F492016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1233 | 447 | 2466 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300035084|Ga0373928_0028627|Ga0373928_0028627_249_719 |
| Length | 156 |
| Sequence | MRRRRPKGRGRKYEADPETRSQTFILLQSAGEQTVPYTYPESPIIVQMPKVFATGFMIVLMEWTCTQLMEPHLDAGEGSLGTHVDVSHLAATPIGFTVKVDAELVAVDGRKLTFEVRAHDGKDLIGEGRHERVVVAWDRFNAKVAEKVKSAAEMVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 11 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 12 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 13 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 14 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 25 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 26 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 27 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 31 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 145 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 146 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 147 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 148 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 149 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 150 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 151 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 152 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 153 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 171 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 172 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 255 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 258 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 259 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 268 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 270 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 275 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 276 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 282 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 286 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 292 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 299 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 303 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 304 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 305 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 309 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 312 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 313 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 314 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 315 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 316 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 317 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 318 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 319 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 320 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 321 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 322 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 389 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 390 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 391 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 392 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 393 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 394 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 397 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 398 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 399 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 400 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 401 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 402 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 431 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 432 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 446 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.92 |
| Metatranscriptomes | 0.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 6.33 |
| Rhizosphere | 92.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373928_0028627 | 3300035084 | Bacteria | 1220 |
| 2 | SwRhRL2b_contig_309045 | 2162886007 | Bacteria | 1975 |
| 3 | 2214770210 | 2209111006 | Bacteria | 2695 |
| 4 | ARcpr5oldR_c000101 | 3300000041 | Bacteria | 15420 |
| 5 | ARSoilYngRDRAFT_c00241 | 3300000042 | Bacteria | 8764 |
| 6 | ARcpr5yngRDRAFT_c000102 | 3300000043 | Bacteria | 13547 |
| 7 | ARSoilOldRDRAFT_c000134 | 3300000044 | Bacteria | 13034 |
| 8 | ARCol0oldRDRAFT_c00121 | 3300000045 | Bacteria | 6899 |
