
| 1655 | Ga0163161_11094287 | |||
| 1656 | Ga0206356_10899570 | |||
| 1657 | Ga0206356_11542665 | |||
| 1658 | Ga0206354_10762389 | |||
| 1659 | Ga0206354_10957585 | |||
| 1660 | Ga0206354_11589080 | |||
| 1661 | Ga0206353_10125552 | |||
| 1662 | Ga0206353_11044796 | |||
| 1663 | Ga0224712_10426978 | |||
| 1664 | Ga0207653_10040743 | |||
| 1665 | Ga0207653_10085409 | |||
| 1666 | Ga0207692_10069317 | |||
| 1667 | Ga0207642_10495427 | |||
| 1668 | Ga0207647_10544680 | |||
| 1669 | Ga0207685_10004314 | |||
| 1670 | Ga0207685_10040005 | |||
| 1671 | Ga0207685_10305341 | |||
| 1672 | Ga0207699_10113977 | |||
| 1673 | Ga0207699_10126905 | |||
| 1674 | Ga0207699_10213518 | |||
| 1675 | Ga0207699_10244174 | |||
| 1676 | Ga0207699_10514380 | |||
| 1677 | Ga0207705_10254051 | |||
| 1678 | Ga0207705_10373979 | |||
| 1679 | Ga0207684_10118812 | |||
| 1680 | Ga0207684_10344774 | |||
| 1681 | Ga0207684_10445018 | |||
| 1682 | Ga0207684_11309656 | |||
| 1683 | Ga0207707_10002240 | |||
| 1684 | Ga0207707_10007327 | |||
| 1685 | Ga0207707_10052433 | |||
| 1686 | Ga0207707_10086931 | |||
| 1687 | Ga0207707_10166580 | |||
| 1688 | Ga0207707_10177157 | |||
| 1689 | Ga0207707_10747028 | |||
| 1690 | Ga0207707_10747474 | |||
| 1691 | Ga0207695_10374530 | |||
| 1692 | Ga0207695_10516075 | |||
| 1693 | Ga0207695_10775729 | |||
| 1694 | Ga0207695_11062905 | |||
| 1695 | Ga0207671_10165105 | |||
| 1696 | Ga0207693_10001413 | |||
| 1697 | Ga0207693_10003121 | |||
| 1698 | Ga0207693_10013285 | |||
| 1699 | Ga0207693_10013689 | |||
| 1700 | Ga0207693_10017496 | |||
| 1701 | Ga0207693_10114733 | |||
| 1702 | Ga0207693_10133422 | |||
| 1703 | Ga0207693_10136163 | |||
| 1704 | Ga0207693_10255588 | |||
| 1705 | Ga0207693_10807937 | |||
| 1706 | Ga0207663_10011530 | |||
| 1707 | Ga0207663_10153012 | |||
| 1708 | Ga0207663_10154712 | |||
| 1709 | Ga0207663_10164858 | |||
| 1710 | Ga0207663_10193643 | |||
| 1711 | Ga0207663_11293934 | |||
| 1712 | Ga0207660_10025605 | |||
| 1713 | Ga0207660_10083463 | |||
| 1714 | Ga0207660_10143095 | |||
| 1715 | Ga0207660_10188300 | |||
| 1716 | Ga0207660_10230151 | |||
| 1717 | Ga0207660_10403758 | |||
| 1718 | Ga0207660_10677481 | |||
| 1719 | Ga0207662_10195978 | |||
| 1720 | Ga0207657_10004596 | |||
| 1721 | Ga0207657_10007905 | |||
| 1722 | Ga0207657_10063649 | |||
| 1723 | Ga0207657_10066420 | |||
| 1724 | Ga0207657_10170731 | |||
| 1725 | Ga0207649_10135445 | |||
| 1726 | Ga0207649_10469451 | |||
| 1727 | Ga0207649_10889868 | |||
| 1728 | Ga0207649_10930468 | |||
| 1729 | Ga0207652_10050250 | |||
| 1730 | Ga0207652_10060178 | |||
| 1731 | Ga0207652_10347002 | |||
| 1732 | Ga0207652_10983054 | |||
| 1733 | Ga0207646_10023032 | |||
| 1734 | Ga0207646_10024884 | |||
| 1735 | Ga0207646_10127417 | |||
| 1736 | Ga0207646_10184044 | |||
| 1737 | Ga0207646_10227292 | |||
| 1738 | Ga0207646_10526807 | |||
| 1739 | Ga0207646_10819776 | |||
| 1740 | Ga0207646_11208232 | |||
| 1741 | Ga0207681_10440473 | |||
| 1742 | Ga0207659_10156308 | |||
| 1743 | Ga0207687_10005471 | |||
| 1744 | Ga0207687_10034631 | |||
| 1745 | Ga0207687_10036457 | |||
| 1746 | Ga0207687_10267586 | |||
| 1747 | Ga0207687_10505797 | |||
| 1748 | Ga0207700_10000004 | |||
| 1749 | Ga0207700_10163551 | |||
| 1750 | Ga0207700_10168395 | |||
| 1751 | Ga0207700_10262180 | |||
| 1752 | Ga0207700_10340745 | |||
| 1753 | Ga0207664_10034516 | |||
| 1754 | Ga0207664_10078694 | |||
| 1755 | Ga0207664_10154879 | |||
| 1756 | Ga0207664_10240571 | |||
| 1757 | Ga0207664_10255563 | |||
| 1758 | Ga0207664_10257255 | |||
| 1759 | Ga0207664_10268057 | |||
| 1760 | Ga0207664_10292632 | |||
| 1761 | Ga0207664_10632595 | |||
| 1762 | Ga0207664_10758076 | |||
| 1763 | Ga0207664_11270685 | |||
