F492016

General Info

Members Datasets Scaffolds Average Seq Length
1233 447 2466 143

Family's Representative Sequence

Representative Sequence 3300035084|Ga0373928_0028627|Ga0373928_0028627_249_719
Length 156
Sequence MRRRRPKGRGRKYEADPETRSQTFILLQSAGEQTVPYTYPESPIIVQMPKVFATGFMIVLMEWTCTQLMEPHLDAGEGSLGTHVDVSHLAATPIGFTVKVDAELVAVDGRKLTFEVRAHDGKDLIGEGRHERVVVAWDRFNAKVAEKVKSAAEMVS

Samples

Sample ID Description Type Environment
1 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
25 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
31 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
145 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
146 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
147 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
148 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
149 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
150 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
151 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
152 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
153 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
171 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
172 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
254 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
255 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
269 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
270 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
271 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
274 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
275 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
276 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
277 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
278 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
279 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
280 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
281 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
282 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
289 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
290 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
291 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
292 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
293 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
294 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
295 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
296 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
297 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
309 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
310 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
311 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
312 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
313 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
314 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
315 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
316 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
317 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
318 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
319 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
320 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
321 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
328 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
332 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
340 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
341 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
348 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
349 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
350 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
351 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
352 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
358 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
361 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
362 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
363 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
366 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
367 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
368 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
371 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
372 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
373 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
374 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
375 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
376 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
377 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
380 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
381 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
382 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
383 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
384 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
385 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
416 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
424 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
425 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
426 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
433 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
434 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
435 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
436 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
437 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
438 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
439 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
440 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
441 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
442 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
446 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 6.33
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373928_0028627 3300035084 Bacteria 1220
2 SwRhRL2b_contig_309045 2162886007 Bacteria 1975
3 2214770210 2209111006 Bacteria 2695
4 ARcpr5oldR_c000101 3300000041 Bacteria 15420
5 ARSoilYngRDRAFT_c00241 3300000042 Bacteria 8764
6 ARcpr5yngRDRAFT_c000102 3300000043 Bacteria 13547
7 ARSoilOldRDRAFT_c000134 3300000044 Bacteria 13034
8 ARCol0oldRDRAFT_c00121 3300000045 Bacteria 6899
9 ARCol0yngRDRAFT_1000058 3300000652 Bacteria 19902
10 JGI24032J14994_100156 3300001430 Bacteria 3340
11 JGI24741J21665_1022680 3300001915 Bacteria 972
12 JGI24752J21851_1000685 3300001976 Bacteria 4517
13 JGI24746J21847_1000232 3300001977 Bacteria 7655
14 JGI24747J21853_1000155 3300001978 Bacteria 3390
15 JGI24739J22299_10000103 3300001989 Bacteria 25576
16 JGI24737J22298_10001448 3300001990 Bacteria 8467
17 JGI24737J22298_10029151 3300001990 Bacteria 1732
18 JGI24743J22301_10004796 3300001991 Bacteria 2223
19 JGI24750J21931_1000146 3300002070 Bacteria 11547
20 JGI24745J21846_1000381 3300002073 Bacteria 3881
21 JGI24748J21848_1000880 3300002074 Bacteria 3254
22 JGI24738J21930_10000080 3300002075 Bacteria 21134
23 JGI24749J21850_1007989 3300002076 Bacteria 1472
24 JGI24749J21850_1021711 3300002076 Bacteria 909
25 JGI24744J21845_10034652 3300002077 Bacteria 957
26 JGI24035J26624_1000077 3300002126 Bacteria 7943
27 JGI24033J26618_1000650 3300002155 Bacteria 3318
28 JGI24034J26672_10000241 3300002239 Bacteria 7230
29 JGI24742J22300_10000066 3300002244 Bacteria 15346
30 JGI24751J29686_10004621 3300002459 Bacteria 2797
31 JGI25405J52794_10022384 3300003911 Bacteria 1282
32 JGI25405J52794_10038502 3300003911 Bacteria 1007
33 Ga0065717_1002263 3300005276 Bacteria 2305
34 Ga0065716_1001748 3300005277 Bacteria 3601
35 Ga0065714_10034947 3300005288 Bacteria 1167
36 Ga0065704_10073258 3300005289 Bacteria 7373
37 Ga0065712_10006326 3300005290 Bacteria 4719
38 Ga0065712_10077314 3300005290 Bacteria 3474
39 Ga0065712_10082297 3300005290 Bacteria 2928
40 Ga0065715_10089784 3300005293 Bacteria 8534
41 Ga0065715_10119480 3300005293 Bacteria 2285
42 Ga0065715_10153183 3300005293 Bacteria 1706
43 Ga0065715_10328988 3300005293 Bacteria 980
44 Ga0065707_10406550 3300005295 Bacteria 846
45 Ga0070658_10216384 3300005327 Bacteria 1619
46 Ga0070676_10010179 3300005328 Bacteria 5098
47 Ga0070676_10865739 3300005328 Bacteria 671
48 Ga0070676_10910558 3300005328 Bacteria 655
49 Ga0070676_11497590 3300005328 Bacteria 519
50 Ga0070683_100000001 3300005329 Bacteria 529385
51 Ga0070683_100001199 3300005329 Bacteria 19731
52 Ga0070683_100102147 3300005329 Bacteria 2700
53 Ga0070683_100216813 3300005329 Bacteria 1818
54 Ga0070683_100304765 3300005329 Bacteria 1515
55 Ga0070690_100034038 3300005330 Bacteria 3191
56 Ga0070690_100041801 3300005330 Bacteria 2903
57 Ga0070690_100217576 3300005330 Bacteria 1337
58 Ga0070690_100666964 3300005330 Bacteria 796
59 Ga0070670_100037807 3300005331 Bacteria 4152
60 Ga0070670_100057926 3300005331 Bacteria 3325
61 Ga0070677_10000497 3300005333 Bacteria 13540
62 Ga0068869_100000236 3300005334 Bacteria 29097
63 Ga0070666_10008751 3300005335 Bacteria 6293
64 Ga0070666_10085825 3300005335 Bacteria 2156
65 Ga0070680_100007477 3300005336 Bacteria 8331
66 Ga0070680_100152783 3300005336 Bacteria 1938
67 Ga0070680_100287481 3300005336 Bacteria 1393
68 Ga0070680_100343346 3300005336 Bacteria 1269
69 Ga0070680_100879356 3300005336 Bacteria 773
70 Ga0070682_100002602 3300005337 Bacteria 9963
71 Ga0070682_100692923 3300005337 Bacteria 816
72 Ga0070682_101076809 3300005337 Bacteria 672
73 Ga0068868_100013245 3300005338 Bacteria 6042
74 Ga0070660_100003492 3300005339 Bacteria 10828
75 Ga0070660_100101864 3300005339 Bacteria 2276
76 Ga0070660_100102357 3300005339 Bacteria 2270
77 Ga0070660_100293168 3300005339 Bacteria 1332
78 Ga0070660_100553695 3300005339 Bacteria 960
79 Ga0070689_100000466 3300005340 Bacteria 23849
80 Ga0070689_100116539 3300005340 Bacteria 2130
81 Ga0070689_100345745 3300005340 Bacteria 1246
82 Ga0070689_100655852 3300005340 Bacteria 913
83 Ga0070691_10002256 3300005341 Bacteria 8534
84 Ga0070691_10589218 3300005341 Bacteria 655
85 Ga0070687_100000277 3300005343 Bacteria 17398
86 Ga0070661_100000827 3300005344 Bacteria 22257
87 Ga0070661_100449196 3300005344 Bacteria 1025
88 Ga0070661_100867110 3300005344 Bacteria 744
89 Ga0070692_10142335 3300005345 Bacteria 1358
90 Ga0070668_100010921 3300005347 Bacteria 6757
91 Ga0070668_100121809 3300005347 Bacteria 2085
92 Ga0070669_100002399 3300005353 Bacteria 13560
93 Ga0070675_100005703 3300005354 Bacteria 9530
94 Ga0070671_100000736 3300005355 Bacteria 23441
95 Ga0070671_100119314 3300005355 Bacteria 2219
96 Ga0070674_100010959 3300005356 Bacteria 5499
97 Ga0070673_100000302 3300005364 Bacteria 25831
98 Ga0070673_100092031 3300005364 Bacteria 2480
99 Ga0070688_100050588 3300005365 Bacteria 2589
100 Ga0070659_100001555 3300005366 Bacteria 16548
101 Ga0070659_101766058 3300005366 Bacteria 554
102 Ga0070667_100002272 3300005367 Bacteria 16919
103 Ga0070667_100065449 3300005367 Bacteria 3086
104 Ga0070667_100120120 3300005367 Bacteria 2286
105 Ga0070667_100197812 3300005367 Bacteria 1783
106 Ga0070703_10001123 3300005406 Bacteria 8283
107 Ga0070703_10339458 3300005406 Bacteria 638
108 Ga0070709_10016552 3300005434 Bacteria 4213
109 Ga0070709_11366045 3300005434 Bacteria 573
110 Ga0070714_100043457 3300005435 Bacteria 3800
111 Ga0070714_100080604 3300005435 Bacteria 2832
112 Ga0070714_100175959 3300005435 Bacteria 1944
113 Ga0070714_100775192 3300005435 Bacteria 928
114 Ga0070714_100792006 3300005435 Bacteria 918
115 Ga0070713_100121443 3300005436 Bacteria 2292
116 Ga0070713_101071508 3300005436 Bacteria 779
117 Ga0070710_10016794 3300005437 Bacteria 3732
118 Ga0070710_10022905 3300005437 Bacteria 3274
119 Ga0070710_10242047 3300005437 Bacteria 1156
120 Ga0070710_10421542 3300005437 Bacteria 899
121 Ga0070710_10538825 3300005437 Bacteria 804
122 Ga0070710_10773454 3300005437 Bacteria 684
123 Ga0070710_10955315 3300005437 Bacteria 622
124 Ga0070701_10000864 3300005438 Bacteria 10897
125 Ga0070701_10358656 3300005438 Bacteria 913
126 Ga0070711_100080319 3300005439 Bacteria 2322
