F492067

General Info

Members Datasets Scaffolds Average Seq Length
1239 345 1216 161

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100099788|Ga0070670_1000997882
Length 180
Sequence VLRCAQPIYFIEAGAGNVNRSRASNLMFWGSLALCYVLQLMPLPPALLPFKPFWLALVLIYWALESPERVGLGLMFCLGLLGDVLGGELLGEQAARLCVLGFIVLRFRPRLRFFPMWQQSLAVLALLLNDRVFLLMIHAFAGDPIPPASFWLAPPAGALAWPWLFLLLDDLRARLRVHEA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
7 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
8 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
9 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
10 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
11 2734482264 Dyella sp. AD052 Isolate Unclassified
12 2738543009 Luteibacter sp. OK325 Isolate Unclassified
13 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
14 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
15 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
16 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
17 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
18 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
19 2919085039 Luteibacter sp. 1214 Isolate Unclassified
20 2919404418 Luteibacter sp. 3190 Isolate Unclassified
21 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
22 2941471342 Luteibacter sp. 621 Isolate Unclassified
23 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
32 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
230 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
231 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
232 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
233 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
248 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
251 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
326 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
327 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
335 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
338 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
339 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 0.81
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.71
Nodule 0
Rhizoplane 1.45
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 6.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1026770 3300001904 Bacteria 895
2 JGI24741J21665_1000630 3300001915 Bacteria 10657
3 JGI24741J21665_1002101 3300001915 Bacteria 5316
4 JGI24741J21665_1003649 3300001915 Bacteria 3604
5 JGI24740J21852_10000804 3300001979 Bacteria 13785
6 JGI24740J21852_10002531 3300001979 Bacteria 8254
7 JGI24735J21928_10032079 3300002067 Bacteria 1555
8 JGI25156J39149_1010862 3300002705 Bacteria 2106
9 JGI25156J39149_1019318 3300002705 Bacteria 1230
10 JGI25162J39368_1002123 3300002737 Bacteria 8406
11 JGI25162J39368_1004779 3300002737 Bacteria 2966
12 JGI25162J39368_1005781 3300002737 Bacteria 2309
13 JGI25162J39368_1007437 3300002737 Bacteria 1707
14 JGI25157J39369_1001648 3300002741 Bacteria 7660
15 JGI25164J39214_1001039 3300002772 Bacteria 8407
16 JGI25164J39214_1001045 3300002772 Bacteria 8322
17 JGI25165J46597_1001900 3300003214 Bacteria 8406
18 JGI25165J46597_1001970 3300003214 Bacteria 7992
19 rootH1_10066759 3300003316 Bacteria 7309
20 JGI25160J50197_1037683 3300003354 Bacteria 1154
21 Ga0055525_1000138 3300003759 Bacteria 104087
22 Ga0055542_1001346 3300003762 Bacteria 12683
23 Ga0055543_1031151 3300004625 Bacteria 930
24 Ga0065165_1003134 3300005262 Bacteria 12213
25 Ga0070658_10003930 3300005327 Bacteria 12187
26 Ga0070658_10093137 3300005327 Bacteria 2485
27 Ga0070658_10176649 3300005327 Bacteria 1796
28 Ga0070658_10904447 3300005327 Bacteria 767
29 Ga0070676_10036654 3300005328 Bacteria 2826
30 Ga0070683_100053125 3300005329 Bacteria 3755
31 Ga0070683_100298134 3300005329 Bacteria 1533
32 Ga0070683_100833055 3300005329 Bacteria 885
33 Ga0070690_100032031 3300005330 Bacteria 3280
34 Ga0070690_100382069 3300005330 Bacteria 1030
35 Ga0070670_100045839 3300005331 Bacteria 3759
36 Ga0070670_100072165 3300005331 Bacteria 2965
37 Ga0070670_100099788 3300005331 Bacteria 2498
38 Ga0070670_100254111 3300005331 Bacteria 1531
39 Ga0070670_100282782 3300005331 Bacteria 1449
40 Ga0068869_100037302 3300005334 Bacteria 3455
41 Ga0068869_100564228 3300005334 Unclassified 958
42 Ga0068869_101117335 3300005334 Bacteria 690
43 Ga0070666_10000022 3300005335 Bacteria 166910
44 Ga0070666_10001570 3300005335 Bacteria 13877
45 Ga0070666_10011557 3300005335 Bacteria 5545
46 Ga0070666_10149933 3300005335 Bacteria 1627
47 Ga0070680_100000293 3300005336 Bacteria 33547
48 Ga0070680_100004283 3300005336 Bacteria 10719
49 Ga0070680_100027064 3300005336 Bacteria 4592
50 Ga0070680_100079929 3300005336 Bacteria 2696
51 Ga0070680_100096453 3300005336 Bacteria 2452
52 Ga0070680_100253040 3300005336 Bacteria 1489
53 Ga0070680_100274562 3300005336 Bacteria 1427
54 Ga0070680_100302335 3300005336 Unclassified 1357
55 Ga0070682_100000806 3300005337 Bacteria 18399
56 Ga0070682_100002014 3300005337 Bacteria 11352
57 Ga0070682_100003486 3300005337 Bacteria 8698
58 Ga0070682_100018241 3300005337 Bacteria 4099
59 Ga0070682_100206768 3300005337 Bacteria 1389
60 Ga0070682_100358656 3300005337 Bacteria 1089
61 Ga0068868_100032443 3300005338 Bacteria 4018
62 Ga0068868_100055470 3300005338 Bacteria 3126
63 Ga0068868_100117283 3300005338 Bacteria 2169
64 Ga0068868_100120780 3300005338 Bacteria 2137
65 Ga0068868_100162860 3300005338 Bacteria 1843
66 Ga0070660_100026896 3300005339 Bacteria 4287
67 Ga0070660_100036407 3300005339 Bacteria 3728
68 Ga0070660_100133415 3300005339 Bacteria 1988
69 Ga0070660_100221358 3300005339 Bacteria 1538
70 Ga0070660_100274344 3300005339 Bacteria 1379
71 Ga0070660_100287795 3300005339 Bacteria 1345
72 Ga0070660_100909566 3300005339 Bacteria 742
73 Ga0070689_100032715 3300005340 Bacteria 3957
74 Ga0070689_100151107 3300005340 Bacteria 1873
75 Ga0070689_100181018 3300005340 Bacteria 1712
76 Ga0070691_10003796 3300005341 Bacteria 6820
77 Ga0070691_10025884 3300005341 Bacteria 2734
78 Ga0070691_10035737 3300005341 Bacteria 2340
79 Ga0070691_10041177 3300005341 Bacteria 2183
80 Ga0070661_100003432 3300005344 Bacteria 10940
81 Ga0070661_100004407 3300005344 Bacteria 9704
82 Ga0070661_100007406 3300005344 Bacteria 7564
83 Ga0070661_100017497 3300005344 Bacteria 5087
84 Ga0070661_100024169 3300005344 Bacteria 4358
85 Ga0070661_100077255 3300005344 Bacteria 2454
86 Ga0070661_100079163 3300005344 Bacteria 2425
87 Ga0070661_100144046 3300005344 Bacteria 1797
88 Ga0070661_100188172 3300005344 Bacteria 1573
89 Ga0070692_10013186 3300005345 Bacteria 3847
90 Ga0070692_10014558 3300005345 Bacteria 3699
91 Ga0070692_10033369 3300005345 Bacteria 2593
92 Ga0070692_10035538 3300005345 Bacteria 2523
93 Ga0070692_10047682 3300005345 Bacteria 2218
94 Ga0070692_10085870 3300005345 Bacteria 1703
95 Ga0070668_100039383 3300005347 Bacteria 3615
96 Ga0070668_100078330 3300005347 Bacteria 2585
97 Ga0070668_100089642 3300005347 Bacteria 2423
98 Ga0070668_100859096 3300005347 Bacteria 809
99 Ga0070668_101152705 3300005347 Bacteria 701
100 Ga0070669_100032599 3300005353 Bacteria 3764
101 Ga0070675_100138837 3300005354 Bacteria 2076
102 Ga0070675_100152659 3300005354 Bacteria 1981
103 Ga0070671_100202765 3300005355 Bacteria 1682
104 Ga0070671_100353883 3300005355 Bacteria 1254
105 Ga0070671_101298045 3300005355 Bacteria 642
106 Ga0070673_100105600 3300005364 Bacteria 2327
107 Ga0070688_100132502 3300005365 Bacteria 1683
108 Ga0070688_100285678 3300005365 Unclassified 1187
109 Ga0070659_100024890 3300005366 Bacteria 4593
110 Ga0070659_100035633 3300005366 Bacteria 3875
111 Ga0070659_100115297 3300005366 Bacteria 2171
112 Ga0070659_100143083 3300005366 Bacteria 1947
113 Ga0070659_100255343 3300005366 Bacteria 1453
114 Ga0070659_100386472 3300005366 Bacteria 1179
115 Ga0070659_100746655 3300005366 Bacteria 848
116 Ga0070667_100000049 3300005367 Bacteria 158483
117 Ga0070667_100009859 3300005367 Bacteria 7918
118 Ga0070667_100016825 3300005367 Bacteria 6051
119 Ga0070667_100124607 3300005367 Bacteria 2244
120 Ga0070667_100136481 3300005367 Bacteria 2145
121 Ga0070667_100147570 3300005367 Bacteria 2064
122 Ga0070667_100178465 3300005367 Bacteria 1877
123 Ga0070667_100418739 3300005367 Bacteria 1221
124 Ga0070667_100751526 3300005367 Bacteria 904
125 Ga0070709_10414684 3300005434 Bacteria 1008
126 Ga0070709_10835252 3300005434 Bacteria 725
127 Ga0070714_100000180 3300005435 Bacteria 50386
128 Ga0070714_100005379 3300005435 Bacteria 9771
129 Ga0070714_100221141 3300005435 Bacteria 1740
130 Ga0070713_100010125 3300005436 Bacteria 6799
131 Ga0070710_10105724 3300005437 Bacteria 1683
132 Ga0070694_100076895 3300005444 Bacteria 2312
133 Ga0070663_100000042 3300005455 Bacteria 57899
134 Ga0070663_100000898 3300005455 Bacteria 16150
135 Ga0070663_100013890 3300005455 Bacteria 5151
136 Ga0070663_100014429 3300005455 Bacteria 5071
137 Ga0070663_100021650 3300005455 Bacteria 4280
138 Ga0070663_100071519 3300005455 Bacteria 2524
139 Ga0070663_100074074 3300005455 Bacteria 2485
140 Ga0070663_100195158 3300005455 Bacteria 1578
141 Ga0070663_100277690 3300005455 Bacteria 1334
142 Ga0070663_100560829 3300005455 Bacteria 956
143 Ga0070678_100731727 3300005456 Bacteria 893
144 Ga0070662_100043041 3300005457 Bacteria 3228
145 Ga0070662_100779690 3300005457 Bacteria 812
146 Ga0070681_10001007 3300005458 Bacteria 23826
147 Ga0070681_10016163 3300005458 Bacteria 7440
148 Ga0070681_10021468 3300005458 Bacteria 6473
149 Ga0070681_10021815 3300005458 Bacteria 6422
150 Ga0070681_10035566 3300005458 Bacteria 5004
151 Ga0070681_10042226 3300005458 Bacteria 4570
152 Ga0070681_10228897 3300005458 Bacteria 1773
153 Ga0070681_10547943 3300005458 Bacteria 1070
154 Ga0070681_10853298 3300005458 Bacteria 828
155 Ga0068867_100142054 3300005459 Bacteria 1878
156 Ga0070685_10002427 3300005466 Bacteria 9586
157 Ga0070679_100000155 3300005530 Bacteria 55384
158 Ga0070679_100016385 3300005530 Bacteria 7147
159 Ga0070679_100020655 3300005530 Bacteria 6422
160 Ga0070679_100028019 3300005530 Bacteria 5550
161 Ga0070679_100116839 3300005530 Bacteria 2652
162 Ga0070679_100143750 3300005530 Bacteria 2364
163 Ga0070679_100148538 3300005530 Bacteria 2321
164 Ga0070679_100149519 3300005530 Bacteria 2313
165 Ga0070679_100326451 3300005530 Bacteria 1483
166 Ga0070684_100092360 3300005535 Bacteria 2693
167 Ga0068853_100004241 3300005539 Bacteria 11071
168 Ga0068853_100011813 3300005539 Bacteria 7100
169 Ga0068853_100019329 3300005539 Bacteria 5647
170 Ga0068853_100034056 3300005539 Bacteria 4322
171 Ga0068853_100051204 3300005539 Bacteria 3554
172 Ga0068853_100058481 3300005539 Bacteria 3328
173 Ga0068853_100121628 3300005539 Bacteria 2329
174 Ga0068853_100124859 3300005539 Bacteria 2298
175 Ga0068853_100127446 3300005539 Bacteria 2275
176 Ga0068853_100132189 3300005539 Bacteria 2235
177 Ga0068853_100148812 3300005539 Bacteria 2106
178 Ga0068853_100175221 3300005539 Bacteria 1942
179 Ga0068853_100264330 3300005539 Bacteria 1583
180 Ga0068853_100331541 3300005539 Bacteria 1412
181 Ga0068853_100476320 3300005539 Bacteria 1176
182 Ga0068853_100535923 3300005539 Bacteria 1108
183 Ga0068853_100791573 3300005539 Bacteria 908
184 Ga0070672_100004899 3300005543 Bacteria 8806
185 Ga0070672_100023555 3300005543 Bacteria 4540
186 Ga0070696_100009571 3300005546 Bacteria 6483
187 Ga0070696_100039613 3300005546 Bacteria 3253
188 Ga0070696_100045291 3300005546 Bacteria 3048
189 Ga0070696_100067558 3300005546 Bacteria 2509
190 Ga0070696_100202669 3300005546 Bacteria 1482
191 Ga0070693_100001044 3300005547 Bacteria 12375
192 Ga0070693_100002799 3300005547 Bacteria 8024
193 Ga0070693_100227465 3300005547 Bacteria 1225
194 Ga0070693_100493919 3300005547 Bacteria 867
195 Ga0070693_100539259 3300005547 Bacteria 833
196 Ga0070665_100000028 3300005548 Bacteria 351357
197 Ga0070665_100000394 3300005548 Bacteria 64434
198 Ga0070665_100043608 3300005548 Bacteria 4507
199 Ga0070665_100141995 3300005548 Bacteria 2404
200 Ga0070665_100357771 3300005548 Bacteria 1466
201 Ga0070665_100515339 3300005548 Bacteria 1207
202 Ga0068855_100030179 3300005563 Bacteria 6485
203 Ga0068855_100039530 3300005563 Bacteria 5601
204 Ga0068855_100068427 3300005563 Bacteria 4134
205 Ga0068855_100129764 3300005563 Bacteria 2880
206 Ga0068855_100151012 3300005563 Bacteria 2642
207 Ga0068855_100164800 3300005563 Bacteria 2513
208 Ga0068855_100168051 3300005563 Bacteria 2485
209 Ga0068855_100316374 3300005563 Unclassified 1726
210 Ga0068855_100382153 3300005563 Bacteria 1546
211 Ga0068855_100419702 3300005563 Bacteria 1463
212 Ga0068855_100552721 3300005563 Bacteria 1246
213 Ga0068855_100733703 3300005563 Bacteria 1055
214 Ga0068855_101563814 3300005563 Bacteria 676
215 Ga0070664_100014865 3300005564 Bacteria 6352
216 Ga0070664_100027338 3300005564 Bacteria 4740
217 Ga0070664_100133533 3300005564 Bacteria 2181
218 Ga0070664_100905820 3300005564 Bacteria 827
219 Ga0068857_100063848 3300005577 Bacteria 3274
220 Ga0068857_100156629 3300005577 Bacteria 2066
221 Ga0068857_100235525 3300005577 Bacteria 1675
222 Ga0068857_100280235 3300005577 Bacteria 1533
223 Ga0068854_100025886 3300005578 Bacteria 4026
224 Ga0068854_100032378 3300005578 Bacteria 3638
225 Ga0068854_100036278 3300005578 Bacteria 3456
226 Ga0068854_100205817 3300005578 Bacteria 1549
227 Ga0068854_100211890 3300005578 Bacteria 1528
228 Ga0068854_100692814 3300005578 Bacteria 879
229 Ga0068856_100000086 3300005614 Bacteria 87570
230 Ga0068856_100007013 3300005614 Bacteria 11007
231 Ga0068856_100047444 3300005614 Bacteria 4231
232 Ga0068856_100060130 3300005614 Bacteria 3754
233 Ga0068856_100129949 3300005614 Bacteria 2523
234 Ga0068856_100135054 3300005614 Bacteria 2472
235 Ga0068856_100188836 3300005614 Bacteria 2074
236 Ga0068856_100481954 3300005614 Bacteria 1261
237 Ga0068852_100001178 3300005616 Bacteria 17316
238 Ga0068852_100028616 3300005616 Bacteria 4565
239 Ga0068852_100044297 3300005616 Bacteria 3778
240 Ga0068852_100111714 3300005616 Bacteria 2485
241 Ga0068852_100182641 3300005616 Bacteria 1974
242 Ga0068852_100328175 3300005616 Bacteria 1488
243 Ga0068852_100660572 3300005616 Bacteria 1053
244 Ga0068852_100884301 3300005616 Bacteria 910
245 Ga0068852_100934514 3300005616 Bacteria 885
246 Ga0068852_101410174 3300005616 Bacteria 719
247 Ga0068859_100123902 3300005617 Bacteria 2652
248 Ga0068859_100152170 3300005617 Bacteria 2389
249 Ga0068859_101271295 3300005617 Bacteria 811
250 Ga0068864_100026288 3300005618 Bacteria 4909
251 Ga0068851_10000308 3300005834 Bacteria 22240
252 Ga0068851_10004951 3300005834 Bacteria 6033
253 Ga0068851_10054443 3300005834 Bacteria 2037
254 Ga0068863_100001699 3300005841 Bacteria 21808
255 Ga0068863_100016174 3300005841 Bacteria 7157
256 Ga0068863_100211165 3300005841 Bacteria 1869
257 Ga0068863_100309501 3300005841 Bacteria 1533
258 Ga0068863_100317288 3300005841 Bacteria 1513
259 Ga0068863_100674993 3300005841 Bacteria 1026
260 Ga0068858_100001920 3300005842 Bacteria 21193
261 Ga0068858_100126920 3300005842 Bacteria 2389
262 Ga0068858_100590534 3300005842 Bacteria 1077
263 Ga0068858_100664842 3300005842 Bacteria 1013
264 Ga0068860_100002386 3300005843 Bacteria 19708
265 Ga0068860_100054266 3300005843 Bacteria 3810
266 Ga0068860_100093513 3300005843 Bacteria 2865
267 Ga0068860_100282579 3300005843 Bacteria 1622
268 Ga0068860_100304583 3300005843 Bacteria 1562
269 Ga0068860_102220925 3300005843 Bacteria 570
270 Ga0070712_100400983 3300006175 Bacteria 1133
271 Ga0097621_100024618 3300006237 Bacteria 4703
272 Ga0097621_100051803 3300006237 Bacteria 3341
273 Ga0097621_100055831 3300006237 Bacteria 3226
274 Ga0097621_100245526 3300006237 Bacteria 1566
275 Ga0097621_100265628 3300006237 Bacteria 1507
276 Ga0097621_100949173 3300006237 Bacteria 803
277 Ga0097621_101080323 3300006237 Bacteria 753
278 Ga0068871_100105221 3300006358 Bacteria 2367
279 Ga0068871_100123844 3300006358 Bacteria 2186
280 Ga0068871_100214041 3300006358 Bacteria 1667
281 Ga0068871_100372668 3300006358 Bacteria 1267
282 Ga0068871_100499052 3300006358 Bacteria 1097
283 Ga0075434_100135781 3300006871 Bacteria 2479
284 Ga0068865_100019090 3300006881 Bacteria 4434
285 Ga0068865_100019360 3300006881 Bacteria 4405
286 Ga0068865_100717049 3300006881 Bacteria 856
287 Ga0097620_100123911 3300006931 Bacteria 2652
288 Ga0097620_100152175 3300006931 Bacteria 2389
289 Ga0097620_101271231 3300006931 Bacteria 811
290 Ga0105240_10001002 3300009093 Bacteria 50418
291 Ga0105240_10015087 3300009093 Bacteria 10517
292 Ga0105240_10015130 3300009093 Bacteria 10501
293 Ga0105240_10023570 3300009093 Bacteria 8134
294 Ga0105240_10068361 3300009093 Bacteria 4400
295 Ga0105240_10072678 3300009093 Bacteria 4250
296 Ga0105240_10114951 3300009093 Bacteria 3250
297 Ga0105240_10117922 3300009093 Bacteria 3199
298 Ga0105240_10132814 3300009093 Bacteria 2984
299 Ga0105240_10152817 3300009093 Bacteria 2748
300 Ga0105240_10168342 3300009093 Bacteria 2597
301 Ga0105240_10288097 3300009093 Bacteria 1884
302 Ga0105240_10387489 3300009093 Bacteria 1577
303 Ga0105245_10255638 3300009098 Bacteria 1703
304 Ga0105245_10297204 3300009098 Bacteria 1583
305 Ga0105245_10487032 3300009098 Bacteria 1247
306 Ga0105245_10729718 3300009098 Bacteria 1025