| 1764 | Ga0207644_10464614 | |||
| 1765 | Ga0207644_11564444 | |||
| 1766 | Ga0207690_10083851 | |||
| 1767 | Ga0207690_10252101 | |||
| 1768 | Ga0207706_10033829 | |||
| 1769 | Ga0207706_10134566 | |||
| 1770 | Ga0207706_10177781 | |||
| 1771 | Ga0207686_10020098 | |||
| 1772 | Ga0207686_10276017 | |||
| 1773 | Ga0207686_10474743 | |||
| 1774 | Ga0207709_10020706 | |||
| 1775 | Ga0207709_10164136 | |||
| 1776 | Ga0207709_10346551 | |||
| 1777 | Ga0207709_10617949 | |||
| 1778 | Ga0207709_10793775 | |||
| 1779 | Ga0207709_11217769 | |||
| 1780 | Ga0207669_10085042 | |||
| 1781 | Ga0207669_10389140 | |||
| 1782 | Ga0207665_10016651 | |||
| 1783 | Ga0207665_10058834 | |||
| 1784 | Ga0207665_10287137 | |||
| 1785 | Ga0207665_10555025 | |||
| 1786 | Ga0207691_10942219 | |||
| 1787 | Ga0207711_10160899 | |||
| 1788 | Ga0207711_11331653 | |||
| 1789 | Ga0207661_10000267 | |||
| 1790 | Ga0207661_10023853 | |||
| 1791 | Ga0207661_10118816 | |||
| 1792 | Ga0207661_10151849 | |||
| 1793 | Ga0207661_10164965 | |||
| 1794 | Ga0207661_10629418 | |||
| 1795 | Ga0207661_11023119 | |||
| 1796 | Ga0207661_11085809 | |||
| 1797 | Ga0207679_10129821 | |||
| 1798 | Ga0207679_10180148 | |||
| 1799 | Ga0207679_10585304 | |||
| 1800 | Ga0207667_10034152 | |||
| 1801 | Ga0207667_10199263 | |||
| 1802 | Ga0207667_10361565 | |||
| 1803 | Ga0207667_10567920 | |||
| 1804 | Ga0207651_10466537 | |||
| 1805 | Ga0207651_11432738 | |||
| 1806 | Ga0207712_10250341 | |||
| 1807 | Ga0207668_10059047 | |||
| 1808 | Ga0207668_10136707 | |||
| 1809 | Ga0207668_11026282 | |||
| 1810 | Ga0207640_10303974 | |||
| 1811 | Ga0207640_10514689 | |||
| 1812 | Ga0207658_10771610 | |||
| 1813 | Ga0207677_10099992 | |||
| 1814 | Ga0207677_10243874 | |||
| 1815 | Ga0207677_10280573 | |||
| 1816 | Ga0207677_10870810 | |||
| 1817 | Ga0207677_10912224 | |||
| 1818 | Ga0207677_11053573 | |||
| 1819 | Ga0207639_10410316 | |||
| 1820 | Ga0207678_10181432 | |||
| 1821 | Ga0207678_10512200 | |||
| 1822 | Ga0207678_10615382 | |||
| 1823 | Ga0207678_11068513 | |||
| 1824 | Ga0207708_10043614 | |||
| 1825 | Ga0207708_10179395 | |||
| 1826 | Ga0207708_10325686 | |||
| 1827 | Ga0207708_10683329 | |||
| 1828 | Ga0207702_10023561 | |||
| 1829 | Ga0207702_10112732 | |||
| 1830 | Ga0207702_10158677 | |||
| 1831 | Ga0207702_10273976 | |||
| 1832 | Ga0207702_10316545 | |||
| 1833 | Ga0207702_10344658 | |||
| 1834 | Ga0207702_10521171 | |||
| 1835 | Ga0207702_10775871 | |||
| 1836 | Ga0207702_10849098 | |||
| 1837 | Ga0207702_10960818 | |||
| 1838 | Ga0207702_11545579 | |||
| 1839 | Ga0207648_10141020 | |||
| 1840 | Ga0207648_10298118 | |||
| 1841 | Ga0207676_10107189 | |||
| 1842 | Ga0207674_10002797 | |||
| 1843 | Ga0207674_10123097 | |||
| 1844 | Ga0207674_10380690 | |||
| 1845 | Ga0207674_10545070 | |||
| 1846 | Ga0207675_100103035 | |||
| 1847 | Ga0207675_100125783 | |||
| 1848 | Ga0207675_100176725 | |||
| 1849 | Ga0207683_10015292 | |||
| 1850 | Ga0207683_10060043 | |||
| 1851 | Ga0207683_10249982 | |||
| 1852 | Ga0207683_10783881 | |||
| 1853 | Ga0207698_10177255 | |||
| 1854 | Ga0207698_11415995 | |||
| 1855 | Ga0207428_10005283 | |||
| 1856 | Ga0207428_10060435 | |||
| 1857 | Ga0207428_10066174 | |||
| 1858 | Ga0268265_10204197 | |||
| 1859 | Ga0268265_10570981 | |||
| 1860 | Ga0268265_10864491 | |||
| 1861 | Ga0265337_1033484 | |||
| 1862 | Ga0265319_1000701 | |||
| 1863 | Ga0265319_1003960 | |||
| 1864 | Ga0265319_1011867 | |||
| 1865 | Ga0265334_10001490 | |||
| 1866 | Ga0265334_10017585 | |||
| 1867 | Ga0265334_10325638 | |||
| 1868 | Ga0265318_10000400 | |||
| 1869 | Ga0265318_10006430 | |||
| 1870 | Ga0265318_10066769 | |||
| 1871 | Ga0265322_10007571 | |||