127 Ga0070711_100098761 3300005439 Bacteria 2120
128 Ga0070711_100103656 3300005439 Bacteria 2074
129 Ga0070711_100115857 3300005439 Bacteria 1974
130 Ga0070711_100157542 3300005439 Bacteria 1718
131 Ga0070711_100369247 3300005439 Bacteria 1157
132 Ga0070705_100001212 3300005440 Bacteria 13972
133 Ga0070705_100030515 3300005440 Bacteria 2977
134 Ga0070705_100100465 3300005440 Bacteria 1825
135 Ga0070705_100342026 3300005440 Bacteria 1088
136 Ga0070705_100558195 3300005440 Bacteria 879
137 Ga0070700_100001313 3300005441 Bacteria 12331
138 Ga0070694_100003865 3300005444 Bacteria 8952
139 Ga0070694_100071827 3300005444 Bacteria 2386
140 Ga0070694_100148829 3300005444 Bacteria 1708
141 Ga0070694_101206258 3300005444 Bacteria 634
142 Ga0070694_101371431 3300005444 Bacteria 596
143 Ga0070708_100784682 3300005445 Bacteria 896
144 Ga0070663_100021939 3300005455 Bacteria 4258
145 Ga0070663_100199586 3300005455 Bacteria 1560
146 Ga0070663_100408366 3300005455 Bacteria 1112
147 Ga0070663_101257870 3300005455 Bacteria 652
148 Ga0070678_100005062 3300005456 Bacteria 7560
149 Ga0070678_100013987 3300005456 Bacteria 5046
150 Ga0070678_100133772 3300005456 Bacteria 1974
151 Ga0070662_100086416 3300005457 Bacteria 2346
152 Ga0070662_100141427 3300005457 Bacteria 1865
153 Ga0070662_100212296 3300005457 Bacteria 1541
154 Ga0070662_101191028 3300005457 Bacteria 655
155 Ga0070662_101399376 3300005457 Bacteria 603
156 Ga0070662_101603045 3300005457 Bacteria 562
157 Ga0070681_10058442 3300005458 Bacteria 3836
158 Ga0070681_10325957 3300005458 Bacteria 1445
159 Ga0070681_10358326 3300005458 Bacteria 1369
160 Ga0070681_10934986 3300005458 Bacteria 786
161 Ga0070681_10961182 3300005458 Bacteria 773
162 Ga0070681_11840253 3300005458 Bacteria 532
163 Ga0068867_100001495 3300005459 Bacteria 16179
164 Ga0068867_100306529 3300005459 Bacteria 1311
165 Ga0070685_10005500 3300005466 Bacteria 6420
166 Ga0070685_10005707 3300005466 Bacteria 6320
167 Ga0070679_100021336 3300005530 Bacteria 6322
168 Ga0070679_100064229 3300005530 Bacteria 3659
169 Ga0070679_100179346 3300005530 Bacteria 2091
170 Ga0070679_100333473 3300005530 Bacteria 1465
171 Ga0070679_100422294 3300005530 Bacteria 1279
172 Ga0070679_100651388 3300005530 Bacteria 996
173 Ga0070679_100711874 3300005530 Bacteria 947
174 Ga0070684_100005932 3300005535 Bacteria 9408
175 Ga0070684_100368497 3300005535 Bacteria 1322
176 Ga0070684_100526769 3300005535 Bacteria 1095
177 Ga0070684_100727907 3300005535 Bacteria 925
178 Ga0070684_100746006 3300005535 Bacteria 914
179 Ga0070697_100028994 3300005536 Bacteria 4436
180 Ga0070697_100216417 3300005536 Bacteria 1632
181 Ga0070697_100432428 3300005536 Bacteria 1145
182 Ga0068853_100000919 3300005539 Bacteria 20601
183 Ga0068853_100201197 3300005539 Bacteria 1813
184 Ga0068853_100228999 3300005539 Bacteria 1699
185 Ga0068853_100237770 3300005539 Bacteria 1668
186 Ga0068853_102200717 3300005539 Bacteria 534
187 Ga0070672_100004500 3300005543 Bacteria 9131
188 Ga0070672_100278007 3300005543 Bacteria 1415
189 Ga0070686_100000488 3300005544 Bacteria 24002
190 Ga0070686_100154611 3300005544 Bacteria 1609
191 Ga0070686_100323971 3300005544 Bacteria 1150
192 Ga0070695_100002834 3300005545 Bacteria 10077
193 Ga0070695_100137259 3300005545 Bacteria 1691
194 Ga0070695_100210334 3300005545 Bacteria 1396
195 Ga0070696_100038159 3300005546 Bacteria 3315
196 Ga0070696_100039045 3300005546 Bacteria 3278
197 Ga0070696_100134549 3300005546 Bacteria 1801
198 Ga0070693_100002155 3300005547 Bacteria 9028
199 Ga0070665_100949159 3300005548 Bacteria 872
200 Ga0070665_102256935 3300005548 Bacteria 548
201 Ga0070704_100009996 3300005549 Bacteria 5761
202 Ga0070704_100016677 3300005549 Bacteria 4648
203 Ga0068855_100007603 3300005563 Bacteria 13112
204 Ga0068855_100147201 3300005563 Bacteria 2680
205 Ga0068855_100210414 3300005563 Bacteria 2185
206 Ga0068855_100518535 3300005563 Bacteria 1293
207 Ga0068855_100535350 3300005563 Bacteria 1269
208 Ga0068855_102128311 3300005563 Bacteria 564
209 Ga0070664_100002753 3300005564 Bacteria 14191
210 Ga0070664_100059778 3300005564 Bacteria 3243
211 Ga0070664_100405934 3300005564 Bacteria 1246
212 Ga0070664_100878764 3300005564 Bacteria 840
213 Ga0068857_100001539 3300005577 Bacteria 18457
214 Ga0068857_100860048 3300005577 Bacteria 868
215 Ga0068854_100002718 3300005578 Bacteria 10971
216 Ga0068854_100873230 3300005578 Bacteria 789
217 Ga0068854_101185016 3300005578 Bacteria 684
218 Ga0068856_100001722 3300005614 Bacteria 22877
219 Ga0068856_100472386 3300005614 Bacteria 1275
220 Ga0068856_100978601 3300005614 Bacteria 864
221 Ga0068856_101898933 3300005614 Bacteria 606
222 Ga0070702_100007674 3300005615 Bacteria 5177
223 Ga0070702_100074487 3300005615 Bacteria 2014
224 Ga0068852_100001817 3300005616 Bacteria 14500
225 Ga0068852_100101514 3300005616 Bacteria 2598
226 Ga0068852_100345453 3300005616 Bacteria 1451
227 Ga0068852_100388936 3300005616 Bacteria 1369
228 Ga0068852_100923046 3300005616 Bacteria 890
229 Ga0068852_100927546 3300005616 Bacteria 888
230 Ga0068859_100010286 3300005617 Bacteria 9417
231 Ga0068859_100055055 3300005617 Bacteria 4002
232 Ga0068859_100067731 3300005617 Bacteria 3605
233 Ga0068859_100445196 3300005617 Bacteria 1391
234 Ga0068864_100002498 3300005618 Bacteria 15204
235 Ga0068866_10004287 3300005718 Bacteria 5858
236 Ga0068866_10079424 3300005718 Bacteria 1758
237 Ga0068861_100000668 3300005719 Bacteria 20402
238 Ga0068870_10000676 3300005840 Bacteria 13010
239 Ga0068863_100004649 3300005841 Bacteria 13532
240 Ga0068863_100576179 3300005841 Bacteria 1113
241 Ga0068858_100008130 3300005842 Bacteria 10087
242 Ga0068858_100190014 3300005842 Bacteria 1941
243 Ga0068858_100266723 3300005842 Bacteria 1628
244 Ga0068858_100435170 3300005842 Bacteria 1263
245 Ga0068858_101283400 3300005842 Bacteria 720
246 Ga0068860_100007431 3300005843 Bacteria 10959
247 Ga0068860_100055702 3300005843 Bacteria 3759
248 Ga0068860_100209915 3300005843 Bacteria 1889
249 Ga0068862_100008906 3300005844 Bacteria 8308
250 Ga0068862_100317644 3300005844 Bacteria 1437
251 Ga0068862_100324628 3300005844 Bacteria 1422
252 Ga0068862_101889509 3300005844 Bacteria 607
253 Ga0081455_10000327 3300005937 Bacteria 62253
254 Ga0070717_10001681 3300006028 Bacteria 15390
255 Ga0070717_10089694 3300006028 Bacteria 2593
256 Ga0070717_10186052 3300006028 Bacteria 1813
257 Ga0070717_10350141 3300006028 Bacteria 1320
258 Ga0070717_11575011 3300006028 Bacteria 596
259 Ga0075365_10742849 3300006038 Bacteria 693
260 Ga0075363_100062100 3300006048 Bacteria 2014
261 Ga0075432_10008052 3300006058 Bacteria 3597
262 Ga0075432_10053567 3300006058 Bacteria 1427
263 Ga0070715_10023768 3300006163 Bacteria 2405
264 Ga0070715_10143730 3300006163 Bacteria 1161
265 Ga0070716_100007734 3300006173 Bacteria 5305
266 Ga0070716_100494529 3300006173 Bacteria 901
267 Ga0070712_100006392 3300006175 Bacteria 7307
268 Ga0070712_100150712 3300006175 Bacteria 1785
269 Ga0070712_100160167 3300006175 Bacteria 1737
270 Ga0070712_100260740 3300006175 Bacteria 1389
271 Ga0070712_100267571 3300006175 Bacteria 1372
272 Ga0075427_10003431 3300006194 Bacteria 2182
273 Ga0097621_100000892 3300006237 Bacteria 20916
274 Ga0097621_100097765 3300006237 Bacteria 2465
275 Ga0097621_100152142 3300006237 Bacteria 1984
276 Ga0075370_10490443 3300006353 Bacteria 741
277 Ga0068871_100010466 3300006358 Bacteria 6771
278 Ga0068871_100034066 3300006358 Bacteria 4038
279 Ga0068871_100086509 3300006358 Bacteria 2604
280 Ga0075428_100035887 3300006844 Bacteria 5464
281 Ga0075428_101735292 3300006844 Bacteria 651
282 Ga0075430_100007678 3300006846 Bacteria 9110
283 Ga0075430_100042524 3300006846 Bacteria 3842
284 Ga0075431_100007378 3300006847 Bacteria 10949
285 Ga0075431_100438823 3300006847 Bacteria 1303
286 Ga0075433_10002306 3300006852 Bacteria 14532
287 Ga0075433_10090055 3300006852 Bacteria 2712
288 Ga0075434_100000110 3300006871 Bacteria 46873
289 Ga0075434_100023586 3300006871 Bacteria 5999
290 Ga0075434_100023964 3300006871 Bacteria 5959
291 Ga0075434_101468170 3300006871 Unclassified 691
292 Ga0075434_101632825 3300006871 Bacteria 653
293 Ga0075429_100006496 3300006880 Bacteria 10126
294 Ga0068865_100000452 3300006881 Bacteria 22857
295 Ga0068865_100127075 3300006881 Bacteria 1905
296 Ga0068865_100523928 3300006881 Bacteria 992
297 Ga0075436_100251899 3300006914 Bacteria 1258
298 Ga0075436_100342127 3300006914 Bacteria 1077
299 Ga0097620_100010289 3300006931 Bacteria 9417
300 Ga0097620_100055055 3300006931 Bacteria 4002
301 Ga0097620_100067730 3300006931 Bacteria 3605
302 Ga0097620_100445196 3300006931 Bacteria 1391
303 Ga0075435_100066443 3300007076 Bacteria 2934
304 Ga0075435_100069762 3300007076 Bacteria 2867
305 Ga0075435_100277272 3300007076 Bacteria 1431
306 Ga0105251_10032957 3300009011 Bacteria 2576
307 Ga0105251_10227641 3300009011 Bacteria 840
308 Ga0105240_10377979 3300009093 Bacteria 1600
309 Ga0105240_11153613 3300009093 Bacteria 822
310 Ga0111539_10002712 3300009094 Bacteria 23487
311 Ga0111539_10011154 3300009094 Bacteria 11302
312 Ga0111539_10016303 3300009094 Bacteria 9213
313 Ga0111539_10379568 3300009094 Bacteria 1646
314 Ga0111539_11230264 3300009094 Bacteria 869
315 Ga0105245_10000380 3300009098 Bacteria 41293
316 Ga0105245_10175950 3300009098 Bacteria 2041
317 Ga0105245_10495036 3300009098 Bacteria 1238
318 Ga0105245_10998244 3300009098 Bacteria 881
319 Ga0105245_11129873 3300009098 Bacteria 830
320 Ga0105247_10095025 3300009101 Bacteria 1897
321 Ga0105247_10095195 3300009101 Bacteria 1896
322 Ga0114129_10058215 3300009147 Bacteria 5405
323 Ga0114129_10086721 3300009147 Bacteria 4341
324 Ga0105243_10002254 3300009148 Bacteria 16204
325 Ga0105243_12385601 3300009148 Unclassified 567
326 Ga0105241_10000342 3300009174 Bacteria 35383
327 Ga0105241_10273046 3300009174 Bacteria 1441
328 Ga0105241_10321033 3300009174 Bacteria 1335
329 Ga0105241_10469851 3300009174 Bacteria 1116
330 Ga0105242_10000855 3300009176 Bacteria 23621
331 Ga0105242_10114826 3300009176 Bacteria 2301
332 Ga0105242_10126470 3300009176 Bacteria 2200
333 Ga0105242_10455389 3300009176 Bacteria 1207
334 Ga0105248_10012394 3300009177 Bacteria 9405
335 Ga0105248_10027173 3300009177 Bacteria 6366
336 Ga0105248_10227162 3300009177 Bacteria 2101
337 Ga0105248_10566771 3300009177 Bacteria 1281
338 Ga0105237_10165865 3300009545 Bacteria 2208
339 Ga0105237_10350105 3300009545 Bacteria 1482
340 Ga0105237_10670432 3300009545 Bacteria 1044
341 Ga0105237_12039233 3300009545 Bacteria 582
342 Ga0105238_10053194 3300009551 Bacteria 4068
343 Ga0105238_10161315 3300009551 Bacteria 2217
344 Ga0105238_10282017 3300009551 Bacteria 1643
345 Ga0105238_10791792 3300009551 Bacteria 963
346 Ga0105238_10865163 3300009551 Bacteria 921
347 Ga0105249_10001982 3300009553 Bacteria 17778
348 Ga0105249_10019413 3300009553 Bacteria 6064
349 Ga0105249_10089178 3300009553 Bacteria 2881
350 Ga0105249_10818843 3300009553 Bacteria 996
351 Ga0105249_11646056 3300009553 Bacteria 714
352 Ga0105239_10012830 3300010375 Bacteria 9320
353 Ga0105239_10042492 3300010375 Bacteria 4981
354 Ga0105239_10132145 3300010375 Bacteria 2777
355 Ga0105239_10172256 3300010375 Bacteria 2421
356 Ga0105239_11111307 3300010375 Bacteria 910
357 Ga0105246_10000185 3300011119 Bacteria 30744
358 Ga0105246_10231406 3300011119 Bacteria 1455
359 Ga0157337_1015808 3300012483 Bacteria 647
360 Ga0157323_1021068 3300012495 Bacteria 621
361 Ga0157319_1045173 3300012497 Bacteria 529
362 Ga0157345_1041907 3300012498 Unclassified 554
363 Ga0157314_1017101 3300012500 Bacteria 702
364 Ga0157347_1021434 3300012502 Bacteria 759
365 Ga0157339_1015113 3300012505 Bacteria 757
366 Ga0157339_1026226 3300012505 Bacteria 654
367 Ga0157324_1027005 3300012506 Bacteria 626
368 Ga0157327_1029806 3300012512 Bacteria 674
369 Ga0157326_1002949 3300012513 Bacteria 1798
370 Ga0157373_10130966 3300013100 Bacteria 1764
371 Ga0157373_10162794 3300013100 Bacteria 1570
372 Ga0157373_10296751 3300013100 Bacteria 1146
373 Ga0157373_10867538 3300013100 Bacteria 668
374 Ga0157373_11148155 3300013100 Unclassified 584