307 Ga0105245_11996473 3300009098 Bacteria 633
308 Ga0105247_10009071 3300009101 Bacteria 6055
309 Ga0105247_10992104 3300009101 Bacteria 655
310 Ga0105241_10019716 3300009174 Bacteria 4977
311 Ga0105241_10020002 3300009174 Bacteria 4943
312 Ga0105241_10033603 3300009174 Bacteria 3851
313 Ga0105241_10080359 3300009174 Bacteria 2551
314 Ga0105241_10207841 3300009174 Bacteria 1639
315 Ga0105242_10016160 3300009176 Bacteria 5798
316 Ga0105242_10171803 3300009176 Bacteria 1905
317 Ga0105242_10234948 3300009176 Bacteria 1645
318 Ga0105242_11013772 3300009176 Bacteria 839
319 Ga0105242_11517552 3300009176 Unclassified 701
320 Ga0105248_10000120 3300009177 Bacteria 89960
321 Ga0105248_10103169 3300009177 Bacteria 3214
322 Ga0105248_10416462 3300009177 Bacteria 1513
323 Ga0105248_10861065 3300009177 Bacteria 1023
324 Ga0105248_11065690 3300009177 Bacteria 913
325 Ga0105237_10000070 3300009545 Bacteria 136694
326 Ga0105237_10009634 3300009545 Bacteria 10342
327 Ga0105237_10013807 3300009545 Bacteria 8454
328 Ga0105237_10028245 3300009545 Bacteria 5716
329 Ga0105237_10075077 3300009545 Bacteria 3372
330 Ga0105237_10079728 3300009545 Bacteria 3264
331 Ga0105237_10133674 3300009545 Bacteria 2475
332 Ga0105237_10672570 3300009545 Bacteria 1042
333 Ga0105238_10000175 3300009551 Bacteria 69973
334 Ga0105238_10001727 3300009551 Bacteria 22009
335 Ga0105238_10003190 3300009551 Bacteria 16363
336 Ga0105238_10009039 3300009551 Bacteria 9969
337 Ga0105238_10024319 3300009551 Bacteria 6174
338 Ga0105238_10041807 3300009551 Bacteria 4643
339 Ga0105238_10087375 3300009551 Bacteria 3105
340 Ga0105238_10157028 3300009551 Bacteria 2250
341 Ga0105238_10170925 3300009551 Bacteria 2149
342 Ga0105238_10177357 3300009551 Bacteria 2108
343 Ga0105238_10183185 3300009551 Bacteria 2071
344 Ga0105238_10230800 3300009551 Bacteria 1827
345 Ga0105238_10254953 3300009551 Bacteria 1733
346 Ga0105238_10324593 3300009551 Bacteria 1525
347 Ga0105238_10420655 3300009551 Bacteria 1331
348 Ga0105238_10683731 3300009551 Bacteria 1038
349 Ga0105249_10000898 3300009553 Bacteria 26273
350 Ga0105249_10072509 3300009553 Bacteria 3183
351 Ga0105249_10547963 3300009553 Bacteria 1207
352 Ga0105249_10783638 3300009553 Bacteria 1017
353 Ga0105147_101535 3300009982 Bacteria 1891
354 Ga0105239_10001034 3300010375 Bacteria 38757
355 Ga0105239_10018012 3300010375 Bacteria 7812
356 Ga0105239_10025853 3300010375 Bacteria 6465
357 Ga0105239_10049118 3300010375 Bacteria 4626
358 Ga0105239_10067307 3300010375 Bacteria 3935
359 Ga0105239_10100383 3300010375 Bacteria 3201
360 Ga0105239_10102205 3300010375 Bacteria 3172
361 Ga0105239_10424255 3300010375 Bacteria 1507
362 Ga0105239_10447237 3300010375 Bacteria 1466
363 Ga0105239_10475878 3300010375 Bacteria 1419
364 Ga0105239_10929211 3300010375 Bacteria 999
365 Ga0105239_11156120 3300010375 Bacteria 891
366 Ga0105246_10207764 3300011119 Bacteria 1526
367 Ga0105246_10429731 3300011119 Bacteria 1104
368 Ga0157373_10007367 3300013100 Bacteria 8188
369 Ga0157373_10036630 3300013100 Bacteria 3520
370 Ga0157373_10051110 3300013100 Bacteria 2944
371 Ga0157373_10065626 3300013100 Bacteria 2568
372 Ga0157373_10087952 3300013100 Bacteria 2189
373 Ga0157373_10130559 3300013100 Bacteria 1767
374 Ga0157373_10193847 3300013100 Bacteria 1432
375 Ga0157373_10223546 3300013100 Bacteria 1328
376 Ga0157373_10371976 3300013100 Bacteria 1021
377 Ga0157373_10421235 3300013100 Bacteria 959
378 Ga0157373_10555294 3300013100 Bacteria 833
379 Ga0157371_10033023 3300013102 Bacteria 3721
380 Ga0157371_10040232 3300013102 Bacteria 3339
381 Ga0157371_10058366 3300013102 Bacteria 2737
382 Ga0157371_10088494 3300013102 Bacteria 2193
383 Ga0157371_10123182 3300013102 Bacteria 1843
384 Ga0157371_10133110 3300013102 Bacteria 1769
385 Ga0157371_10351867 3300013102 Bacteria 1072
386 Ga0157371_10358785 3300013102 Bacteria 1062
387 Ga0157371_10365771 3300013102 Bacteria 1052
388 Ga0157370_10001260 3300013104 Bacteria 31632
389 Ga0157370_10001542 3300013104 Bacteria 28507
390 Ga0157370_10011588 3300013104 Bacteria 9204
391 Ga0157370_10013170 3300013104 Bacteria 8530
392 Ga0157370_10015414 3300013104 Bacteria 7768
393 Ga0157370_10021902 3300013104 Bacteria 6365
394 Ga0157370_10030869 3300013104 Bacteria 5248
395 Ga0157370_10048618 3300013104 Bacteria 4063
396 Ga0157370_10059310 3300013104 Bacteria 3636
397 Ga0157370_10082343 3300013104 Bacteria 3027
398 Ga0157370_10159422 3300013104 Bacteria 2100
399 Ga0157370_10165941 3300013104 Bacteria 2054
400 Ga0157370_10250682 3300013104 Bacteria 1637
401 Ga0157370_10271705 3300013104 Bacteria 1566
402 Ga0157370_10507693 3300013104 Bacteria 1107
403 Ga0157370_10736798 3300013104 Bacteria 898
404 Ga0157370_10739140 3300013104 Unclassified 897
405 Ga0157369_10000150 3300013105 Bacteria 99203
406 Ga0157369_10002250 3300013105 Bacteria 23203
407 Ga0157369_10016215 3300013105 Bacteria 8385
408 Ga0157369_10048155 3300013105 Bacteria 4625
409 Ga0157369_10051694 3300013105 Bacteria 4446
410 Ga0157369_10069251 3300013105 Bacteria 3791
411 Ga0157369_10107227 3300013105 Bacteria 2972
412 Ga0157369_10154338 3300013105 Bacteria 2426
413 Ga0157369_10571461 3300013105 Bacteria 1168
414 Ga0157369_11061263 3300013105 Bacteria 829
415 Ga0157374_10051331 3300013296 Bacteria 3838
416 Ga0157374_10072742 3300013296 Bacteria 3244
417 Ga0157374_10213847 3300013296 Bacteria 1891
418 Ga0157374_10244900 3300013296 Bacteria 1763
419 Ga0157374_10304807 3300013296 Bacteria 1576
420 Ga0157374_10476625 3300013296 Unclassified 1251
421 Ga0157374_10811891 3300013296 Bacteria 951
422 Ga0157378_10000536 3300013297 Bacteria 36043
423 Ga0157378_10129559 3300013297 Bacteria 2334
424 Ga0163162_10000004 3300013306 Bacteria 505593
425 Ga0163162_10000249 3300013306 Bacteria 48772
426 Ga0163162_10010787 3300013306 Bacteria 8890
427 Ga0163162_10102624 3300013306 Bacteria 2953
428 Ga0163162_10177760 3300013306 Bacteria 2254
429 Ga0163162_10321229 3300013306 Bacteria 1680
430 Ga0157372_10000344 3300013307 Bacteria 51217
431 Ga0157372_10007598 3300013307 Bacteria 11524
432 Ga0157372_10007654 3300013307 Bacteria 11485
433 Ga0157372_10012237 3300013307 Bacteria 9137
434 Ga0157372_10041942 3300013307 Bacteria 5060
435 Ga0157372_10048078 3300013307 Bacteria 4742
436 Ga0157372_10066621 3300013307 Bacteria 4046
437 Ga0157372_10076933 3300013307 Bacteria 3768
438 Ga0157372_10113894 3300013307 Bacteria 3100
439 Ga0157372_10140240 3300013307 Bacteria 2784
440 Ga0157372_10151260 3300013307 Bacteria 2679
441 Ga0157372_10160316 3300013307 Bacteria 2600
442 Ga0157372_10203883 3300013307 Bacteria 2291
443 Ga0157372_10454629 3300013307 Bacteria 1492
444 Ga0157372_10470231 3300013307 Bacteria 1465
445 Ga0157372_10681617 3300013307 Bacteria 1196
446 Ga0157372_10796966 3300013307 Bacteria 1098
447 Ga0157372_10810363 3300013307 Bacteria 1088
448 Ga0157375_10003767 3300013308 Bacteria 13139
449 Ga0157375_10202000 3300013308 Bacteria 2144
450 Ga0157375_10433626 3300013308 Bacteria 1480
451 Ga0157375_10672421 3300013308 Bacteria 1190
452 Ga0157375_11576933 3300013308 Bacteria 776
453 Ga0163163_10000029 3300014325 Bacteria 174973
454 Ga0163163_10000564 3300014325 Bacteria 32582
455 Ga0163163_10814013 3300014325 Bacteria 997
456 Ga0163163_12005726 3300014325 Bacteria 638
457 Ga0182008_10006745 3300014497 Bacteria 6389
458 Ga0182008_10035533 3300014497 Bacteria 2495
459 Ga0182008_10073961 3300014497 Bacteria 1676
460 Ga0182008_10107155 3300014497 Bacteria 1383
461 Ga0182008_10124394 3300014497 Bacteria 1283
462 Ga0182008_10142811 3300014497 Bacteria 1198
463 Ga0182008_10614200 3300014497 Unclassified 612
464 Ga0157379_10001942 3300014968 Bacteria 17106
465 Ga0157379_10215862 3300014968 Bacteria 1737
466 Ga0157379_10227670 3300014968 Bacteria 1690
467 Ga0157379_10798493 3300014968 Bacteria 891
468 Ga0157376_10030990 3300014969 Bacteria 4277
469 Ga0157376_10039939 3300014969 Bacteria 3832
470 Ga0157376_10048157 3300014969 Bacteria 3522
471 Ga0157376_10057731 3300014969 Bacteria 3248
472 Ga0157376_10479271 3300014969 Bacteria 1219
473 Ga0157376_10497523 3300014969 Bacteria 1197
474 Ga0157376_10789965 3300014969 Bacteria 961
475 Ga0182006_1000426 3300015261 Bacteria 33653
476 Ga0182006_1003182 3300015261 Bacteria 8567
477 Ga0182006_1038826 3300015261 Bacteria 1881
478 Ga0182006_1079352 3300015261 Bacteria 1200
479 Ga0182006_1111314 3300015261 Bacteria 960
480 Ga0182007_10009141 3300015262 Bacteria 4027
481 Ga0182007_10012611 3300015262 Bacteria 3245
482 Ga0182007_10020455 3300015262 Bacteria 2366
483 Ga0182007_10028447 3300015262 Bacteria 1920
484 Ga0182007_10028992 3300015262 Bacteria 1897
485 Ga0182007_10033419 3300015262 Bacteria 1743
486 Ga0182007_10169996 3300015262 Bacteria 749
487 Ga0182005_1000177 3300015265 Bacteria 43741
488 Ga0182005_1004444 3300015265 Bacteria 4536
489 Ga0182005_1006829 3300015265 Bacteria 3457
490 Ga0182005_1074140 3300015265 Bacteria 936
491 Ga0183369_1003 3300015685 Bacteria 726443
492 Ga0163161_10019113 3300017792 Bacteria 4803
493 Ga0197907_10116855 3300020069 Bacteria 1294
494 Ga0206356_10207760 3300020070 Bacteria 3743
495 Ga0206356_11420723 3300020070 Bacteria 5683
496 Ga0206354_10156960 3300020081 Bacteria 2576
497 Ga0206354_10910981 3300020081 Bacteria 2806
498 Ga0206354_10918145 3300020081 Bacteria 1918
499 Ga0206353_10041605 3300020082 Bacteria 6702
500 Ga0206353_10270789 3300020082 Bacteria 1841
501 Ga0206353_10381236 3300020082 Bacteria 1332
502 Ga0206353_10388015 3300020082 Bacteria 2984
503 Ga0209674_100557 3300025226 Bacteria 14799
504 Ga0209674_103546 3300025226 Bacteria 2827
505 Ga0209147_110057 3300025229 Bacteria 1098
506 Ga0207427_100344 3300025231 Bacteria 30048
507 Ga0207427_100349 3300025231 Bacteria 29540
508 Ga0207427_103226 3300025231 Bacteria 3571
509 Ga0209437_100083 3300025233 Bacteria 256005
510 Ga0209437_100162 3300025233 Bacteria 147864
511 Ga0209437_100886 3300025233 Bacteria 12095
512 Ga0209437_101614 3300025233 Bacteria 5178
513 Ga0209258_112756 3300025242 Bacteria 1020
514 Ga0209646_1002743 3300025246 Bacteria 3740
515 Ga0209026_1000237 3300025250 Bacteria 73153
516 Ga0209026_1000378 3300025250 Bacteria 40841
517 Ga0209026_1003831 3300025250 Bacteria 4747
518 Ga0209148_1000005 3300025254 Bacteria 1806504
519 Ga0209759_1004980 3300025256 Bacteria 4791
520 Ga0209129_1001531 3300025258 Bacteria 12762
521 Ga0209233_1000075 3300025261 Bacteria 356837
522 Ga0209233_1000715 3300025261 Bacteria 15448
523 Ga0209233_1000998 3300025261 Bacteria 12103
524 Ga0209455_1000151 3300025272 Bacteria 129842
525 Ga0209758_1011818 3300025297 Bacteria 4989
526 Ga0209256_1004882 3300025299 Bacteria 8074
527 Ga0207426_1008951 3300025302 Bacteria 3993
528 Ga0209051_1008393 3300025303 Bacteria 5473
529 Ga0207697_10270674 3300025315 Bacteria 752
530 Ga0207656_10000991 3300025321 Bacteria 9266
531 Ga0207656_10002462 3300025321 Bacteria 6244
532 Ga0207656_10016530 3300025321 Bacteria 2874
533 Ga0207656_10188548 3300025321 Bacteria 992
534 Ga0207656_10305183 3300025321 Bacteria 788
535 Ga0207692_10213894 3300025898 Bacteria 1140
536 Ga0207680_10000001 3300025903 Bacteria 1091453
537 Ga0207680_10000363 3300025903 Bacteria 21806
538 Ga0207680_10007204 3300025903 Bacteria 5407
539 Ga0207680_10073914 3300025903 Bacteria 2121
540 Ga0207680_10420349 3300025903 Bacteria 946
541 Ga0207647_10000188 3300025904 Bacteria 50006
542 Ga0207647_10000539 3300025904 Bacteria 30219
543 Ga0207647_10000865 3300025904 Bacteria 23447
544 Ga0207647_10001336 3300025904 Bacteria 18958
545 Ga0207647_10005244 3300025904 Bacteria 9539
546 Ga0207647_10013218 3300025904 Bacteria 5730
547 Ga0207647_10501867 3300025904 Bacteria 676
548 Ga0207699_10071505 3300025906 Bacteria 2122
549 Ga0207699_10319977 3300025906 Bacteria 1088
550 Ga0207699_10593093 3300025906 Bacteria 806
551 Ga0207645_10097761 3300025907 Bacteria 1892
552 Ga0207705_10000087 3300025909 Bacteria 114441
553 Ga0207705_10000431 3300025909 Bacteria 36519
554 Ga0207705_10000543 3300025909 Bacteria 31805
555 Ga0207705_10000878 3300025909 Bacteria 24640
556 Ga0207705_10001049 3300025909 Bacteria 22456
557 Ga0207705_10029635 3300025909 Bacteria 3901
558 Ga0207705_10058521 3300025909 Bacteria 2780
559 Ga0207654_10016978 3300025911 Bacteria 3799
560 Ga0207654_10025859 3300025911 Bacteria 3172
561 Ga0207654_10066483 3300025911 Bacteria 2126
562 Ga0207654_10190082 3300025911 Bacteria 1345
563 Ga0207707_10000055 3300025912 Bacteria 114355
564 Ga0207707_10000086 3300025912 Bacteria 93164
565 Ga0207707_10000187 3300025912 Bacteria 65346
566 Ga0207707_10000300 3300025912 Bacteria 51991
567 Ga0207707_10005585 3300025912 Bacteria 11005
568 Ga0207707_10009123 3300025912 Bacteria 8616
569 Ga0207707_10023301 3300025912 Bacteria 5418
570 Ga0207707_10034593 3300025912 Bacteria 4421
571 Ga0207707_10069505 3300025912 Bacteria 3069
572 Ga0207707_10113441 3300025912 Bacteria 2368
573 Ga0207707_10134010 3300025912 Bacteria 2166
574 Ga0207707_10210435 3300025912 Bacteria 1694
575 Ga0207695_10000040 3300025913 Bacteria 452787
576 Ga0207695_10000772 3300025913 Bacteria 60706
577 Ga0207695_10000997 3300025913 Bacteria 50121
578 Ga0207695_10002269 3300025913 Bacteria 28800
579 Ga0207695_10003383 3300025913 Bacteria 22539
580 Ga0207695_10004149 3300025913 Bacteria 19891
581 Ga0207695_10011198 3300025913 Bacteria 10881
582 Ga0207695_10011473 3300025913 Bacteria 10729
583 Ga0207695_10013808 3300025913 Bacteria 9610
584 Ga0207695_10014145 3300025913 Bacteria 9470
585 Ga0207695_10065122 3300025913 Bacteria 3748
586 Ga0207695_10097692 3300025913 Bacteria 2938
587 Ga0207695_10143200 3300025913 Bacteria 2337
588 Ga0207695_10155801 3300025913 Bacteria 2219
589 Ga0207671_10001266 3300025914 Bacteria 29783
590 Ga0207671_10002602 3300025914 Bacteria 19057
591 Ga0207671_10004204 3300025914 Bacteria 13881
592 Ga0207671_10005617 3300025914 Bacteria 11507
593 Ga0207671_10012095 3300025914 Bacteria 6969
594 Ga0207671_10265569 3300025914 Bacteria 1351
595 Ga0207671_10308582 3300025914 Bacteria 1250
596 Ga0207671_10466811 3300025914 Bacteria 1006
597 Ga0207693_10352213 3300025915 Bacteria 1152
598 Ga0207660_10000541 3300025917 Bacteria 25362
599 Ga0207660_10000727 3300025917 Bacteria 21894
600 Ga0207660_10003202 3300025917 Bacteria 10708
601 Ga0207660_10049299 3300025917 Bacteria 2984
602 Ga0207660_10050064 3300025917 Bacteria 2965
603 Ga0207660_10111066 3300025917 Bacteria 2063
604 Ga0207660_10238643 3300025917 Bacteria 1431
605 Ga0207660_10630362 3300025917 Bacteria 874
606 Ga0207660_10945592 3300025917 Unclassified 703
607 Ga0207657_10007147 3300025919 Bacteria 11466
608 Ga0207657_10042257 3300025919 Bacteria 4023
609 Ga0207657_10072996 3300025919 Bacteria 2901
610 Ga0207657_10073797 3300025919 Bacteria 2882
611 Ga0207657_10073798 3300025919 Bacteria 2882
612 Ga0207657_10085526 3300025919 Bacteria 2641
613 Ga0207657_10122899 3300025919 Bacteria 2135
614 Ga0207657_10140744 3300025919 Bacteria 1971
615 Ga0207657_10251452 3300025919 Bacteria 1409
616 Ga0207657_10630238 3300025919 Bacteria 835
617 Ga0207649_10000196 3300025920 Bacteria 50015
618 Ga0207649_10002654 3300025920 Bacteria 9932
619 Ga0207649_10012076 3300025920 Bacteria 4779
620 Ga0207649_10017757 3300025920 Bacteria 4034
621 Ga0207649_10060346 3300025920 Bacteria 2383
622 Ga0207649_10109972 3300025920 Bacteria 1839
623 Ga0207649_10183123 3300025920 Bacteria 1467
624 Ga0207649_10206449 3300025920 Bacteria 1391
625 Ga0207649_10352096 3300025920 Bacteria 1090
626 Ga0207652_10000017 3300025921 Bacteria 188391
627 Ga0207652_10000040 3300025921 Bacteria 131566
628 Ga0207652_10000072 3300025921 Bacteria 109080
629 Ga0207652_10000260 3300025921 Bacteria 55151
630 Ga0207652_10001180 3300025921 Bacteria 23480
631 Ga0207652_10007346 3300025921 Bacteria 8882
632 Ga0207652_10073420 3300025921 Bacteria 2976
633 Ga0207652_10178281 3300025921 Bacteria 1909
634 Ga0207652_10352353 3300025921 Bacteria 1328
635 Ga0207652_10394589 3300025921 Bacteria 1249
636 Ga0207681_10062990 3300025923 Bacteria 2556
637 Ga0207694_10000257 3300025924 Bacteria 50545
638 Ga0207694_10001164 3300025924 Bacteria 22818
639 Ga0207694_10001852 3300025924 Bacteria 17610
640 Ga0207694_10020918 3300025924 Bacteria 4954
641 Ga0207694_10037919 3300025924 Bacteria 3704
642 Ga0207694_10052481 3300025924 Bacteria 3160
643 Ga0207694_10096692 3300025924 Bacteria 2336
644 Ga0207694_10178123 3300025924 Bacteria 1723
645 Ga0207694_10211407 3300025924 Bacteria 1580
646 Ga0207650_10053945 3300025925 Bacteria 2980
647 Ga0207650_10054254 3300025925 Bacteria 2972
648 Ga0207650_10104877 3300025925 Bacteria 2181
649 Ga0207659_10294142 3300025926 Bacteria 1331
650 Ga0207687_10194660 3300025927 Bacteria 1580
651 Ga0207687_10208365 3300025927 Bacteria 1532
652 Ga0207687_10452059 3300025927 Bacteria 1065
653 Ga0207700_10039573 3300025928 Bacteria 3434
654 Ga0207664_10000041 3300025929 Bacteria 154806
655 Ga0207664_10001637 3300025929 Bacteria 14760
656 Ga0207664_10030205 3300025929 Bacteria 4137
657 Ga0207644_11055842 3300025931 Bacteria 682
658 Ga0207690_10000290 3300025932 Bacteria 35687
659 Ga0207690_10005157 3300025932 Bacteria 7710
660 Ga0207690_10028114 3300025932 Bacteria 3561
661 Ga0207690_10030324 3300025932 Bacteria 3448
662 Ga0207690_10036275 3300025932 Bacteria 3191