| 1872 | Ga0265336_10015536 | |||
| 1873 | Ga0265336_10022494 | |||
| 1874 | Ga0265338_10004790 | |||
| 1875 | Ga0265338_10007252 | |||
| 1876 | Ga0265324_10021766 | |||
| 1877 | Ga0265330_10001899 | |||
| 1878 | Ga0265330_10022449 | |||
| 1879 | Ga0265330_10205768 | |||
| 1880 | Ga0265332_10003587 | |||
| 1881 | Ga0265332_10123366 | |||
| 1882 | Ga0265328_10004911 | |||
| 1883 | Ga0265328_10087007 | |||
| 1884 | Ga0265320_10016387 | |||
| 1885 | Ga0265320_10077209 | |||
| 1886 | Ga0265325_10004124 | |||
| 1887 | Ga0265325_10060946 | |||
| 1888 | Ga0265329_10004136 | |||
| 1889 | Ga0265340_10012992 | |||
| 1890 | Ga0265340_10062734 | |||
| 1891 | Ga0265339_10006743 | |||
| 1892 | Ga0265339_10018324 | |||
| 1893 | Ga0265339_10234252 | |||
| 1894 | Ga0265331_10016699 | |||
| 1895 | Ga0265327_10011945 | |||
| 1896 | Ga0265327_10016620 | |||
| 1897 | Ga0265316_10009256 | |||
| 1898 | Ga0265316_10013876 | |||
| 1899 | Ga0265316_10047506 | |||
| 1900 | Ga0265316_10323392 | |||
| 1901 | Ga0265313_10011443 | |||
| 1902 | Ga0265313_10200340 | |||
| 1903 | Ga0265314_10025003 | |||
| 1904 | Ga0265314_10114538 | |||
| 1905 | Ga0265342_10011944 | |||
| 1906 | Ga0265342_10096550 | |||
| 1907 | Ga0307406_10032550 | |||
| 1908 | Ga0307406_10333844 | |||
| 1909 | Ga0307409_100318484 | |||
| 1910 | Ga0307416_100094801 | |||
| 1911 | Ga0307416_100394910 | |||
| 1912 | Ga0307416_100805392 | |||
| 1913 | Ga0307411_10341940 | |||
| 1914 | Ga0307415_100082901 | |||
| 1915 | Ga0307415_100084225 | |||
| 1916 | Ga0307415_100114369 | |||
| 1917 | Ga0373948_0001030 | |||
| 1918 | Ga0373950_0001374 | |||
| 1919 | Ga0373959_0016523 | |||
| 1920 | Ga0373959_0194784 | |||
| 1921 | Ga0373928_0009302 | |||
| 1922 | Ga0373928_0043252 | |||
| 1923 | Ga0373929_0174764 | |||
| 1924 | Ga0373944_0006430 | |||
| 1925 | Ga0373949_0002456 | |||
| 1926 | Ga0373951_0010117 | |||
| 1927 | Ga0373932_0006861 | |||
| 1928 | Ga0373932_0102548 | |||
| 1929 | Ga0373945_0013670 | |||
| 1930 | Ga0373953_0514112 | |||
| 1931 | Ga0373960_0000659 | |||
| 1932 | Ga0373960_0082049 | |||
| 1933 | Ga0373960_0161335 | |||
| 1934 | Ga0373943_0044893 | |||
| 1935 | Ga0373943_0090860 | |||
| 1936 | Ga0373946_0025050 | |||
| 1937 | Ga0373942_0033826 | |||
| 1938 | Ga0373942_0245166 | |||
| 1939 | Ga0373961_0004945 | |||
| 1940 | Ga0373961_0022155 | |||
| 1941 | Ga0373962_0021984 | |||
| 1942 | Ga0373935_0059860 | |||
| 1943 | Ga0373935_0149648 | |||
| 1944 | Ga0373935_0337221 | |||
| 1945 | Ga0373927_0178107 | |||
| 1946 | Ga0373947_0008709 | |||
| 1947 | Ga0373925_0001380 | |||
| 1948 | Ga0373925_0258569 | |||
| 1949 | Ga0373925_1575372 | |||
| 1950 | Ga0395899_0002522 | |||
| 1951 | Ga0395899_0002768 | |||
| 1952 | Ga0395899_0010024 | |||
| 1953 | Ga0395899_0029486 | |||
| 1954 | Ga0395899_0031542 | |||
| 1955 | Ga0395899_0066853 | |||
| 1956 | Ga0395899_0277901 | |||
| 1957 | Ga0395899_0301650 | |||
| 1958 | Ga0395899_0305049 | |||
| 1959 | Ga0395899_0352887 | |||
| 1960 | Ga0395899_0515976 | |||
| 1961 | Ga0395899_0918796 | |||
| 1962 | Ga0395900_0004816 | |||
| 1963 | Ga0395900_0008116 | |||
| 1964 | Ga0395900_0013683 | |||
| 1965 | Ga0395900_0015373 | |||
| 1966 | Ga0395900_0015535 | |||
| 1967 | Ga0395900_0020954 | |||
| 1968 | Ga0395900_0026748 | |||
| 1969 | Ga0395900_0027465 | |||
| 1970 | Ga0395900_0046433 | |||
| 1971 | Ga0395900_0062783 | |||
| 1972 | Ga0395900_0100089 | |||
| 1973 | Ga0395900_0114957 | |||
| 1974 | Ga0395900_0172194 | |||
| 1975 | Ga0395900_0290128 | |||
| 1976 | Ga0395900_0351192 | |||
| 1977 | Ga0395900_0363073 | |||
| 1978 | Ga0395900_0430394 | |||
| 1979 | Ga0395900_0664599 | |||
| 1980 | Ga0395900_0981838 | |||
| 1981 | Ga0395900_1457410 | |||
| 1982 | Ga0395900_1886758 | |||