375 Ga0157371_10006659 3300013102 Bacteria 9456
376 Ga0157371_10648232 3300013102 Bacteria 788
377 Ga0157370_10577840 3300013104 Bacteria 1030
378 Ga0157369_10323622 3300013105 Bacteria 1603
379 Ga0157369_10777524 3300013105 Bacteria 984
380 Ga0157369_12367953 3300013105 Bacteria 538
381 Ga0157374_10001986 3300013296 Bacteria 17156
382 Ga0157374_10033399 3300013296 Bacteria 4694
383 Ga0157378_10001729 3300013297 Bacteria 19618
384 Ga0157378_10166278 3300013297 Bacteria 2066
385 Ga0157378_10322366 3300013297 Bacteria 1501
386 Ga0157378_10846386 3300013297 Unclassified 943
387 Ga0163162_10012026 3300013306 Bacteria 8439
388 Ga0163162_10026532 3300013306 Bacteria 5725
389 Ga0163162_10057878 3300013306 Bacteria 3904
390 Ga0163162_10990683 3300013306 Bacteria 950
391 Ga0163162_12184061 3300013306 Bacteria 635
392 Ga0157372_10024601 3300013307 Bacteria 6544
393 Ga0157372_10593975 3300013307 Bacteria 1290
394 Ga0157372_10632801 3300013307 Bacteria 1246
395 Ga0157372_10645343 3300013307 Bacteria 1233
396 Ga0157372_12640263 3300013307 Bacteria 576
397 Ga0157375_10001883 3300013308 Bacteria 18038
398 Ga0157375_10030202 3300013308 Bacteria 5107
399 Ga0163163_10010785 3300014325 Bacteria 8246
400 Ga0163163_10295679 3300014325 Bacteria 1671
401 Ga0157380_10007676 3300014326 Bacteria 7677
402 Ga0157380_10869299 3300014326 Bacteria 925
403 Ga0157377_10000643 3300014745 Bacteria 14554
404 Ga0157379_10010633 3300014968 Bacteria 8021
405 Ga0157379_10026543 3300014968 Bacteria 5156
406 Ga0157379_10599353 3300014968 Bacteria 1028
407 Ga0157376_10000920 3300014969 Bacteria 19113
408 Ga0157376_10426233 3300014969 Bacteria 1288
409 Ga0157376_10578466 3300014969 Bacteria 1115
410 Ga0157376_10680057 3300014969 Unclassified 1032
411 Ga0163161_10000379 3300017792 Bacteria 37281
412 Ga0163161_10737962 3300017792 Bacteria 823
413 Ga0163161_11339248 3300017792 Bacteria 623
414 Ga0206354_11424105 3300020081 Bacteria 760
415 Ga0213874_10147432 3300021377 Bacteria 819
416 Ga0213871_10124861 3300021441 Bacteria 769
417 Ga0207666_1000046 3300025271 Bacteria 24194
418 Ga0207673_1000461 3300025290 Bacteria 4236
419 Ga0207697_10000714 3300025315 Bacteria 18891
420 Ga0207697_10045981 3300025315 Bacteria 1797
421 Ga0207713_1076792 3300025735 Bacteria 1215
422 Ga0207653_10004733 3300025885 Bacteria 4259
423 Ga0207682_10000043 3300025893 Bacteria 52108
424 Ga0207692_10007751 3300025898 Bacteria 4414
425 Ga0207692_10055266 3300025898 Bacteria 2031
426 Ga0207692_10641073 3300025898 Bacteria 686
427 Ga0207692_10931279 3300025898 Bacteria 572
428 Ga0207642_10002212 3300025899 Bacteria 6031
429 Ga0207710_10002657 3300025900 Bacteria 8239
430 Ga0207710_10004284 3300025900 Bacteria 6246
431 Ga0207710_10079101 3300025900 Bacteria 1522
432 Ga0207710_10086258 3300025900 Bacteria 1463
433 Ga0207688_10000083 3300025901 Bacteria 36050
434 Ga0207688_10036653 3300025901 Bacteria 2719
435 Ga0207680_10005187 3300025903 Bacteria 6214
436 Ga0207680_10116964 3300025903 Bacteria 1738
437 Ga0207647_10025829 3300025904 Bacteria 3851
438 Ga0207685_10015847 3300025905 Bacteria 2399
439 Ga0207685_10064252 3300025905 Bacteria 1465
440 Ga0207699_10012561 3300025906 Bacteria 4310
441 Ga0207699_10035800 3300025906 Bacteria 2826
442 Ga0207699_10065818 3300025906 Bacteria 2198
443 Ga0207645_10002954 3300025907 Bacteria 13126
444 Ga0207645_10015101 3300025907 Bacteria 5143
445 Ga0207645_10160586 3300025907 Bacteria 1470
446 Ga0207643_10000128 3300025908 Bacteria 51191
447 Ga0207705_10397009 3300025909 Bacteria 1066
448 Ga0207654_10001559 3300025911 Bacteria 12036
449 Ga0207654_10550168 3300025911 Bacteria 820
450 Ga0207707_10004600 3300025912 Bacteria 12117
451 Ga0207707_10210462 3300025912 Bacteria 1694
452 Ga0207707_10619673 3300025912 Bacteria 914
453 Ga0207707_11349131 3300025912 Bacteria 571
454 Ga0207695_10598098 3300025913 Bacteria 984
455 Ga0207671_10013743 3300025914 Bacteria 6427
456 Ga0207671_10151757 3300025914 Bacteria 1790
457 Ga0207671_10422168 3300025914 Bacteria 1061
458 Ga0207671_10529717 3300025914 Bacteria 939
459 Ga0207693_10008254 3300025915 Bacteria 8526
460 Ga0207693_10012476 3300025915 Bacteria 6864
461 Ga0207693_10022622 3300025915 Bacteria 4994
462 Ga0207693_10116477 3300025915 Bacteria 2098
463 Ga0207693_10208215 3300025915 Bacteria 1537
464 Ga0207663_10016239 3300025916 Bacteria 4123
465 Ga0207663_10197595 3300025916 Bacteria 1448
466 Ga0207663_10253841 3300025916 Bacteria 1295
467 Ga0207663_10470974 3300025916 Bacteria 972
468 Ga0207663_10931645 3300025916 Bacteria 695
469 Ga0207660_10001486 3300025917 Bacteria 15770
470 Ga0207660_10483731 3300025917 Bacteria 1003
471 Ga0207660_10484894 3300025917 Bacteria 1002
472 Ga0207660_10535411 3300025917 Bacteria 952
473 Ga0207660_10790831 3300025917 Bacteria 774
474 Ga0207662_10000301 3300025918 Bacteria 22744
475 Ga0207657_10001859 3300025919 Bacteria 22810
476 Ga0207657_10047359 3300025919 Bacteria 3760
477 Ga0207657_10107787 3300025919 Bacteria 2304
478 Ga0207657_10327325 3300025919 Bacteria 1211
479 Ga0207649_10003562 3300025920 Bacteria 8508
480 Ga0207649_10046661 3300025920 Bacteria 2663
481 Ga0207649_10650080 3300025920 Bacteria 815
482 Ga0207649_10718638 3300025920 Bacteria 776
483 Ga0207652_10016674 3300025921 Bacteria 6003
484 Ga0207652_10046330 3300025921 Bacteria 3710
485 Ga0207652_10153811 3300025921 Bacteria 2060
486 Ga0207652_10259840 3300025921 Bacteria 1566
487 Ga0207652_10441052 3300025921 Bacteria 1174
488 Ga0207652_10561912 3300025921 Bacteria 1025
489 Ga0207681_10004864 3300025923 Bacteria 8251
490 Ga0207694_10076101 3300025924 Bacteria 2628
491 Ga0207694_10457974 3300025924 Bacteria 1065
492 Ga0207694_10570376 3300025924 Bacteria 951
493 Ga0207650_10019558 3300025925 Bacteria 4761
494 Ga0207650_10690913 3300025925 Bacteria 862
495 Ga0207659_10000411 3300025926 Bacteria 25858
496 Ga0207659_10374250 3300025926 Bacteria 1186
497 Ga0207687_10000667 3300025927 Bacteria 23099
498 Ga0207687_10259128 3300025927 Bacteria 1386
499 Ga0207687_10473587 3300025927 Bacteria 1042
500 Ga0207687_10675276 3300025927 Bacteria 875
501 Ga0207700_10000412 3300025928 Bacteria 25028
502 Ga0207700_10040508 3300025928 Bacteria 3401
503 Ga0207700_10189586 3300025928 Bacteria 1727
504 Ga0207664_10107056 3300025929 Bacteria 2319
505 Ga0207664_10202163 3300025929 Bacteria 1715
506 Ga0207664_10385539 3300025929 Bacteria 1244
507 Ga0207664_10731138 3300025929 Bacteria 890
508 Ga0207664_10882667 3300025929 Bacteria 803
509 Ga0207644_10005279 3300025931 Bacteria 8432
510 Ga0207644_10009684 3300025931 Bacteria 6334
511 Ga0207644_10100107 3300025931 Bacteria 2176
512 Ga0207644_10280769 3300025931 Bacteria 1337
513 Ga0207690_10002854 3300025932 Bacteria 10412
514 Ga0207690_10015321 3300025932 Bacteria 4644
515 Ga0207706_10004082 3300025933 Bacteria 13792
516 Ga0207706_10031063 3300025933 Bacteria 4760
517 Ga0207706_10211589 3300025933 Bacteria 1700
518 Ga0207686_10000579 3300025934 Bacteria 22963
519 Ga0207686_10033530 3300025934 Bacteria 3066
520 Ga0207709_10000551 3300025935 Bacteria 32038
521 Ga0207709_10104027 3300025935 Bacteria 1883
522 Ga0207709_10171562 3300025935 Bacteria 1523
523 Ga0207709_10183425 3300025935 Bacteria 1480
524 Ga0207670_10000556 3300025936 Bacteria 20667
525 Ga0207670_10394064 3300025936 Bacteria 1106
526 Ga0207669_10000675 3300025937 Bacteria 14703
527 Ga0207704_10002887 3300025938 Bacteria 7772
528 Ga0207704_10109694 3300025938 Bacteria 1862
529 Ga0207704_10501021 3300025938 Bacteria 979
530 Ga0207665_10014619 3300025939 Bacteria 5167
531 Ga0207665_10146009 3300025939 Bacteria 1690
532 Ga0207665_10214421 3300025939 Bacteria 1408
533 Ga0207665_10453868 3300025939 Bacteria 984
534 Ga0207665_10736491 3300025939 Bacteria 776
535 Ga0207691_10000599 3300025940 Bacteria 35997
536 Ga0207691_10063150 3300025940 Bacteria 3360
537 Ga0207691_10118905 3300025940 Bacteria 2344
538 Ga0207711_10010308 3300025941 Bacteria 7762
539 Ga0207711_10073399 3300025941 Bacteria 2973
540 Ga0207711_10312423 3300025941 Bacteria 1451
541 Ga0207689_10000165 3300025942 Bacteria 57494
542 Ga0207661_10008897 3300025944 Bacteria 7188
543 Ga0207679_10000112 3300025945 Bacteria 65716
544 Ga0207679_10044874 3300025945 Bacteria 3193
545 Ga0207667_10017788 3300025949 Bacteria 7992
546 Ga0207667_10038289 3300025949 Bacteria 5123
547 Ga0207667_10091380 3300025949 Bacteria 3145
548 Ga0207667_10614442 3300025949 Bacteria 1095
549 Ga0207667_10842176 3300025949 Bacteria 912
550 Ga0207651_10000099 3300025960 Bacteria 38059
551 Ga0207651_10555171 3300025960 Bacteria 999
552 Ga0207712_10019595 3300025961 Bacteria 4422
553 Ga0207712_10135889 3300025961 Bacteria 1880
554 Ga0207712_10267370 3300025961 Bacteria 1389
555 Ga0207712_11515422 3300025961 Bacteria 601
556 Ga0207668_10000713 3300025972 Bacteria 20303
557 Ga0207668_10142168 3300025972 Bacteria 1847
558 Ga0207640_10002957 3300025981 Bacteria 9147
559 Ga0207640_10619175 3300025981 Bacteria 919
560 Ga0207658_10003702 3300025986 Bacteria 10772
561 Ga0207658_10067675 3300025986 Bacteria 2691
562 Ga0207658_10206505 3300025986 Bacteria 1643
563 Ga0207658_11001604 3300025986 Bacteria 762
564 Ga0207677_10010465 3300026023 Bacteria 5249
565 Ga0207703_10018016 3300026035 Bacteria 5515
566 Ga0207703_10058062 3300026035 Bacteria 3157
567 Ga0207703_10122787 3300026035 Bacteria 2232
568 Ga0207703_10336333 3300026035 Bacteria 1386
569 Ga0207639_10002883 3300026041 Bacteria 11555
570 Ga0207639_10250332 3300026041 Bacteria 1545
571 Ga0207639_10449624 3300026041 Bacteria 1169
572 Ga0207639_10925591 3300026041 Bacteria 815
573 Ga0207639_11053468 3300026041 Bacteria 762
574 Ga0207678_10001329 3300026067 Bacteria 22814
575 Ga0207678_10029433 3300026067 Bacteria 4793
576 Ga0207678_10036192 3300026067 Bacteria 4297
577 Ga0207678_10328559 3300026067 Bacteria 1316
578 Ga0207678_11000848 3300026067 Bacteria 740
579 Ga0207708_10000862 3300026075 Bacteria 22870
580 Ga0207708_10113285 3300026075 Bacteria 2107
581 Ga0207708_10458939 3300026075 Bacteria 1062
582 Ga0207702_10007796 3300026078 Bacteria 9086
583 Ga0207702_10148575 3300026078 Bacteria 2129
584 Ga0207702_10606172 3300026078 Bacteria 1075
585 Ga0207702_11838734 3300026078 Bacteria 597
586 Ga0207641_10001462 3300026088 Bacteria 23160
587 Ga0207641_10242043 3300026088 Bacteria 1681
588 Ga0207641_10730699 3300026088 Bacteria 976
589 Ga0207648_10001891 3300026089 Bacteria 22870
590 Ga0207648_10081422 3300026089 Bacteria 2824
591 Ga0207648_10288236 3300026089 Bacteria 1469
592 Ga0207676_10001459 3300026095 Bacteria 17574
593 Ga0207676_10136555 3300026095 Bacteria 2093
594 Ga0207676_10376323 3300026095 Bacteria 1320
595 Ga0207674_10006899 3300026116 Bacteria 13310
596 Ga0207674_10212794 3300026116 Bacteria 1882
597 Ga0207674_10333507 3300026116 Bacteria 1467
598 Ga0207675_100001575 3300026118 Bacteria 22801
599 Ga0207675_100040944 3300026118 Bacteria 4328
600 Ga0207675_100387886 3300026118 Bacteria 1375
601 Ga0207683_10001273 3300026121 Bacteria 22829
602 Ga0207683_10004182 3300026121 Bacteria 12489
603 Ga0207683_10026331 3300026121 Bacteria 5020
604 Ga0207698_10000511 3300026142 Bacteria 22568
605 Ga0207698_10006111 3300026142 Bacteria 7493
606 Ga0207698_11324611 3300026142 Bacteria 735
607 Ga0207698_12227675 3300026142 Bacteria 560
608 Ga0209984_1026426 3300027424 Bacteria 811
609 Ga0209999_1042707 3300027543 Bacteria 851
610 Ga0210002_1002548 3300027617 Bacteria 2635
611 Ga0210002_1036553 3300027617 Bacteria 827
612 Ga0209971_1020926 3300027682 Bacteria 1556
613 Ga0209966_1002413 3300027695 Bacteria 3117
614 Ga0209966_1007471 3300027695 Bacteria 1917
615 Ga0209998_10001602 3300027717 Bacteria 5437
616 Ga0209998_10009907 3300027717 Bacteria 1975
617 Ga0209974_10020171 3300027876 Bacteria 2210
618 Ga0207428_10000064 3300027907 Bacteria 151185
619 Ga0207428_10003078 3300027907 Bacteria 16410
620 Ga0207428_10006523 3300027907 Bacteria 10765
621 Ga0268266_10010320 3300028379 Bacteria 8170
622 Ga0268266_10052520 3300028379 Bacteria 3500
623 Ga0268266_10741623 3300028379 Bacteria 948
624 Ga0268265_10003386 3300028380 Bacteria 11479