663 Ga0207690_10051472 3300025932 Bacteria 2754
664 Ga0207690_10080648 3300025932 Bacteria 2271
665 Ga0207690_10084307 3300025932 Bacteria 2227
666 Ga0207690_10145215 3300025932 Bacteria 1753
667 Ga0207690_10443068 3300025932 Bacteria 1043
668 Ga0207706_10000876 3300025933 Bacteria 30901
669 Ga0207706_10037100 3300025933 Bacteria 4328
670 Ga0207706_10067488 3300025933 Bacteria 3146
671 Ga0207706_10150484 3300025933 Bacteria 2047
672 Ga0207706_10169040 3300025933 Bacteria 1921
673 Ga0207706_10201677 3300025933 Bacteria 1745
674 Ga0207686_10349816 3300025934 Bacteria 1112
675 Ga0207670_10185743 3300025936 Bacteria 1569
676 Ga0207704_10003344 3300025938 Bacteria 7280
677 Ga0207704_10294979 3300025938 Bacteria 1239
678 Ga0207704_10306275 3300025938 Bacteria 1219
679 Ga0207704_10850885 3300025938 Bacteria 764
680 Ga0207691_10014561 3300025940 Bacteria 7497
681 Ga0207691_10140519 3300025940 Bacteria 2128
682 Ga0207711_10003012 3300025941 Bacteria 14729
683 Ga0207711_10075066 3300025941 Bacteria 2942
684 Ga0207711_10621941 3300025941 Bacteria 1008
685 Ga0207711_11169249 3300025941 Bacteria 711
686 Ga0207689_10010382 3300025942 Bacteria 8021
687 Ga0207689_10125337 3300025942 Bacteria 2113
688 Ga0207689_10295366 3300025942 Bacteria 1342
689 Ga0207689_10311584 3300025942 Bacteria 1305
690 Ga0207661_10015268 3300025944 Bacteria 5647
691 Ga0207661_10069774 3300025944 Bacteria 2866
692 Ga0207661_10079079 3300025944 Bacteria 2709
693 Ga0207661_10150526 3300025944 Bacteria 2011
694 Ga0207679_10112052 3300025945 Bacteria 2155
695 Ga0207679_10182667 3300025945 Bacteria 1736
696 Ga0207679_10571089 3300025945 Bacteria 1016
697 Ga0207667_10001223 3300025949 Bacteria 32189
698 Ga0207667_10001894 3300025949 Bacteria 26261
699 Ga0207667_10017136 3300025949 Bacteria 8167
700 Ga0207667_10026371 3300025949 Bacteria 6351
701 Ga0207667_10026475 3300025949 Bacteria 6336
702 Ga0207667_10047090 3300025949 Bacteria 4565
703 Ga0207667_10051933 3300025949 Bacteria 4320
704 Ga0207667_10089965 3300025949 Bacteria 3172
705 Ga0207667_10103390 3300025949 Bacteria 2938
706 Ga0207667_10103394 3300025949 Bacteria 2938
707 Ga0207667_10125057 3300025949 Bacteria 2648
708 Ga0207667_10281816 3300025949 Bacteria 1698
709 Ga0207667_11433814 3300025949 Unclassified 663
710 Ga0207651_10052952 3300025960 Bacteria 2771
711 Ga0207651_10216987 3300025960 Bacteria 1544
712 Ga0207651_10283172 3300025960 Bacteria 1371
713 Ga0207712_10000120 3300025961 Bacteria 84214
714 Ga0207712_10000305 3300025961 Bacteria 45213
715 Ga0207712_10290942 3300025961 Bacteria 1337
716 Ga0207712_11162140 3300025961 Bacteria 688
717 Ga0207668_10053313 3300025972 Bacteria 2802
718 Ga0207668_10134580 3300025972 Bacteria 1892
719 Ga0207668_10186082 3300025972 Bacteria 1642
720 Ga0207668_10637286 3300025972 Bacteria 932
721 Ga0207668_11082086 3300025972 Bacteria 718
722 Ga0207640_10001570 3300025981 Bacteria 12265
723 Ga0207640_10003988 3300025981 Bacteria 7971
724 Ga0207640_10015557 3300025981 Bacteria 4407
725 Ga0207640_10029459 3300025981 Bacteria 3370
726 Ga0207640_10042366 3300025981 Bacteria 2903
727 Ga0207640_10396024 3300025981 Bacteria 1123
728 Ga0207640_10644476 3300025981 Bacteria 902
729 Ga0207640_10875811 3300025981 Bacteria 783
730 Ga0207640_11384459 3300025981 Bacteria 630
731 Ga0207658_10000033 3300025986 Bacteria 158540
732 Ga0207658_10015018 3300025986 Bacteria 5309
733 Ga0207658_10062351 3300025986 Bacteria 2790
734 Ga0207658_10098611 3300025986 Bacteria 2283
735 Ga0207658_10127879 3300025986 Bacteria 2036
736 Ga0207658_10465399 3300025986 Bacteria 1121
737 Ga0207658_10639096 3300025986 Bacteria 958
738 Ga0207658_10697093 3300025986 Bacteria 917
739 Ga0207677_10048990 3300026023 Bacteria 2848
740 Ga0207677_10071111 3300026023 Bacteria 2454
741 Ga0207677_10300370 3300026023 Unclassified 1326
742 Ga0207677_10776400 3300026023 Bacteria 856
743 Ga0207677_11271663 3300026023 Unclassified 675
744 Ga0207703_10001512 3300026035 Bacteria 21182
745 Ga0207703_10198029 3300026035 Bacteria 1783
746 Ga0207703_11255140 3300026035 Bacteria 712
747 Ga0207639_10000236 3300026041 Bacteria 41381
748 Ga0207639_10000342 3300026041 Bacteria 32205
749 Ga0207639_10000485 3300026041 Bacteria 27467
750 Ga0207639_10000514 3300026041 Bacteria 26656
751 Ga0207639_10004200 3300026041 Bacteria 9704
752 Ga0207639_10014601 3300026041 Bacteria 5530
753 Ga0207639_10021093 3300026041 Bacteria 4674
754 Ga0207639_10028137 3300026041 Bacteria 4101
755 Ga0207639_10058113 3300026041 Bacteria 2973
756 Ga0207639_10066198 3300026041 Bacteria 2807
757 Ga0207639_10098070 3300026041 Bacteria 2361
758 Ga0207639_10111256 3300026041 Bacteria 2232
759 Ga0207639_10422900 3300026041 Bacteria 1205
760 Ga0207639_10452373 3300026041 Bacteria 1166
761 Ga0207639_10499959 3300026041 Bacteria 1111
762 Ga0207639_10564505 3300026041 Bacteria 1046
763 Ga0207639_10932060 3300026041 Bacteria 812
764 Ga0207639_11039218 3300026041 Bacteria 768
765 Ga0207639_11213293 3300026041 Bacteria 708
766 Ga0207678_10002720 3300026067 Bacteria 16033
767 Ga0207678_10007806 3300026067 Bacteria 9446
768 Ga0207678_10012455 3300026067 Bacteria 7467
769 Ga0207678_10023199 3300026067 Bacteria 5428
770 Ga0207678_10033131 3300026067 Bacteria 4502
771 Ga0207678_10041897 3300026067 Bacteria 3969
772 Ga0207678_10079233 3300026067 Bacteria 2813
773 Ga0207678_10079234 3300026067 Bacteria 2813
774 Ga0207678_10222329 3300026067 Bacteria 1616
775 Ga0207678_10246850 3300026067 Bacteria 1529
776 Ga0207702_10000222 3300026078 Bacteria 66254
777 Ga0207702_10001321 3300026078 Bacteria 24839
778 Ga0207702_10026036 3300026078 Bacteria 4856
779 Ga0207702_10027421 3300026078 Bacteria 4730
780 Ga0207702_10201886 3300026078 Bacteria 1843
781 Ga0207702_10426416 3300026078 Bacteria 1283
782 Ga0207702_10897257 3300026078 Bacteria 878
783 Ga0207641_10038920 3300026088 Bacteria 3976
784 Ga0207641_10042503 3300026088 Bacteria 3813
785 Ga0207641_10234912 3300026088 Bacteria 1706
786 Ga0207641_10265773 3300026088 Bacteria 1608
787 Ga0207641_10347431 3300026088 Bacteria 1413
788 Ga0207641_11065226 3300026088 Bacteria 806
789 Ga0207641_11250407 3300026088 Bacteria 742
790 Ga0207648_10008256 3300026089 Bacteria 10108
791 Ga0207648_10133915 3300026089 Bacteria 2182
792 Ga0207648_10680112 3300026089 Bacteria 953
793 Ga0207676_10022947 3300026095 Bacteria 4595
794 Ga0207674_10016311 3300026116 Bacteria 8136
795 Ga0207674_10022718 3300026116 Bacteria 6730
796 Ga0207674_10039904 3300026116 Bacteria 4864
797 Ga0207674_10041887 3300026116 Bacteria 4734
798 Ga0207674_10065552 3300026116 Bacteria 3660
799 Ga0207674_10262258 3300026116 Bacteria 1675
800 Ga0207674_10480166 3300026116 Bacteria 1201
801 Ga0207675_100773528 3300026118 Bacteria 972
802 Ga0207675_101068880 3300026118 Bacteria 826
803 Ga0207683_10031349 3300026121 Bacteria 4613
804 Ga0207683_10059367 3300026121 Bacteria 3360
805 Ga0207683_10231561 3300026121 Bacteria 1685
806 Ga0207683_10290609 3300026121 Bacteria 1495
807 Ga0207698_10000056 3300026142 Bacteria 80605
808 Ga0207698_10001199 3300026142 Bacteria 15109
809 Ga0207698_10003052 3300026142 Bacteria 10037
810 Ga0207698_10032130 3300026142 Bacteria 3799
811 Ga0207698_10060302 3300026142 Bacteria 2950
812 Ga0207698_10407428 3300026142 Bacteria 1301
813 Ga0207698_10663755 3300026142 Bacteria 1034
814 Ga0207698_10761281 3300026142 Bacteria 968
815 Ga0207698_10892202 3300026142 Bacteria 896
816 Ga0268266_10000007 3300028379 Bacteria 1372921
817 Ga0268266_10000017 3300028379 Bacteria 607272
818 Ga0268266_10000091 3300028379 Bacteria 195002
819 Ga0268266_10080769 3300028379 Bacteria 2833
820 Ga0268266_10328290 3300028379 Bacteria 1433
821 Ga0268266_10340880 3300028379 Bacteria 1407
822 Ga0268264_10002870 3300028381 Bacteria 14998
823 Ga0268264_10022702 3300028381 Bacteria 5120
824 Ga0268264_10054202 3300028381 Bacteria 3348
825 Ga0268264_10172920 3300028381 Bacteria 1955
826 Ga0268264_11228589 3300028381 Bacteria 759
827 Ga0265332_10078359 3300031238 Bacteria 1403
828 Ga0307509_10049147 3300031507 Bacteria 4525
829 Ga0307408_100303059 3300031548 Bacteria 1339
830 Ga0307508_10080598 3300031616 Bacteria 2837
831 Ga0307508_10372436 3300031616 Bacteria 1019
832 Ga0316575_10011435 3300031665 Bacteria 3286
833 Ga0316575_10015148 3300031665 Bacteria 2904
834 Ga0307516_10113414 3300031730 Bacteria 2508
835 Ga0307413_10049543 3300031824 Bacteria 2518
836 Ga0307413_11043420 3300031824 Bacteria 703
837 Ga0307412_10002394 3300031911 Bacteria 10417
838 Ga0307409_102083119 3300031995 Bacteria 597
839 Ga0307416_100283040 3300032002 Bacteria 1636
840 Ga0307414_10660392 3300032004 Bacteria 943
841 Ga0307414_10793861 3300032004 Unclassified 863
842 Ga0307411_10239623 3300032005 Bacteria 1419
843 Ga0307510_10001702 3300033180 Bacteria 24446
844 Ga0307510_10052665 3300033180 Bacteria 4286
845 Ga0373934_0351138 3300035086 Unclassified 614
846 Ga0373954_0299205 3300035118 Bacteria 794
847 Ga0373931_1224881 3300035691 Bacteria 514
848 Ga0373933_0527165 3300035724 Bacteria 774
849 Ga0373947_0614860 3300035725 Unclassified 741
850 Ga0373937_0106546 3300036401 Bacteria 2605
851 Ga0395899_0009369 3300037312 Bacteria 7520
852 Ga0395899_0022010 3300037312 Bacteria 4834
853 Ga0395899_0070055 3300037312 Bacteria 2566
854 Ga0395899_0547604 3300037312 Bacteria 744
855 Ga0395900_0000163 3300037418 Bacteria 109199
856 Ga0395900_0000446 3300037418 Bacteria 59137
857 Ga0395900_0001441 3300037418 Bacteria 28406
858 Ga0395900_0008165 3300037418 Bacteria 10775
859 Ga0395900_0008717 3300037418 Bacteria 10414
860 Ga0395898_0026897 3300037466 Bacteria 5780
861 Ga0395898_0035138 3300037466 Bacteria 4988
862 Ga0395898_0118612 3300037466 Bacteria 2535
863 Ga0395898_0809437 3300037466 Bacteria 877
864 Ga0395901_0001974 3300038443 Bacteria 21107
865 Ga0395901_0017711 3300038443 Bacteria 7272
866 Ga0395901_0158486 3300038443 Bacteria 2377
867 Ga0395901_0184188 3300038443 Bacteria 2190
868 Ga0395901_1050236 3300038443 Bacteria 788
869 Ga0436365_0724831 3300039437 Bacteria 1062
870 Ga0436365_1735123 3300039437 Bacteria 1946
871 Ga0439436_0000009 3300041404 Bacteria 108375
872 Ga0439465_0004842 3300041413 Bacteria 4325
873 Ga0439432_039086 3300042006 Bacteria 1509
874 Ga0439454_066687 3300042011 Bacteria 632
875 Ga0450908_000062 3300042184 Bacteria 21656
876 Ga0439459_0000740 3300042438 Bacteria 4477
877 Ga0466982_0019436 3300044672 Bacteria 3836
878 Ga0453684_0001955 3300044712 Bacteria 53116
879 Ga0466968_0001442 3300044735 Bacteria 8533
880 Ga0466957_0093360 3300044842 Bacteria 1888
881 Ga0451576_0000042 3300045051 Bacteria 342102
882 Ga0466967_1353482 3300045976 Bacteria 709
883 Ga0495617_000131 3300046452 Bacteria 49764
884 Ga0495617_000523 3300046452 Bacteria 19954
885 Ga0495590_0051860 3300046457 Bacteria 1433
886 Ga0495638_0000180 3300046460 Bacteria 96716
887 Ga0495638_0000865 3300046460 Bacteria 31467
888 Ga0495650_0000469 3300046471 Bacteria 62135
889 Ga0495650_0006669 3300046471 Bacteria 7155
890 Ga0495580_0090581 3300046472 Bacteria 2129
891 Ga0495664_0082530 3300046477 Bacteria 1928
892 Ga0495584_0035273 3300046491 Bacteria 2529
893 Ga0495585_0000437 3300046492 Bacteria 39894
894 Ga0495585_0050081 3300046492 Bacteria 2317
895 Ga0495607_0000654 3300046501 Bacteria 33669
896 Ga0495607_0001295 3300046501 Bacteria 22335
897 Ga0495607_0025557 3300046501 Bacteria 3671
898 Ga0495583_0034392 3300046506 Bacteria 2427
899 Ga0495606_0000918 3300046507 Bacteria 43503
900 Ga0495606_0000948 3300046507 Bacteria 42725
901 Ga0495606_0008648 3300046507 Bacteria 8793
902 Ga0495606_0066365 3300046507 Bacteria 2289
903 Ga0495606_0194774 3300046507 Bacteria 1159
904 Ga0495610_0002419 3300046512 Bacteria 15714
905 Ga0495610_0013864 3300046512 Bacteria 4764
906 Ga0495616_0000190 3300046513 Bacteria 51392
907 Ga0495616_0006537 3300046513 Bacteria 7038
908 Ga0495620_0000565 3300046515 Bacteria 23373
909 Ga0495631_0000994 3300046518 Bacteria 17601
910 Ga0495631_0002241 3300046518 Bacteria 11100
911 Ga0495631_0190055 3300046518 Bacteria 879
912 Ga0495632_0000135 3300046519 Bacteria 75082
913 Ga0495632_0014817 3300046519 Bacteria 4397
914 Ga0495632_0020690 3300046519 Bacteria 3557
915 Ga0495637_0003288 3300046520 Bacteria 8594
916 Ga0495648_0001900 3300046524 Bacteria 19949
917 Ga0495648_0006502 3300046524 Bacteria 9528
918 Ga0495587_0159299 3300046536 Bacteria 1285
919 Ga0495609_0004002 3300046538 Bacteria 8228
920 Ga0495668_0006704 3300046616 Bacteria 7499
921 Ga0495611_0000004 3300046648 Bacteria 308149
922 Ga0495611_0001192 3300046648 Bacteria 13465
923 Ga0495625_0000617 3300046660 Bacteria 51659
924 Ga0495625_0051539 3300046660 Bacteria 2950
925 Ga0495625_0056776 3300046660 Bacteria 2785
926 Ga0495661_0001320 3300046665 Bacteria 21068
927 Ga0495588_0182954 3300046674 Bacteria 1107
928 Ga0495623_0533442 3300046679 Unclassified 616
929 Ga0495647_0046958 3300046681 Bacteria 1665
930 Ga0495658_0863066 3300046683 Unclassified 579
931 Ga0495670_0001876 3300046691 Bacteria 10338
932 Ga0495670_0056556 3300046691 Bacteria 1968
933 Ga0495671_0001801 3300046692 Bacteria 13867
934 Ga0495649_0121944 3300046694 Bacteria 1378
935 Ga0495649_0137857 3300046694 Bacteria 1285
936 Ga0495589_0000555 3300046794 Bacteria 25768
937 Ga0495600_0354445 3300046809 Bacteria 919
938 Ga0495660_0002959 3300046810 Bacteria 10627
939 Ga0495660_0068347 3300046810 Bacteria 1890
940 Ga0495581_0119570 3300047315 Bacteria 1533
941 Ga0495604_0634844 3300047317 Bacteria 682
942 Ga0495683_0001003 3300047323 Bacteria 19727
943 Ga0495679_000011 3300047446 Bacteria 324498
944 Ga0495679_113932 3300047446 Bacteria 743
945 Ga0495673_0000036 3300047469 Bacteria 311035
946 Ga0495673_0003506 3300047469 Bacteria 10322
947 Ga0495684_0106898 3300047471 Bacteria 2114
948 Ga0495686_0000126 3300047472 Bacteria 157350
949 Ga0495686_0004945 3300047472 Bacteria 10727
950 Ga0495686_0007659 3300047472 Bacteria 8061
951 Ga0495686_0020609 3300047472 Bacteria 4394
952 Ga0495686_0169704 3300047472 Bacteria 1269
953 Ga0496100_0028588 3300048903 Bacteria 3440
954 Ga0496101_0023789 3300048904 Bacteria 4235
955 Ga0496101_0355024 3300048904 Bacteria 1152
956 Ga0496102_0254604 3300048905 Bacteria 1655
957 Ga0496102_0876679 3300048905 Bacteria 819
958 Ga0496102_1589897 3300048905 Bacteria 572
959 Ga0496103_0138088 3300048906 Bacteria 1558
960 Ga0496104_0000005 3300048907 Bacteria 620360
961 Ga0496104_0318730 3300048907 Bacteria 1467
962 Ga0496105_0000259 3300048908 Bacteria 35646
963 Ga0496105_0002564 3300048908 Bacteria 13194
964 Ga0496106_0011791 3300048909 Bacteria 6451
965 Ga0496106_0040971 3300048909 Bacteria 3470
966 Ga0496107_0498535 3300048910 Bacteria 903
967 Ga0496107_0960783 3300048910 Bacteria 621
968 Ga0496115_0000077 3300048918 Bacteria 89885
969 Ga0496115_0023652 3300048918 Bacteria 4768
970 Ga0496115_0630284 3300048918 Bacteria 849
971 Ga0496116_0039663 3300048919 Bacteria 3253
972 Ga0496116_0072468 3300048919 Bacteria 2177
973 Ga0496117_0009281 3300048920 Bacteria 9189
974 Ga0496117_0010777 3300048920 Bacteria 8255
975 Ga0496117_0015592 3300048920 Bacteria 6466
976 Ga0496117_0015663 3300048920 Bacteria 6444
977 Ga0496117_0056200 3300048920 Bacteria 2743
978 Ga0496118_0004467 3300048921 Bacteria 16586
979 Ga0496118_0006061 3300048921 Bacteria 13467
980 Ga0496118_0006523 3300048921 Bacteria 12777
981 Ga0496118_0007470 3300048921 Bacteria 11569
982 Ga0496118_0008841 3300048921 Bacteria 10307
983 Ga0496118_0013000 3300048921 Bacteria 7921
984 Ga0496118_0281771 3300048921 Bacteria 925
985 Ga0496119_0000218 3300048922 Bacteria 81458
986 Ga0496119_0005096 3300048922 Bacteria 12756
987 Ga0496119_0026906 3300048922 Bacteria 3973
988 Ga0496120_0001849 3300048923 Bacteria 23568
989 Ga0496120_0002027 3300048923 Bacteria 22032
990 Ga0496120_0237604 3300048923 Bacteria 862
991 Ga0496121_0001803 3300048924 Bacteria 34595
992 Ga0496121_0003410 3300048924 Bacteria 22722
993 Ga0496121_0005180 3300048924 Bacteria 16903
994 Ga0496121_0010228 3300048924 Bacteria 10618
995 Ga0496121_0028882 3300048924 Bacteria 5150
996 Ga0496121_0053649 3300048924 Bacteria 3376
997 Ga0496121_0065341 3300048924 Bacteria 2960
998 Ga0496121_0084684 3300048924 Bacteria 2498
999 Ga0496122_0001517 3300048925 Bacteria 37011
1000 Ga0496122_0024944 3300048925 Bacteria 5217
1001 Ga0496123_0000323 3300048926 Bacteria 91212
1002 Ga0496123_0019122 3300048926 Bacteria 5408
1003 Ga0496123_0025582 3300048926 Bacteria 4446
1004 Ga0496123_0173819 3300048926 Bacteria 1133
1005 Ga0496123_0181841 3300048926 Bacteria 1097
1006 Ga0496124_0000241 3300048927 Bacteria 105919
1007 Ga0496124_0387469 3300048927 Bacteria 975
1008 Ga0496125_0016927 3300048928 Bacteria 6976
1009 Ga0496125_0038637 3300048928 Bacteria 4127
1010 Ga0496126_0000047 3300048929 Bacteria 322212
1011 Ga0496126_0003595 3300048929 Bacteria 19418
1012 Ga0496126_0010801 3300048929 Bacteria 9531
1013 Ga0496126_0040651 3300048929 Bacteria 4310
1014 Ga0496126_0041653 3300048929 Bacteria 4248
1015 Ga0496126_0087947 3300048929 Bacteria 2738
1016 Ga0496126_0330138 3300048929 Bacteria 1252
1017 Ga0495678_002032 3300049459 Bacteria 14489
1018 Ga0495682_0004016 3300049460 Bacteria 6405
1019 Ga0501031_0089410 3300049568 Bacteria 2008
1020 Ga0501031_0241523 3300049568 Bacteria 1174
1021 Ga0501031_0542665 3300049568 Bacteria 749