| 1983 | Ga0395898_0000635 | |||
| 1984 | Ga0395898_0004222 | |||
| 1985 | Ga0395898_0012120 | |||
| 1986 | Ga0395898_0013333 | |||
| 1987 | Ga0395898_0018206 | |||
| 1988 | Ga0395898_0019228 | |||
| 1989 | Ga0395898_0043451 | |||
| 1990 | Ga0395898_0058150 | |||
| 1991 | Ga0395898_0068002 | |||
| 1992 | Ga0395898_0070716 | |||
| 1993 | Ga0395898_0092297 | |||
| 1994 | Ga0395898_0093719 | |||
| 1995 | Ga0395898_0117809 | |||
| 1996 | Ga0395898_0167641 | |||
| 1997 | Ga0395898_0183903 | |||
| 1998 | Ga0395898_0277130 | |||
| 1999 | Ga0395898_0313132 | |||
| 2000 | Ga0395898_0350755 | |||
| 2001 | Ga0395898_0567589 | |||
| 2002 | Ga0395898_0757508 | |||
| 2003 | Ga0395898_0764494 | |||
| 2004 | Ga0395898_0829694 | |||
| 2005 | Ga0395898_0936656 | |||
| 2006 | Ga0395898_1328667 | |||
| 2007 | Ga0395898_1481907 | |||
| 2008 | Ga0395905_0006804 | |||
| 2009 | Ga0395905_0009799 | |||
| 2010 | Ga0395905_0024697 | |||
| 2011 | Ga0395905_0026941 | |||
| 2012 | Ga0395905_0032364 | |||
| 2013 | Ga0395905_0045678 | |||
| 2014 | Ga0395905_0046418 | |||
| 2015 | Ga0395905_0068297 | |||
| 2016 | Ga0395905_0102974 | |||
| 2017 | Ga0395905_0125458 | |||
| 2018 | Ga0395905_0274139 | |||
| 2019 | Ga0395905_0420491 | |||
| 2020 | Ga0395905_0687857 | |||
| 2021 | Ga0395905_0740466 | |||
| 2022 | Ga0395905_0812550 | |||
| 2023 | Ga0395905_1010807 | |||
| 2024 | Ga0395905_1129397 | |||
| 2025 | Ga0395905_1134535 | |||
| 2026 | Ga0395901_0002544 | |||
| 2027 | Ga0395901_0006552 | |||
| 2028 | Ga0395901_0008779 | |||
| 2029 | Ga0395901_0010232 | |||
| 2030 | Ga0395901_0014478 | |||
| 2031 | Ga0395901_0016360 | |||
| 2032 | Ga0395901_0016913 | |||
| 2033 | Ga0395901_0019082 | |||
| 2034 | Ga0395901_0058458 | |||
| 2035 | Ga0395901_0060988 | |||
| 2036 | Ga0395901_0066787 | |||
| 2037 | Ga0395901_0095980 | |||
| 2038 | Ga0395901_0117869 | |||
| 2039 | Ga0395901_0126868 | |||
| 2040 | Ga0395901_0142940 | |||
| 2041 | Ga0395901_0177673 | |||
| 2042 | Ga0395901_0212055 | |||
| 2043 | Ga0395901_0302082 | |||
| 2044 | Ga0395901_0369595 | |||
| 2045 | Ga0395901_0393199 | |||
| 2046 | Ga0395901_0395172 | |||
| 2047 | Ga0395901_0406680 | |||
| 2048 | Ga0395901_0778085 | |||
| 2049 | Ga0395901_1327255 | |||
| 2050 | Ga0395901_1750139 | |||
| 2051 | Ga0395901_1778174 | |||
| 2052 | Ga0242420_145225 | |||
| 2053 | Ga0436365_0307627 | |||
| 2054 | Ga0439453_0028297 | |||
| 2055 | Ga0439453_0063875 | |||
| 2056 | Ga0439466_0062803 | |||
| 2057 | Ga0451789_0339081 | |||
| 2058 | Ga0451789_1312427 | |||
| 2059 | Ga0451793_0317672 | |||
| 2060 | Ga0451795_0027106 | |||
| 2061 | Ga0451798_0263104 | |||
| 2062 | Ga0451800_1462570 | |||
| 2063 | Ga0451802_1524512 | |||
| 2064 | Ga0451802_2028705 | |||
| 2065 | Ga0451804_0321035 | |||
| 2066 | Ga0451807_0330186 | |||
| 2067 | Ga0451835_0161116 | |||
| 2068 | Ga0451835_0538146 | |||
| 2069 | Ga0451839_0726782 | |||
| 2070 | Ga0451841_1061094 | |||
| 2071 | Ga0451845_0482713 | |||
| 2072 | Ga0451845_0862811 | |||
| 2073 | Ga0451847_0449104 | |||
| 2074 | Ga0451849_0691407 | |||
| 2075 | Ga0451849_0945287 | |||
| 2076 | Ga0451851_0768897 | |||
| 2077 | Ga0451851_0904337 | |||
| 2078 | Ga0451855_1065849 | |||
| 2079 | Ga0451853_0167061 | |||
| 2080 | Ga0451853_0460319 | |||
| 2081 | Ga0451853_0801509 | |||
| 2082 | Ga0439448_0015925 | |||
| 2083 | Ga0439448_0232723 | |||
| 2084 | Ga0439455_0007025 | |||
| 2085 | Ga0439455_0109878 | |||
| 2086 | Ga0439463_063743 | |||
| 2087 | Ga0439458_0090197 | |||
| 2088 | Ga0439458_0149503 | |||
| 2089 | Ga0450916_021282 | |||
| 2090 | Ga0466965_0082223 | |||
| 2091 | Ga0466966_0046003 | |||
| 2092 | Ga0466966_0256009 | |||
| 2093 | Ga0466966_0631076 | |||
| 2094 | Ga0466961_0097942 | |||