625 Ga0268265_10064227 3300028380 Bacteria 2827
626 Ga0268265_10312259 3300028380 Bacteria 1420
627 Ga0268264_10003086 3300028381 Bacteria 14418
628 Ga0268264_10162583 3300028381 Bacteria 2013
629 Ga0268264_10508122 3300028381 Bacteria 1176
630 Ga0265334_10062241 3300028573 Bacteria 1405
631 Ga0265338_10258059 3300028800 Bacteria 1283
632 Ga0265338_10396420 3300028800 Bacteria 984
633 Ga0265338_10727185 3300028800 Bacteria 683
634 Ga0265330_10288310 3300031235 Bacteria 691
635 Ga0265325_10000006 3300031241 Bacteria 255758
636 Ga0265325_10015951 3300031241 Bacteria 4208
637 Ga0265325_10049438 3300031241 Bacteria 2170
638 Ga0265325_10086875 3300031241 Bacteria 1547
639 Ga0265325_10304470 3300031241 Bacteria 711
640 Ga0265340_10216027 3300031247 Bacteria 860
641 Ga0265339_10060333 3300031249 Bacteria 2044
642 Ga0265339_10233286 3300031249 Bacteria 896
643 Ga0265339_10329985 3300031249 Bacteria 722
644 Ga0265327_10001075 3300031251 Bacteria 38065
645 Ga0307513_10000010 3300031456 Bacteria 360812
646 Ga0265313_10001122 3300031595 Bacteria 25603
647 Ga0265313_10005418 3300031595 Bacteria 9399
648 Ga0265313_10009773 3300031595 Bacteria 6181
649 Ga0265313_10065468 3300031595 Bacteria 1687
650 Ga0265314_10078013 3300031711 Bacteria 2195
651 Ga0265314_10254593 3300031711 Bacteria 1006
652 Ga0265342_10001631 3300031712 Bacteria 20687
653 Ga0265342_10109886 3300031712 Bacteria 1561
654 Ga0307405_10764607 3300031731 Bacteria 806
655 Ga0307413_10613995 3300031824 Bacteria 892
656 Ga0307412_10328399 3300031911 Bacteria 1220
657 Ga0307416_100416024 3300032002 Bacteria 1387
658 Ga0307411_10771220 3300032005 Bacteria 844
659 Ga0307411_12094042 3300032005 Unclassified 529
660 Ga0307415_101150037 3300032126 Bacteria 729
661 Ga0373930_0153620 3300034816 Bacteria 579
662 Ga0373948_0008375 3300034817 Bacteria 1759
663 Ga0373950_0000575 3300034818 Bacteria 4508
664 Ga0373958_0002130 3300034819 Bacteria 2742
665 Ga0373958_0002762 3300034819 Bacteria 2489
666 Ga0373958_0004921 3300034819 Bacteria 2002
667 Ga0373958_0005151 3300034819 Bacteria 1972
668 Ga0373959_0001506 3300034820 Bacteria 3726
669 Ga0373959_0014183 3300034820 Bacteria 1447
670 Ga0373938_0000276 3300034957 Bacteria 8189
671 Ga0373926_0022405 3300035083 Bacteria 2192
672 Ga0373926_0059886 3300035083 Bacteria 1386
673 Ga0373926_0093256 3300035083 Bacteria 1121
674 Ga0373928_0000820 3300035084 Bacteria 6070
675 Ga0373928_0146245 3300035084 Bacteria 651
676 Ga0373929_0002326 3300035085 Bacteria 3496
677 Ga0373929_0027503 3300035085 Bacteria 1195
678 Ga0373934_0023173 3300035086 Bacteria 2398
679 Ga0373934_0088919 3300035086 Bacteria 1244
680 Ga0373940_0000049 3300035088 Bacteria 13501
681 Ga0373940_0002067 3300035088 Bacteria 3814
682 Ga0373940_0378973 3300035088 Unclassified 501
683 Ga0373944_0006580 3300035089 Bacteria 3087
684 Ga0373944_0037658 3300035089 Bacteria 1482
685 Ga0373949_0001191 3300035090 Bacteria 7712
686 Ga0373949_0002203 3300035090 Bacteria 5099
687 Ga0373949_0007218 3300035090 Bacteria 2435
688 Ga0373951_0000518 3300035091 Bacteria 10973
689 Ga0373951_0022569 3300035091 Bacteria 1449
690 Ga0373951_0036363 3300035091 Bacteria 1175
691 Ga0373952_0000453 3300035092 Bacteria 7153
692 Ga0373952_0000483 3300035092 Bacteria 6949
693 Ga0373952_0023287 3300035092 Bacteria 1322
694 Ga0373923_0001175 3300035111 Bacteria 7302
695 Ga0373923_0068057 3300035111 Bacteria 1524
696 Ga0373923_0071871 3300035111 Bacteria 1487
697 Ga0373923_0139502 3300035111 Bacteria 1095
698 Ga0373932_0000462 3300035112 Bacteria 12458
699 Ga0373932_0018167 3300035112 Bacteria 1815
700 Ga0373932_0059751 3300035112 Bacteria 1155
701 Ga0373936_0000328 3300035113 Bacteria 16031
702 Ga0373936_0393460 3300035113 Bacteria 635
703 Ga0373939_0001076 3300035114 Bacteria 6716
704 Ga0373939_0003300 3300035114 Bacteria 3787
705 Ga0373939_0003626 3300035114 Bacteria 3630
706 Ga0373939_0014317 3300035114 Bacteria 2056
707 Ga0373941_0048238 3300035115 Bacteria 1344
708 Ga0373945_0000123 3300035116 Bacteria 19133
709 Ga0373945_0075580 3300035116 Bacteria 1282
710 Ga0373953_0017796 3300035117 Bacteria 2618
711 Ga0373953_0035216 3300035117 Bacteria 1966
712 Ga0373953_0394016 3300035117 Bacteria 609
713 Ga0373954_0012572 3300035118 Bacteria 3765
714 Ga0373954_0503934 3300035118 Bacteria 600
715 Ga0373956_0045117 3300035119 Bacteria 1966
716 Ga0373956_0083075 3300035119 Bacteria 1472
717 Ga0373956_0139840 3300035119 Bacteria 1136
718 Ga0373956_0218800 3300035119 Bacteria 904
719 Ga0373957_0002486 3300035120 Bacteria 5276
720 Ga0373957_0004774 3300035120 Bacteria 4152
721 Ga0373957_0047990 3300035120 Bacteria 1626
722 Ga0373957_0123089 3300035120 Bacteria 1051
723 Ga0373960_0001504 3300035121 Bacteria 5184
724 Ga0373960_0008556 3300035121 Bacteria 2455
725 Ga0373943_0001821 3300035170 Bacteria 9632
726 Ga0373943_0028120 3300035170 Bacteria 2648
727 Ga0373943_0079624 3300035170 Bacteria 1677
728 Ga0373943_0117503 3300035170 Bacteria 1410
729 Ga0373943_0156385 3300035170 Bacteria 1238
730 Ga0373943_0183007 3300035170 Bacteria 1152
731 Ga0373946_0003579 3300035171 Bacteria 5512
732 Ga0373946_0006894 3300035171 Bacteria 4135
733 Ga0373946_0018373 3300035171 Bacteria 2685
734 Ga0373946_0029864 3300035171 Bacteria 2173
735 Ga0373955_0001781 3300035172 Bacteria 9242
736 Ga0373955_0003764 3300035172 Bacteria 6683
737 Ga0373955_0008163 3300035172 Bacteria 4847
738 Ga0373955_0053359 3300035172 Bacteria 2207
739 Ga0373955_0125793 3300035172 Bacteria 1493
740 Ga0373955_0445025 3300035172 Bacteria 789
741 Ga0373942_0004252 3300035207 Bacteria 3335
742 Ga0373942_0023528 3300035207 Bacteria 1573
743 Ga0373942_0226159 3300035207 Bacteria 629
744 Ga0373961_0260354 3300035241 Bacteria 630
745 Ga0373962_0000215 3300035242 Bacteria 12190
746 Ga0373962_0001429 3300035242 Bacteria 5635
747 Ga0373962_0002252 3300035242 Bacteria 4611
748 Ga0373962_0041030 3300035242 Bacteria 1303
749 Ga0373924_0005980 3300035410 Bacteria 4339
750 Ga0373924_0145520 3300035410 Bacteria 1035
751 Ga0373924_0202229 3300035410 Bacteria 876
752 Ga0373924_0292737 3300035410 Bacteria 722
753 Ga0373931_0004700 3300035691 Bacteria 6252
754 Ga0373931_0014856 3300035691 Bacteria 3813
755 Ga0373931_0021068 3300035691 Bacteria 3268
756 Ga0373931_0047512 3300035691 Bacteria 2272
757 Ga0373931_0047908 3300035691 Bacteria 2263
758 Ga0373931_0149622 3300035691 Bacteria 1359
759 Ga0373935_0008365 3300035692 Bacteria 6190
760 Ga0373935_0008371 3300035692 Bacteria 6188
761 Ga0373935_0010930 3300035692 Bacteria 5449
762 Ga0373935_0128672 3300035692 Bacteria 1699
763 Ga0373935_0136849 3300035692 Bacteria 1651
764 Ga0373935_0162733 3300035692 Bacteria 1522
765 Ga0373935_0243858 3300035692 Bacteria 1255
766 Ga0373927_0002377 3300035695 Bacteria 13712
767 Ga0373927_0009145 3300035695 Bacteria 6651
768 Ga0373927_0059332 3300035695 Bacteria 2474
769 Ga0373927_0357911 3300035695 Bacteria 962
770 Ga0373927_0822108 3300035695 Bacteria 613
771 Ga0373933_0003512 3300035724 Bacteria 8728
772 Ga0373933_0005999 3300035724 Bacteria 6610
773 Ga0373933_0014137 3300035724 Bacteria 4433
774 Ga0373933_0502505 3300035724 Bacteria 794
775 Ga0373933_0563715 3300035724 Bacteria 747
776 Ga0373947_0002454 3300035725 Bacteria 11164
777 Ga0373947_0003283 3300035725 Bacteria 9588
778 Ga0373947_0005390 3300035725 Bacteria 7462
779 Ga0373947_0028558 3300035725 Bacteria 3271
780 Ga0373947_0155628 3300035725 Bacteria 1475
781 Ga0373947_0203221 3300035725 Bacteria 1297
782 Ga0373937_0000977 3300036401 Bacteria 24260
783 Ga0373937_0000998 3300036401 Bacteria 23980
784 Ga0373937_0011819 3300036401 Bacteria 7666
785 Ga0373937_0067460 3300036401 Bacteria 3296
786 Ga0373937_0075420 3300036401 Bacteria 3113
787 Ga0373937_0076111 3300036401 Bacteria 3099
788 Ga0373937_0281737 3300036401 Unclassified 1570
789 Ga0316582_0590448 3300036647 Bacteria 765
790 Ga0373925_0002457 3300037068 Bacteria 14848
791 Ga0373925_0005022 3300037068 Bacteria 9926
792 Ga0373925_0027418 3300037068 Bacteria 4169
793 Ga0373925_0109865 3300037068 Bacteria 2128
794 Ga0436364_0196077 3300037853 Bacteria 3393
795 Ga0436364_0693652 3300037853 Bacteria 667
796 Ga0242419_003577 3300038698 Bacteria 1057
797 Ga0436365_1561377 3300039437 Bacteria 1136
798 Ga0436365_1844700 3300039437 Bacteria 631
799 Ga0436360_0067312 3300039438 Bacteria 2249
800 Ga0436360_0689073 3300039438 Bacteria 1181
801 Ga0436360_0906468 3300039438 Bacteria 686
802 Ga0436360_1257893 3300039438 Bacteria 1398
803 Ga0436363_0533112 3300039450 Bacteria 1019
804 Ga0436363_0628984 3300039450 Bacteria 596
805 Ga0436363_1506293 3300039450 Bacteria 1953
806 Ga0436363_1544118 3300039450 Unclassified 655
807 Ga0439453_0029892 3300041408 Bacteria 1027
808 Ga0451793_1469895 3300041452 Bacteria 627
809 Ga0439441_017992 3300042001 Bacteria 1275
810 Ga0439450_025650 3300042008 Bacteria 1294
811 Ga0439455_0106715 3300042012 Bacteria 777
812 Ga0450923_174744 3300042125 Unclassified 527
813 Ga0439464_0150717 3300042439 Bacteria 727
814 Ga0451577_0110442 3300042876 Bacteria 2460
815 Ga0451577_1318351 3300042876 Bacteria 642
816 Ga0439440_0213986 3300042993 Bacteria 576
817 Ga0466966_0993832 3300044684 Bacteria 506
818 Ga0451576_0105771 3300045051 Bacteria 2928
819 Ga0451576_0433355 3300045051 Unclassified 1380
820 Ga0495592_0002187 3300046454 Bacteria 13770
821 Ga0495592_0003145 3300046454 Bacteria 11808
822 Ga0495592_0011852 3300046454 Bacteria 6605
823 Ga0495592_0153609 3300046454 Bacteria 1589
824 Ga0495603_0000127 3300046455 Bacteria 37048
825 Ga0495603_0006157 3300046455 Bacteria 7172
826 Ga0495603_0010152 3300046455 Bacteria 5698
827 Ga0495629_0000474 3300046459 Bacteria 33674
828 Ga0495629_0001081 3300046459 Bacteria 21648
829 Ga0495629_0001491 3300046459 Bacteria 18414
830 Ga0495629_0095292 3300046459 Bacteria 2076
831 Ga0495629_0241009 3300046459 Bacteria 1245
832 Ga0495641_0000716 3300046461 Bacteria 28072
833 Ga0495641_0042565 3300046461 Bacteria 2104
834 Ga0495641_0079762 3300046461 Bacteria 1466
835 Ga0495651_0001830 3300046462 Bacteria 16422
836 Ga0495651_0005021 3300046462 Bacteria 10109
837 Ga0495651_0063498 3300046462 Bacteria 2822
838 Ga0495651_0076902 3300046462 Bacteria 2527
839 Ga0495651_0191302 3300046462 Bacteria 1440
840 Ga0495653_0001477 3300046463 Bacteria 18333
841 Ga0495653_0002011 3300046463 Bacteria 16000
842 Ga0495653_0117615 3300046463 Bacteria 1899
843 Ga0495653_0302595 3300046463 Bacteria 1042
844 Ga0495580_0000533 3300046472 Bacteria 32237
845 Ga0495580_0001373 3300046472 Bacteria 21360
846 Ga0495580_0029341 3300046472 Bacteria 3993
847 Ga0495582_0000310 3300046473 Bacteria 26965
848 Ga0495582_0001241 3300046473 Bacteria 14349
849 Ga0495582_0088147 3300046473 Bacteria 1728
850 Ga0495582_0126967 3300046473 Bacteria 1439
851 Ga0495605_0061919 3300046474 Bacteria 1789
852 Ga0495639_0000593 3300046475 Bacteria 16896
853 Ga0495639_0000991 3300046475 Bacteria 12814
854 Ga0495639_0005266 3300046475 Bacteria 5562
855 Ga0495662_0000599 3300046476 Bacteria 16654
856 Ga0495662_0032239 3300046476 Bacteria 2531
857 Ga0495662_0041930 3300046476 Bacteria 2209
858 Ga0495662_0152150 3300046476 Bacteria 1139
859 Ga0495662_0491309 3300046476 Unclassified 602
860 Ga0495664_0001780 3300046477 Bacteria 11436
861 Ga0495664_0008385 3300046477 Bacteria 5765
862 Ga0495664_0089917 3300046477 Bacteria 1846
863 Ga0495664_0120397 3300046477 Bacteria 1587
864 Ga0495664_0173742 3300046477 Bacteria 1307
865 Ga0495584_0019476 3300046491 Bacteria 3447
866 Ga0495584_0036802 3300046491 Bacteria 2472
867 Ga0495584_0292132 3300046491 Bacteria 828
868 Ga0495585_0012307 3300046492 Bacteria 5040
869 Ga0495594_0000660 3300046499 Bacteria 17845
870 Ga0495594_0023664 3300046499 Bacteria 3293
871 Ga0495607_0012298 3300046501 Bacteria 5658
872 Ga0495608_0000844 3300046511 Bacteria 21431
873 Ga0495608_0029605 3300046511 Bacteria 3712
874 Ga0495608_0160962 3300046511 Bacteria 1427
875 Ga0495608_0299470 3300046511 Bacteria 996
876 Ga0495618_0003351 3300046514 Bacteria 9989
877 Ga0495618_0006349 3300046514 Bacteria 7176
878 Ga0495618_0010591 3300046514 Bacteria 5579
879 Ga0495618_0112356 3300046514 Bacteria 1744