1022 Ga0501032_0014192 3300049569 Bacteria 5644
1023 Ga0501032_0038655 3300049569 Bacteria 3248
1024 Ga0501032_0054246 3300049569 Bacteria 2698
1025 Ga0501032_0703351 3300049569 Bacteria 640
1026 Ga0501033_0001723 3300049570 Bacteria 19140
1027 Ga0501033_0007330 3300049570 Bacteria 8596
1028 Ga0501033_0051974 3300049570 Bacteria 3037
1029 Ga0501033_0055857 3300049570 Bacteria 2918
1030 Ga0501033_0321195 3300049570 Bacteria 1087
1031 Ga0501034_0002782 3300049571 Bacteria 20512
1032 Ga0501034_0023477 3300049571 Bacteria 6284
1033 Ga0501034_0037473 3300049571 Bacteria 4910
1034 Ga0501034_0037895 3300049571 Bacteria 4883
1035 Ga0501034_0057242 3300049571 Bacteria 3919
1036 Ga0501034_0098249 3300049571 Bacteria 2923
1037 Ga0501034_0137509 3300049571 Bacteria 2424
1038 Ga0501034_0464103 3300049571 Bacteria 1183
1039 Ga0501034_0745808 3300049571 Bacteria 875
1040 Ga0501036_0035936 3300049572 Bacteria 4192
1041 Ga0501036_0123824 3300049572 Bacteria 2183
1042 Ga0501036_0149713 3300049572 Bacteria 1968
1043 Ga0501036_0357356 3300049572 Bacteria 1220
1044 Ga0501036_1123710 3300049572 Bacteria 641
1045 Ga0501037_0002066 3300049573 Bacteria 14559
1046 Ga0501037_0004872 3300049573 Bacteria 9765
1047 Ga0501037_0020372 3300049573 Bacteria 4896
1048 Ga0501037_0040858 3300049573 Bacteria 3412
1049 Ga0501037_0043950 3300049573 Bacteria 3283
1050 Ga0501037_0110796 3300049573 Bacteria 1977
1051 Ga0501037_0116910 3300049573 Bacteria 1919
1052 Ga0501037_0274710 3300049573 Bacteria 1175
1053 Ga0501038_0008882 3300049574 Bacteria 9223
1054 Ga0501038_0082843 3300049574 Bacteria 2701
1055 Ga0501038_0092258 3300049574 Bacteria 2536
1056 Ga0501038_0109536 3300049574 Bacteria 2288
1057 Ga0501038_0123355 3300049574 Bacteria 2134
1058 Ga0501038_0156164 3300049574 Bacteria 1857
1059 Ga0501038_0963965 3300049574 Unclassified 627
1060 Ga0501039_0086103 3300049575 Bacteria 2447
1061 Ga0501039_0288731 3300049575 Bacteria 1289
1062 Ga0501040_0045989 3300049576 Bacteria 2979
1063 Ga0501042_0044006 3300049578 Bacteria 3181
1064 Ga0501043_0026645 3300049579 Bacteria 4536
1065 Ga0501043_0032150 3300049579 Bacteria 4124
1066 Ga0501043_0036993 3300049579 Bacteria 3840
1067 Ga0501043_0077665 3300049579 Bacteria 2608
1068 Ga0501043_0106751 3300049579 Bacteria 2199
1069 Ga0501043_0135042 3300049579 Bacteria 1933
1070 Ga0501043_0214035 3300049579 Bacteria 1493
1071 Ga0501043_0243510 3300049579 Bacteria 1387
1072 Ga0501043_0275942 3300049579 Bacteria 1289
1073 Ga0501046_0029538 3300049580 Bacteria 4455
1074 Ga0501046_0056809 3300049580 Bacteria 3070
1075 Ga0501046_0225064 3300049580 Bacteria 1388
1076 Ga0501046_0285391 3300049580 Bacteria 1208
1077 Ga0501047_0003794 3300049581 Bacteria 14214
1078 Ga0501047_0011548 3300049581 Bacteria 8362
1079 Ga0501047_0012936 3300049581 Bacteria 7902
1080 Ga0501047_0020529 3300049581 Bacteria 6342
1081 Ga0501047_0026899 3300049581 Bacteria 5538
1082 Ga0501047_0036519 3300049581 Bacteria 4749
1083 Ga0501047_0037310 3300049581 Bacteria 4699
1084 Ga0501047_0067397 3300049581 Bacteria 3449
1085 Ga0501047_0087069 3300049581 Bacteria 3001
1086 Ga0501047_0255771 3300049581 Bacteria 1600
1087 Ga0501047_0336363 3300049581 Bacteria 1348
1088 Ga0501047_0416293 3300049581 Bacteria 1175
1089 Ga0501047_0499183 3300049581 Bacteria 1043
1090 Ga0501047_0525047 3300049581 Bacteria 1009
1091 Ga0501047_0586196 3300049581 Bacteria 937
1092 Ga0501048_0011381 3300049582 Bacteria 6635
1093 Ga0501048_0141283 3300049582 Bacteria 1702
1094 Ga0501048_0148392 3300049582 Bacteria 1658
1095 Ga0501048_0569837 3300049582 Bacteria 813
1096 Ga0501067_0000857 3300049583 Bacteria 16400
1097 Ga0501067_0012199 3300049583 Bacteria 4764
1098 Ga0501068_0004617 3300049584 Bacteria 7494
1099 Ga0501068_0084501 3300049584 Bacteria 1952
1100 Ga0501068_0112415 3300049584 Bacteria 1694
1101 Ga0501069_0004350 3300049585 Bacteria 7310
1102 Ga0501069_0018788 3300049585 Bacteria 3732
1103 Ga0501069_0021725 3300049585 Bacteria 3486
1104 Ga0501069_0044339 3300049585 Bacteria 2462
1105 Ga0501069_0063123 3300049585 Bacteria 2069
1106 Ga0501069_0112660 3300049585 Bacteria 1550
1107 Ga0501069_0213033 3300049585 Bacteria 1121
1108 Ga0501070_0000912 3300049586 Bacteria 26871
1109 Ga0501070_0000943 3300049586 Bacteria 26245
1110 Ga0501070_0001089 3300049586 Bacteria 24401
1111 Ga0501070_0007679 3300049586 Bacteria 9149
1112 Ga0501070_0016130 3300049586 Bacteria 6279
1113 Ga0501070_0026441 3300049586 Bacteria 4868
1114 Ga0501070_0028353 3300049586 Bacteria 4696
1115 Ga0501070_0034589 3300049586 Bacteria 4223
1116 Ga0501070_0043188 3300049586 Bacteria 3752
1117 Ga0501070_0116701 3300049586 Bacteria 2204
1118 Ga0501070_0122909 3300049586 Bacteria 2145
1119 Ga0501070_0127865 3300049586 Bacteria 2099
1120 Ga0501070_0206426 3300049586 Bacteria 1613
1121 Ga0501070_0235902 3300049586 Bacteria 1498
1122 Ga0501071_0003086 3300049587 Bacteria 10324
1123 Ga0501071_0043991 3300049587 Bacteria 3203
1124 Ga0501071_0071019 3300049587 Bacteria 2537
1125 Ga0501071_0278800 3300049587 Bacteria 1265
1126 Ga0501071_1026681 3300049587 Bacteria 637
1127 Ga0501072_0000573 3300049588 Bacteria 26511
1128 Ga0501072_0010920 3300049588 Bacteria 6928
1129 Ga0501072_0701619 3300049588 Bacteria 795
1130 Ga0501073_0008546 3300049589 Bacteria 7592
1131 Ga0501073_0040689 3300049589 Bacteria 3287
1132 Ga0501073_0048295 3300049589 Bacteria 2988
1133 Ga0501073_0096544 3300049589 Bacteria 2052
1134 Ga0501073_0124971 3300049589 Bacteria 1783
1135 Ga0501073_0196894 3300049589 Bacteria 1393
1136 Ga0501074_0000733 3300049590 Bacteria 20594
1137 Ga0501074_0002721 3300049590 Bacteria 12370
1138 Ga0501074_0003202 3300049590 Bacteria 11546
1139 Ga0501074_0046568 3300049590 Bacteria 3135
1140 Ga0501074_0085748 3300049590 Bacteria 2256
1141 Ga0501074_0143125 3300049590 Bacteria 1710
1142 Ga0501074_0219899 3300049590 Bacteria 1352
1143 Ga0501076_0049056 3300049592 Bacteria 3338
1144 Ga0501076_1316875 3300049592 Bacteria 594
1145 Ga0501079_0027299 3300049741 Bacteria 4376
1146 Ga0501079_0036882 3300049741 Bacteria 3765
1147 Ga0501079_0122391 3300049741 Bacteria 2023
1148 Ga0501079_0310021 3300049741 Bacteria 1235
1149 Ga0501079_0558498 3300049741 Bacteria 900
1150 Ga0501079_0703212 3300049741 Bacteria 795
1151 Ga0501080_0000764 3300049742 Bacteria 26124
1152 Ga0501080_0006152 3300049742 Bacteria 10770
1153 Ga0501080_0016890 3300049742 Bacteria 6740
1154 Ga0501080_0030743 3300049742 Bacteria 5003
1155 Ga0501080_0036409 3300049742 Bacteria 4593
1156 Ga0501080_0149659 3300049742 Bacteria 2158
1157 Ga0501080_0337920 3300049742 Bacteria 1361
1158 Ga0501080_0418177 3300049742 Bacteria 1204
1159 Ga0501080_0505593 3300049742 Bacteria 1079
1160 Ga0501080_0712534 3300049742 Bacteria 884
1161 Ga0501080_0812895 3300049742 Bacteria 819
1162 Ga0501081_0054458 3300049743 Bacteria 2764
1163 Ga0501083_0000246 3300049744 Bacteria 34511
1164 Ga0501083_0059947 3300049744 Bacteria 2544
1165 Ga0501083_0094544 3300049744 Bacteria 1973
1166 Ga0501083_0455391 3300049744 Bacteria 833
1167 Ga0501035_0003966 3300049822 Bacteria 14106
1168 Ga0501035_0004415 3300049822 Bacteria 13354
1169 Ga0501035_0007330 3300049822 Bacteria 10310
1170 Ga0501035_0007906 3300049822 Bacteria 9933
1171 Ga0501035_0017044 3300049822 Bacteria 6693
1172 Ga0501035_0065342 3300049822 Bacteria 3231
1173 Ga0501035_0106250 3300049822 Bacteria 2461
1174 Ga0501035_0146059 3300049822 Bacteria 2054
1175 Ga0501035_0233427 3300049822 Bacteria 1567
1176 Ga0501035_0361456 3300049822 Bacteria 1213
1177 Ga0501035_0820848 3300049822 Bacteria 741
1178 Ga0501035_0981132 3300049822 Bacteria 665
1179 Ga0501044_0009940 3300049823 Bacteria 10336
1180 Ga0501044_0012031 3300049823 Bacteria 9374
1181 Ga0501044_0018707 3300049823 Bacteria 7419
1182 Ga0501044_0044497 3300049823 Bacteria 4606
1183 Ga0501044_0056882 3300049823 Bacteria 4015
1184 Ga0501044_0058278 3300049823 Bacteria 3961
1185 Ga0501044_0062194 3300049823 Bacteria 3816
1186 Ga0501044_0083028 3300049823 Bacteria 3240
1187 Ga0501044_0202487 3300049823 Bacteria 1943
1188 Ga0501044_0254314 3300049823 Bacteria 1696
1189 Ga0501044_0320171 3300049823 Bacteria 1475
1190 Ga0501044_0320600 3300049823 Bacteria 1474
1191 Ga0501044_0549512 3300049823 Bacteria 1052
1192 Ga0501044_0736976 3300049823 Bacteria 868
1193 Ga0501044_1001844 3300049823 Bacteria 707
1194 Ga0501045_0006516 3300049824 Bacteria 8092
1195 nmdc:mga0sz30_232173_c1 3300050516 Bacteria 821
1196 nmdc:mga0sz30_69637_c1 3300050516 Bacteria 1513
1197 Ga0495612_0150709 3300053078 Bacteria 1012
1198 Ga0500635_0331452 3300053080 Unclassified 602
1199 Ga0500643_000012 3300053087 Bacteria 369839
1200 Ga0500643_002272 3300053087 Bacteria 10080
1201 Ga0500651_0221483 3300053093 Bacteria 1109
1202 Ga0500566_0035055 3300053094 Bacteria 2917
1203 Ga0500555_000686 3300053103 Bacteria 12859
1204 Ga0500597_000129 3300053120 Bacteria 15440
1205 Ga0500568_0000233 3300053139 Bacteria 47567
1206 Ga0500633_0021546 3300053160 Bacteria 1961
1207 Ga0500645_000375 3300053730 Bacteria 31466
1208 Ga0501084_0024432 3300054114 Bacteria 5041
1209 Ga0501084_0118416 3300054114 Bacteria 2226
1210 Ga0501084_0133378 3300054114 Bacteria 2091
1211 Ga0501082_0000107 3300060353 Bacteria 65178
1212 Ga0501082_0017700 3300060353 Bacteria 6136
1213 Ga0501082_0069949 3300060353 Bacteria 3022
1214 Ga0501082_0076297 3300060353 Bacteria 2889
1215 Ga0501082_0273069 3300060353 Bacteria 1471
1216 Ga0530510_0050485 3300061734 Bacteria 3005

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0235902 Ga0501070_0235902_519_1019 143
2 3300025921 Ga0207652_10178281 Ga0207652_101782812 144
3 3300031616 Ga0307508_10372436 Ga0307508_103724362 145
4 3300032004 Ga0307414_10793861 Ga0307414_107938612 145
5 3300032005 Ga0307411_10239623 Ga0307411_102396232 145
6 3300009093 Ga0105240_10387489 Ga0105240_103874892 146
7 3300025913 Ga0207695_10003383 Ga0207695_100033832 146
8 3300026041 Ga0207639_10111256 Ga0207639_101112562 146
9 3300049587 Ga0501071_0278800 Ga0501071_0278800_246_746 146
10 3300053139 Ga0500568_0000233 Ga0500568_0000233_11284_11775 147
11 3300001915 JGI24741J21665_1003649 JGI24741J21665_10036492 148
12 3300001979 JGI24740J21852_10002531 JGI24740J21852_100025314 148
13 3300005327 Ga0070658_10093137 Ga0070658_100931372 148
14 3300005329 Ga0070683_100053125 Ga0070683_1000531253 148
15 3300005329 Ga0070683_100298134 Ga0070683_1002981342 148
16 3300005330 Ga0070690_100032031 Ga0070690_1000320313 148
17 3300005334 Ga0068869_100564228 Ga0068869_1005642282 148
18 3300005335 Ga0070666_10011557 Ga0070666_100115574 148
19 3300005336 Ga0070680_100000293 Ga0070680_10000029322 148
20 3300005336 Ga0070680_100027064 Ga0070680_1000270643 148
21 3300005336 Ga0070680_100253040 Ga0070680_1002530401 148
22 3300005336 Ga0070680_100302335 Ga0070680_1003023352 148
23 3300005338 Ga0068868_100117283 Ga0068868_1001172832 148
24 3300005339 Ga0070660_100026896 Ga0070660_1000268962 148
25 3300005339 Ga0070660_100036407 Ga0070660_1000364072 148
26 3300005341 Ga0070691_10025884 Ga0070691_100258842 148
27 3300005344 Ga0070661_100007406 Ga0070661_1000074066 148
28 3300005345 Ga0070692_10035538 Ga0070692_100355382 148
29 3300005366 Ga0070659_100024890 Ga0070659_1000248902 148
30 3300005367 Ga0070667_100124607 Ga0070667_1001246072 148
31 3300005455 Ga0070663_100000898 Ga0070663_1000008989 148
32 3300005455 Ga0070663_100074074 Ga0070663_1000740742 148
33 3300005458 Ga0070681_10001007 Ga0070681_1000100719 148
34 3300005458 Ga0070681_10035566 Ga0070681_100355663 148
35 3300005458 Ga0070681_10853298 Ga0070681_108532981 148
36 3300005530 Ga0070679_100000155 Ga0070679_10000015527 148
37 3300005530 Ga0070679_100016385 Ga0070679_1000163855 148
38 3300005530 Ga0070679_100143750 Ga0070679_1001437502 148
39 3300005530 Ga0070679_100326451 Ga0070679_1003264512 148
40 3300005535 Ga0070684_100092360 Ga0070684_1000923602 148
41 3300005539 Ga0068853_100148812 Ga0068853_1001488122 148
42 3300005546 Ga0070696_100045291 Ga0070696_1000452912 148
43 3300005546 Ga0070696_100067558 Ga0070696_1000675582 148
44 3300005563 Ga0068855_100030179 Ga0068855_1000301792 148
45 3300005563 Ga0068855_100168051 Ga0068855_1001680512 148
46 3300005563 Ga0068855_100316374 Ga0068855_1003163742 148
47 3300005564 Ga0070664_100133533 Ga0070664_1001335332 148
48 3300005577 Ga0068857_100280235 Ga0068857_1002802352 148
49 3300005578 Ga0068854_100025886 Ga0068854_1000258862 148
50 3300005578 Ga0068854_100205817 Ga0068854_1002058172 148
51 3300005614 Ga0068856_100047444 Ga0068856_1000474443 148
52 3300005614 Ga0068856_100129949 Ga0068856_1001299492 148
53 3300005616 Ga0068852_100111714 Ga0068852_1001117142 148
54 3300005616 Ga0068852_100328175 Ga0068852_1003281752 148
55 3300005834 Ga0068851_10054443 Ga0068851_100544432 148
56 3300005842 Ga0068858_100664842 Ga0068858_1006648421 148
57 3300005843 Ga0068860_100054266 Ga0068860_1000542663 148
58 3300006358 Ga0068871_100499052 Ga0068871_1004990522 148
59 3300009093 Ga0105240_10072678 Ga0105240_100726782 148
60 3300009093 Ga0105240_10114951 Ga0105240_101149513 148
61 3300009093 Ga0105240_10132814 Ga0105240_101328142 148
62 3300009098 Ga0105245_10297204 Ga0105245_102972042 148
63 3300009174 Ga0105241_10020002 Ga0105241_100200024 148
64 3300009174 Ga0105241_10080359 Ga0105241_100803592 148
65 3300009545 Ga0105237_10075077 Ga0105237_100750773 148
66 3300009551 Ga0105238_10254953 Ga0105238_102549532 148
67 3300009553 Ga0105249_10547963 Ga0105249_105479632 148
68 3300010375 Ga0105239_10475878 Ga0105239_104758782 148
69 3300011119 Ga0105246_10207764 Ga0105246_102077642 148
70 3300013100 Ga0157373_10051110 Ga0157373_100511102 148
71 3300013100 Ga0157373_10065626 Ga0157373_100656263 148
72 3300013100 Ga0157373_10193847 Ga0157373_101938472 148
73 3300013102 Ga0157371_10058366 Ga0157371_100583662 148
74 3300013102 Ga0157371_10133110 Ga0157371_101331102 148
75 3300013102 Ga0157371_10365771 Ga0157371_103657712 148
76 3300013104 Ga0157370_10001542 Ga0157370_1000154225 148
77 3300013104 Ga0157370_10159422 Ga0157370_101594222 148
78 3300013104 Ga0157370_10165941 Ga0157370_101659412 148
79 3300013104 Ga0157370_10250682 Ga0157370_102506822 148
80 3300013105 Ga0157369_10048155 Ga0157369_100481553 148
81 3300013105 Ga0157369_10107227 Ga0157369_101072272 148
82 3300013105 Ga0157369_10154338 Ga0157369_101543382 148
83 3300013307 Ga0157372_10007654 Ga0157372_100076544 148
84 3300013307 Ga0157372_10048078 Ga0157372_100480782 148
85 3300013307 Ga0157372_10160316 Ga0157372_101603162 148
86 3300020069 Ga0197907_10116855 Ga0197907_101168552 148
87 3300020070 Ga0206356_10207760 Ga0206356_102077603 148
88 3300020081 Ga0206354_10910981 Ga0206354_109109812 148
89 3300020081 Ga0206354_10918145 Ga0206354_109181452 148
90 3300020082 Ga0206353_10270789 Ga0206353_102707892 148
91 3300020082 Ga0206353_10388015 Ga0206353_103880152 148
92 3300025321 Ga0207656_10188548 Ga0207656_101885482 148
93 3300025321 Ga0207656_10305183 Ga0207656_103051832 148
94 3300025904 Ga0207647_10001336 Ga0207647_100013363 148
95 3300025904 Ga0207647_10013218 Ga0207647_100132184 148
96 3300025909 Ga0207705_10000543 Ga0207705_1000054329 148
97 3300025909 Ga0207705_10029635 Ga0207705_100296353 148
98 3300025909 Ga0207705_10058521 Ga0207705_100585213 148
99 3300025911 Ga0207654_10066483 Ga0207654_100664832 148
100 3300025912 Ga0207707_10000055 Ga0207707_1000005581 148
101 3300025912 Ga0207707_10000086 Ga0207707_1000008636 148
102 3300025912 Ga0207707_10000300 Ga0207707_1000030020 148
103 3300025912 Ga0207707_10009123 Ga0207707_100091237 148
104 3300025912 Ga0207707_10210435 Ga0207707_102104352 148
105 3300025913 Ga0207695_10097692 Ga0207695_100976922 148
106 3300025913 Ga0207695_10143200 Ga0207695_101432002 148
107 3300025917 Ga0207660_10000541 Ga0207660_1000054122 148
108 3300025917 Ga0207660_10000727 Ga0207660_1000072718 148
109 3300025917 Ga0207660_10049299 Ga0207660_100492992 148
110 3300025917 Ga0207660_10050064 Ga0207660_100500642 148
111 3300025917 Ga0207660_10945592 Ga0207660_109455922 148
112 3300025919 Ga0207657_10007147 Ga0207657_100071475 148
113 3300025919 Ga0207657_10073797 Ga0207657_100737972 148
114 3300025919 Ga0207657_10073798 Ga0207657_100737982 148
115 3300025919 Ga0207657_10630238 Ga0207657_106302382 148
116 3300025920 Ga0207649_10060346 Ga0207649_100603463 148
117 3300025920 Ga0207649_10183123 Ga0207649_101831232 148
118 3300025920 Ga0207649_10206449 Ga0207649_102064492 148
119 3300025921 Ga0207652_10000017 Ga0207652_1000001728 148
120 3300025921 Ga0207652_10000040 Ga0207652_1000004087 148
121 3300025921 Ga0207652_10000260 Ga0207652_1000026047 148
122 3300025921 Ga0207652_10007346 Ga0207652_100073464 148
123 3300025921 Ga0207652_10073420 Ga0207652_100734202 148
124 3300025927 Ga0207687_10208365 Ga0207687_102083652 148
125 3300025932 Ga0207690_10036275 Ga0207690_100362753 148
126 3300025932 Ga0207690_10084307 Ga0207690_100843072 148
127 3300025933 Ga0207706_10169040 Ga0207706_101690402 148
128 3300025942 Ga0207689_10125337 Ga0207689_101253372 148
129 3300025944 Ga0207661_10015268 Ga0207661_100152682 148
130 3300025944 Ga0207661_10069774 Ga0207661_100697742 148
131 3300025945 Ga0207679_10182667 Ga0207679_101826672 148
132 3300025949 Ga0207667_10047090 Ga0207667_100470905 148
133 3300025949 Ga0207667_10103390 Ga0207667_101033902 148