| 2095 | Ga0466963_0002756 | |||
| 2096 | Ga0466963_0072458 | |||
| 2097 | Ga0466963_0133691 | |||
| 2098 | Ga0466963_0249010 | |||
| 2099 | Ga0466963_0346030 | |||
| 2100 | Ga0466963_0461383 | |||
| 2101 | Ga0466963_0577936 | |||
| 2102 | Ga0466963_0808718 | |||
| 2103 | Ga0466963_1280354 | |||
| 2104 | Ga0466964_0002141 | |||
| 2105 | Ga0466964_0008934 | |||
| 2106 | Ga0466964_0287689 | |||
| 2107 | Ga0466971_0025187 | |||
| 2108 | Ga0466971_0045201 | |||
| 2109 | Ga0466971_0306612 | |||
| 2110 | Ga0466968_0060322 | |||
| 2111 | Ga0466957_0236711 | |||
| 2112 | Ga0466957_0768038 | |||
| 2113 | Ga0466960_0031717 | |||
| 2114 | Ga0466960_0059978 | |||
| 2115 | Ga0466960_0309132 | |||
| 2116 | Ga0466959_0012573 | |||
| 2117 | Ga0466959_0879196 | |||
| 2118 | Ga0451576_0013374 | |||
| 2119 | Ga0451576_1141280 | |||
| 2120 | Ga0466958_0031410 | |||
| 2121 | Ga0466958_0073966 | |||
| 2122 | Ga0466958_0107860 | |||
| 2123 | Ga0466958_0203590 | |||
| 2124 | Ga0466958_0359906 | |||
| 2125 | Ga0466958_0575394 | |||
| 2126 | Ga0466967_0002982 | |||
| 2127 | Ga0466967_0051946 | |||
| 2128 | Ga0466967_0068765 | |||
| 2129 | Ga0466967_0131822 | |||
| 2130 | Ga0466967_0159179 | |||
| 2131 | Ga0466967_0164778 | |||
| 2132 | Ga0466967_0231230 | |||
| 2133 | Ga0466967_0231462 | |||
| 2134 | Ga0466967_0355525 | |||
| 2135 | Ga0466967_0823387 | |||
| 2136 | Ga0466967_1065500 | |||
| 2137 | Ga0466967_1187418 | |||
| 2138 | Ga0466967_1224003 | |||
| 2139 | Ga0495592_0526773 | |||
| 2140 | Ga0495603_0066776 | |||
| 2141 | Ga0495629_0079911 | |||
| 2142 | Ga0495629_0169606 | |||
| 2143 | Ga0495641_0001074 | |||
| 2144 | Ga0495641_0077242 | |||
| 2145 | Ga0495641_0122736 | |||
| 2146 | Ga0495641_0147684 | |||
| 2147 | Ga0495651_0379822 | |||
| 2148 | Ga0495651_0526482 | |||
| 2149 | Ga0495653_0075281 | |||
| 2150 | Ga0495653_0149157 | |||
| 2151 | Ga0495580_0050268 | |||
| 2152 | Ga0495582_0025909 | |||
| 2153 | Ga0495582_0065275 | |||
| 2154 | Ga0495605_0343545 | |||
| 2155 | Ga0495639_0149702 | |||
| 2156 | Ga0495664_0451082 | |||
| 2157 | Ga0495664_0493925 | |||
| 2158 | Ga0495584_0055679 | |||
| 2159 | Ga0495585_0230235 | |||
| 2160 | Ga0495594_0002224 | |||
| 2161 | Ga0495594_0463034 | |||
| 2162 | Ga0495596_0214632 | |||
| 2163 | Ga0495596_0221112 | |||
| 2164 | Ga0495607_0132391 | |||
| 2165 | Ga0495607_0155424 | |||
| 2166 | Ga0495607_0510900 | |||
| 2167 | Ga0495608_0656559 | |||
| 2168 | Ga0495618_0207417 | |||
| 2169 | Ga0495618_0663682 | |||
| 2170 | Ga0495630_0144463 | |||
| 2171 | Ga0495630_0236754 | |||
| 2172 | Ga0495630_0346218 | |||
| 2173 | Ga0495631_0167572 | |||
| 2174 | Ga0495637_0169922 | |||
| 2175 | Ga0495644_0032720 | |||
| 2176 | Ga0495644_0157154 | |||
| 2177 | Ga0495644_0253258 | |||
| 2178 | Ga0495663_0152700 | |||
| 2179 | Ga0495663_0338114 | |||
| 2180 | Ga0495666_0034432 | |||
| 2181 | Ga0495642_0121695 | |||
| 2182 | Ga0495642_0298542 | |||
| 2183 | Ga0495665_0070197 | |||
| 2184 | Ga0495640_0482123 | |||
| 2185 | Ga0495640_0522499 | |||
| 2186 | Ga0495598_0061117 | |||
| 2187 | Ga0495609_0206439 | |||
| 2188 | Ga0495609_0258174 | |||
| 2189 | Ga0495645_0536073 | |||
| 2190 | Ga0495667_0065362 | |||
| 2191 | Ga0495656_0024935 | |||
| 2192 | Ga0495656_0044402 | |||
| 2193 | Ga0495656_0303518 | |||
| 2194 | Ga0495656_0387114 | |||
| 2195 | Ga0495668_0562155 | |||
| 2196 | Ga0495668_0804061 | |||
| 2197 | Ga0495634_0465866 | |||
| 2198 | Ga0495611_0131629 | |||
| 2199 | Ga0495635_0547324 | |||
| 2200 | Ga0495659_0194215 | |||
| 2201 | Ga0495588_0000390 | |||
| 2202 | Ga0495588_0196323 | |||
| 2203 | Ga0495657_0068189 | |||
| 2204 | Ga0495657_0315612 | |||
| 2205 | Ga0495599_0546378 | |||
| 2206 | Ga0495647_0216042 | |||