880 Ga0495618_0239850 3300046514 Bacteria 1140
881 Ga0495628_0017046 3300046516 Bacteria 6053
882 Ga0495628_0022156 3300046516 Bacteria 5221
883 Ga0495628_0079335 3300046516 Bacteria 2552
884 Ga0495628_0201198 3300046516 Bacteria 1501
885 Ga0495628_0743799 3300046516 Bacteria 689
886 Ga0495630_0031825 3300046517 Bacteria 3928
887 Ga0495630_0093594 3300046517 Bacteria 2271
888 Ga0495630_0282768 3300046517 Bacteria 1267
889 Ga0495630_0718255 3300046517 Bacteria 764
890 Ga0495630_0733912 3300046517 Bacteria 755
891 Ga0495631_0137035 3300046518 Bacteria 1051
892 Ga0495637_0020659 3300046520 Bacteria 3027
893 Ga0495644_0001924 3300046523 Bacteria 8344
894 Ga0495666_0005432 3300046526 Bacteria 6419
895 Ga0495666_0020312 3300046526 Bacteria 3292
896 Ga0495666_0087088 3300046526 Bacteria 1475
897 Ga0495652_0001947 3300046529 Bacteria 21945
898 Ga0495652_0003249 3300046529 Bacteria 16200
899 Ga0495652_0012241 3300046529 Bacteria 7747
900 Ga0495652_0026434 3300046529 Bacteria 5129
901 Ga0495652_0681172 3300046529 Bacteria 693
902 Ga0495665_0000185 3300046531 Bacteria 31863
903 Ga0495665_0007528 3300046531 Bacteria 5894
904 Ga0495665_0009023 3300046531 Bacteria 5410
905 Ga0495640_0006612 3300046533 Bacteria 9144
906 Ga0495640_0006875 3300046533 Bacteria 8963
907 Ga0495640_0113867 3300046533 Bacteria 1764
908 Ga0495640_0149666 3300046533 Bacteria 1500
909 Ga0495640_0153330 3300046533 Bacteria 1479
910 Ga0495586_0003393 3300046535 Bacteria 8540
911 Ga0495586_0028093 3300046535 Bacteria 3010
912 Ga0495586_0302512 3300046535 Bacteria 916
913 Ga0495587_0000732 3300046536 Bacteria 21969
914 Ga0495587_0011211 3300046536 Bacteria 5683
915 Ga0495587_0045682 3300046536 Bacteria 2602
916 Ga0495587_0525530 3300046536 Bacteria 653
917 Ga0495645_0003961 3300046543 Bacteria 10097
918 Ga0495645_0005829 3300046543 Bacteria 8500
919 Ga0495645_0028789 3300046543 Bacteria 4037
920 Ga0495645_0080798 3300046543 Bacteria 2333
921 Ga0495622_0001379 3300046557 Bacteria 12379
922 Ga0495622_0028177 3300046557 Bacteria 2622
923 Ga0495622_0277214 3300046557 Bacteria 734
924 Ga0495633_0004731 3300046558 Bacteria 8549
925 Ga0495667_0002039 3300046559 Bacteria 13390
926 Ga0495667_0002260 3300046559 Bacteria 12888
927 Ga0495667_0007395 3300046559 Bacteria 7447
928 Ga0495667_0008839 3300046559 Bacteria 6849
929 Ga0495667_0076054 3300046559 Bacteria 2184
930 Ga0495667_0451324 3300046559 Bacteria 808
931 Ga0495656_0000505 3300046615 Bacteria 12799
932 Ga0495634_0005916 3300046642 Bacteria 9344
933 Ga0495634_0006195 3300046642 Bacteria 9115
934 Ga0495634_0027885 3300046642 Bacteria 3925
935 Ga0495634_0047227 3300046642 Bacteria 2902
936 Ga0495634_0136594 3300046642 Bacteria 1559
937 Ga0495611_0018877 3300046648 Bacteria 2959
938 Ga0495635_0002667 3300046663 Bacteria 12193
939 Ga0495635_0008996 3300046663 Bacteria 6966
940 Ga0495635_0018383 3300046663 Bacteria 4878
941 Ga0495635_0035752 3300046663 Bacteria 3444
942 Ga0495635_0145691 3300046663 Bacteria 1612
943 Ga0495635_0374113 3300046663 Bacteria 948
944 Ga0495635_0485779 3300046663 Bacteria 814
945 Ga0495659_0000862 3300046664 Bacteria 10792
946 Ga0495661_0063190 3300046665 Bacteria 2190
947 Ga0495588_0000855 3300046674 Bacteria 13493
948 Ga0495588_0039197 3300046674 Bacteria 2413
949 Ga0495588_0042747 3300046674 Bacteria 2317
950 Ga0495657_0019080 3300046675 Bacteria 4953
951 Ga0495657_0037513 3300046675 Bacteria 3340
952 Ga0495657_0061658 3300046675 Bacteria 2480
953 Ga0495657_0257047 3300046675 Bacteria 1050
954 Ga0495599_0013241 3300046678 Bacteria 5096
955 Ga0495599_0037130 3300046678 Bacteria 3060
956 Ga0495599_0052645 3300046678 Bacteria 2550
957 Ga0495599_0149186 3300046678 Bacteria 1449
958 Ga0495623_0003160 3300046679 Bacteria 10870
959 Ga0495623_0040188 3300046679 Bacteria 2987
960 Ga0495623_0078630 3300046679 Bacteria 2044
961 Ga0495646_0000681 3300046680 Bacteria 18660
962 Ga0495646_0009918 3300046680 Bacteria 6052
963 Ga0495646_0316385 3300046680 Bacteria 823
964 Ga0495647_0001556 3300046681 Bacteria 7080
965 Ga0495647_0006977 3300046681 Bacteria 3765
966 Ga0495647_0010913 3300046681 Bacteria 3103
967 Ga0495647_0016276 3300046681 Bacteria 2615
968 Ga0495647_0392571 3300046681 Bacteria 636
969 Ga0495658_0000453 3300046683 Bacteria 22768
970 Ga0495658_0000640 3300046683 Bacteria 18972
971 Ga0495658_0003124 3300046683 Bacteria 8268
972 Ga0495658_0011916 3300046683 Bacteria 4387
973 Ga0495658_0303236 3300046683 Bacteria 1011
974 Ga0495669_0000388 3300046684 Bacteria 21895
975 Ga0495613_0000450 3300046689 Bacteria 35062
976 Ga0495613_0010177 3300046689 Bacteria 6988
977 Ga0495613_0059445 3300046689 Bacteria 2802
978 Ga0495624_0000990 3300046690 Bacteria 22455
979 Ga0495624_0168685 3300046690 Bacteria 1335
980 Ga0495624_0178317 3300046690 Bacteria 1295
981 Ga0495624_0352902 3300046690 Bacteria 884
982 Ga0495670_0014504 3300046691 Bacteria 3873
983 Ga0495600_0000326 3300046809 Bacteria 25282
984 Ga0495600_0001691 3300046809 Bacteria 12333
985 Ga0495600_0055531 3300046809 Bacteria 2586
986 Ga0495600_0088439 3300046809 Bacteria 2021
987 Ga0495581_0000462 3300047315 Bacteria 20789
988 Ga0495581_0002835 3300047315 Bacteria 9903
989 Ga0495581_0010642 3300047315 Bacteria 5317
990 Ga0495581_0034799 3300047315 Bacteria 2915
991 Ga0495604_0000643 3300047317 Bacteria 29876
992 Ga0495604_0001763 3300047317 Bacteria 17689
993 Ga0495604_0002511 3300047317 Bacteria 14648
994 Ga0495604_0050376 3300047317 Bacteria 3234
995 Ga0495674_0003479 3300047319 Bacteria 15302
996 Ga0495674_0008425 3300047319 Bacteria 9822
997 Ga0495674_0027234 3300047319 Bacteria 5224
998 Ga0495674_0039411 3300047319 Bacteria 4235
999 Ga0495674_0064848 3300047319 Bacteria 3174
1000 Ga0495676_0003716 3300047321 Bacteria 13857
1001 Ga0495676_0054793 3300047321 Bacteria 3167
1002 Ga0495680_0001401 3300047322 Bacteria 26002
1003 Ga0495680_0006685 3300047322 Bacteria 10678
1004 Ga0495680_0006889 3300047322 Bacteria 10490
1005 Ga0495680_0012123 3300047322 Bacteria 7605
1006 Ga0495680_0021937 3300047322 Bacteria 5336
1007 Ga0495680_0086555 3300047322 Bacteria 2357
1008 Ga0495680_0094543 3300047322 Bacteria 2236
1009 Ga0495675_0005017 3300047444 Bacteria 8053
1010 Ga0495675_0031377 3300047444 Bacteria 3392
1011 Ga0495675_0033575 3300047444 Bacteria 3275
1012 Ga0495679_013128 3300047446 Bacteria 3123
1013 Ga0495684_0020107 3300047471 Bacteria 5142
1014 Ga0495684_0042671 3300047471 Bacteria 3473
1015 Ga0495684_0052577 3300047471 Bacteria 3109
1016 Ga0495684_0087324 3300047471 Bacteria 2364
1017 Ga0495684_0317133 3300047471 Bacteria 1115
1018 Ga0495593_0000730 3300047673 Bacteria 19058
1019 Ga0495593_0002845 3300047673 Bacteria 10425
1020 Ga0495593_0245199 3300047673 Bacteria 897
1021 Ga0495593_0326769 3300047673 Bacteria 767
1022 Ga0495602_0003673 3300048088 Bacteria 15906
1023 Ga0495602_0005637 3300048088 Bacteria 13125
1024 Ga0495602_0010516 3300048088 Bacteria 9605
1025 Ga0495602_0405624 3300048088 Bacteria 971
1026 Ga0495602_0427578 3300048088 Bacteria 939
1027 Ga0495602_0434578 3300048088 Bacteria 929
1028 Ga0495614_0013295 3300048089 Bacteria 3610
1029 Ga0495614_0021658 3300048089 Bacteria 2775
1030 Ga0495614_0064188 3300048089 Bacteria 1579
1031 Ga0496100_0003708 3300048903 Bacteria 8002
1032 Ga0496100_0076198 3300048903 Bacteria 2251
1033 Ga0496100_0158496 3300048903 Bacteria 1621
1034 Ga0496100_0507676 3300048903 Bacteria 929
1035 Ga0496101_0012951 3300048904 Bacteria 5577
1036 Ga0496101_0074915 3300048904 Bacteria 2490
1037 Ga0496101_0310860 3300048904 Bacteria 1235
1038 Ga0496101_0405182 3300048904 Bacteria 1074
1039 Ga0496102_0002938 3300048905 Bacteria 14454
1040 Ga0496102_0131440 3300048905 Bacteria 2344
1041 Ga0496102_0332539 3300048905 Bacteria 1431
1042 Ga0496102_0515200 3300048905 Bacteria 1118
1043 Ga0496103_0003026 3300048906 Bacteria 10356
1044 Ga0496103_0013998 3300048906 Bacteria 4762
1045 Ga0496103_0028943 3300048906 Bacteria 3365
1046 Ga0496103_0279927 3300048906 Bacteria 1073
1047 Ga0496103_0455931 3300048906 Bacteria 820
1048 Ga0496103_1020430 3300048906 Bacteria 514
1049 Ga0496104_0000741 3300048907 Bacteria 27998
1050 Ga0496104_0194289 3300048907 Bacteria 1941
1051 Ga0496104_0208547 3300048907 Bacteria 1866
1052 Ga0496104_0303240 3300048907 Bacteria 1509
1053 Ga0496104_0342230 3300048907 Bacteria 1408
1054 Ga0496104_0424694 3300048907 Bacteria 1241
1055 Ga0496105_0011046 3300048908 Bacteria 7119
1056 Ga0496105_0019370 3300048908 Bacteria 5488
1057 Ga0496106_0009990 3300048909 Bacteria 7008
1058 Ga0496106_0037988 3300048909 Bacteria 3602
1059 Ga0496106_0062646 3300048909 Bacteria 2824
1060 Ga0496106_0088279 3300048909 Bacteria 2390
1061 Ga0496106_0195793 3300048909 Bacteria 1608
1062 Ga0496106_0342064 3300048909 Bacteria 1201
1063 Ga0496106_1027894 3300048909 Bacteria 647
1064 Ga0496107_0015547 3300048910 Bacteria 5336
1065 Ga0496107_0054442 3300048910 Bacteria 2887
1066 Ga0496107_0104657 3300048910 Bacteria 2077
1067 Ga0496107_0301202 3300048910 Bacteria 1193
1068 Ga0496107_0411688 3300048910 Bacteria 1005
1069 Ga0496108_0007653 3300048911 Bacteria 8745
1070 Ga0496108_0078821 3300048911 Bacteria 2788
1071 Ga0496108_0092967 3300048911 Bacteria 2565
1072 Ga0496108_0241538 3300048911 Bacteria 1571
1073 Ga0496108_0322150 3300048911 Bacteria 1347
1074 Ga0496108_0975060 3300048911 Bacteria 725
1075 Ga0496109_0000526 3300048912 Bacteria 32410
1076 Ga0496109_0040880 3300048912 Bacteria 4200
1077 Ga0496109_0064201 3300048912 Bacteria 3359
1078 Ga0496109_0286158 3300048912 Bacteria 1554
1079 Ga0496109_0500862 3300048912 Bacteria 1146
1080 Ga0496109_0910820 3300048912 Bacteria 817
1081 Ga0496110_0079401 3300048913 Bacteria 2922
1082 Ga0496110_0080027 3300048913 Bacteria 2910
1083 Ga0496110_0483296 3300048913 Bacteria 1128
1084 Ga0496110_1383825 3300048913 Bacteria 613
1085 Ga0496111_0030122 3300048914 Bacteria 3858
1086 Ga0496111_0199372 3300048914 Bacteria 1488
1087 Ga0496111_0206615 3300048914 Bacteria 1459
1088 Ga0496112_0046760 3300048915 Bacteria 4245
1089 Ga0496112_0084195 3300048915 Bacteria 3145
1090 Ga0496112_0207537 3300048915 Bacteria 1917
1091 Ga0496112_0279844 3300048915 Bacteria 1616
1092 Ga0496112_1113207 3300048915 Bacteria 708
1093 Ga0496113_0001026 3300048916 Bacteria 15018
1094 Ga0496113_0041681 3300048916 Bacteria 3389
1095 Ga0496113_0075727 3300048916 Bacteria 2569
1096 Ga0496113_0184655 3300048916 Bacteria 1653
1097 Ga0496113_0233463 3300048916 Bacteria 1467
1098 Ga0496113_0401727 3300048916 Bacteria 1100
1099 Ga0496113_0962263 3300048916 Bacteria 673
1100 Ga0496114_0018559 3300048917 Bacteria 5626
1101 Ga0496114_0019225 3300048917 Bacteria 5535
1102 Ga0496114_0023712 3300048917 Bacteria 5008
1103 Ga0496115_0019401 3300048918 Bacteria 5231
1104 Ga0496115_0046484 3300048918 Bacteria 3469
1105 Ga0496115_0205546 3300048918 Bacteria 1626
1106 Ga0496115_0397562 3300048918 Bacteria 1119
1107 Ga0496115_0821283 3300048918 Bacteria 722
1108 Ga0501031_0131424 3300049568 Bacteria 1635
1109 Ga0501031_0271447 3300049568 Bacteria 1101
1110 Ga0501031_0492068 3300049568 Bacteria 791
1111 Ga0501032_0037119 3300049569 Bacteria 3324
1112 Ga0501032_0116694 3300049569 Bacteria 1765
1113 Ga0501033_0067408 3300049570 Bacteria 2631
1114 Ga0501034_0000097 3300049571 Bacteria 161027
1115 Ga0501034_0119692 3300049571 Bacteria 2619
1116 Ga0501034_0127255 3300049571 Bacteria 2532
1117 Ga0501034_0154152 3300049571 Bacteria 2272
1118 Ga0501034_0307575 3300049571 Bacteria 1520
1119 Ga0501034_1279021 3300049571 Bacteria 611
1120 Ga0501036_0100044 3300049572 Bacteria 2452
1121 Ga0501036_0662789 3300049572 Bacteria 863
1122 Ga0501037_0033917 3300049573 Bacteria 3769
1123 Ga0501037_0113612 3300049573 Bacteria 1949
1124 Ga0501037_0129663 3300049573 Bacteria 1809
1125 Ga0501038_0014583 3300049574 Bacteria 7162
1126 Ga0501038_0044497 3300049574 Bacteria 3856
1127 Ga0501039_0262273 3300049575 Bacteria 1358
1128 Ga0501039_0569401 3300049575 Bacteria 889
1129 Ga0501042_1403239 3300049578 Bacteria 509
1130 Ga0501043_0004428 3300049579 Bacteria 11409
1131 Ga0501043_0241481 3300049579 Bacteria 1393
1132 Ga0501043_0350381 3300049579 Bacteria 1122