134 3300025949 Ga0207667_10103394 Ga0207667_101033942 148
135 3300025949 Ga0207667_10281816 Ga0207667_102818162 148
136 3300025949 Ga0207667_11433814 Ga0207667_114338141 148
137 3300025981 Ga0207640_10001570 Ga0207640_100015702 148
138 3300025981 Ga0207640_10029459 Ga0207640_100294593 148
139 3300025981 Ga0207640_10042366 Ga0207640_100423662 148
140 3300026023 Ga0207677_10300370 Ga0207677_103003702 148
141 3300026035 Ga0207703_10198029 Ga0207703_101980292 148
142 3300026041 Ga0207639_10066198 Ga0207639_100661982 148
143 3300026067 Ga0207678_10079233 Ga0207678_100792332 148
144 3300026067 Ga0207678_10079234 Ga0207678_100792342 148
145 3300026078 Ga0207702_10001321 Ga0207702_1000132123 148
146 3300026116 Ga0207674_10022718 Ga0207674_100227182 148
147 3300026116 Ga0207674_10065552 Ga0207674_100655522 148
148 3300026142 Ga0207698_10001199 Ga0207698_100011994 148
149 3300028381 Ga0268264_10022702 Ga0268264_100227025 148
150 3300049568 Ga0501031_0542665 Ga0501031_0542665_99_599 148
151 3300049569 Ga0501032_0703351 Ga0501032_0703351_89_589 148
152 3300049570 Ga0501033_0051974 Ga0501033_0051974_644_1144 148
153 3300049571 Ga0501034_0464103 Ga0501034_0464103_379_879 148
154 3300049572 Ga0501036_0357356 Ga0501036_0357356_16_516 148
155 3300049573 Ga0501037_0004872 Ga0501037_0004872_4840_5340 148
156 3300049574 Ga0501038_0092258 Ga0501038_0092258_1943_2443 148
157 3300049581 Ga0501047_0011548 Ga0501047_0011548_5011_5511 148
158 3300049581 Ga0501047_0026899 Ga0501047_0026899_1598_2098 148
159 3300049585 Ga0501069_0018788 Ga0501069_0018788_1894_2394 148
160 3300049585 Ga0501069_0021725 Ga0501069_0021725_2694_3194 148
161 3300049585 Ga0501069_0044339 Ga0501069_0044339_1146_1634 148
162 3300049585 Ga0501069_0112660 Ga0501069_0112660_847_1347 148
163 3300049586 Ga0501070_0000912 Ga0501070_0000912_3371_3871 148
164 3300049586 Ga0501070_0000943 Ga0501070_0000943_22684_23172 148
165 3300049586 Ga0501070_0001089 Ga0501070_0001089_11216_11716 148
166 3300049586 Ga0501070_0116701 Ga0501070_0116701_1682_2182 148
167 3300049587 Ga0501071_0003086 Ga0501071_0003086_6902_7402 148
168 3300049588 Ga0501072_0701619 Ga0501072_0701619_123_623 148
169 3300049589 Ga0501073_0040689 Ga0501073_0040689_2738_3238 148
170 3300049589 Ga0501073_0124971 Ga0501073_0124971_91_591 148
171 3300049590 Ga0501074_0000733 Ga0501074_0000733_10739_11239 148
172 3300049590 Ga0501074_0002721 Ga0501074_0002721_2927_3427 148
173 3300049592 Ga0501076_0049056 Ga0501076_0049056_2661_3161 148
174 3300049741 Ga0501079_0122391 Ga0501079_0122391_433_933 148
175 3300049742 Ga0501080_0006152 Ga0501080_0006152_6206_6706 148
176 3300049742 Ga0501080_0030743 Ga0501080_0030743_3284_3772 148
177 3300049742 Ga0501080_0712534 Ga0501080_0712534_24_524 148
178 3300049744 Ga0501083_0094544 Ga0501083_0094544_267_767 148
179 3300049822 Ga0501035_0003966 Ga0501035_0003966_1802_2302 148
180 3300049822 Ga0501035_0007330 Ga0501035_0007330_1043_1543 148
181 3300049822 Ga0501035_0820848 Ga0501035_0820848_72_572 148
182 3300049823 Ga0501044_0018707 Ga0501044_0018707_1710_2210 148
183 3300049823 Ga0501044_0044497 Ga0501044_0044497_1813_2313 148
184 3300049823 Ga0501044_0058278 Ga0501044_0058278_1021_1521 148
185 3300005455 Ga0070663_100560829 Ga0070663_1005608292 149
186 3300013104 Ga0157370_10507693 Ga0157370_105076932 149
187 3300005563 Ga0068855_100382153 Ga0068855_1003821532 150
188 3300053078 Ga0495612_0150709 Ga0495612_0150709_114_605 150
189 3300005539 Ga0068853_100132189 Ga0068853_1001321892 152
190 3300005614 Ga0068856_100060130 Ga0068856_1000601303 152
191 3300013104 Ga0157370_10736798 Ga0157370_107367981 152
192 3300013307 Ga0157372_10810363 Ga0157372_108103632 152
193 3300013308 Ga0157375_10672421 Ga0157375_106724212 152
194 3300026041 Ga0207639_10932060 Ga0207639_109320601 152
195 3300035086 Ga0373934_0351138 Ga0373934_0351138_13_477 152
196 3300046679 Ga0495623_0533442 Ga0495623_0533442_141_605 152
197 3300049586 Ga0501070_0026441 Ga0501070_0026441_1292_1792 152
198 3300005455 Ga0070663_100195158 Ga0070663_1001951582 153
199 3300005539 Ga0068853_100124859 Ga0068853_1001248593 153
200 3300005548 Ga0070665_100515339 Ga0070665_1005153392 153
201 3300006881 Ga0068865_100717049 Ga0068865_1007170492 153
202 3300025315 Ga0207697_10270674 Ga0207697_102706742 153
203 3300025938 Ga0207704_10850885 Ga0207704_108508852 153
204 3300026067 Ga0207678_10222329 Ga0207678_102223292 153
205 3300028379 Ga0268266_10328290 Ga0268266_103282902 153
206 3300005331 Ga0070670_100045839 Ga0070670_1000458392 155
207 3300005334 Ga0068869_101117335 Ga0068869_1011173351 155
208 3300005335 Ga0070666_10001570 Ga0070666_1000157011 155
209 3300005338 Ga0068868_100032443 Ga0068868_1000324433 155
210 3300005344 Ga0070661_100079163 Ga0070661_1000791631 155
211 3300005347 Ga0070668_100859096 Ga0070668_1008590962 155
212 3300005367 Ga0070667_100016825 Ga0070667_1000168256 155
213 3300005455 Ga0070663_100071519 Ga0070663_1000715192 155
214 3300005548 Ga0070665_100000394 Ga0070665_10000039435 155
215 3300005563 Ga0068855_100129764 Ga0068855_1001297642 155
216 3300005578 Ga0068854_100032378 Ga0068854_1000323784 155
217 3300005617 Ga0068859_101271295 Ga0068859_1012712952 155
218 3300005834 Ga0068851_10000308 Ga0068851_1000030814 155
219 3300005841 Ga0068863_100674993 Ga0068863_1006749932 155
220 3300005842 Ga0068858_100001920 Ga0068858_1000019207 155
221 3300006931 Ga0097620_101271231 Ga0097620_1012712312 155
222 3300009177 Ga0105248_11065690 Ga0105248_110656902 155
223 3300009551 Ga0105238_10024319 Ga0105238_100243192 155
224 3300009553 Ga0105249_10072509 Ga0105249_100725093 155
225 3300013296 Ga0157374_10051331 Ga0157374_100513312 155
226 3300013307 Ga0157372_10076933 Ga0157372_100769332 155
227 3300014325 Ga0163163_12005726 Ga0163163_120057261 155
228 3300015262 Ga0182007_10169996 Ga0182007_101699962 155
229 3300025321 Ga0207656_10000991 Ga0207656_100009914 155
230 3300025903 Ga0207680_10007204 Ga0207680_100072043 155
231 3300025904 Ga0207647_10005244 Ga0207647_100052444 155
232 3300025913 Ga0207695_10065122 Ga0207695_100651223 155
233 3300025914 Ga0207671_10012095 Ga0207671_100120952 155
234 3300025920 Ga0207649_10352096 Ga0207649_103520962 155
235 3300025924 Ga0207694_10001852 Ga0207694_100018524 155
236 3300025925 Ga0207650_10054254 Ga0207650_100542543 155
237 3300025933 Ga0207706_10000876 Ga0207706_1000087614 155
238 3300025942 Ga0207689_10311584 Ga0207689_103115842 155
239 3300025945 Ga0207679_10571089 Ga0207679_105710892 155
240 3300025949 Ga0207667_10051933 Ga0207667_100519334 155
241 3300025961 Ga0207712_10000120 Ga0207712_1000012053 155
242 3300025972 Ga0207668_10637286 Ga0207668_106372862 155
243 3300025986 Ga0207658_10098611 Ga0207658_100986112 155
244 3300026023 Ga0207677_10071111 Ga0207677_100711112 155
245 3300026035 Ga0207703_10001512 Ga0207703_1000151212 155
246 3300026041 Ga0207639_10000236 Ga0207639_1000023623 155
247 3300026067 Ga0207678_10041897 Ga0207678_100418973 155
248 3300026078 Ga0207702_10426416 Ga0207702_104264161 155
249 3300026088 Ga0207641_10347431 Ga0207641_103474312 155
250 3300026089 Ga0207648_10680112 Ga0207648_106801122 155
251 3300026142 Ga0207698_10060302 Ga0207698_100603023 155
252 3300028379 Ga0268266_10000007 Ga0268266_10000007180 155
253 3300049572 Ga0501036_1123710 Ga0501036_1123710_127_597 156
254 iso_pu_bacteria 2524614729 2525556579 156
255 iso_pu_bacteria 2627854209 2630649808 156
256 iso_pu_bacteria 2537561836 2538835315 157
257 iso_pu_bacteria 2593339238 2595447539 157
258 iso_pu_bacteria 2593339239 2595451037 157
259 iso_pu_bacteria 2643221562 2643829721 157
260 iso_pu_bacteria 2643221577 2643897024 157
261 iso_pu_bacteria 2643221685 2644479229 157
262 iso_pu_bacteria 2687453130 2687581715 157
263 iso_pu_bacteria 2718218334 2721029014 157
264 iso_pu_bacteria 2734482264 2735835406 157
265 iso_pu_bacteria 2738543009 2739227397 157
266 iso_pu_bacteria 2818991440 2819565850 157
267 iso_pu_bacteria 2842914999 2842918733 157
268 iso_pu_bacteria 2842918807 2842921927 157
269 iso_pu_bacteria 2884338543 2884342196 157
270 iso_pu_bacteria 2895395659 2895395802 157
271 iso_pu_bacteria 2904463128 2904467300 157
272 iso_pu_bacteria 2919085039 2919087226 157
273 iso_pu_bacteria 2919404418 2919407918 157
274 iso_pu_bacteria 2939611941 2939614064 157
275 iso_pu_bacteria 2941471342 2941475810 157
276 iso_pu_bacteria 2953994433 2953997020 157
277 3300005334 Ga0068869_100037302 Ga0068869_1000373023 160
278 3300005338 Ga0068868_100162860 Ga0068868_1001628602 160
279 3300005340 Ga0070689_100151107 Ga0070689_1001511072 160
280 3300005365 Ga0070688_100285678 Ga0070688_1002856782 160
281 3300005367 Ga0070667_100147570 Ga0070667_1001475702 160
282 3300005367 Ga0070667_100178465 Ga0070667_1001784651 160
283 3300005455 Ga0070663_100014429 Ga0070663_1000144293 160
284 3300005466 Ga0070685_10002427 Ga0070685_100024273 160
285 3300005539 Ga0068853_100331541 Ga0068853_1003315412 160
286 3300005539 Ga0068853_100791573 Ga0068853_1007915731 160
287 3300005616 Ga0068852_101410174 Ga0068852_1014101742 160
288 3300005841 Ga0068863_100309501 Ga0068863_1003095012 160
289 3300005842 Ga0068858_100590534 Ga0068858_1005905342 160
290 3300009093 Ga0105240_10001002 Ga0105240_1000100228 160
291 3300009093 Ga0105240_10023570 Ga0105240_100235704 160
292 3300009093 Ga0105240_10288097 Ga0105240_102880972 160
293 3300009174 Ga0105241_10207841 Ga0105241_102078412 160
294 3300009176 Ga0105242_11517552 Ga0105242_115175522 160
295 3300009545 Ga0105237_10079728 Ga0105237_100797281 160
296 3300009545 Ga0105237_10672570 Ga0105237_106725702 160
297 3300009551 Ga0105238_10001727 Ga0105238_1000172714 160
298 3300009551 Ga0105238_10170925 Ga0105238_101709252 160
299 3300010375 Ga0105239_10424255 Ga0105239_104242552 160
300 3300013296 Ga0157374_10072742 Ga0157374_100727423 160
301 3300013307 Ga0157372_10681617 Ga0157372_106816172 160
302 3300013308 Ga0157375_10202000 Ga0157375_102020002 160
303 3300014497 Ga0182008_10614200 Ga0182008_106142001 160
304 3300014968 Ga0157379_10798493 Ga0157379_107984932 160
305 3300014969 Ga0157376_10057731 Ga0157376_100577313 160
306 3300025261 Ga0209233_1000715 Ga0209233_10007154 160
307 3300025913 Ga0207695_10000040 Ga0207695_10000040182 160
308 3300025913 Ga0207695_10011473 Ga0207695_100114735 160
309 3300025913 Ga0207695_10014145 Ga0207695_100141452 160
310 3300025914 Ga0207671_10265569 Ga0207671_102655692 160
311 3300025914 Ga0207671_10308582 Ga0207671_103085822 160
312 3300025924 Ga0207694_10001164 Ga0207694_1000116414 160
313 3300025936 Ga0207670_10185743 Ga0207670_101857432 160
314 3300025942 Ga0207689_10295366 Ga0207689_102953662 160
315 3300025961 Ga0207712_11162140 Ga0207712_111621402 160
316 3300025981 Ga0207640_10396024 Ga0207640_103960242 160
317 3300025986 Ga0207658_10062351 Ga0207658_100623512 160
318 3300026041 Ga0207639_10499959 Ga0207639_104999592 160
319 3300026067 Ga0207678_10012455 Ga0207678_100124554 160
320 3300026118 Ga0207675_100773528 Ga0207675_1007735282 160
321 3300035691 Ga0373931_1224881 Ga0373931_1224881_16_501 160
322 3300046683 Ga0495658_0863066 Ga0495658_0863066_66_551 160
323 3300048921 Ga0496118_0006523 Ga0496118_0006523_10562_11050 160
324 3300049571 Ga0501034_0137509 Ga0501034_0137509_636_1124 160
325 3300001904 JGI24736J21556_1026770 JGI24736J21556_10267702 161
326 3300001915 JGI24741J21665_1000630 JGI24741J21665_10006304 161
327 3300001915 JGI24741J21665_1002101 JGI24741J21665_10021015 161
328 3300001979 JGI24740J21852_10000804 JGI24740J21852_100008049 161
329 3300002067 JGI24735J21928_10032079 JGI24735J21928_100320792 161
330 3300002705 JGI25156J39149_1010862 JGI25156J39149_10108623 161
331 3300002705 JGI25156J39149_1019318 JGI25156J39149_10193182 161
332 3300002737 JGI25162J39368_1002123 JGI25162J39368_10021236 161
333 3300002737 JGI25162J39368_1004779 JGI25162J39368_10047792 161
334 3300002737 JGI25162J39368_1005781 JGI25162J39368_10057812 161
335 3300002737 JGI25162J39368_1007437 JGI25162J39368_10074372 161
336 3300002741 JGI25157J39369_1001648 JGI25157J39369_10016485 161
337 3300002772 JGI25164J39214_1001039 JGI25164J39214_10010396 161
338 3300002772 JGI25164J39214_1001045 JGI25164J39214_10010456 161
339 3300003214 JGI25165J46597_1001900 JGI25165J46597_10019003 161
340 3300003214 JGI25165J46597_1001970 JGI25165J46597_10019703 161
341 3300003316 rootH1_10066759 rootH1_100667594 161
342 3300003354 JGI25160J50197_1037683 JGI25160J50197_10376832 161
343 3300003759 Ga0055525_1000138 Ga0055525_100013815 161
344 3300003762 Ga0055542_1001346 Ga0055542_10013464 161
345 3300004625 Ga0055543_1031151 Ga0055543_10311512 161
346 3300005262 Ga0065165_1003134 Ga0065165_10031343 161
347 3300005327 Ga0070658_10003930 Ga0070658_1000393010 161
348 3300005327 Ga0070658_10176649 Ga0070658_101766492 161
349 3300005327 Ga0070658_10904447 Ga0070658_109044472 161
350 3300005328 Ga0070676_10036654 Ga0070676_100366542 161
351 3300005329 Ga0070683_100833055 Ga0070683_1008330552 161
352 3300005330 Ga0070690_100382069 Ga0070690_1003820691 161
353 3300005331 Ga0070670_100072165 Ga0070670_1000721652 161
354 3300005331 Ga0070670_100099788 Ga0070670_1000997882 161
355 3300005331 Ga0070670_100254111 Ga0070670_1002541112 161
356 3300005331 Ga0070670_100282782 Ga0070670_1002827822 161
357 3300005335 Ga0070666_10000022 Ga0070666_10000022116 161
358 3300005335 Ga0070666_10149933 Ga0070666_101499331 161
359 3300005336 Ga0070680_100004283 Ga0070680_1000042833 161
360 3300005336 Ga0070680_100079929 Ga0070680_1000799292 161
361 3300005336 Ga0070680_100096453 Ga0070680_1000964532 161
362 3300005336 Ga0070680_100274562 Ga0070680_1002745622 161
363 3300005337 Ga0070682_100000806 Ga0070682_10000080613 161
364 3300005337 Ga0070682_100002014 Ga0070682_1000020144 161
365 3300005337 Ga0070682_100003486 Ga0070682_1000034866 161
366 3300005337 Ga0070682_100018241 Ga0070682_1000182412 161
367 3300005337 Ga0070682_100206768 Ga0070682_1002067682 161
368 3300005337 Ga0070682_100358656 Ga0070682_1003586562 161
369 3300005338 Ga0068868_100055470 Ga0068868_1000554701 161
370 3300005338 Ga0068868_100120780 Ga0068868_1001207802 161
371 3300005339 Ga0070660_100133415 Ga0070660_1001334152 161
372 3300005339 Ga0070660_100221358 Ga0070660_1002213582 161
373 3300005339 Ga0070660_100274344 Ga0070660_1002743442 161
374 3300005339 Ga0070660_100287795 Ga0070660_1002877952 161
375 3300005339 Ga0070660_100909566 Ga0070660_1009095661 161
376 3300005340 Ga0070689_100032715 Ga0070689_1000327151 161
377 3300005340 Ga0070689_100181018 Ga0070689_1001810182 161
378 3300005341 Ga0070691_10003796 Ga0070691_100037962 161
379 3300005341 Ga0070691_10035737 Ga0070691_100357372 161
380 3300005341 Ga0070691_10041177 Ga0070691_100411772 161
381 3300005344 Ga0070661_100003432 Ga0070661_1000034329 161
382 3300005344 Ga0070661_100004407 Ga0070661_1000044073 161
383 3300005344 Ga0070661_100017497 Ga0070661_1000174974 161
384 3300005344 Ga0070661_100024169 Ga0070661_1000241693 161
385 3300005344 Ga0070661_100077255 Ga0070661_1000772552 161
386 3300005344 Ga0070661_100144046 Ga0070661_1001440462 161
387 3300005344 Ga0070661_100188172 Ga0070661_1001881722 161
388 3300005345 Ga0070692_10013186 Ga0070692_100131863 161
389 3300005345 Ga0070692_10014558 Ga0070692_100145582 161
390 3300005345 Ga0070692_10033369 Ga0070692_100333692 161
391 3300005345 Ga0070692_10047682 Ga0070692_100476822 161
392 3300005345 Ga0070692_10085870 Ga0070692_100858702 161
393 3300005347 Ga0070668_100039383 Ga0070668_1000393832 161
394 3300005347 Ga0070668_100078330 Ga0070668_1000783302 161
395 3300005347 Ga0070668_100089642 Ga0070668_1000896422 161
396 3300005347 Ga0070668_101152705 Ga0070668_1011527051 161
397 3300005353 Ga0070669_100032599 Ga0070669_1000325993 161
398 3300005354 Ga0070675_100138837 Ga0070675_1001388372 161
399 3300005354 Ga0070675_100152659 Ga0070675_1001526592 161
400 3300005355 Ga0070671_100202765 Ga0070671_1002027651 161
401 3300005355 Ga0070671_100353883 Ga0070671_1003538831 161
402 3300005355 Ga0070671_101298045 Ga0070671_1012980451 161
403 3300005364 Ga0070673_100105600 Ga0070673_1001056002 161
404 3300005365 Ga0070688_100132502 Ga0070688_1001325022 161
405 3300005366 Ga0070659_100035633 Ga0070659_1000356333 161
406 3300005366 Ga0070659_100115297 Ga0070659_1001152972 161
407 3300005366 Ga0070659_100143083 Ga0070659_1001430831 161
408 3300005366 Ga0070659_100255343 Ga0070659_1002553432 161
409 3300005366 Ga0070659_100386472 Ga0070659_1003864722 161
410 3300005366 Ga0070659_100746655 Ga0070659_1007466552 161
411 3300005367 Ga0070667_100000049 Ga0070667_10000004922 161
412 3300005367 Ga0070667_100009859 Ga0070667_1000098597 161
413 3300005367 Ga0070667_100136481 Ga0070667_1001364812 161
414 3300005367 Ga0070667_100418739 Ga0070667_1004187391 161
415 3300005367 Ga0070667_100751526 Ga0070667_1007515261 161
416 3300005434 Ga0070709_10414684 Ga0070709_104146842 161
417 3300005434 Ga0070709_10835252 Ga0070709_108352522 161
418 3300005435 Ga0070714_100000180 Ga0070714_1000001806 161
419 3300005435 Ga0070714_100005379 Ga0070714_1000053798 161
420 3300005435 Ga0070714_100221141 Ga0070714_1002211413 161
421 3300005436 Ga0070713_100010125 Ga0070713_1000101253 161
422 3300005437 Ga0070710_10105724 Ga0070710_101057242 161
423 3300005444 Ga0070694_100076895 Ga0070694_1000768952 161