| 2207 | Ga0495658_0262499 | |||
| 2208 | Ga0495658_0423071 | |||
| 2209 | Ga0495669_0607960 | |||
| 2210 | Ga0495613_0065200 | |||
| 2211 | Ga0495613_0099395 | |||
| 2212 | Ga0495670_0323987 | |||
| 2213 | Ga0495670_0832544 | |||
| 2214 | Ga0495589_0381721 | |||
| 2215 | Ga0495600_0043700 | |||
| 2216 | Ga0495600_0218419 | |||
| 2217 | Ga0495660_0115494 | |||
| 2218 | Ga0495581_0019596 | |||
| 2219 | Ga0495581_0095755 | |||
| 2220 | Ga0495636_0060526 | |||
| 2221 | Ga0495674_0469515 | |||
| 2222 | Ga0495676_0000419 | |||
| 2223 | Ga0495676_0039368 | |||
| 2224 | Ga0495676_0051089 | |||
| 2225 | Ga0495676_0346794 | |||
| 2226 | Ga0495676_0748915 | |||
| 2227 | Ga0495680_0152718 | |||
| 2228 | Ga0495680_0407119 | |||
| 2229 | Ga0495677_0225389 | |||
| 2230 | Ga0495679_051780 | |||
| 2231 | Ga0495685_213922 | |||
| 2232 | Ga0495684_0600936 | |||
| 2233 | Ga0495614_0422813 | |||
| 2234 | Ga0495615_0061153 | |||
| 2235 | Ga0496100_0062123 | |||
| 2236 | Ga0496100_0099904 | |||
| 2237 | Ga0496100_0222547 | |||
| 2238 | Ga0496100_0490643 | |||
| 2239 | Ga0496100_0729353 | |||
| 2240 | Ga0496101_0006797 | |||
| 2241 | Ga0496101_0057373 | |||
| 2242 | Ga0496101_0353852 | |||
| 2243 | Ga0496101_0403928 | |||
| 2244 | Ga0496101_0624119 | |||
| 2245 | Ga0496101_0648102 | |||
| 2246 | Ga0496102_0021405 | |||
| 2247 | Ga0496102_0097220 | |||
| 2248 | Ga0496102_0158310 | |||
| 2249 | Ga0496102_0187258 | |||
| 2250 | Ga0496102_0270804 | |||
| 2251 | Ga0496102_1361634 | |||
| 2252 | Ga0496103_0004888 | |||
| 2253 | Ga0496103_0009732 | |||
| 2254 | Ga0496103_0035474 | |||
| 2255 | Ga0496103_0044941 | |||
| 2256 | Ga0496103_0119414 | |||
| 2257 | Ga0496103_0150713 | |||
| 2258 | Ga0496103_0213230 | |||
| 2259 | Ga0496104_0000407 | |||
| 2260 | Ga0496104_0002003 | |||
| 2261 | Ga0496104_0002189 | |||
| 2262 | Ga0496104_0061377 | |||
| 2263 | Ga0496104_0389930 | |||
| 2264 | Ga0496104_0489064 | |||
| 2265 | Ga0496104_0830134 | |||
| 2266 | Ga0496104_0967613 | |||
| 2267 | Ga0496104_1767110 | |||
| 2268 | Ga0496105_0003606 | |||
| 2269 | Ga0496105_0153981 | |||
| 2270 | Ga0496105_0231013 | |||
| 2271 | Ga0496105_0281950 | |||
| 2272 | Ga0496105_0452005 | |||
| 2273 | Ga0496105_0611523 | |||
| 2274 | Ga0496106_0022850 | |||
| 2275 | Ga0496106_0043319 | |||
| 2276 | Ga0496106_0044607 | |||
| 2277 | Ga0496106_0174881 | |||
| 2278 | Ga0496106_0300865 | |||
| 2279 | Ga0496106_0743770 | |||
| 2280 | Ga0496107_0017059 | |||
| 2281 | Ga0496107_0044202 | |||
| 2282 | Ga0496107_0069024 | |||
| 2283 | Ga0496107_0357669 | |||
| 2284 | Ga0496107_0535351 | |||
| 2285 | Ga0496107_0716969 | |||
| 2286 | Ga0496108_0005212 | |||
| 2287 | Ga0496108_0122629 | |||
| 2288 | Ga0496108_0134632 | |||
| 2289 | Ga0496108_0207670 | |||
| 2290 | Ga0496108_0220141 | |||
| 2291 | Ga0496108_0908223 | |||
| 2292 | Ga0496109_0002745 | |||
| 2293 | Ga0496109_0004241 | |||
| 2294 | Ga0496109_0015213 | |||
| 2295 | Ga0496109_0047176 | |||
| 2296 | Ga0496109_0079090 | |||
| 2297 | Ga0496109_0090059 | |||
| 2298 | Ga0496109_0194256 | |||
| 2299 | Ga0496109_0207893 | |||
| 2300 | Ga0496109_0271841 | |||
| 2301 | Ga0496109_0706730 | |||
| 2302 | Ga0496109_0718984 | |||
| 2303 | Ga0496109_0852572 | |||
| 2304 | Ga0496109_1202745 | |||
| 2305 | Ga0496109_1519541 | |||
| 2306 | Ga0496109_1595495 | |||
| 2307 | Ga0496109_1784227 | |||
| 2308 | Ga0496109_1810066 | |||
| 2309 | Ga0496110_0000628 | |||
| 2310 | Ga0496110_0002493 | |||
| 2311 | Ga0496110_0014421 | |||
| 2312 | Ga0496110_0028794 | |||
| 2313 | Ga0496110_0090381 | |||
| 2314 | Ga0496110_0163802 | |||
| 2315 | Ga0496110_0180210 | |||
| 2316 | Ga0496110_0341840 | |||
| 2317 | Ga0496110_0408017 | |||
| 2318 | Ga0496110_0479556 | |||