1133 Ga0501043_0502099 3300049579 Bacteria 906
1134 Ga0501046_0000592 3300049580 Bacteria 35637
1135 Ga0501046_0184946 3300049580 Bacteria 1556
1136 Ga0501046_0973063 3300049580 Bacteria 590
1137 Ga0501046_0982833 3300049580 Bacteria 586
1138 Ga0501047_0063697 3300049581 Bacteria 3556
1139 Ga0501047_0079115 3300049581 Bacteria 3161
1140 Ga0501047_0138641 3300049581 Bacteria 2311
1141 Ga0501047_0211652 3300049581 Bacteria 1797
1142 Ga0501047_0380733 3300049581 Bacteria 1245
1143 Ga0501047_0488879 3300049581 Bacteria 1058
1144 Ga0501048_0402738 3300049582 Bacteria 978
1145 Ga0501067_0203147 3300049583 Bacteria 1104
1146 Ga0501068_0485764 3300049584 Bacteria 800
1147 Ga0501070_0110549 3300049586 Bacteria 2271
1148 Ga0501070_0200175 3300049586 Bacteria 1640
1149 Ga0501070_0209609 3300049586 Bacteria 1600
1150 Ga0501070_0274029 3300049586 Bacteria 1377
1151 Ga0501071_0144258 3300049587 Bacteria 1774
1152 Ga0501072_0356753 3300049588 Bacteria 1161
1153 Ga0501072_0745018 3300049588 Bacteria 769
1154 Ga0501073_0072222 3300049589 Bacteria 2403
1155 Ga0501073_0505909 3300049589 Bacteria 835
1156 Ga0501074_0029297 3300049590 Bacteria 3988
1157 Ga0501074_0175972 3300049590 Bacteria 1527
1158 Ga0501074_1124237 3300049590 Bacteria 551
1159 Ga0501076_0464933 3300049592 Bacteria 1042
1160 Ga0501080_0122468 3300049742 Bacteria 2409
1161 Ga0501080_0340580 3300049742 Bacteria 1355
1162 Ga0501080_1020047 3300049742 Bacteria 717
1163 Ga0501081_0621635 3300049743 Bacteria 809
1164 Ga0501083_0037630 3300049744 Bacteria 3294
1165 Ga0501035_0076196 3300049822 Bacteria 2966
1166 Ga0501035_0155636 3300049822 Bacteria 1981
1167 Ga0501035_0435187 3300049822 Bacteria 1087
1168 Ga0501035_1524383 3300049822 Bacteria 509
1169 Ga0501044_0137076 3300049823 Bacteria 2438
1170 Ga0501044_0179838 3300049823 Bacteria 2082
1171 Ga0501044_0320487 3300049823 Bacteria 1474
1172 Ga0501044_1140455 3300049823 Bacteria 648
1173 Ga0501045_0255643 3300049824 Bacteria 1304
1174 nmdc:mga00v17_304884_c1 3300050491 Bacteria 1034
1175 nmdc:mga06z11_294277_c1 3300050494 Bacteria 964
1176 nmdc:mga06z11_426718_c1 3300050494 Bacteria 799
1177 nmdc:mga07m45_367446_c1 3300050496 Bacteria 836
1178 nmdc:mga05p37_13983_c1 3300050507 Bacteria 9625
1179 nmdc:mga05p37_30534_c1 3300050507 Bacteria 6575
1180 nmdc:mga09592_5091_c1 3300050508 Bacteria 10670
1181 nmdc:mga0qj67_15114_c1 3300050509 Bacteria 5842
1182 nmdc:mga06r32_14111_c1 3300050510 Bacteria 7248
1183 nmdc:mga06r32_764267_c1 3300050510 Bacteria 929
1184 nmdc:mga06r32_88354_c1 3300050510 Bacteria 3025
1185 nmdc:mga08y16_15444_c1 3300050511 Bacteria 8031
1186 nmdc:mga08y16_56956_c1 3300050511 Bacteria 4085
1187 nmdc:mga0n895_1237189_c1 3300050512 Bacteria 719
1188 nmdc:mga0n895_14103_c1 3300050512 Bacteria 7245
1189 nmdc:mga0n895_18419_c1 3300050512 Bacteria 6462
1190 nmdc:mga0n895_272211_c1 3300050512 Bacteria 1718
1191 nmdc:mga0n895_27429_c1 3300050512 Bacteria 5411
1192 nmdc:mga0n895_384110_c1 3300050512 Bacteria 1421
1193 nmdc:mga0rr50_106723_c1 3300050513 Bacteria 2210
1194 nmdc:mga0rr50_247171_c1 3300050513 Bacteria 1480
1195 nmdc:mga0rr50_324699_c1 3300050513 Bacteria 1291
1196 nmdc:mga0rr50_52572_c1 3300050513 Bacteria 3028
1197 nmdc:mga0rr50_55233_c1 3300050513 Bacteria 2962
1198 nmdc:mga0rr50_7345_c1 3300050513 Bacteria 6788
1199 nmdc:mga08x19_178479_c1 3300050514 Bacteria 1449
1200 nmdc:mga08x19_198907_c1 3300050514 Bacteria 1373
1201 nmdc:mga08x19_352423_c1 3300050514 Bacteria 1028
1202 nmdc:mga0a205_19729_c1 3300050515 Bacteria 6361
1203 nmdc:mga0a205_295825_c2 3300050515 Bacteria 856
1204 nmdc:mga0a205_4498_c1 3300050515 Bacteria 12508
1205 nmdc:mga0a205_51984_c1 3300050515 Bacteria 3955
1206 Ga0495601_0001598 3300053077 Bacteria 12496
1207 Ga0495601_0003108 3300053077 Bacteria 9482
1208 Ga0495601_0005987 3300053077 Bacteria 7095
1209 Ga0495601_0016195 3300053077 Bacteria 4515
1210 Ga0495601_0376490 3300053077 Bacteria 922
1211 Ga0495612_0000389 3300053078 Bacteria 17611
1212 Ga0495612_0001478 3300053078 Bacteria 9675
1213 Ga0495612_0001959 3300053078 Bacteria 8479
1214 Ga0495612_0002008 3300053078 Bacteria 8382
1215 Ga0495612_0011538 3300053078 Bacteria 3560
1216 Ga0495612_0089477 3300053078 Bacteria 1301
1217 Ga0495595_0000245 3300053084 Bacteria 21413
1218 Ga0495595_0000948 3300053084 Bacteria 11166
1219 Ga0495595_0001617 3300053084 Bacteria 8798
1220 Ga0495595_0003200 3300053084 Bacteria 6495
1221 Ga0495595_0012754 3300053084 Bacteria 3540
1222 Ga0495619_0000097 3300053085 Bacteria 65411
1223 Ga0495619_0000374 3300053085 Bacteria 30825
1224 Ga0495619_0000478 3300053085 Bacteria 26805
1225 Ga0495619_0003878 3300053085 Bacteria 9612
1226 Ga0495619_0004827 3300053085 Bacteria 8559
1227 Ga0495619_0004978 3300053085 Bacteria 8438
1228 Ga0495619_0012506 3300053085 Bacteria 5346
1229 Ga0495619_0022784 3300053085 Bacteria 4010
1230 Ga0500566_0103427 3300053094 Bacteria 1558
1231 Ga0501084_0602417 3300054114 Bacteria 928
1232 Ga0501082_0230356 3300060353 Bacteria 1612
1233 Ga0501082_0465872 3300060353 Bacteria 1104
1234 Ga0373928_0028627
1235 SwRhRL2b_contig_309045
1236 2214770210
1237 ARcpr5oldR_c000101
1238 ARSoilYngRDRAFT_c00241
1239 ARcpr5yngRDRAFT_c000102
1240 ARSoilOldRDRAFT_c000134
1241 ARCol0oldRDRAFT_c00121
1242 ARCol0yngRDRAFT_1000058
1243 JGI24032J14994_100156
1244 JGI24741J21665_1022680
1245 JGI24752J21851_1000685
1246 JGI24746J21847_1000232
1247 JGI24747J21853_1000155
1248 JGI24739J22299_10000103
1249 JGI24737J22298_10001448
1250 JGI24737J22298_10029151
1251 JGI24743J22301_10004796
1252 JGI24750J21931_1000146
1253 JGI24745J21846_1000381
1254 JGI24748J21848_1000880
1255 JGI24738J21930_10000080
1256 JGI24749J21850_1007989
1257 JGI24749J21850_1021711
1258 JGI24744J21845_10034652
1259 JGI24035J26624_1000077
1260 JGI24033J26618_1000650
1261 JGI24034J26672_10000241
1262 JGI24742J22300_10000066
1263 JGI24751J29686_10004621
1264 JGI25405J52794_10022384
1265 JGI25405J52794_10038502
1266 Ga0065717_1002263
1267 Ga0065716_1001748
1268 Ga0065714_10034947
1269 Ga0065704_10073258
1270 Ga0065712_10006326
1271 Ga0065712_10077314
1272 Ga0065712_10082297
1273 Ga0065715_10089784
1274 Ga0065715_10119480
1275 Ga0065715_10153183
1276 Ga0065715_10328988
1277 Ga0065707_10406550
1278 Ga0070658_10216384
1279 Ga0070676_10010179
1280 Ga0070676_10865739
1281 Ga0070676_10910558
1282 Ga0070676_11497590
1283 Ga0070683_100000001
1284 Ga0070683_100001199
1285 Ga0070683_100102147
1286 Ga0070683_100216813
1287 Ga0070683_100304765
1288 Ga0070690_100034038
1289 Ga0070690_100041801
1290 Ga0070690_100217576
1291 Ga0070690_100666964
1292 Ga0070670_100037807
1293 Ga0070670_100057926
1294 Ga0070677_10000497
1295 Ga0068869_100000236
1296 Ga0070666_10008751
1297 Ga0070666_10085825
1298 Ga0070680_100007477
1299 Ga0070680_100152783
1300 Ga0070680_100287481
1301 Ga0070680_100343346
1302 Ga0070680_100879356
1303 Ga0070682_100002602
1304 Ga0070682_100692923
1305 Ga0070682_101076809
1306 Ga0068868_100013245
1307 Ga0070660_100003492
1308 Ga0070660_100101864
1309 Ga0070660_100102357
1310 Ga0070660_100293168
1311 Ga0070660_100553695
1312 Ga0070689_100000466
1313 Ga0070689_100116539
1314 Ga0070689_100345745
1315 Ga0070689_100655852
1316 Ga0070691_10002256
1317 Ga0070691_10589218
1318 Ga0070687_100000277
1319 Ga0070661_100000827
1320 Ga0070661_100449196
1321 Ga0070661_100867110
1322 Ga0070692_10142335
1323 Ga0070668_100010921
1324 Ga0070668_100121809
1325 Ga0070669_100002399
1326 Ga0070675_100005703
1327 Ga0070671_100000736
1328 Ga0070671_100119314
1329 Ga0070674_100010959
1330 Ga0070673_100000302
1331 Ga0070673_100092031
1332 Ga0070688_100050588
1333 Ga0070659_100001555
1334 Ga0070659_101766058
1335 Ga0070667_100002272
1336 Ga0070667_100065449
1337 Ga0070667_100120120
1338 Ga0070667_100197812
1339 Ga0070703_10001123
1340 Ga0070703_10339458
1341 Ga0070709_10016552
1342 Ga0070709_11366045
1343 Ga0070714_100043457
1344 Ga0070714_100080604
1345 Ga0070714_100175959
1346 Ga0070714_100775192
1347 Ga0070714_100792006
1348 Ga0070713_100121443
1349 Ga0070713_101071508
1350 Ga0070710_10016794
1351 Ga0070710_10022905
1352 Ga0070710_10242047
1353 Ga0070710_10421542
1354 Ga0070710_10538825
1355 Ga0070710_10773454
1356 Ga0070710_10955315
1357 Ga0070701_10000864
1358 Ga0070701_10358656
1359 Ga0070711_100080319
1360 Ga0070711_100098761
1361 Ga0070711_100103656
1362 Ga0070711_100115857
1363 Ga0070711_100157542
1364 Ga0070711_100369247
1365 Ga0070705_100001212
1366 Ga0070705_100030515
1367 Ga0070705_100100465
1368 Ga0070705_100342026
1369 Ga0070705_100558195
1370 Ga0070700_100001313
1371 Ga0070694_100003865
1372 Ga0070694_100071827
1373 Ga0070694_100148829
1374 Ga0070694_101206258
1375 Ga0070694_101371431
1376 Ga0070708_100784682
1377 Ga0070663_100021939
1378 Ga0070663_100199586
1379 Ga0070663_100408366
1380 Ga0070663_101257870
1381 Ga0070678_100005062
1382 Ga0070678_100013987
1383 Ga0070678_100133772
1384 Ga0070662_100086416
1385 Ga0070662_100141427
1386 Ga0070662_100212296
1387 Ga0070662_101191028
1388 Ga0070662_101399376
1389 Ga0070662_101603045
1390 Ga0070681_10058442
1391 Ga0070681_10325957
1392 Ga0070681_10358326
1393 Ga0070681_10934986
1394 Ga0070681_10961182
1395 Ga0070681_11840253
1396 Ga0068867_100001495
1397 Ga0068867_100306529
1398 Ga0070685_10005500
1399 Ga0070685_10005707
1400 Ga0070679_100021336
1401 Ga0070679_100064229
1402 Ga0070679_100179346
1403 Ga0070679_100333473
1404 Ga0070679_100422294
1405 Ga0070679_100651388
1406 Ga0070679_100711874
1407 Ga0070684_100005932
1408 Ga0070684_100368497
1409 Ga0070684_100526769
1410 Ga0070684_100727907
1411 Ga0070684_100746006
1412 Ga0070697_100028994
1413 Ga0070697_100216417
1414 Ga0070697_100432428
1415 Ga0068853_100000919
1416 Ga0068853_100201197
1417 Ga0068853_100228999
1418 Ga0068853_100237770
1419 Ga0068853_102200717
1420 Ga0070672_100004500
1421 Ga0070672_100278007
1422 Ga0070686_100000488
1423 Ga0070686_100154611
1424 Ga0070686_100323971
1425 Ga0070695_100002834
1426 Ga0070695_100137259
1427 Ga0070695_100210334
1428 Ga0070696_100038159
1429 Ga0070696_100039045
1430 Ga0070696_100134549
1431 Ga0070693_100002155
1432 Ga0070665_100949159
1433 Ga0070665_102256935
1434 Ga0070704_100009996
1435 Ga0070704_100016677
1436 Ga0068855_100007603
1437 Ga0068855_100147201
1438 Ga0068855_100210414
1439 Ga0068855_100518535
1440 Ga0068855_100535350
1441 Ga0068855_102128311
1442 Ga0070664_100002753
1443 Ga0070664_100059778
1444 Ga0070664_100405934
1445 Ga0070664_100878764
1446 Ga0068857_100001539
1447 Ga0068857_100860048
1448 Ga0068854_100002718
1449 Ga0068854_100873230
1450 Ga0068854_101185016
1451 Ga0068856_100001722
1452 Ga0068856_100472386
1453 Ga0068856_100978601
1454 Ga0068856_101898933
1455 Ga0070702_100007674
1456 Ga0070702_100074487
1457 Ga0068852_100001817
1458 Ga0068852_100101514
1459 Ga0068852_100345453
1460 Ga0068852_100388936
1461 Ga0068852_100923046
1462 Ga0068852_100927546
1463 Ga0068859_100010286
1464 Ga0068859_100055055
1465 Ga0068859_100067731
1466 Ga0068859_100445196
1467 Ga0068864_100002498
1468 Ga0068866_10004287
1469 Ga0068866_10079424
1470 Ga0068861_100000668
1471 Ga0068870_10000676
1472 Ga0068863_100004649
1473 Ga0068863_100576179
1474 Ga0068858_100008130
1475 Ga0068858_100190014
1476 Ga0068858_100266723
1477 Ga0068858_100435170
1478 Ga0068858_101283400
1479 Ga0068860_100007431
1480 Ga0068860_100055702
1481 Ga0068860_100209915
1482 Ga0068862_100008906
1483 Ga0068862_100317644
1484 Ga0068862_100324628
1485 Ga0068862_101889509
1486 Ga0081455_10000327
1487 Ga0070717_10001681
1488 Ga0070717_10089694
1489 Ga0070717_10186052
1490 Ga0070717_10350141
1491 Ga0070717_11575011
1492 Ga0075365_10742849
1493 Ga0075363_100062100
1494 Ga0075432_10008052
1495 Ga0075432_10053567
1496 Ga0070715_10023768
1497 Ga0070715_10143730
1498 Ga0070716_100007734
1499 Ga0070716_100494529
1500 Ga0070712_100006392
1501 Ga0070712_100150712
1502 Ga0070712_100160167
1503 Ga0070712_100260740
1504 Ga0070712_100267571
1505 Ga0075427_10003431
1506 Ga0097621_100000892
1507 Ga0097621_100097765
1508 Ga0097621_100152142
1509 Ga0075370_10490443
1510 Ga0068871_100010466
1511 Ga0068871_100034066
1512 Ga0068871_100086509