424 3300005455 Ga0070663_100000042 Ga0070663_10000004221 161
425 3300005455 Ga0070663_100013890 Ga0070663_1000138904 161
426 3300005455 Ga0070663_100021650 Ga0070663_1000216503 161
427 3300005455 Ga0070663_100277690 Ga0070663_1002776902 161
428 3300005456 Ga0070678_100731727 Ga0070678_1007317271 161
429 3300005457 Ga0070662_100043041 Ga0070662_1000430412 161
430 3300005457 Ga0070662_100779690 Ga0070662_1007796901 161
431 3300005458 Ga0070681_10016163 Ga0070681_100161632 161
432 3300005458 Ga0070681_10021468 Ga0070681_100214685 161
433 3300005458 Ga0070681_10021815 Ga0070681_100218153 161
434 3300005458 Ga0070681_10042226 Ga0070681_100422263 161
435 3300005458 Ga0070681_10228897 Ga0070681_102288972 161
436 3300005458 Ga0070681_10547943 Ga0070681_105479432 161
437 3300005459 Ga0068867_100142054 Ga0068867_1001420542 161
438 3300005530 Ga0070679_100020655 Ga0070679_1000206553 161
439 3300005530 Ga0070679_100028019 Ga0070679_1000280195 161
440 3300005530 Ga0070679_100116839 Ga0070679_1001168392 161
441 3300005530 Ga0070679_100148538 Ga0070679_1001485382 161
442 3300005530 Ga0070679_100149519 Ga0070679_1001495192 161
443 3300005539 Ga0068853_100004241 Ga0068853_10000424111 161
444 3300005539 Ga0068853_100011813 Ga0068853_1000118135 161
445 3300005539 Ga0068853_100019329 Ga0068853_1000193294 161
446 3300005539 Ga0068853_100034056 Ga0068853_1000340562 161
447 3300005539 Ga0068853_100051204 Ga0068853_1000512042 161
448 3300005539 Ga0068853_100058481 Ga0068853_1000584812 161
449 3300005539 Ga0068853_100121628 Ga0068853_1001216283 161
450 3300005539 Ga0068853_100127446 Ga0068853_1001274462 161
451 3300005539 Ga0068853_100175221 Ga0068853_1001752212 161
452 3300005539 Ga0068853_100264330 Ga0068853_1002643302 161
453 3300005539 Ga0068853_100476320 Ga0068853_1004763202 161
454 3300005539 Ga0068853_100535923 Ga0068853_1005359232 161
455 3300005543 Ga0070672_100004899 Ga0070672_1000048992 161
456 3300005543 Ga0070672_100023555 Ga0070672_1000235552 161
457 3300005546 Ga0070696_100009571 Ga0070696_1000095715 161
458 3300005546 Ga0070696_100039613 Ga0070696_1000396133 161
459 3300005546 Ga0070696_100202669 Ga0070696_1002026692 161
460 3300005547 Ga0070693_100001044 Ga0070693_1000010447 161
461 3300005547 Ga0070693_100002799 Ga0070693_1000027996 161
462 3300005547 Ga0070693_100227465 Ga0070693_1002274652 161
463 3300005547 Ga0070693_100493919 Ga0070693_1004939191 161
464 3300005547 Ga0070693_100539259 Ga0070693_1005392591 161
465 3300005548 Ga0070665_100000028 Ga0070665_100000028179 161
466 3300005548 Ga0070665_100043608 Ga0070665_1000436084 161
467 3300005548 Ga0070665_100141995 Ga0070665_1001419953 161
468 3300005548 Ga0070665_100357771 Ga0070665_1003577712 161
469 3300005563 Ga0068855_100039530 Ga0068855_1000395306 161
470 3300005563 Ga0068855_100068427 Ga0068855_1000684273 161
471 3300005563 Ga0068855_100151012 Ga0068855_1001510123 161
472 3300005563 Ga0068855_100164800 Ga0068855_1001648003 161
473 3300005563 Ga0068855_100419702 Ga0068855_1004197022 161
474 3300005563 Ga0068855_100552721 Ga0068855_1005527211 161
475 3300005563 Ga0068855_100733703 Ga0068855_1007337032 161
476 3300005563 Ga0068855_101563814 Ga0068855_1015638142 161
477 3300005564 Ga0070664_100014865 Ga0070664_1000148653 161
478 3300005564 Ga0070664_100027338 Ga0070664_1000273384 161
479 3300005564 Ga0070664_100905820 Ga0070664_1009058201 161
480 3300005577 Ga0068857_100063848 Ga0068857_1000638483 161
481 3300005577 Ga0068857_100156629 Ga0068857_1001566293 161
482 3300005577 Ga0068857_100235525 Ga0068857_1002355252 161
483 3300005578 Ga0068854_100036278 Ga0068854_1000362782 161
484 3300005578 Ga0068854_100211890 Ga0068854_1002118902 161
485 3300005578 Ga0068854_100692814 Ga0068854_1006928142 161
486 3300005614 Ga0068856_100000086 Ga0068856_10000008641 161
487 3300005614 Ga0068856_100007013 Ga0068856_1000070136 161
488 3300005614 Ga0068856_100135054 Ga0068856_1001350542 161
489 3300005614 Ga0068856_100188836 Ga0068856_1001888362 161
490 3300005614 Ga0068856_100481954 Ga0068856_1004819542 161
491 3300005616 Ga0068852_100001178 Ga0068852_10000117816 161
492 3300005616 Ga0068852_100028616 Ga0068852_1000286162 161
493 3300005616 Ga0068852_100044297 Ga0068852_1000442973 161
494 3300005616 Ga0068852_100182641 Ga0068852_1001826412 161
495 3300005616 Ga0068852_100660572 Ga0068852_1006605722 161
496 3300005616 Ga0068852_100884301 Ga0068852_1008843012 161
497 3300005616 Ga0068852_100934514 Ga0068852_1009345141 161
498 3300005617 Ga0068859_100123902 Ga0068859_1001239023 161
499 3300005617 Ga0068859_100152170 Ga0068859_1001521703 161
500 3300005618 Ga0068864_100026288 Ga0068864_1000262883 161
501 3300005834 Ga0068851_10004951 Ga0068851_100049512 161
502 3300005841 Ga0068863_100001699 Ga0068863_10000169916 161
503 3300005841 Ga0068863_100016174 Ga0068863_1000161742 161
504 3300005841 Ga0068863_100211165 Ga0068863_1002111652 161
505 3300005841 Ga0068863_100317288 Ga0068863_1003172882 161
506 3300005842 Ga0068858_100126920 Ga0068858_1001269202 161
507 3300005843 Ga0068860_100002386 Ga0068860_1000023865 161
508 3300005843 Ga0068860_100093513 Ga0068860_1000935132 161
509 3300005843 Ga0068860_100282579 Ga0068860_1002825791 161
510 3300005843 Ga0068860_100304583 Ga0068860_1003045832 161
511 3300005843 Ga0068860_102220925 Ga0068860_1022209251 161
512 3300006175 Ga0070712_100400983 Ga0070712_1004009832 161
513 3300006237 Ga0097621_100024618 Ga0097621_1000246183 161
514 3300006237 Ga0097621_100051803 Ga0097621_1000518032 161
515 3300006237 Ga0097621_100055831 Ga0097621_1000558312 161
516 3300006237 Ga0097621_100245526 Ga0097621_1002455262 161
517 3300006237 Ga0097621_100265628 Ga0097621_1002656282 161
518 3300006237 Ga0097621_100949173 Ga0097621_1009491731 161
519 3300006237 Ga0097621_101080323 Ga0097621_1010803232 161
520 3300006358 Ga0068871_100105221 Ga0068871_1001052213 161
521 3300006358 Ga0068871_100123844 Ga0068871_1001238442 161
522 3300006358 Ga0068871_100214041 Ga0068871_1002140412 161
523 3300006358 Ga0068871_100372668 Ga0068871_1003726681 161
524 3300006871 Ga0075434_100135781 Ga0075434_1001357812 161
525 3300006881 Ga0068865_100019090 Ga0068865_1000190902 161
526 3300006881 Ga0068865_100019360 Ga0068865_1000193602 161
527 3300006931 Ga0097620_100123911 Ga0097620_1001239113 161
528 3300006931 Ga0097620_100152175 Ga0097620_1001521753 161
529 3300009093 Ga0105240_10015087 Ga0105240_100150878 161
530 3300009093 Ga0105240_10015130 Ga0105240_100151308 161
531 3300009093 Ga0105240_10068361 Ga0105240_100683613 161
532 3300009093 Ga0105240_10117922 Ga0105240_101179223 161
533 3300009093 Ga0105240_10152817 Ga0105240_101528172 161
534 3300009093 Ga0105240_10168342 Ga0105240_101683424 161
535 3300009098 Ga0105245_10255638 Ga0105245_102556381 161
536 3300009098 Ga0105245_10487032 Ga0105245_104870322 161
537 3300009098 Ga0105245_10729718 Ga0105245_107297182 161
538 3300009098 Ga0105245_11996473 Ga0105245_119964731 161
539 3300009101 Ga0105247_10009071 Ga0105247_100090713 161
540 3300009101 Ga0105247_10992104 Ga0105247_109921041 161
541 3300009174 Ga0105241_10019716 Ga0105241_100197163 161
542 3300009174 Ga0105241_10033603 Ga0105241_100336032 161
543 3300009176 Ga0105242_10016160 Ga0105242_100161605 161
544 3300009176 Ga0105242_10171803 Ga0105242_101718033 161
545 3300009176 Ga0105242_10234948 Ga0105242_102349482 161
546 3300009176 Ga0105242_11013772 Ga0105242_110137721 161
547 3300009177 Ga0105248_10000120 Ga0105248_1000012027 161
548 3300009177 Ga0105248_10103169 Ga0105248_101031694 161
549 3300009177 Ga0105248_10416462 Ga0105248_104164621 161
550 3300009177 Ga0105248_10861065 Ga0105248_108610651 161
551 3300009545 Ga0105237_10000070 Ga0105237_1000007098 161
552 3300009545 Ga0105237_10009634 Ga0105237_1000963412 161
553 3300009545 Ga0105237_10013807 Ga0105237_100138078 161
554 3300009545 Ga0105237_10028245 Ga0105237_100282456 161
555 3300009545 Ga0105237_10133674 Ga0105237_101336742 161
556 3300009551 Ga0105238_10000175 Ga0105238_1000017535 161
557 3300009551 Ga0105238_10003190 Ga0105238_1000319012 161
558 3300009551 Ga0105238_10009039 Ga0105238_1000903910 161
559 3300009551 Ga0105238_10041807 Ga0105238_100418073 161
560 3300009551 Ga0105238_10087375 Ga0105238_100873753 161
561 3300009551 Ga0105238_10157028 Ga0105238_101570282 161
562 3300009551 Ga0105238_10177357 Ga0105238_101773572 161
563 3300009551 Ga0105238_10183185 Ga0105238_101831852 161
564 3300009551 Ga0105238_10230800 Ga0105238_102308002 161
565 3300009551 Ga0105238_10324593 Ga0105238_103245931 161
566 3300009551 Ga0105238_10420655 Ga0105238_104206552 161
567 3300009551 Ga0105238_10683731 Ga0105238_106837312 161
568 3300009553 Ga0105249_10000898 Ga0105249_100008983 161
569 3300009553 Ga0105249_10783638 Ga0105249_107836382 161
570 3300009982 Ga0105147_101535 Ga0105147_1015352 161
571 3300010375 Ga0105239_10001034 Ga0105239_100010349 161
572 3300010375 Ga0105239_10018012 Ga0105239_100180123 161
573 3300010375 Ga0105239_10025853 Ga0105239_100258537 161
574 3300010375 Ga0105239_10049118 Ga0105239_100491183 161
575 3300010375 Ga0105239_10067307 Ga0105239_100673073 161
576 3300010375 Ga0105239_10100383 Ga0105239_101003832 161
577 3300010375 Ga0105239_10102205 Ga0105239_101022053 161
578 3300010375 Ga0105239_10447237 Ga0105239_104472372 161
579 3300010375 Ga0105239_10929211 Ga0105239_109292112 161
580 3300010375 Ga0105239_11156120 Ga0105239_111561201 161
581 3300011119 Ga0105246_10429731 Ga0105246_104297312 161
582 3300013100 Ga0157373_10007367 Ga0157373_100073672 161
583 3300013100 Ga0157373_10036630 Ga0157373_100366303 161
584 3300013100 Ga0157373_10087952 Ga0157373_100879521 161
585 3300013100 Ga0157373_10130559 Ga0157373_101305592 161
586 3300013100 Ga0157373_10223546 Ga0157373_102235462 161
587 3300013100 Ga0157373_10371976 Ga0157373_103719762 161
588 3300013100 Ga0157373_10421235 Ga0157373_104212352 161
589 3300013100 Ga0157373_10555294 Ga0157373_105552942 161
590 3300013102 Ga0157371_10033023 Ga0157371_100330232 161
591 3300013102 Ga0157371_10040232 Ga0157371_100402322 161
592 3300013102 Ga0157371_10088494 Ga0157371_100884942 161
593 3300013102 Ga0157371_10123182 Ga0157371_101231822 161
594 3300013102 Ga0157371_10351867 Ga0157371_103518672 161
595 3300013102 Ga0157371_10358785 Ga0157371_103587851 161
596 3300013104 Ga0157370_10001260 Ga0157370_1000126019 161
597 3300013104 Ga0157370_10011588 Ga0157370_100115885 161
598 3300013104 Ga0157370_10013170 Ga0157370_100131706 161
599 3300013104 Ga0157370_10015414 Ga0157370_100154143 161
600 3300013104 Ga0157370_10021902 Ga0157370_100219026 161
601 3300013104 Ga0157370_10030869 Ga0157370_100308693 161
602 3300013104 Ga0157370_10048618 Ga0157370_100486183 161
603 3300013104 Ga0157370_10059310 Ga0157370_100593103 161
604 3300013104 Ga0157370_10082343 Ga0157370_100823433 161
605 3300013104 Ga0157370_10271705 Ga0157370_102717052 161
606 3300013104 Ga0157370_10739140 Ga0157370_107391402 161
607 3300013105 Ga0157369_10000150 Ga0157369_1000015071 161
608 3300013105 Ga0157369_10002250 Ga0157369_100022508 161
609 3300013105 Ga0157369_10016215 Ga0157369_100162155 161
610 3300013105 Ga0157369_10051694 Ga0157369_100516944 161
611 3300013105 Ga0157369_10069251 Ga0157369_100692513 161
612 3300013105 Ga0157369_10571461 Ga0157369_105714612 161
613 3300013105 Ga0157369_11061263 Ga0157369_110612631 161
614 3300013296 Ga0157374_10213847 Ga0157374_102138472 161
615 3300013296 Ga0157374_10244900 Ga0157374_102449002 161
616 3300013296 Ga0157374_10304807 Ga0157374_103048071 161
617 3300013296 Ga0157374_10476625 Ga0157374_104766252 161
618 3300013296 Ga0157374_10811891 Ga0157374_108118912 161
619 3300013297 Ga0157378_10000536 Ga0157378_1000053616 161
620 3300013297 Ga0157378_10129559 Ga0157378_101295592 161
621 3300013306 Ga0163162_10000004 Ga0163162_10000004310 161
622 3300013306 Ga0163162_10000249 Ga0163162_1000024947 161
623 3300013306 Ga0163162_10010787 Ga0163162_100107876 161
624 3300013306 Ga0163162_10102624 Ga0163162_101026242 161
625 3300013306 Ga0163162_10177760 Ga0163162_101777602 161
626 3300013306 Ga0163162_10321229 Ga0163162_103212291 161
627 3300013307 Ga0157372_10000344 Ga0157372_1000034427 161
628 3300013307 Ga0157372_10007598 Ga0157372_100075984 161
629 3300013307 Ga0157372_10012237 Ga0157372_100122376 161
630 3300013307 Ga0157372_10041942 Ga0157372_100419422 161
631 3300013307 Ga0157372_10066621 Ga0157372_100666213 161
632 3300013307 Ga0157372_10113894 Ga0157372_101138943 161
633 3300013307 Ga0157372_10140240 Ga0157372_101402402 161
634 3300013307 Ga0157372_10151260 Ga0157372_101512603 161
635 3300013307 Ga0157372_10203883 Ga0157372_102038832 161
636 3300013307 Ga0157372_10454629 Ga0157372_104546292 161
637 3300013307 Ga0157372_10470231 Ga0157372_104702312 161
638 3300013307 Ga0157372_10796966 Ga0157372_107969662 161
639 3300013308 Ga0157375_10003767 Ga0157375_100037678 161
640 3300013308 Ga0157375_10433626 Ga0157375_104336261 161
641 3300013308 Ga0157375_11576933 Ga0157375_115769332 161
642 3300014325 Ga0163163_10000029 Ga0163163_1000002950 161
643 3300014325 Ga0163163_10000564 Ga0163163_1000056419 161
644 3300014325 Ga0163163_10814013 Ga0163163_108140132 161
645 3300014497 Ga0182008_10006745 Ga0182008_100067455 161
646 3300014497 Ga0182008_10035533 Ga0182008_100355332 161
647 3300014497 Ga0182008_10073961 Ga0182008_100739612 161
648 3300014497 Ga0182008_10107155 Ga0182008_101071552 161
649 3300014497 Ga0182008_10124394 Ga0182008_101243942 161
650 3300014497 Ga0182008_10142811 Ga0182008_101428112 161
651 3300014968 Ga0157379_10001942 Ga0157379_100019429 161
652 3300014968 Ga0157379_10215862 Ga0157379_102158622 161
653 3300014968 Ga0157379_10227670 Ga0157379_102276702 161
654 3300014969 Ga0157376_10030990 Ga0157376_100309903 161
655 3300014969 Ga0157376_10039939 Ga0157376_100399393 161
656 3300014969 Ga0157376_10048157 Ga0157376_100481572 161
657 3300014969 Ga0157376_10479271 Ga0157376_104792712 161
658 3300014969 Ga0157376_10497523 Ga0157376_104975232 161
659 3300014969 Ga0157376_10789965 Ga0157376_107899652 161
660 3300015261 Ga0182006_1000426 Ga0182006_100042622 161
661 3300015261 Ga0182006_1003182 Ga0182006_10031822 161
662 3300015261 Ga0182006_1038826 Ga0182006_10388262 161
663 3300015261 Ga0182006_1079352 Ga0182006_10793522 161
664 3300015261 Ga0182006_1111314 Ga0182006_11113141 161
665 3300015262 Ga0182007_10009141 Ga0182007_100091413 161
666 3300015262 Ga0182007_10012611 Ga0182007_100126113 161
667 3300015262 Ga0182007_10020455 Ga0182007_100204552 161
668 3300015262 Ga0182007_10028447 Ga0182007_100284472 161
669 3300015262 Ga0182007_10028992 Ga0182007_100289922 161
670 3300015262 Ga0182007_10033419 Ga0182007_100334192 161
671 3300015265 Ga0182005_1000177 Ga0182005_100017739 161
672 3300015265 Ga0182005_1004444 Ga0182005_10044444 161
673 3300015265 Ga0182005_1006829 Ga0182005_10068292 161
674 3300015265 Ga0182005_1074140 Ga0182005_10741401 161
675 3300015685 Ga0183369_1003 Ga0183369_10035 161
676 3300017792 Ga0163161_10019113 Ga0163161_100191133 161
677 3300020070 Ga0206356_11420723 Ga0206356_114207234 161
678 3300020081 Ga0206354_10156960 Ga0206354_101569603 161
679 3300020082 Ga0206353_10041605 Ga0206353_100416054 161
680 3300020082 Ga0206353_10381236 Ga0206353_103812362 161
681 3300025226 Ga0209674_100557 Ga0209674_1005575 161
682 3300025226 Ga0209674_103546 Ga0209674_1035462 161
683 3300025229 Ga0209147_110057 Ga0209147_1100572 161
684 3300025231 Ga0207427_100344 Ga0207427_10034420 161
685 3300025231 Ga0207427_100349 Ga0207427_10034920 161
686 3300025231 Ga0207427_103226 Ga0207427_1032262 161
687 3300025233 Ga0209437_100083 Ga0209437_1000836 161
688 3300025233 Ga0209437_100162 Ga0209437_1001625 161
689 3300025233 Ga0209437_100886 Ga0209437_1008863 161
690 3300025233 Ga0209437_101614 Ga0209437_1016144 161
691 3300025242 Ga0209258_112756 Ga0209258_1127562 161
692 3300025246 Ga0209646_1002743 Ga0209646_10027432 161
693 3300025250 Ga0209026_1000237 Ga0209026_100023759 161
694 3300025250 Ga0209026_1000378 Ga0209026_100037826 161
695 3300025250 Ga0209026_1003831 Ga0209026_10038314 161
696 3300025254 Ga0209148_1000005 Ga0209148_10000051609 161
697 3300025256 Ga0209759_1004980 Ga0209759_10049804 161
698 3300025258 Ga0209129_1001531 Ga0209129_10015319 161
699 3300025261 Ga0209233_1000075 Ga0209233_1000075317 161
700 3300025261 Ga0209233_1000998 Ga0209233_10009983 161
701 3300025272 Ga0209455_1000151 Ga0209455_1000151121 161
702 3300025297 Ga0209758_1011818 Ga0209758_10118182 161
703 3300025299 Ga0209256_1004882 Ga0209256_10048822 161
704 3300025302 Ga0207426_1008951 Ga0207426_10089512 161
705 3300025303 Ga0209051_1008393 Ga0209051_10083933 161
706 3300025321 Ga0207656_10002462 Ga0207656_100024624 161
707 3300025321 Ga0207656_10016530 Ga0207656_100165303 161
708 3300025898 Ga0207692_10213894 Ga0207692_102138942 161
709 3300025903 Ga0207680_10000001 Ga0207680_10000001519 161
710 3300025903 Ga0207680_10000363 Ga0207680_1000036322 161
711 3300025903 Ga0207680_10073914 Ga0207680_100739142 161
712 3300025903 Ga0207680_10420349 Ga0207680_104203492 161
713 3300025904 Ga0207647_10000188 Ga0207647_1000018837 161
714 3300025904 Ga0207647_10000539 Ga0207647_100005393 161
715 3300025904 Ga0207647_10000865 Ga0207647_1000086515 161
716 3300025904 Ga0207647_10501867 Ga0207647_105018671 161