| 2319 | Ga0496110_0760680 | |||
| 2320 | Ga0496111_0002892 | |||
| 2321 | Ga0496111_0003525 | |||
| 2322 | Ga0496111_0024101 | |||
| 2323 | Ga0496111_0025685 | |||
| 2324 | Ga0496111_0045172 | |||
| 2325 | Ga0496111_0131354 | |||
| 2326 | Ga0496111_0369790 | |||
| 2327 | Ga0496111_0532908 | |||
| 2328 | Ga0496111_0658484 | |||
| 2329 | Ga0496111_0689981 | |||
| 2330 | Ga0496111_0795438 | |||
| 2331 | Ga0496112_0002231 | |||
| 2332 | Ga0496112_0004088 | |||
| 2333 | Ga0496112_0016721 | |||
| 2334 | Ga0496112_0019773 | |||
| 2335 | Ga0496112_0047973 | |||
| 2336 | Ga0496112_0203607 | |||
| 2337 | Ga0496112_0284351 | |||
| 2338 | Ga0496112_0539759 | |||
| 2339 | Ga0496112_0581257 | |||
| 2340 | Ga0496112_0625357 | |||
| 2341 | Ga0496112_0707761 | |||
| 2342 | Ga0496112_0905620 | |||
| 2343 | Ga0496112_1918524 | |||
| 2344 | Ga0496113_0035059 | |||
| 2345 | Ga0496113_0103248 | |||
| 2346 | Ga0496113_0120026 | |||
| 2347 | Ga0496113_0120386 | |||
| 2348 | Ga0496113_1026541 | |||
| 2349 | Ga0496114_0002506 | |||
| 2350 | Ga0496114_0002854 | |||
| 2351 | Ga0496114_0039143 | |||
| 2352 | Ga0496114_0053819 | |||
| 2353 | Ga0496114_0123461 | |||
| 2354 | Ga0496114_0225050 | |||
| 2355 | Ga0496114_0297247 | |||
| 2356 | Ga0496114_1491785 | |||
| 2357 | Ga0501031_0903874 | |||
| 2358 | Ga0501034_0009184 | |||
| 2359 | Ga0501036_0640608 | |||
| 2360 | Ga0501039_0137895 | |||
| 2361 | Ga0501040_0366469 | |||
| 2362 | Ga0501040_0446171 | |||
| 2363 | Ga0501040_0526411 | |||
| 2364 | Ga0501041_0118470 | |||
| 2365 | Ga0501042_0001033 | |||
| 2366 | Ga0501043_0014874 | |||
| 2367 | Ga0501043_0636164 | |||
| 2368 | Ga0501047_0106545 | |||
| 2369 | Ga0501048_0004658 | |||
| 2370 | Ga0501048_0519772 | |||
| 2371 | Ga0501048_1039227 | |||
| 2372 | Ga0501067_0002416 | |||
| 2373 | Ga0501067_0031798 | |||
| 2374 | Ga0501067_0087271 | |||
| 2375 | Ga0501067_0724965 | |||
| 2376 | Ga0501068_0013558 | |||
| 2377 | Ga0501069_0001655 | |||
| 2378 | Ga0501069_0210633 | |||
| 2379 | Ga0501069_0404621 | |||
| 2380 | Ga0501069_0468963 | |||
| 2381 | Ga0501069_0684328 | |||
| 2382 | Ga0501070_0013996 | |||
| 2383 | Ga0501070_0079576 | |||
| 2384 | Ga0501070_0307423 | |||
| 2385 | Ga0501071_0741910 | |||
| 2386 | Ga0501071_0824240 | |||
| 2387 | Ga0501072_0011327 | |||
| 2388 | Ga0501072_0093455 | |||
| 2389 | Ga0501073_0074391 | |||
| 2390 | Ga0501074_0122081 | |||
| 2391 | Ga0501074_0344050 | |||
| 2392 | Ga0501074_0560556 | |||
| 2393 | Ga0501075_0133739 | |||
| 2394 | Ga0501075_0701641 | |||
| 2395 | Ga0501076_0148379 | |||
| 2396 | Ga0501076_0861812 | |||
| 2397 | Ga0501077_0065470 | |||
| 2398 | Ga0501079_0056730 | |||
| 2399 | Ga0501079_0200471 | |||
| 2400 | Ga0501079_0451488 | |||
| 2401 | Ga0501079_0647692 | |||
| 2402 | Ga0501080_0052034 | |||
| 2403 | Ga0501080_0216787 | |||
| 2404 | Ga0501083_0004863 | |||
| 2405 | Ga0501035_0063637 | |||
| 2406 | Ga0501044_0253934 | |||
| 2407 | Ga0501045_0152924 | |||
| 2408 | Ga0501045_0666262 | |||
| 2409 | nmdc:mga05p37_163020_c1 | |||
| 2410 | nmdc:mga05p37_182865_c1 | |||
| 2411 | nmdc:mga05p37_307721_c2 | |||
| 2412 | nmdc:mga05p37_41140_c1 | |||
| 2413 | nmdc:mga05p37_47682_c1 | |||
| 2414 | nmdc:mga05p37_585963_c1 | |||
| 2415 | nmdc:mga06r32_114013_c1 | |||
| 2416 | nmdc:mga06r32_147876_c1 | |||
| 2417 | nmdc:mga06r32_179801_c1 | |||
| 2418 | nmdc:mga06r32_572977_c1 | |||
| 2419 | nmdc:mga06r32_806662_c1 | |||
| 2420 | nmdc:mga06r32_914519_c1 | |||
| 2421 | nmdc:mga08y16_115402_c1 | |||
| 2422 | nmdc:mga08y16_188725_c1 | |||
| 2423 | nmdc:mga08y16_28005_c1 | |||
| 2424 | nmdc:mga08y16_375609_c1 | |||
| 2425 | nmdc:mga08y16_534799_c1 | |||
| 2426 | nmdc:mga08y16_788766_c1 | |||