1513 Ga0075428_100035887
1514 Ga0075428_101735292
1515 Ga0075430_100007678
1516 Ga0075430_100042524
1517 Ga0075431_100007378
1518 Ga0075431_100438823
1519 Ga0075433_10002306
1520 Ga0075433_10090055
1521 Ga0075434_100000110
1522 Ga0075434_100023586
1523 Ga0075434_100023964
1524 Ga0075434_101468170
1525 Ga0075434_101632825
1526 Ga0075429_100006496
1527 Ga0068865_100000452
1528 Ga0068865_100127075
1529 Ga0068865_100523928
1530 Ga0075436_100251899
1531 Ga0075436_100342127
1532 Ga0097620_100010289
1533 Ga0097620_100055055
1534 Ga0097620_100067730
1535 Ga0097620_100445196
1536 Ga0075435_100066443
1537 Ga0075435_100069762
1538 Ga0075435_100277272
1539 Ga0105251_10032957
1540 Ga0105251_10227641
1541 Ga0105240_10377979
1542 Ga0105240_11153613
1543 Ga0111539_10002712
1544 Ga0111539_10011154
1545 Ga0111539_10016303
1546 Ga0111539_10379568
1547 Ga0111539_11230264
1548 Ga0105245_10000380
1549 Ga0105245_10175950
1550 Ga0105245_10495036
1551 Ga0105245_10998244
1552 Ga0105245_11129873
1553 Ga0105247_10095025
1554 Ga0105247_10095195
1555 Ga0114129_10058215
1556 Ga0114129_10086721
1557 Ga0105243_10002254
1558 Ga0105243_12385601
1559 Ga0105241_10000342
1560 Ga0105241_10273046
1561 Ga0105241_10321033
1562 Ga0105241_10469851
1563 Ga0105242_10000855
1564 Ga0105242_10114826
1565 Ga0105242_10126470
1566 Ga0105242_10455389
1567 Ga0105248_10012394
1568 Ga0105248_10027173
1569 Ga0105248_10227162
1570 Ga0105248_10566771
1571 Ga0105237_10165865
1572 Ga0105237_10350105
1573 Ga0105237_10670432
1574 Ga0105237_12039233
1575 Ga0105238_10053194
1576 Ga0105238_10161315
1577 Ga0105238_10282017
1578 Ga0105238_10791792
1579 Ga0105238_10865163
1580 Ga0105249_10001982
1581 Ga0105249_10019413
1582 Ga0105249_10089178
1583 Ga0105249_10818843
1584 Ga0105249_11646056
1585 Ga0105239_10012830
1586 Ga0105239_10042492
1587 Ga0105239_10132145
1588 Ga0105239_10172256
1589 Ga0105239_11111307
1590 Ga0105246_10000185
1591 Ga0105246_10231406
1592 Ga0157337_1015808
1593 Ga0157323_1021068
1594 Ga0157319_1045173
1595 Ga0157345_1041907
1596 Ga0157314_1017101
1597 Ga0157347_1021434
1598 Ga0157339_1015113
1599 Ga0157339_1026226
1600 Ga0157324_1027005
1601 Ga0157327_1029806
1602 Ga0157326_1002949
1603 Ga0157373_10130966
1604 Ga0157373_10162794
1605 Ga0157373_10296751
1606 Ga0157373_10867538
1607 Ga0157373_11148155
1608 Ga0157371_10006659
1609 Ga0157371_10648232
1610 Ga0157370_10577840
1611 Ga0157369_10323622
1612 Ga0157369_10777524
1613 Ga0157369_12367953
1614 Ga0157374_10001986
1615 Ga0157374_10033399
1616 Ga0157378_10001729
1617 Ga0157378_10166278
1618 Ga0157378_10322366
1619 Ga0157378_10846386
1620 Ga0163162_10012026
1621 Ga0163162_10026532
1622 Ga0163162_10057878
1623 Ga0163162_10990683
1624 Ga0163162_12184061
1625 Ga0157372_10024601
1626 Ga0157372_10593975
1627 Ga0157372_10632801
1628 Ga0157372_10645343
1629 Ga0157372_12640263
1630 Ga0157375_10001883
1631 Ga0157375_10030202
1632 Ga0163163_10010785
1633 Ga0163163_10295679
1634 Ga0157380_10007676
1635 Ga0157380_10869299
1636 Ga0157377_10000643
1637 Ga0157379_10010633
1638 Ga0157379_10026543
1639 Ga0157379_10599353
1640 Ga0157376_10000920
1641 Ga0157376_10426233
1642 Ga0157376_10578466
1643 Ga0157376_10680057
1644 Ga0163161_10000379
1645 Ga0163161_10737962
1646 Ga0163161_11339248
1647 Ga0206354_11424105
1648 Ga0213874_10147432
1649 Ga0213871_10124861
1650 Ga0207666_1000046
1651 Ga0207673_1000461
1652 Ga0207697_10000714
1653 Ga0207697_10045981
1654 Ga0207713_1076792
1655 Ga0207653_10004733
1656 Ga0207682_10000043
1657 Ga0207692_10007751
1658 Ga0207692_10055266
1659 Ga0207692_10641073
1660 Ga0207692_10931279
1661 Ga0207642_10002212
1662 Ga0207710_10002657
1663 Ga0207710_10004284
1664 Ga0207710_10079101
1665 Ga0207710_10086258
1666 Ga0207688_10000083
1667 Ga0207688_10036653
1668 Ga0207680_10005187
1669 Ga0207680_10116964
1670 Ga0207647_10025829
1671 Ga0207685_10015847
1672 Ga0207685_10064252
1673 Ga0207699_10012561
1674 Ga0207699_10035800
1675 Ga0207699_10065818
1676 Ga0207645_10002954
1677 Ga0207645_10015101
1678 Ga0207645_10160586
1679 Ga0207643_10000128
1680 Ga0207705_10397009
1681 Ga0207654_10001559
1682 Ga0207654_10550168
1683 Ga0207707_10004600
1684 Ga0207707_10210462
1685 Ga0207707_10619673
1686 Ga0207707_11349131
1687 Ga0207695_10598098
1688 Ga0207671_10013743
1689 Ga0207671_10151757
1690 Ga0207671_10422168
1691 Ga0207671_10529717
1692 Ga0207693_10008254
1693 Ga0207693_10012476
1694 Ga0207693_10022622
1695 Ga0207693_10116477
1696 Ga0207693_10208215
1697 Ga0207663_10016239
1698 Ga0207663_10197595
1699 Ga0207663_10253841
1700 Ga0207663_10470974
1701 Ga0207663_10931645
1702 Ga0207660_10001486
1703 Ga0207660_10483731
1704 Ga0207660_10484894
1705 Ga0207660_10535411
1706 Ga0207660_10790831
1707 Ga0207662_10000301
1708 Ga0207657_10001859
1709 Ga0207657_10047359
1710 Ga0207657_10107787
1711 Ga0207657_10327325
1712 Ga0207649_10003562
1713 Ga0207649_10046661
1714 Ga0207649_10650080
1715 Ga0207649_10718638
1716 Ga0207652_10016674
1717 Ga0207652_10046330
1718 Ga0207652_10153811
1719 Ga0207652_10259840
1720 Ga0207652_10441052
1721 Ga0207652_10561912
1722 Ga0207681_10004864
1723 Ga0207694_10076101
1724 Ga0207694_10457974
1725 Ga0207694_10570376
1726 Ga0207650_10019558
1727 Ga0207650_10690913
1728 Ga0207659_10000411
1729 Ga0207659_10374250
1730 Ga0207687_10000667
1731 Ga0207687_10259128
1732 Ga0207687_10473587
1733 Ga0207687_10675276
1734 Ga0207700_10000412
1735 Ga0207700_10040508
1736 Ga0207700_10189586
1737 Ga0207664_10107056
1738 Ga0207664_10202163
1739 Ga0207664_10385539
1740 Ga0207664_10731138
1741 Ga0207664_10882667
1742 Ga0207644_10005279
1743 Ga0207644_10009684
1744 Ga0207644_10100107
1745 Ga0207644_10280769
1746 Ga0207690_10002854
1747 Ga0207690_10015321
1748 Ga0207706_10004082
1749 Ga0207706_10031063
1750 Ga0207706_10211589
1751 Ga0207686_10000579
1752 Ga0207686_10033530
1753 Ga0207709_10000551
1754 Ga0207709_10104027
1755 Ga0207709_10171562
1756 Ga0207709_10183425
1757 Ga0207670_10000556
1758 Ga0207670_10394064
1759 Ga0207669_10000675
1760 Ga0207704_10002887
1761 Ga0207704_10109694
1762 Ga0207704_10501021
1763 Ga0207665_10014619
1764 Ga0207665_10146009
1765 Ga0207665_10214421
1766 Ga0207665_10453868
1767 Ga0207665_10736491
1768 Ga0207691_10000599
1769 Ga0207691_10063150
1770 Ga0207691_10118905
1771 Ga0207711_10010308
1772 Ga0207711_10073399
1773 Ga0207711_10312423
1774 Ga0207689_10000165
1775 Ga0207661_10008897
1776 Ga0207679_10000112
1777 Ga0207679_10044874
1778 Ga0207667_10017788
1779 Ga0207667_10038289
1780 Ga0207667_10091380
1781 Ga0207667_10614442
1782 Ga0207667_10842176
1783 Ga0207651_10000099
1784 Ga0207651_10555171
1785 Ga0207712_10019595
1786 Ga0207712_10135889
1787 Ga0207712_10267370
1788 Ga0207712_11515422
1789 Ga0207668_10000713
1790 Ga0207668_10142168
1791 Ga0207640_10002957
1792 Ga0207640_10619175
1793 Ga0207658_10003702
1794 Ga0207658_10067675
1795 Ga0207658_10206505
1796 Ga0207658_11001604
1797 Ga0207677_10010465
1798 Ga0207703_10018016
1799 Ga0207703_10058062
1800 Ga0207703_10122787
1801 Ga0207703_10336333
1802 Ga0207639_10002883
1803 Ga0207639_10250332
1804 Ga0207639_10449624
1805 Ga0207639_10925591
1806 Ga0207639_11053468
1807 Ga0207678_10001329
1808 Ga0207678_10029433
1809 Ga0207678_10036192
1810 Ga0207678_10328559
1811 Ga0207678_11000848
1812 Ga0207708_10000862
1813 Ga0207708_10113285
1814 Ga0207708_10458939
1815 Ga0207702_10007796
1816 Ga0207702_10148575
1817 Ga0207702_10606172
1818 Ga0207702_11838734
1819 Ga0207641_10001462
1820 Ga0207641_10242043
1821 Ga0207641_10730699
1822 Ga0207648_10001891
1823 Ga0207648_10081422
1824 Ga0207648_10288236
1825 Ga0207676_10001459
1826 Ga0207676_10136555
1827 Ga0207676_10376323
1828 Ga0207674_10006899
1829 Ga0207674_10212794
1830 Ga0207674_10333507
1831 Ga0207675_100001575
1832 Ga0207675_100040944
1833 Ga0207675_100387886
1834 Ga0207683_10001273
1835 Ga0207683_10004182
1836 Ga0207683_10026331
1837 Ga0207698_10000511
1838 Ga0207698_10006111
1839 Ga0207698_11324611
1840 Ga0207698_12227675
1841 Ga0209984_1026426
1842 Ga0209999_1042707
1843 Ga0210002_1002548
1844 Ga0210002_1036553
1845 Ga0209971_1020926
1846 Ga0209966_1002413
1847 Ga0209966_1007471
1848 Ga0209998_10001602
1849 Ga0209998_10009907
1850 Ga0209974_10020171
1851 Ga0207428_10000064
1852 Ga0207428_10003078
1853 Ga0207428_10006523
1854 Ga0268266_10010320
1855 Ga0268266_10052520
1856 Ga0268266_10741623
1857 Ga0268265_10003386
1858 Ga0268265_10064227
1859 Ga0268265_10312259
1860 Ga0268264_10003086
1861 Ga0268264_10162583
1862 Ga0268264_10508122
1863 Ga0265334_10062241
1864 Ga0265338_10258059
1865 Ga0265338_10396420
1866 Ga0265338_10727185
1867 Ga0265330_10288310
1868 Ga0265325_10000006
1869 Ga0265325_10015951
1870 Ga0265325_10049438
1871 Ga0265325_10086875
1872 Ga0265325_10304470
1873 Ga0265340_10216027
1874 Ga0265339_10060333
1875 Ga0265339_10233286
1876 Ga0265339_10329985
1877 Ga0265327_10001075
1878 Ga0307513_10000010
1879 Ga0265313_10001122
1880 Ga0265313_10005418
1881 Ga0265313_10009773
1882 Ga0265313_10065468
1883 Ga0265314_10078013
1884 Ga0265314_10254593
1885 Ga0265342_10001631
1886 Ga0265342_10109886
1887 Ga0307405_10764607
1888 Ga0307413_10613995
1889 Ga0307412_10328399
1890 Ga0307416_100416024
1891 Ga0307411_10771220
1892 Ga0307411_12094042
1893 Ga0307415_101150037
1894 Ga0373930_0153620
1895 Ga0373948_0008375
1896 Ga0373950_0000575
1897 Ga0373958_0002130
1898 Ga0373958_0002762
1899 Ga0373958_0004921
1900 Ga0373958_0005151
1901 Ga0373959_0001506
1902 Ga0373959_0014183
1903 Ga0373938_0000276
1904 Ga0373926_0022405
1905 Ga0373926_0059886
1906 Ga0373926_0093256
1907 Ga0373928_0000820
1908 Ga0373928_0146245
1909 Ga0373929_0002326
1910 Ga0373929_0027503
1911 Ga0373934_0023173
1912 Ga0373934_0088919
1913 Ga0373940_0000049
1914 Ga0373940_0002067
1915 Ga0373940_0378973
1916 Ga0373944_0006580
1917 Ga0373944_0037658
1918 Ga0373949_0001191
1919 Ga0373949_0002203
1920 Ga0373949_0007218
1921 Ga0373951_0000518
1922 Ga0373951_0022569
1923 Ga0373951_0036363
1924 Ga0373952_0000453
1925 Ga0373952_0000483
1926 Ga0373952_0023287
1927 Ga0373923_0001175
1928 Ga0373923_0068057
1929 Ga0373923_0071871
1930 Ga0373923_0139502
1931 Ga0373932_0000462
1932 Ga0373932_0018167
1933 Ga0373932_0059751
1934 Ga0373936_0000328
1935 Ga0373936_0393460
1936 Ga0373939_0001076
1937 Ga0373939_0003300
1938 Ga0373939_0003626
1939 Ga0373939_0014317
1940 Ga0373941_0048238
1941 Ga0373945_0000123
1942 Ga0373945_0075580
1943 Ga0373953_0017796
1944 Ga0373953_0035216
1945 Ga0373953_0394016
1946 Ga0373954_0012572
1947 Ga0373954_0503934
1948 Ga0373956_0045117
1949 Ga0373956_0083075
1950 Ga0373956_0139840
1951 Ga0373956_0218800
1952 Ga0373957_0002486
1953 Ga0373957_0004774
1954 Ga0373957_0047990
1955 Ga0373957_0123089
1956 Ga0373960_0001504
1957 Ga0373960_0008556
1958 Ga0373943_0001821
1959 Ga0373943_0028120
1960 Ga0373943_0079624
1961 Ga0373943_0117503
1962 Ga0373943_0156385
1963 Ga0373943_0183007
1964 Ga0373946_0003579
1965 Ga0373946_0006894
1966 Ga0373946_0018373
1967 Ga0373946_0029864
1968 Ga0373955_0001781
1969 Ga0373955_0003764
1970 Ga0373955_0008163
1971 Ga0373955_0053359
1972 Ga0373955_0125793
1973 Ga0373955_0445025
1974 Ga0373942_0004252
1975 Ga0373942_0023528
1976 Ga0373942_0226159
1977 Ga0373961_0260354
1978 Ga0373962_0000215
1979 Ga0373962_0001429
1980 Ga0373962_0002252
1981 Ga0373962_0041030
1982 Ga0373924_0005980
1983 Ga0373924_0145520
1984 Ga0373924_0202229
1985 Ga0373924_0292737
1986 Ga0373931_0004700
1987 Ga0373931_0014856
1988 Ga0373931_0021068
1989 Ga0373931_0047512
1990 Ga0373931_0047908
1991 Ga0373931_0149622
1992 Ga0373935_0008365
1993 Ga0373935_0008371
1994 Ga0373935_0010930
1995 Ga0373935_0128672
1996 Ga0373935_0136849
1997 Ga0373935_0162733
1998 Ga0373935_0243858
1999 Ga0373927_0002377
2000 Ga0373927_0009145
2001 Ga0373927_0059332
2002 Ga0373927_0357911
2003 Ga0373927_0822108
2004 Ga0373933_0003512
2005 Ga0373933_0005999
2006 Ga0373933_0014137
2007 Ga0373933_0502505
2008 Ga0373933_0563715
2009 Ga0373947_0002454
2010 Ga0373947_0003283
2011 Ga0373947_0005390
2012 Ga0373947_0028558
2013 Ga0373947_0155628
2014 Ga0373947_0203221
2015 Ga0373937_0000977
2016 Ga0373937_0000998
2017 Ga0373937_0011819
2018 Ga0373937_0067460