717 3300025906 Ga0207699_10071505 Ga0207699_100715052 161
718 3300025906 Ga0207699_10319977 Ga0207699_103199772 161
719 3300025906 Ga0207699_10593093 Ga0207699_105930931 161
720 3300025907 Ga0207645_10097761 Ga0207645_100977612 161
721 3300025909 Ga0207705_10000087 Ga0207705_1000008729 161
722 3300025909 Ga0207705_10000431 Ga0207705_1000043111 161
723 3300025909 Ga0207705_10000878 Ga0207705_1000087823 161
724 3300025909 Ga0207705_10001049 Ga0207705_1000104913 161
725 3300025911 Ga0207654_10016978 Ga0207654_100169785 161
726 3300025911 Ga0207654_10025859 Ga0207654_100258592 161
727 3300025911 Ga0207654_10190082 Ga0207654_101900822 161
728 3300025912 Ga0207707_10000187 Ga0207707_1000018742 161
729 3300025912 Ga0207707_10005585 Ga0207707_100055853 161
730 3300025912 Ga0207707_10023301 Ga0207707_100233014 161
731 3300025912 Ga0207707_10034593 Ga0207707_100345933 161
732 3300025912 Ga0207707_10069505 Ga0207707_100695053 161
733 3300025912 Ga0207707_10113441 Ga0207707_101134412 161
734 3300025912 Ga0207707_10134010 Ga0207707_101340102 161
735 3300025913 Ga0207695_10000772 Ga0207695_1000077218 161
736 3300025913 Ga0207695_10000997 Ga0207695_1000099714 161
737 3300025913 Ga0207695_10002269 Ga0207695_1000226927 161
738 3300025913 Ga0207695_10004149 Ga0207695_100041493 161
739 3300025913 Ga0207695_10011198 Ga0207695_100111989 161
740 3300025913 Ga0207695_10013808 Ga0207695_100138087 161
741 3300025913 Ga0207695_10155801 Ga0207695_101558012 161
742 3300025914 Ga0207671_10001266 Ga0207671_100012662 161
743 3300025914 Ga0207671_10002602 Ga0207671_1000260212 161
744 3300025914 Ga0207671_10004204 Ga0207671_100042047 161
745 3300025914 Ga0207671_10005617 Ga0207671_1000561710 161
746 3300025914 Ga0207671_10466811 Ga0207671_104668112 161
747 3300025915 Ga0207693_10352213 Ga0207693_103522132 161
748 3300025917 Ga0207660_10003202 Ga0207660_100032027 161
749 3300025917 Ga0207660_10111066 Ga0207660_101110662 161
750 3300025917 Ga0207660_10238643 Ga0207660_102386432 161
751 3300025917 Ga0207660_10630362 Ga0207660_106303622 161
752 3300025919 Ga0207657_10042257 Ga0207657_100422573 161
753 3300025919 Ga0207657_10072996 Ga0207657_100729962 161
754 3300025919 Ga0207657_10085526 Ga0207657_100855262 161
755 3300025919 Ga0207657_10122899 Ga0207657_101228992 161
756 3300025919 Ga0207657_10140744 Ga0207657_101407443 161
757 3300025919 Ga0207657_10251452 Ga0207657_102514522 161
758 3300025920 Ga0207649_10000196 Ga0207649_1000019622 161
759 3300025920 Ga0207649_10002654 Ga0207649_100026542 161
760 3300025920 Ga0207649_10012076 Ga0207649_100120762 161
761 3300025920 Ga0207649_10017757 Ga0207649_100177572 161
762 3300025920 Ga0207649_10109972 Ga0207649_101099722 161
763 3300025921 Ga0207652_10000072 Ga0207652_1000007253 161
764 3300025921 Ga0207652_10001180 Ga0207652_1000118014 161
765 3300025921 Ga0207652_10352353 Ga0207652_103523531 161
766 3300025921 Ga0207652_10394589 Ga0207652_103945892 161
767 3300025923 Ga0207681_10062990 Ga0207681_100629902 161
768 3300025924 Ga0207694_10000257 Ga0207694_1000025744 161
769 3300025924 Ga0207694_10020918 Ga0207694_100209182 161
770 3300025924 Ga0207694_10037919 Ga0207694_100379192 161
771 3300025924 Ga0207694_10052481 Ga0207694_100524812 161
772 3300025924 Ga0207694_10096692 Ga0207694_100966922 161
773 3300025924 Ga0207694_10178123 Ga0207694_101781232 161
774 3300025924 Ga0207694_10211407 Ga0207694_102114072 161
775 3300025925 Ga0207650_10053945 Ga0207650_100539453 161
776 3300025925 Ga0207650_10104877 Ga0207650_101048772 161
777 3300025926 Ga0207659_10294142 Ga0207659_102941422 161
778 3300025927 Ga0207687_10194660 Ga0207687_101946602 161
779 3300025927 Ga0207687_10452059 Ga0207687_104520592 161
780 3300025928 Ga0207700_10039573 Ga0207700_100395733 161
781 3300025929 Ga0207664_10000041 Ga0207664_100000416 161
782 3300025929 Ga0207664_10001637 Ga0207664_100016379 161
783 3300025929 Ga0207664_10030205 Ga0207664_100302054 161
784 3300025931 Ga0207644_11055842 Ga0207644_110558421 161
785 3300025932 Ga0207690_10000290 Ga0207690_1000029031 161
786 3300025932 Ga0207690_10005157 Ga0207690_100051572 161
787 3300025932 Ga0207690_10028114 Ga0207690_100281143 161
788 3300025932 Ga0207690_10030324 Ga0207690_100303243 161
789 3300025932 Ga0207690_10051472 Ga0207690_100514722 161
790 3300025932 Ga0207690_10080648 Ga0207690_100806481 161
791 3300025932 Ga0207690_10145215 Ga0207690_101452153 161
792 3300025932 Ga0207690_10443068 Ga0207690_104430682 161
793 3300025933 Ga0207706_10037100 Ga0207706_100371003 161
794 3300025933 Ga0207706_10067488 Ga0207706_100674882 161
795 3300025933 Ga0207706_10150484 Ga0207706_101504843 161
796 3300025933 Ga0207706_10201677 Ga0207706_102016772 161
797 3300025934 Ga0207686_10349816 Ga0207686_103498162 161
798 3300025938 Ga0207704_10003344 Ga0207704_100033443 161
799 3300025938 Ga0207704_10294979 Ga0207704_102949792 161
800 3300025938 Ga0207704_10306275 Ga0207704_103062752 161
801 3300025940 Ga0207691_10014561 Ga0207691_100145615 161
802 3300025940 Ga0207691_10140519 Ga0207691_101405192 161
803 3300025941 Ga0207711_10003012 Ga0207711_100030129 161
804 3300025941 Ga0207711_10075066 Ga0207711_100750662 161
805 3300025941 Ga0207711_10621941 Ga0207711_106219411 161
806 3300025941 Ga0207711_11169249 Ga0207711_111692492 161
807 3300025942 Ga0207689_10010382 Ga0207689_100103822 161
808 3300025944 Ga0207661_10079079 Ga0207661_100790792 161
809 3300025944 Ga0207661_10150526 Ga0207661_101505262 161
810 3300025945 Ga0207679_10112052 Ga0207679_101120522 161
811 3300025949 Ga0207667_10001223 Ga0207667_100012232 161
812 3300025949 Ga0207667_10001894 Ga0207667_100018944 161
813 3300025949 Ga0207667_10017136 Ga0207667_100171362 161
814 3300025949 Ga0207667_10026371 Ga0207667_100263712 161
815 3300025949 Ga0207667_10026475 Ga0207667_100264755 161
816 3300025949 Ga0207667_10089965 Ga0207667_100899652 161
817 3300025949 Ga0207667_10125057 Ga0207667_101250573 161
818 3300025960 Ga0207651_10052952 Ga0207651_100529523 161
819 3300025960 Ga0207651_10216987 Ga0207651_102169872 161
820 3300025960 Ga0207651_10283172 Ga0207651_102831721 161
821 3300025961 Ga0207712_10000305 Ga0207712_1000030523 161
822 3300025961 Ga0207712_10290942 Ga0207712_102909422 161
823 3300025972 Ga0207668_10053313 Ga0207668_100533132 161
824 3300025972 Ga0207668_10134580 Ga0207668_101345802 161
825 3300025972 Ga0207668_10186082 Ga0207668_101860822 161
826 3300025972 Ga0207668_11082086 Ga0207668_110820862 161
827 3300025981 Ga0207640_10003988 Ga0207640_100039884 161
828 3300025981 Ga0207640_10015557 Ga0207640_100155573 161
829 3300025981 Ga0207640_10644476 Ga0207640_106444761 161
830 3300025981 Ga0207640_10875811 Ga0207640_108758112 161
831 3300025981 Ga0207640_11384459 Ga0207640_113844591 161
832 3300025986 Ga0207658_10000033 Ga0207658_10000033128 161
833 3300025986 Ga0207658_10015018 Ga0207658_100150182 161
834 3300025986 Ga0207658_10127879 Ga0207658_101278793 161
835 3300025986 Ga0207658_10465399 Ga0207658_104653992 161
836 3300025986 Ga0207658_10639096 Ga0207658_106390961 161
837 3300025986 Ga0207658_10697093 Ga0207658_106970932 161
838 3300026023 Ga0207677_10048990 Ga0207677_100489902 161
839 3300026023 Ga0207677_10776400 Ga0207677_107764002 161
840 3300026023 Ga0207677_11271663 Ga0207677_112716631 161
841 3300026035 Ga0207703_11255140 Ga0207703_112551401 161
842 3300026041 Ga0207639_10000342 Ga0207639_1000034227 161
843 3300026041 Ga0207639_10000485 Ga0207639_1000048527 161
844 3300026041 Ga0207639_10000514 Ga0207639_100005144 161
845 3300026041 Ga0207639_10004200 Ga0207639_1000420010 161
846 3300026041 Ga0207639_10014601 Ga0207639_100146014 161
847 3300026041 Ga0207639_10021093 Ga0207639_100210934 161
848 3300026041 Ga0207639_10028137 Ga0207639_100281372 161
849 3300026041 Ga0207639_10058113 Ga0207639_100581133 161
850 3300026041 Ga0207639_10098070 Ga0207639_100980702 161
851 3300026041 Ga0207639_10422900 Ga0207639_104229002 161
852 3300026041 Ga0207639_10452373 Ga0207639_104523732 161
853 3300026041 Ga0207639_10564505 Ga0207639_105645052 161
854 3300026041 Ga0207639_11039218 Ga0207639_110392181 161
855 3300026041 Ga0207639_11213293 Ga0207639_112132932 161
856 3300026067 Ga0207678_10002720 Ga0207678_100027203 161
857 3300026067 Ga0207678_10007806 Ga0207678_100078068 161
858 3300026067 Ga0207678_10023199 Ga0207678_100231993 161
859 3300026067 Ga0207678_10033131 Ga0207678_100331312 161
860 3300026067 Ga0207678_10246850 Ga0207678_102468502 161
861 3300026078 Ga0207702_10000222 Ga0207702_1000022257 161
862 3300026078 Ga0207702_10026036 Ga0207702_100260362 161
863 3300026078 Ga0207702_10027421 Ga0207702_100274214 161
864 3300026078 Ga0207702_10201886 Ga0207702_102018862 161
865 3300026078 Ga0207702_10897257 Ga0207702_108972571 161
866 3300026088 Ga0207641_10038920 Ga0207641_100389202 161
867 3300026088 Ga0207641_10042503 Ga0207641_100425035 161
868 3300026088 Ga0207641_10234912 Ga0207641_102349122 161
869 3300026088 Ga0207641_10265773 Ga0207641_102657731 161
870 3300026088 Ga0207641_11065226 Ga0207641_110652262 161
871 3300026088 Ga0207641_11250407 Ga0207641_112504071 161
872 3300026089 Ga0207648_10008256 Ga0207648_100082565 161
873 3300026089 Ga0207648_10133915 Ga0207648_101339152 161
874 3300026095 Ga0207676_10022947 Ga0207676_100229472 161
875 3300026116 Ga0207674_10016311 Ga0207674_100163116 161
876 3300026116 Ga0207674_10039904 Ga0207674_100399043 161
877 3300026116 Ga0207674_10041887 Ga0207674_100418873 161
878 3300026116 Ga0207674_10262258 Ga0207674_102622582 161
879 3300026116 Ga0207674_10480166 Ga0207674_104801662 161
880 3300026118 Ga0207675_101068880 Ga0207675_1010688802 161
881 3300026121 Ga0207683_10031349 Ga0207683_100313492 161
882 3300026121 Ga0207683_10059367 Ga0207683_100593672 161
883 3300026121 Ga0207683_10231561 Ga0207683_102315612 161
884 3300026121 Ga0207683_10290609 Ga0207683_102906092 161
885 3300026142 Ga0207698_10000056 Ga0207698_1000005660 161
886 3300026142 Ga0207698_10003052 Ga0207698_100030522 161
887 3300026142 Ga0207698_10032130 Ga0207698_100321303 161
888 3300026142 Ga0207698_10407428 Ga0207698_104074281 161
889 3300026142 Ga0207698_10663755 Ga0207698_106637552 161
890 3300026142 Ga0207698_10761281 Ga0207698_107612812 161
891 3300026142 Ga0207698_10892202 Ga0207698_108922022 161
892 3300028379 Ga0268266_10000017 Ga0268266_10000017323 161
893 3300028379 Ga0268266_10000091 Ga0268266_1000009154 161
894 3300028379 Ga0268266_10080769 Ga0268266_100807692 161
895 3300028379 Ga0268266_10340880 Ga0268266_103408801 161
896 3300028381 Ga0268264_10002870 Ga0268264_100028702 161
897 3300028381 Ga0268264_10054202 Ga0268264_100542023 161
898 3300028381 Ga0268264_10172920 Ga0268264_101729202 161
899 3300028381 Ga0268264_11228589 Ga0268264_112285892 161
900 3300031238 Ga0265332_10078359 Ga0265332_100783592 161
901 3300031507 Ga0307509_10049147 Ga0307509_100491472 161
902 3300031548 Ga0307408_100303059 Ga0307408_1003030592 161
903 3300031616 Ga0307508_10080598 Ga0307508_100805982 161
904 3300031665 Ga0316575_10011435 Ga0316575_100114353 161
905 3300031665 Ga0316575_10015148 Ga0316575_100151483 161
906 3300031730 Ga0307516_10113414 Ga0307516_101134143 161
907 3300031824 Ga0307413_10049543 Ga0307413_100495432 161
908 3300031824 Ga0307413_11043420 Ga0307413_110434202 161
909 3300031911 Ga0307412_10002394 Ga0307412_100023949 161
910 3300031995 Ga0307409_102083119 Ga0307409_1020831191 161
911 3300032002 Ga0307416_100283040 Ga0307416_1002830401 161
912 3300032004 Ga0307414_10660392 Ga0307414_106603922 161
913 3300033180 Ga0307510_10001702 Ga0307510_1000170221 161
914 3300033180 Ga0307510_10052665 Ga0307510_100526651 161
915 3300035118 Ga0373954_0299205 Ga0373954_0299205_199_690 161
916 3300035724 Ga0373933_0527165 Ga0373933_0527165_213_704 161
917 3300035725 Ga0373947_0614860 Ga0373947_0614860_152_643 161
918 3300036401 Ga0373937_0106546 Ga0373937_0106546_1259_1750 161
919 3300037312 Ga0395899_0009369 Ga0395899_0009369_2451_2939 161
920 3300037312 Ga0395899_0022010 Ga0395899_0022010_3292_3801 161
921 3300037312 Ga0395899_0070055 Ga0395899_0070055_1707_2192 161
922 3300037312 Ga0395899_0547604 Ga0395899_0547604_87_572 161
923 3300037418 Ga0395900_0000163 Ga0395900_0000163_28452_28943 161
924 3300037418 Ga0395900_0000446 Ga0395900_0000446_4521_5006 161
925 3300037418 Ga0395900_0001441 Ga0395900_0001441_8030_8521 161
926 3300037418 Ga0395900_0008165 Ga0395900_0008165_2001_2510 161
927 3300037418 Ga0395900_0008717 Ga0395900_0008717_5318_5827 161
928 3300037466 Ga0395898_0026897 Ga0395898_0026897_494_1003 161
929 3300037466 Ga0395898_0035138 Ga0395898_0035138_3365_3874 161
930 3300037466 Ga0395898_0118612 Ga0395898_0118612_412_903 161
931 3300037466 Ga0395898_0809437 Ga0395898_0809437_21_512 161
932 3300038443 Ga0395901_0001974 Ga0395901_0001974_19586_20071 161
933 3300038443 Ga0395901_0017711 Ga0395901_0017711_4087_4596 161
934 3300038443 Ga0395901_0158486 Ga0395901_0158486_76_561 161
935 3300038443 Ga0395901_0184188 Ga0395901_0184188_995_1480 161
936 3300038443 Ga0395901_1050236 Ga0395901_1050236_185_670 161
937 3300039437 Ga0436365_0724831 Ga0436365_0724831_226_717 161
938 3300039437 Ga0436365_1735123 Ga0436365_1735123_1383_1874 161
939 3300041404 Ga0439436_0000009 Ga0439436_0000009_192_683 161
940 3300041413 Ga0439465_0004842 Ga0439465_0004842_1955_2446 161
941 3300042006 Ga0439432_039086 Ga0439432_039086_1000_1485 161
942 3300042011 Ga0439454_066687 Ga0439454_066687_85_576 161
943 3300042184 Ga0450908_000062 Ga0450908_000062_1483_1974 161
944 3300042438 Ga0439459_0000740 Ga0439459_0000740_3608_4093 161
945 3300044672 Ga0466982_0019436 Ga0466982_0019436_142_633 161
946 3300044712 Ga0453684_0001955 Ga0453684_0001955_3856_4344 161
947 3300044735 Ga0466968_0001442 Ga0466968_0001442_186_677 161
948 3300044842 Ga0466957_0093360 Ga0466957_0093360_75_566 161
949 3300045051 Ga0451576_0000042 Ga0451576_0000042_3856_4344 161
950 3300045976 Ga0466967_1353482 Ga0466967_1353482_187_678 161
951 3300046452 Ga0495617_000131 Ga0495617_000131_1533_2024 161
952 3300046452 Ga0495617_000523 Ga0495617_000523_10894_11385 161
953 3300046457 Ga0495590_0051860 Ga0495590_0051860_544_1035 161
954 3300046460 Ga0495638_0000180 Ga0495638_0000180_94952_95443 161
955 3300046460 Ga0495638_0000865 Ga0495638_0000865_9050_9535 161
956 3300046471 Ga0495650_0000469 Ga0495650_0000469_34646_35137 161
957 3300046471 Ga0495650_0006669 Ga0495650_0006669_4182_4673 161
958 3300046472 Ga0495580_0090581 Ga0495580_0090581_1351_1842 161
959 3300046477 Ga0495664_0082530 Ga0495664_0082530_784_1275 161
960 3300046491 Ga0495584_0035273 Ga0495584_0035273_377_868 161
961 3300046492 Ga0495585_0000437 Ga0495585_0000437_8822_9313 161
962 3300046492 Ga0495585_0050081 Ga0495585_0050081_1216_1707 161
963 3300046501 Ga0495607_0000654 Ga0495607_0000654_24149_24640 161
964 3300046501 Ga0495607_0001295 Ga0495607_0001295_9779_10270 161
965 3300046501 Ga0495607_0025557 Ga0495607_0025557_1217_1708 161
966 3300046506 Ga0495583_0034392 Ga0495583_0034392_414_905 161
967 3300046507 Ga0495606_0000918 Ga0495606_0000918_890_1381 161
968 3300046507 Ga0495606_0000948 Ga0495606_0000948_890_1381 161
969 3300046507 Ga0495606_0008648 Ga0495606_0008648_7189_7680 161
970 3300046507 Ga0495606_0066365 Ga0495606_0066365_1038_1529 161
971 3300046507 Ga0495606_0194774 Ga0495606_0194774_543_1034 161
972 3300046512 Ga0495610_0002419 Ga0495610_0002419_14104_14595 161
973 3300046512 Ga0495610_0013864 Ga0495610_0013864_2569_3060 161
974 3300046513 Ga0495616_0000190 Ga0495616_0000190_41875_42366 161
975 3300046513 Ga0495616_0006537 Ga0495616_0006537_2080_2571 161
976 3300046515 Ga0495620_0000565 Ga0495620_0000565_21469_21960 161
977 3300046518 Ga0495631_0000994 Ga0495631_0000994_7979_8470 161
978 3300046518 Ga0495631_0002241 Ga0495631_0002241_7331_7822 161
979 3300046518 Ga0495631_0190055 Ga0495631_0190055_376_867 161
980 3300046519 Ga0495632_0000135 Ga0495632_0000135_3380_3871 161
981 3300046519 Ga0495632_0014817 Ga0495632_0014817_1758_2249 161
982 3300046519 Ga0495632_0020690 Ga0495632_0020690_2380_2871 161
983 3300046520 Ga0495637_0003288 Ga0495637_0003288_3579_4070 161
984 3300046524 Ga0495648_0001900 Ga0495648_0001900_8763_9254 161
985 3300046524 Ga0495648_0006502 Ga0495648_0006502_1716_2207 161
986 3300046536 Ga0495587_0159299 Ga0495587_0159299_62_553 161
987 3300046538 Ga0495609_0004002 Ga0495609_0004002_4491_4982 161
988 3300046616 Ga0495668_0006704 Ga0495668_0006704_315_806 161
989 3300046648 Ga0495611_0000004 Ga0495611_0000004_8907_9398 161
990 3300046648 Ga0495611_0001192 Ga0495611_0001192_1296_1787 161
991 3300046660 Ga0495625_0000617 Ga0495625_0000617_8864_9355 161
992 3300046660 Ga0495625_0051539 Ga0495625_0051539_1023_1514 161
993 3300046660 Ga0495625_0056776 Ga0495625_0056776_1217_1708 161
994 3300046665 Ga0495661_0001320 Ga0495661_0001320_8972_9463 161
995 3300046674 Ga0495588_0182954 Ga0495588_0182954_104_589 161
996 3300046681 Ga0495647_0046958 Ga0495647_0046958_946_1437 161
997 3300046691 Ga0495670_0001876 Ga0495670_0001876_7625_8116 161
998 3300046691 Ga0495670_0056556 Ga0495670_0056556_1232_1723 161
999 3300046692 Ga0495671_0001801 Ga0495671_0001801_4683_5174 161
1000 3300046694 Ga0495649_0121944 Ga0495649_0121944_365_856 161
1001 3300046694 Ga0495649_0137857 Ga0495649_0137857_263_754 161
1002 3300046794 Ga0495589_0000555 Ga0495589_0000555_16512_17003 161