| 2427 | nmdc:mga0n895_281331_c1 | |||
| 2428 | nmdc:mga0n895_283975_c1 | |||
| 2429 | nmdc:mga0n895_317239_c1 | |||
| 2430 | nmdc:mga0n895_323214_c1 | |||
| 2431 | nmdc:mga0n895_71102_c1 | |||
| 2432 | nmdc:mga0n895_78268_c1 | |||
| 2433 | nmdc:mga0n895_849394_c1 | |||
| 2434 | nmdc:mga0rr50_204575_c1 | |||
| 2435 | nmdc:mga0rr50_268411_c1 | |||
| 2436 | nmdc:mga0rr50_30069_c1 | |||
| 2437 | nmdc:mga0rr50_635395_c1 | |||
| 2438 | nmdc:mga0rr50_669481_c1 | |||
| 2439 | nmdc:mga0rr50_773192_c1 | |||
| 2440 | nmdc:mga0rr50_78138_c1 | |||
| 2441 | nmdc:mga0rr50_78220_c1 | |||
| 2442 | nmdc:mga0rr50_946401_c1 | |||
| 2443 | nmdc:mga08x19_160527_c2 | |||
| 2444 | nmdc:mga08x19_197983_c1 | |||
| 2445 | nmdc:mga08x19_236981_c1 | |||
| 2446 | nmdc:mga08x19_278988_c1 | |||
| 2447 | nmdc:mga08x19_44260_c1 | |||
| 2448 | nmdc:mga0a205_13455_c1 | |||
| 2449 | nmdc:mga0a205_193150_c1 | |||
| 2450 | nmdc:mga0a205_200979_c1 | |||
| 2451 | nmdc:mga0a205_393207_c1 | |||
| 2452 | nmdc:mga0a205_55411_c1 | |||
| 2453 | nmdc:mga0a205_62734_c1 | |||
| 2454 | nmdc:mga0a205_74755_c1 | |||
| 2455 | nmdc:mga0a205_80222_c1 | |||
| 2456 | Ga0495601_0140954 | |||
| 2457 | Ga0495601_0637846 | |||
| 2458 | Ga0495655_0044935 | |||
| 2459 | Ga0495655_0123376 | |||
| 2460 | Ga0495595_0173923 | |||
| 2461 | Ga0495595_0267750 | |||
| 2462 | Ga0495595_0429290 | |||
| 2463 | Ga0495619_0128266 | |||
| 2464 | Ga0495619_0293910 | |||
| 2465 | Ga0495619_0470526 | |||
| 2466 | Ga0500641_0069612 | |||
| 2467 | Ga0501084_0294861 | |||
| 2468 | Ga0501084_0388932 | |||
| 2469 | Ga0501084_0424147 | |||
| 2470 | Ga0501084_0779266 | |||
| 2471 | Ga0501082_0066191 | |||
| 2472 | Ga0501082_0092113 | |||
| 2473 | Ga0501082_0593359 | |||
| 2474 | Ga0466962_0039991 | |||
| 2475 | Ga0466962_0227466 | |||
| 2476 | Ga0466962_0266435 | |||
| 2477 | Ga0466962_0306074 | |||
| 2478 | Ga0466962_0481123 | |||
| 2479 | Ga0466962_0617109 | |||
| 2480 | Ga0530510_0015329 | |||
| 2481 | Ga0530510_0137253 | |||
| 2482 | Ga0530510_0489699 | |||
| 2483 | Ga0530510_0602163 | |||
| 2484 | Ga0530510_0812387 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zbp-assembly1.cif.gz_B | crystal structure of the ampcpr-bound atnudt7 | 0.9005 | 98 | 147 |
| 3fxt-assembly1.cif.gz_A | crystal structure of the n-terminal domain of human nudt6 | 0.8523 | 97 | 148 |
| 4zb3-assembly1.cif.gz_A-2 | crystal structure of the apo atnudt7 | 0.8311 | 98 | 147 |
| 4zbp-assembly2.cif.gz_C-2 | crystal structure of the ampcpr-bound atnudt7 | 0.8254 | 98 | 147 |
| 1b6b-assembly2.cif.gz_B | melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism | 0.8019 | 47 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7M4C3_11_92_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9057 | 98 | 147 | 3.40.630.30 |
| af_Q9SJC4_7_94_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8921 | 99 | 147 | 3.40.630.30 |
| af_Q54U83_110_201_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8825 | 97 | 148 | 3.40.630.30 |
| af_A0A1D6QIS1_205_278_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.839 | 98 | 148 | 3.40.630.30 |
| af_Q9LR91_165_296_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8385 | 55 | 148 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537THW4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9882 | 38 | 148 |
GO:0016747
|
| AF-A0A537THW4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9707 | 38 | 148 |
GO:0016747
|
| AF-A0A537WXQ4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9698 | 1 | 148 |
GO:0016747
|
| AF-A0A7W1JY93-F1-model_v4 | GNAT family N-acetyltransferase | 0.9684 | 16 | 148 |
GO:0016747
|
| AF-A0A427SVV1-F1-model_v4 | GNAT family N-acetyltransferase | 0.9667 | 32 | 148 |
GO:0016747
|