2019 Ga0373937_0075420
2020 Ga0373937_0076111
2021 Ga0373937_0281737
2022 Ga0316582_0590448
2023 Ga0373925_0002457
2024 Ga0373925_0005022
2025 Ga0373925_0027418
2026 Ga0373925_0109865
2027 Ga0436364_0196077
2028 Ga0436364_0693652
2029 Ga0242419_003577
2030 Ga0436365_1561377
2031 Ga0436365_1844700
2032 Ga0436360_0067312
2033 Ga0436360_0689073
2034 Ga0436360_0906468
2035 Ga0436360_1257893
2036 Ga0436363_0533112
2037 Ga0436363_0628984
2038 Ga0436363_1506293
2039 Ga0436363_1544118
2040 Ga0439453_0029892
2041 Ga0451793_1469895
2042 Ga0439441_017992
2043 Ga0439450_025650
2044 Ga0439455_0106715
2045 Ga0450923_174744
2046 Ga0439464_0150717
2047 Ga0451577_0110442
2048 Ga0451577_1318351
2049 Ga0439440_0213986
2050 Ga0466966_0993832
2051 Ga0451576_0105771
2052 Ga0451576_0433355
2053 Ga0495592_0002187
2054 Ga0495592_0003145
2055 Ga0495592_0011852
2056 Ga0495592_0153609
2057 Ga0495603_0000127
2058 Ga0495603_0006157
2059 Ga0495603_0010152
2060 Ga0495629_0000474
2061 Ga0495629_0001081
2062 Ga0495629_0001491
2063 Ga0495629_0095292
2064 Ga0495629_0241009
2065 Ga0495641_0000716
2066 Ga0495641_0042565
2067 Ga0495641_0079762
2068 Ga0495651_0001830
2069 Ga0495651_0005021
2070 Ga0495651_0063498
2071 Ga0495651_0076902
2072 Ga0495651_0191302
2073 Ga0495653_0001477
2074 Ga0495653_0002011
2075 Ga0495653_0117615
2076 Ga0495653_0302595
2077 Ga0495580_0000533
2078 Ga0495580_0001373
2079 Ga0495580_0029341
2080 Ga0495582_0000310
2081 Ga0495582_0001241
2082 Ga0495582_0088147
2083 Ga0495582_0126967
2084 Ga0495605_0061919
2085 Ga0495639_0000593
2086 Ga0495639_0000991
2087 Ga0495639_0005266
2088 Ga0495662_0000599
2089 Ga0495662_0032239
2090 Ga0495662_0041930
2091 Ga0495662_0152150
2092 Ga0495662_0491309
2093 Ga0495664_0001780
2094 Ga0495664_0008385
2095 Ga0495664_0089917
2096 Ga0495664_0120397
2097 Ga0495664_0173742
2098 Ga0495584_0019476
2099 Ga0495584_0036802
2100 Ga0495584_0292132
2101 Ga0495585_0012307
2102 Ga0495594_0000660
2103 Ga0495594_0023664
2104 Ga0495607_0012298
2105 Ga0495608_0000844
2106 Ga0495608_0029605
2107 Ga0495608_0160962
2108 Ga0495608_0299470
2109 Ga0495618_0003351
2110 Ga0495618_0006349
2111 Ga0495618_0010591
2112 Ga0495618_0112356
2113 Ga0495618_0239850
2114 Ga0495628_0017046
2115 Ga0495628_0022156
2116 Ga0495628_0079335
2117 Ga0495628_0201198
2118 Ga0495628_0743799
2119 Ga0495630_0031825
2120 Ga0495630_0093594
2121 Ga0495630_0282768
2122 Ga0495630_0718255
2123 Ga0495630_0733912
2124 Ga0495631_0137035
2125 Ga0495637_0020659
2126 Ga0495644_0001924
2127 Ga0495666_0005432
2128 Ga0495666_0020312
2129 Ga0495666_0087088
2130 Ga0495652_0001947
2131 Ga0495652_0003249
2132 Ga0495652_0012241
2133 Ga0495652_0026434
2134 Ga0495652_0681172
2135 Ga0495665_0000185
2136 Ga0495665_0007528
2137 Ga0495665_0009023
2138 Ga0495640_0006612
2139 Ga0495640_0006875
2140 Ga0495640_0113867
2141 Ga0495640_0149666
2142 Ga0495640_0153330
2143 Ga0495586_0003393
2144 Ga0495586_0028093
2145 Ga0495586_0302512
2146 Ga0495587_0000732
2147 Ga0495587_0011211
2148 Ga0495587_0045682
2149 Ga0495587_0525530
2150 Ga0495645_0003961
2151 Ga0495645_0005829
2152 Ga0495645_0028789
2153 Ga0495645_0080798
2154 Ga0495622_0001379
2155 Ga0495622_0028177
2156 Ga0495622_0277214
2157 Ga0495633_0004731
2158 Ga0495667_0002039
2159 Ga0495667_0002260
2160 Ga0495667_0007395
2161 Ga0495667_0008839
2162 Ga0495667_0076054
2163 Ga0495667_0451324
2164 Ga0495656_0000505
2165 Ga0495634_0005916
2166 Ga0495634_0006195
2167 Ga0495634_0027885
2168 Ga0495634_0047227
2169 Ga0495634_0136594
2170 Ga0495611_0018877
2171 Ga0495635_0002667
2172 Ga0495635_0008996
2173 Ga0495635_0018383
2174 Ga0495635_0035752
2175 Ga0495635_0145691
2176 Ga0495635_0374113
2177 Ga0495635_0485779
2178 Ga0495659_0000862
2179 Ga0495661_0063190
2180 Ga0495588_0000855
2181 Ga0495588_0039197
2182 Ga0495588_0042747
2183 Ga0495657_0019080
2184 Ga0495657_0037513
2185 Ga0495657_0061658
2186 Ga0495657_0257047
2187 Ga0495599_0013241
2188 Ga0495599_0037130
2189 Ga0495599_0052645
2190 Ga0495599_0149186
2191 Ga0495623_0003160
2192 Ga0495623_0040188
2193 Ga0495623_0078630
2194 Ga0495646_0000681
2195 Ga0495646_0009918
2196 Ga0495646_0316385
2197 Ga0495647_0001556
2198 Ga0495647_0006977
2199 Ga0495647_0010913
2200 Ga0495647_0016276
2201 Ga0495647_0392571
2202 Ga0495658_0000453
2203 Ga0495658_0000640
2204 Ga0495658_0003124
2205 Ga0495658_0011916
2206 Ga0495658_0303236
2207 Ga0495669_0000388
2208 Ga0495613_0000450
2209 Ga0495613_0010177
2210 Ga0495613_0059445
2211 Ga0495624_0000990
2212 Ga0495624_0168685
2213 Ga0495624_0178317
2214 Ga0495624_0352902
2215 Ga0495670_0014504
2216 Ga0495600_0000326
2217 Ga0495600_0001691
2218 Ga0495600_0055531
2219 Ga0495600_0088439
2220 Ga0495581_0000462
2221 Ga0495581_0002835
2222 Ga0495581_0010642
2223 Ga0495581_0034799
2224 Ga0495604_0000643
2225 Ga0495604_0001763
2226 Ga0495604_0002511
2227 Ga0495604_0050376
2228 Ga0495674_0003479
2229 Ga0495674_0008425
2230 Ga0495674_0027234
2231 Ga0495674_0039411
2232 Ga0495674_0064848
2233 Ga0495676_0003716
2234 Ga0495676_0054793
2235 Ga0495680_0001401
2236 Ga0495680_0006685
2237 Ga0495680_0006889
2238 Ga0495680_0012123
2239 Ga0495680_0021937
2240 Ga0495680_0086555
2241 Ga0495680_0094543
2242 Ga0495675_0005017
2243 Ga0495675_0031377
2244 Ga0495675_0033575
2245 Ga0495679_013128
2246 Ga0495684_0020107
2247 Ga0495684_0042671
2248 Ga0495684_0052577
2249 Ga0495684_0087324
2250 Ga0495684_0317133
2251 Ga0495593_0000730
2252 Ga0495593_0002845
2253 Ga0495593_0245199
2254 Ga0495593_0326769
2255 Ga0495602_0003673
2256 Ga0495602_0005637
2257 Ga0495602_0010516
2258 Ga0495602_0405624
2259 Ga0495602_0427578
2260 Ga0495602_0434578
2261 Ga0495614_0013295
2262 Ga0495614_0021658
2263 Ga0495614_0064188
2264 Ga0496100_0003708
2265 Ga0496100_0076198
2266 Ga0496100_0158496
2267 Ga0496100_0507676
2268 Ga0496101_0012951
2269 Ga0496101_0074915
2270 Ga0496101_0310860
2271 Ga0496101_0405182
2272 Ga0496102_0002938
2273 Ga0496102_0131440
2274 Ga0496102_0332539
2275 Ga0496102_0515200
2276 Ga0496103_0003026
2277 Ga0496103_0013998
2278 Ga0496103_0028943
2279 Ga0496103_0279927
2280 Ga0496103_0455931
2281 Ga0496103_1020430
2282 Ga0496104_0000741
2283 Ga0496104_0194289
2284 Ga0496104_0208547
2285 Ga0496104_0303240
2286 Ga0496104_0342230
2287 Ga0496104_0424694
2288 Ga0496105_0011046
2289 Ga0496105_0019370
2290 Ga0496106_0009990
2291 Ga0496106_0037988
2292 Ga0496106_0062646
2293 Ga0496106_0088279
2294 Ga0496106_0195793
2295 Ga0496106_0342064
2296 Ga0496106_1027894
2297 Ga0496107_0015547
2298 Ga0496107_0054442
2299 Ga0496107_0104657
2300 Ga0496107_0301202
2301 Ga0496107_0411688
2302 Ga0496108_0007653
2303 Ga0496108_0078821
2304 Ga0496108_0092967
2305 Ga0496108_0241538
2306 Ga0496108_0322150
2307 Ga0496108_0975060
2308 Ga0496109_0000526
2309 Ga0496109_0040880
2310 Ga0496109_0064201
2311 Ga0496109_0286158
2312 Ga0496109_0500862
2313 Ga0496109_0910820
2314 Ga0496110_0079401
2315 Ga0496110_0080027
2316 Ga0496110_0483296
2317 Ga0496110_1383825
2318 Ga0496111_0030122
2319 Ga0496111_0199372
2320 Ga0496111_0206615
2321 Ga0496112_0046760
2322 Ga0496112_0084195
2323 Ga0496112_0207537
2324 Ga0496112_0279844
2325 Ga0496112_1113207
2326 Ga0496113_0001026
2327 Ga0496113_0041681
2328 Ga0496113_0075727
2329 Ga0496113_0184655
2330 Ga0496113_0233463
2331 Ga0496113_0401727
2332 Ga0496113_0962263
2333 Ga0496114_0018559
2334 Ga0496114_0019225
2335 Ga0496114_0023712
2336 Ga0496115_0019401
2337 Ga0496115_0046484
2338 Ga0496115_0205546
2339 Ga0496115_0397562
2340 Ga0496115_0821283
2341 Ga0501031_0131424
2342 Ga0501031_0271447
2343 Ga0501031_0492068
2344 Ga0501032_0037119
2345 Ga0501032_0116694
2346 Ga0501033_0067408
2347 Ga0501034_0000097
2348 Ga0501034_0119692
2349 Ga0501034_0127255
2350 Ga0501034_0154152
2351 Ga0501034_0307575
2352 Ga0501034_1279021
2353 Ga0501036_0100044
2354 Ga0501036_0662789
2355 Ga0501037_0033917
2356 Ga0501037_0113612
2357 Ga0501037_0129663
2358 Ga0501038_0014583
2359 Ga0501038_0044497
2360 Ga0501039_0262273
2361 Ga0501039_0569401
2362 Ga0501042_1403239
2363 Ga0501043_0004428
2364 Ga0501043_0241481
2365 Ga0501043_0350381
2366 Ga0501043_0502099
2367 Ga0501046_0000592
2368 Ga0501046_0184946
2369 Ga0501046_0973063
2370 Ga0501046_0982833
2371 Ga0501047_0063697
2372 Ga0501047_0079115
2373 Ga0501047_0138641
2374 Ga0501047_0211652
2375 Ga0501047_0380733
2376 Ga0501047_0488879
2377 Ga0501048_0402738
2378 Ga0501067_0203147
2379 Ga0501068_0485764
2380 Ga0501070_0110549
2381 Ga0501070_0200175
2382 Ga0501070_0209609
2383 Ga0501070_0274029
2384 Ga0501071_0144258
2385 Ga0501072_0356753
2386 Ga0501072_0745018
2387 Ga0501073_0072222
2388 Ga0501073_0505909
2389 Ga0501074_0029297
2390 Ga0501074_0175972
2391 Ga0501074_1124237
2392 Ga0501076_0464933
2393 Ga0501080_0122468
2394 Ga0501080_0340580
2395 Ga0501080_1020047
2396 Ga0501081_0621635
2397 Ga0501083_0037630
2398 Ga0501035_0076196
2399 Ga0501035_0155636
2400 Ga0501035_0435187
2401 Ga0501035_1524383
2402 Ga0501044_0137076
2403 Ga0501044_0179838
2404 Ga0501044_0320487
2405 Ga0501044_1140455
2406 Ga0501045_0255643
2407 nmdc:mga00v17_304884_c1
2408 nmdc:mga06z11_294277_c1
2409 nmdc:mga06z11_426718_c1
2410 nmdc:mga07m45_367446_c1
2411 nmdc:mga05p37_13983_c1
2412 nmdc:mga05p37_30534_c1
2413 nmdc:mga09592_5091_c1
2414 nmdc:mga0qj67_15114_c1
2415 nmdc:mga06r32_14111_c1
2416 nmdc:mga06r32_764267_c1
2417 nmdc:mga06r32_88354_c1
2418 nmdc:mga08y16_15444_c1
2419 nmdc:mga08y16_56956_c1
2420 nmdc:mga0n895_1237189_c1
2421 nmdc:mga0n895_14103_c1
2422 nmdc:mga0n895_18419_c1
2423 nmdc:mga0n895_272211_c1
2424 nmdc:mga0n895_27429_c1
2425 nmdc:mga0n895_384110_c1
2426 nmdc:mga0rr50_106723_c1
2427 nmdc:mga0rr50_247171_c1
2428 nmdc:mga0rr50_324699_c1
2429 nmdc:mga0rr50_52572_c1
2430 nmdc:mga0rr50_55233_c1
2431 nmdc:mga0rr50_7345_c1
2432 nmdc:mga08x19_178479_c1
2433 nmdc:mga08x19_198907_c1
2434 nmdc:mga08x19_352423_c1
2435 nmdc:mga0a205_19729_c1
2436 nmdc:mga0a205_295825_c2
2437 nmdc:mga0a205_4498_c1
2438 nmdc:mga0a205_51984_c1
2439 Ga0495601_0001598
2440 Ga0495601_0003108
2441 Ga0495601_0005987
2442 Ga0495601_0016195
2443 Ga0495601_0376490
2444 Ga0495612_0000389
2445 Ga0495612_0001478
2446 Ga0495612_0001959
2447 Ga0495612_0002008
2448 Ga0495612_0011538
2449 Ga0495612_0089477
2450 Ga0495595_0000245
2451 Ga0495595_0000948
2452 Ga0495595_0001617
2453 Ga0495595_0003200
2454 Ga0495595_0012754
2455 Ga0495619_0000097
2456 Ga0495619_0000374
2457 Ga0495619_0000478
2458 Ga0495619_0003878
2459 Ga0495619_0004827
2460 Ga0495619_0004978
2461 Ga0495619_0012506
2462 Ga0495619_0022784
2463 Ga0500566_0103427
2464 Ga0501084_0602417
2465 Ga0501082_0230356
2466 Ga0501082_0465872

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22636

FlK

Fluoroacetyl-CoA-specific thioesterase

38

138

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvu-assembly1.cif.gz_A structural basis of the activity and substrate specificity of the fluoroacetyl-coa flk - t42s mutant in complex with acetyl-coa 0.9957 5 135
3kvi-assembly1.cif.gz_B structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk - t42a mutant in complex with fluoro-acetate 0.9873 5 135
3kx8-assembly1.cif.gz_B structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk 0.9873 5 135
3p3f-assembly2.cif.gz_D crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.985 5 132
3p3f-assembly3.cif.gz_E crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.9793 12 135
ID Description Score Start End Superfamily
3p3iA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9769 5 135 3.10.129.10
3p3iA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9416 5 135 3.10.129.10
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9398 5 136 3.10.129.10
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9257 5 136 3.10.129.10
2q78A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8894 1 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2S8CHT1-F1-model_v4 Thioesterase 0.9953 1 131
AF-A0A164MI44-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9937 5 140
AF-A0A257UHG3-F1-model_v4 deleted 0.9926 1 138
AF-A0A2N3PU70-F1-model_v4 Thioesterase 0.9925 1 138
AF-A0A1U7JCY2-F1-model_v4 Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein 0.9922 1 144

Map