1003 3300046809 Ga0495600_0354445 Ga0495600_0354445_256_747 161
1004 3300046810 Ga0495660_0002959 Ga0495660_0002959_1115_1606 161
1005 3300046810 Ga0495660_0068347 Ga0495660_0068347_285_776 161
1006 3300047315 Ga0495581_0119570 Ga0495581_0119570_97_588 161
1007 3300047317 Ga0495604_0634844 Ga0495604_0634844_79_570 161
1008 3300047323 Ga0495683_0001003 Ga0495683_0001003_8757_9248 161
1009 3300047446 Ga0495679_000011 Ga0495679_000011_315020_315511 161
1010 3300047446 Ga0495679_113932 Ga0495679_113932_224_715 161
1011 3300047469 Ga0495673_0000036 Ga0495673_0000036_8978_9469 161
1012 3300047469 Ga0495673_0003506 Ga0495673_0003506_1421_1912 161
1013 3300047471 Ga0495684_0106898 Ga0495684_0106898_96_587 161
1014 3300047472 Ga0495686_0000126 Ga0495686_0000126_148138_148629 161
1015 3300047472 Ga0495686_0004945 Ga0495686_0004945_1064_1555 161
1016 3300047472 Ga0495686_0007659 Ga0495686_0007659_82_576 161
1017 3300047472 Ga0495686_0020609 Ga0495686_0020609_2176_2667 161
1018 3300047472 Ga0495686_0169704 Ga0495686_0169704_84_575 161
1019 3300048903 Ga0496100_0028588 Ga0496100_0028588_1471_1962 161
1020 3300048904 Ga0496101_0023789 Ga0496101_0023789_3039_3530 161
1021 3300048904 Ga0496101_0355024 Ga0496101_0355024_16_507 161
1022 3300048905 Ga0496102_0254604 Ga0496102_0254604_902_1393 161
1023 3300048905 Ga0496102_0876679 Ga0496102_0876679_160_651 161
1024 3300048905 Ga0496102_1589897 Ga0496102_1589897_38_541 161
1025 3300048906 Ga0496103_0138088 Ga0496103_0138088_475_966 161
1026 3300048907 Ga0496104_0000005 Ga0496104_0000005_31297_31788 161
1027 3300048907 Ga0496104_0318730 Ga0496104_0318730_779_1270 161
1028 3300048908 Ga0496105_0000259 Ga0496105_0000259_4246_4737 161
1029 3300048908 Ga0496105_0002564 Ga0496105_0002564_1480_1971 161
1030 3300048909 Ga0496106_0011791 Ga0496106_0011791_5509_6000 161
1031 3300048909 Ga0496106_0040971 Ga0496106_0040971_2847_3338 161
1032 3300048910 Ga0496107_0498535 Ga0496107_0498535_192_683 161
1033 3300048910 Ga0496107_0960783 Ga0496107_0960783_92_583 161
1034 3300048918 Ga0496115_0000077 Ga0496115_0000077_64544_65035 161
1035 3300048918 Ga0496115_0023652 Ga0496115_0023652_1899_2390 161
1036 3300048918 Ga0496115_0630284 Ga0496115_0630284_44_535 161
1037 3300048919 Ga0496116_0039663 Ga0496116_0039663_2201_2692 161
1038 3300048919 Ga0496116_0072468 Ga0496116_0072468_484_975 161
1039 3300048920 Ga0496117_0009281 Ga0496117_0009281_5187_5678 161
1040 3300048920 Ga0496117_0010777 Ga0496117_0010777_4963_5454 161
1041 3300048920 Ga0496117_0015592 Ga0496117_0015592_4874_5365 161
1042 3300048920 Ga0496117_0015663 Ga0496117_0015663_116_607 161
1043 3300048920 Ga0496117_0056200 Ga0496117_0056200_1744_2235 161
1044 3300048921 Ga0496118_0004467 Ga0496118_0004467_3458_3949 161
1045 3300048921 Ga0496118_0006061 Ga0496118_0006061_1585_2076 161
1046 3300048921 Ga0496118_0007470 Ga0496118_0007470_5000_5491 161
1047 3300048921 Ga0496118_0008841 Ga0496118_0008841_2924_3415 161
1048 3300048921 Ga0496118_0013000 Ga0496118_0013000_1895_2386 161
1049 3300048921 Ga0496118_0281771 Ga0496118_0281771_67_561 161
1050 3300048922 Ga0496119_0000218 Ga0496119_0000218_11233_11724 161
1051 3300048922 Ga0496119_0005096 Ga0496119_0005096_9977_10468 161
1052 3300048922 Ga0496119_0026906 Ga0496119_0026906_1096_1587 161
1053 3300048923 Ga0496120_0001849 Ga0496120_0001849_11993_12484 161
1054 3300048923 Ga0496120_0002027 Ga0496120_0002027_4903_5394 161
1055 3300048923 Ga0496120_0237604 Ga0496120_0237604_347_841 161
1056 3300048924 Ga0496121_0001803 Ga0496121_0001803_33215_33706 161
1057 3300048924 Ga0496121_0003410 Ga0496121_0003410_12510_13001 161
1058 3300048924 Ga0496121_0005180 Ga0496121_0005180_10885_11376 161
1059 3300048924 Ga0496121_0010228 Ga0496121_0010228_2131_2622 161
1060 3300048924 Ga0496121_0028882 Ga0496121_0028882_2580_3071 161
1061 3300048924 Ga0496121_0053649 Ga0496121_0053649_1438_1932 161
1062 3300048924 Ga0496121_0065341 Ga0496121_0065341_1580_2071 161
1063 3300048924 Ga0496121_0084684 Ga0496121_0084684_1625_2116 161
1064 3300048925 Ga0496122_0001517 Ga0496122_0001517_15507_16001 161
1065 3300048925 Ga0496122_0024944 Ga0496122_0024944_3436_3927 161
1066 3300048926 Ga0496123_0000323 Ga0496123_0000323_25305_25799 161
1067 3300048926 Ga0496123_0019122 Ga0496123_0019122_2636_3127 161
1068 3300048926 Ga0496123_0025582 Ga0496123_0025582_1467_1958 161
1069 3300048926 Ga0496123_0173819 Ga0496123_0173819_163_654 161
1070 3300048926 Ga0496123_0181841 Ga0496123_0181841_442_933 161
1071 3300048927 Ga0496124_0000241 Ga0496124_0000241_10029_10520 161
1072 3300048927 Ga0496124_0387469 Ga0496124_0387469_472_963 161
1073 3300048928 Ga0496125_0016927 Ga0496125_0016927_994_1485 161
1074 3300048928 Ga0496125_0038637 Ga0496125_0038637_3483_3974 161
1075 3300048929 Ga0496126_0000047 Ga0496126_0000047_229547_230038 161
1076 3300048929 Ga0496126_0003595 Ga0496126_0003595_3567_4058 161
1077 3300048929 Ga0496126_0010801 Ga0496126_0010801_7331_7822 161
1078 3300048929 Ga0496126_0040651 Ga0496126_0040651_1473_1964 161
1079 3300048929 Ga0496126_0041653 Ga0496126_0041653_3435_3926 161
1080 3300048929 Ga0496126_0087947 Ga0496126_0087947_324_818 161
1081 3300048929 Ga0496126_0330138 Ga0496126_0330138_16_507 161
1082 3300049459 Ga0495678_002032 Ga0495678_002032_9531_10022 161
1083 3300049460 Ga0495682_0004016 Ga0495682_0004016_4872_5363 161
1084 3300049568 Ga0501031_0089410 Ga0501031_0089410_1443_1928 161
1085 3300049568 Ga0501031_0241523 Ga0501031_0241523_45_530 161
1086 3300049569 Ga0501032_0014192 Ga0501032_0014192_1541_2026 161
1087 3300049569 Ga0501032_0038655 Ga0501032_0038655_902_1393 161
1088 3300049569 Ga0501032_0054246 Ga0501032_0054246_1356_1847 161
1089 3300049570 Ga0501033_0001723 Ga0501033_0001723_17430_17921 161
1090 3300049570 Ga0501033_0007330 Ga0501033_0007330_5252_5737 161
1091 3300049570 Ga0501033_0055857 Ga0501033_0055857_896_1387 161
1092 3300049570 Ga0501033_0321195 Ga0501033_0321195_412_897 161
1093 3300049571 Ga0501034_0002782 Ga0501034_0002782_19126_19617 161
1094 3300049571 Ga0501034_0023477 Ga0501034_0023477_2292_2783 161
1095 3300049571 Ga0501034_0037473 Ga0501034_0037473_3015_3500 161
1096 3300049571 Ga0501034_0037895 Ga0501034_0037895_1513_1998 161
1097 3300049571 Ga0501034_0057242 Ga0501034_0057242_1093_1584 161
1098 3300049571 Ga0501034_0098249 Ga0501034_0098249_902_1393 161
1099 3300049571 Ga0501034_0745808 Ga0501034_0745808_220_705 161
1100 3300049572 Ga0501036_0035936 Ga0501036_0035936_1591_2082 161
1101 3300049572 Ga0501036_0123824 Ga0501036_0123824_828_1319 161
1102 3300049572 Ga0501036_0149713 Ga0501036_0149713_1381_1872 161
1103 3300049573 Ga0501037_0002066 Ga0501037_0002066_12713_13198 161
1104 3300049573 Ga0501037_0020372 Ga0501037_0020372_740_1225 161
1105 3300049573 Ga0501037_0040858 Ga0501037_0040858_2026_2517 161
1106 3300049573 Ga0501037_0043950 Ga0501037_0043950_2190_2681 161
1107 3300049573 Ga0501037_0110796 Ga0501037_0110796_721_1212 161
1108 3300049573 Ga0501037_0116910 Ga0501037_0116910_895_1380 161
1109 3300049573 Ga0501037_0274710 Ga0501037_0274710_16_507 161
1110 3300049574 Ga0501038_0008882 Ga0501038_0008882_2443_2934 161
1111 3300049574 Ga0501038_0082843 Ga0501038_0082843_894_1379 161
1112 3300049574 Ga0501038_0109536 Ga0501038_0109536_1289_1780 161
1113 3300049574 Ga0501038_0123355 Ga0501038_0123355_1433_1924 161
1114 3300049574 Ga0501038_0156164 Ga0501038_0156164_850_1335 161
1115 3300049574 Ga0501038_0963965 Ga0501038_0963965_110_601 161
1116 3300049575 Ga0501039_0086103 Ga0501039_0086103_802_1287 161
1117 3300049575 Ga0501039_0288731 Ga0501039_0288731_86_577 161
1118 3300049576 Ga0501040_0045989 Ga0501040_0045989_840_1331 161
1119 3300049578 Ga0501042_0044006 Ga0501042_0044006_1252_1743 161
1120 3300049579 Ga0501043_0026645 Ga0501043_0026645_2611_3102 161
1121 3300049579 Ga0501043_0032150 Ga0501043_0032150_1319_1804 161
1122 3300049579 Ga0501043_0036993 Ga0501043_0036993_2396_2887 161
1123 3300049579 Ga0501043_0077665 Ga0501043_0077665_964_1449 161
1124 3300049579 Ga0501043_0106751 Ga0501043_0106751_1134_1625 161
1125 3300049579 Ga0501043_0135042 Ga0501043_0135042_218_703 161
1126 3300049579 Ga0501043_0214035 Ga0501043_0214035_895_1380 161
1127 3300049579 Ga0501043_0243510 Ga0501043_0243510_456_947 161
1128 3300049579 Ga0501043_0275942 Ga0501043_0275942_713_1204 161
1129 3300049580 Ga0501046_0029538 Ga0501046_0029538_2778_3263 161
1130 3300049580 Ga0501046_0056809 Ga0501046_0056809_2143_2634 161
1131 3300049580 Ga0501046_0225064 Ga0501046_0225064_253_738 161
1132 3300049580 Ga0501046_0285391 Ga0501046_0285391_386_877 161
1133 3300049581 Ga0501047_0003794 Ga0501047_0003794_13534_14025 161
1134 3300049581 Ga0501047_0012936 Ga0501047_0012936_857_1348 161
1135 3300049581 Ga0501047_0020529 Ga0501047_0020529_4385_4870 161
1136 3300049581 Ga0501047_0036519 Ga0501047_0036519_1741_2232 161
1137 3300049581 Ga0501047_0037310 Ga0501047_0037310_2422_2913 161
1138 3300049581 Ga0501047_0067397 Ga0501047_0067397_2004_2489 161
1139 3300049581 Ga0501047_0087069 Ga0501047_0087069_1288_1773 161
1140 3300049581 Ga0501047_0255771 Ga0501047_0255771_257_742 161
1141 3300049581 Ga0501047_0336363 Ga0501047_0336363_321_806 161
1142 3300049581 Ga0501047_0416293 Ga0501047_0416293_391_876 161
1143 3300049581 Ga0501047_0499183 Ga0501047_0499183_467_958 161
1144 3300049581 Ga0501047_0525047 Ga0501047_0525047_397_888 161
1145 3300049581 Ga0501047_0586196 Ga0501047_0586196_203_694 161
1146 3300049582 Ga0501048_0011381 Ga0501048_0011381_4438_4923 161
1147 3300049582 Ga0501048_0141283 Ga0501048_0141283_298_789 161
1148 3300049582 Ga0501048_0148392 Ga0501048_0148392_1062_1547 161
1149 3300049582 Ga0501048_0569837 Ga0501048_0569837_142_633 161
1150 3300049583 Ga0501067_0000857 Ga0501067_0000857_14522_15013 161
1151 3300049583 Ga0501067_0012199 Ga0501067_0012199_3312_3803 161
1152 3300049584 Ga0501068_0004617 Ga0501068_0004617_3092_3583 161
1153 3300049584 Ga0501068_0084501 Ga0501068_0084501_699_1190 161
1154 3300049584 Ga0501068_0112415 Ga0501068_0112415_70_561 161
1155 3300049585 Ga0501069_0004350 Ga0501069_0004350_1288_1779 161
1156 3300049585 Ga0501069_0063123 Ga0501069_0063123_731_1222 161
1157 3300049585 Ga0501069_0213033 Ga0501069_0213033_528_1019 161
1158 3300049586 Ga0501070_0007679 Ga0501070_0007679_7573_8091 161
1159 3300049586 Ga0501070_0016130 Ga0501070_0016130_5203_5694 161
1160 3300049586 Ga0501070_0028353 Ga0501070_0028353_1367_1852 161
1161 3300049586 Ga0501070_0034589 Ga0501070_0034589_1243_1734 161
1162 3300049586 Ga0501070_0043188 Ga0501070_0043188_2355_2846 161
1163 3300049586 Ga0501070_0122909 Ga0501070_0122909_220_711 161
1164 3300049586 Ga0501070_0127865 Ga0501070_0127865_896_1387 161
1165 3300049586 Ga0501070_0206426 Ga0501070_0206426_792_1283 161
1166 3300049587 Ga0501071_0043991 Ga0501071_0043991_365_856 161
1167 3300049587 Ga0501071_0071019 Ga0501071_0071019_812_1303 161
1168 3300049587 Ga0501071_1026681 Ga0501071_1026681_107_598 161
1169 3300049588 Ga0501072_0000573 Ga0501072_0000573_24820_25311 161
1170 3300049588 Ga0501072_0010920 Ga0501072_0010920_894_1385 161
1171 3300049589 Ga0501073_0008546 Ga0501073_0008546_3407_3898 161
1172 3300049589 Ga0501073_0048295 Ga0501073_0048295_462_953 161
1173 3300049589 Ga0501073_0096544 Ga0501073_0096544_721_1212 161
1174 3300049589 Ga0501073_0196894 Ga0501073_0196894_308_799 161
1175 3300049590 Ga0501074_0003202 Ga0501074_0003202_1396_1887 161
1176 3300049590 Ga0501074_0046568 Ga0501074_0046568_1296_1787 161
1177 3300049590 Ga0501074_0085748 Ga0501074_0085748_787_1278 161
1178 3300049590 Ga0501074_0143125 Ga0501074_0143125_639_1124 161
1179 3300049590 Ga0501074_0219899 Ga0501074_0219899_765_1256 161
1180 3300049592 Ga0501076_1316875 Ga0501076_1316875_27_518 161
1181 3300049741 Ga0501079_0027299 Ga0501079_0027299_2617_3108 161
1182 3300049741 Ga0501079_0036882 Ga0501079_0036882_497_988 161
1183 3300049741 Ga0501079_0310021 Ga0501079_0310021_131_622 161
1184 3300049741 Ga0501079_0558498 Ga0501079_0558498_373_864 161
1185 3300049741 Ga0501079_0703212 Ga0501079_0703212_143_634 161
1186 3300049742 Ga0501080_0000764 Ga0501080_0000764_23881_24372 161
1187 3300049742 Ga0501080_0016890 Ga0501080_0016890_4508_4999 161
1188 3300049742 Ga0501080_0036409 Ga0501080_0036409_168_659 161
1189 3300049742 Ga0501080_0149659 Ga0501080_0149659_937_1431 161
1190 3300049742 Ga0501080_0337920 Ga0501080_0337920_253_744 161
1191 3300049742 Ga0501080_0418177 Ga0501080_0418177_86_577 161
1192 3300049742 Ga0501080_0505593 Ga0501080_0505593_35_526 161
1193 3300049742 Ga0501080_0812895 Ga0501080_0812895_313_804 161
1194 3300049743 Ga0501081_0054458 Ga0501081_0054458_1754_2245 161
1195 3300049744 Ga0501083_0000246 Ga0501083_0000246_32735_33226 161
1196 3300049744 Ga0501083_0059947 Ga0501083_0059947_1644_2135 161
1197 3300049744 Ga0501083_0455391 Ga0501083_0455391_110_601 161
1198 3300049822 Ga0501035_0004415 Ga0501035_0004415_11968_12459 161
1199 3300049822 Ga0501035_0007906 Ga0501035_0007906_2732_3217 161
1200 3300049822 Ga0501035_0017044 Ga0501035_0017044_572_1063 161
1201 3300049822 Ga0501035_0065342 Ga0501035_0065342_1776_2261 161
1202 3300049822 Ga0501035_0106250 Ga0501035_0106250_791_1276 161
1203 3300049822 Ga0501035_0146059 Ga0501035_0146059_276_767 161
1204 3300049822 Ga0501035_0233427 Ga0501035_0233427_558_1043 161
1205 3300049822 Ga0501035_0361456 Ga0501035_0361456_506_991 161
1206 3300049822 Ga0501035_0981132 Ga0501035_0981132_40_531 161
1207 3300049823 Ga0501044_0009940 Ga0501044_0009940_1415_1900 161
1208 3300049823 Ga0501044_0012031 Ga0501044_0012031_6039_6530 161
1209 3300049823 Ga0501044_0056882 Ga0501044_0056882_1212_1703 161
1210 3300049823 Ga0501044_0062194 Ga0501044_0062194_681_1172 161
1211 3300049823 Ga0501044_0083028 Ga0501044_0083028_1838_2329 161
1212 3300049823 Ga0501044_0202487 Ga0501044_0202487_1315_1800 161
1213 3300049823 Ga0501044_0254314 Ga0501044_0254314_572_1063 161
1214 3300049823 Ga0501044_0320171 Ga0501044_0320171_94_579 161
1215 3300049823 Ga0501044_0320600 Ga0501044_0320600_659_1144 161
1216 3300049823 Ga0501044_0549512 Ga0501044_0549512_533_1018 161
1217 3300049823 Ga0501044_0736976 Ga0501044_0736976_371_856 161
1218 3300049823 Ga0501044_1001844 Ga0501044_1001844_208_693 161
1219 3300049824 Ga0501045_0006516 Ga0501045_0006516_1181_1672 161
1220 3300050516 nmdc:mga0sz30_232173_c1 nmdc:mga0sz30_232173_c1_193_684 161
1221 3300050516 nmdc:mga0sz30_69637_c1 nmdc:mga0sz30_69637_c1_338_829 161
1222 3300053080 Ga0500635_0331452 Ga0500635_0331452_73_564 161
1223 3300053087 Ga0500643_000012 Ga0500643_000012_8920_9411 161
1224 3300053087 Ga0500643_002272 Ga0500643_002272_7998_8492 161
1225 3300053093 Ga0500651_0221483 Ga0500651_0221483_101_592 161
1226 3300053094 Ga0500566_0035055 Ga0500566_0035055_1436_1927 161
1227 3300053103 Ga0500555_000686 Ga0500555_000686_6482_6973 161
1228 3300053120 Ga0500597_000129 Ga0500597_000129_1846_2340 161
1229 3300053160 Ga0500633_0021546 Ga0500633_0021546_257_748 161
1230 3300053730 Ga0500645_000375 Ga0500645_000375_8788_9279 161
1231 3300054114 Ga0501084_0024432 Ga0501084_0024432_1147_1638 161
1232 3300054114 Ga0501084_0118416 Ga0501084_0118416_531_1022 161
1233 3300054114 Ga0501084_0133378 Ga0501084_0133378_792_1283 161
1234 3300060353 Ga0501082_0000107 Ga0501082_0000107_25653_26144 161
1235 3300060353 Ga0501082_0017700 Ga0501082_0017700_4457_4948 161
1236 3300060353 Ga0501082_0069949 Ga0501082_0069949_1644_2135 161
1237 3300060353 Ga0501082_0076297 Ga0501082_0076297_851_1342 161
1238 3300060353 Ga0501082_0273069 Ga0501082_0273069_760_1251 161
1239 3300061734 Ga0530510_0050485 Ga0530510_0050485_1218_1709 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

20

171

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.6644 6 161
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.641 6 161
5zwa-assembly1.cif.gz_B crystal structure of pyridoxal kinase (pdxk) from salmonella typhimurium in complex with adp, pl-linked to lys233 via schiff base in protomer a and the product (plp) in protomer b 0.5815 52 93
2ddm-assembly1.cif.gz_A crystal structure of pyridoxal kinase from the escherichia coli pdxk gene at 2.1 a resolution 0.5718 52 93
2ddm-assembly1.cif.gz_B crystal structure of pyridoxal kinase from the escherichia coli pdxk gene at 2.1 a resolution 0.5674 52 93
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9481 9 153 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9001 9 153 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7028 7 158 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6678 7 158 1.10.1760.20
4huqS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6644 6 161 1.10.1760.20
ID Description Score Start End GO Terms
AF-G7UN05-F1-model_v4 Rod shape-determining protein MreD 0.9812 9 155 GO:0005886
GO:0008360
AF-A0A2K1Q041-F1-model_v4 Rod shape-determining protein MreD 0.9801 3 154 GO:0005886
GO:0008360
AF-A0A7Y1W3E7-F1-model_v4 Rod shape-determining protein MreD 0.9773 1 159 GO:0005886
GO:0008360
AF-A0A2P1PTH0-F1-model_v4 Rod shape-determining protein MreD 0.9746 1 159 GO:0005886
GO:0008360
AF-A0A3M1VD48-F1-model_v4 Rod shape-determining protein MreD 0.9726 7 161 GO:0005886
GO:0008360

Feature Viewer

pLDDT pTM Quality
92.06 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map