| 9 | ARCol0yngRDRAFT_1000058 | 3300000652 | Bacteria | 19902 |
| 10 | JGI24032J14994_100156 | 3300001430 | Bacteria | 3340 |
| 11 | JGI24741J21665_1022680 | 3300001915 | Bacteria | 972 |
| 12 | JGI24752J21851_1000685 | 3300001976 | Bacteria | 4517 |
| 13 | JGI24746J21847_1000232 | 3300001977 | Bacteria | 7655 |
| 14 | JGI24747J21853_1000155 | 3300001978 | Bacteria | 3390 |
| 15 | JGI24739J22299_10000103 | 3300001989 | Bacteria | 25576 |
| 16 | JGI24737J22298_10001448 | 3300001990 | Bacteria | 8467 |
| 17 | JGI24737J22298_10029151 | 3300001990 | Bacteria | 1732 |
| 18 | JGI24743J22301_10004796 | 3300001991 | Bacteria | 2223 |
| 19 | JGI24750J21931_1000146 | 3300002070 | Bacteria | 11547 |
| 20 | JGI24745J21846_1000381 | 3300002073 | Bacteria | 3881 |
| 21 | JGI24748J21848_1000880 | 3300002074 | Bacteria | 3254 |
| 22 | JGI24738J21930_10000080 | 3300002075 | Bacteria | 21134 |
| 23 | JGI24749J21850_1007989 | 3300002076 | Bacteria | 1472 |
| 24 | JGI24749J21850_1021711 | 3300002076 | Bacteria | 909 |
| 25 | JGI24744J21845_10034652 | 3300002077 | Bacteria | 957 |
| 26 | JGI24035J26624_1000077 | 3300002126 | Bacteria | 7943 |
| 27 | JGI24033J26618_1000650 | 3300002155 | Bacteria | 3318 |
| 28 | JGI24034J26672_10000241 | 3300002239 | Bacteria | 7230 |
| 29 | JGI24742J22300_10000066 | 3300002244 | Bacteria | 15346 |
| 30 | JGI24751J29686_10004621 | 3300002459 | Bacteria | 2797 |
| 31 | JGI25405J52794_10022384 | 3300003911 | Bacteria | 1282 |
| 32 | JGI25405J52794_10038502 | 3300003911 | Bacteria | 1007 |
| 33 | Ga0065717_1002263 | 3300005276 | Bacteria | 2305 |
| 34 | Ga0065716_1001748 | 3300005277 | Bacteria | 3601 |
| 35 | Ga0065714_10034947 | 3300005288 | Bacteria | 1167 |
| 36 | Ga0065704_10073258 | 3300005289 | Bacteria | 7373 |
| 37 | Ga0065712_10006326 | 3300005290 | Bacteria | 4719 |
| 38 | Ga0065712_10077314 | 3300005290 | Bacteria | 3474 |
| 39 | Ga0065712_10082297 | 3300005290 | Bacteria | 2928 |
| 40 | Ga0065715_10089784 | 3300005293 | Bacteria | 8534 |
| 41 | Ga0065715_10119480 | 3300005293 | Bacteria | 2285 |
| 42 | Ga0065715_10153183 | 3300005293 | Bacteria | 1706 |
| 43 | Ga0065715_10328988 | 3300005293 | Bacteria | 980 |
| 44 | Ga0065707_10406550 | 3300005295 | Bacteria | 846 |
| 45 | Ga0070658_10216384 | 3300005327 | Bacteria | 1619 |
| 46 | Ga0070676_10010179 | 3300005328 | Bacteria | 5098 |
| 47 | Ga0070676_10865739 | 3300005328 | Bacteria | 671 |
| 48 | Ga0070676_10910558 | 3300005328 | Bacteria | 655 |
| 49 | Ga0070676_11497590 | 3300005328 | Bacteria | 519 |
| 50 | Ga0070683_100000001 | 3300005329 | Bacteria | 529385 |
| 51 | Ga0070683_100001199 | 3300005329 | Bacteria | 19731 |
| 52 | Ga0070683_100102147 | 3300005329 | Bacteria | 2700 |
| 53 | Ga0070683_100216813 | 3300005329 | Bacteria | 1818 |
| 54 | Ga0070683_100304765 | 3300005329 | Bacteria | 1515 |
| 55 | Ga0070690_100034038 | 3300005330 | Bacteria | 3191 |
| 56 | Ga0070690_100041801 | 3300005330 | Bacteria | 2903 |
| 57 | Ga0070690_100217576 | 3300005330 | Bacteria | 1337 |
| 58 | Ga0070690_100666964 | 3300005330 | Bacteria | 796 |
| 59 | Ga0070670_100037807 | 3300005331 | Bacteria | 4152 |
| 60 | Ga0070670_100057926 | 3300005331 | Bacteria | 3325 |
| 61 | Ga0070677_10000497 | 3300005333 | Bacteria | 13540 |
| 62 | Ga0068869_100000236 | 3300005334 | Bacteria | 29097 |
| 63 | Ga0070666_10008751 | 3300005335 | Bacteria | 6293 |
| 64 | Ga0070666_10085825 | 3300005335 | Bacteria | 2156 |
| 65 | Ga0070680_100007477 | 3300005336 | Bacteria | 8331 |
| 66 | Ga0070680_100152783 | 3300005336 | Bacteria | 1938 |
| 67 | Ga0070680_100287481 | 3300005336 | Bacteria | 1393 |
| 68 | Ga0070680_100343346 | 3300005336 | Bacteria | 1269 |
| 69 | Ga0070680_100879356 | 3300005336 | Bacteria | 773 |
| 70 | Ga0070682_100002602 | 3300005337 | Bacteria | 9963 |
| 71 | Ga0070682_100692923 | 3300005337 | Bacteria | 816 |
| 72 | Ga0070682_101076809 | 3300005337 | Bacteria | 672 |
| 73 | Ga0068868_100013245 | 3300005338 | Bacteria | 6042 |
| 74 | Ga0070660_100003492 | 3300005339 | Bacteria | 10828 |
| 75 | Ga0070660_100101864 | 3300005339 | Bacteria | 2276 |
| 76 | Ga0070660_100102357 | 3300005339 | Bacteria | 2270 |
| 77 | Ga0070660_100293168 | 3300005339 | Bacteria | 1332 |
| 78 | Ga0070660_100553695 | 3300005339 | Bacteria | 960 |
| 79 | Ga0070689_100000466 | 3300005340 | Bacteria | 23849 |
| 80 | Ga0070689_100116539 | 3300005340 | Bacteria | 2130 |
| 81 | Ga0070689_100345745 | 3300005340 | Bacteria | 1246 |
| 82 | Ga0070689_100655852 | 3300005340 | Bacteria | 913 |
| 83 | Ga0070691_10002256 | 3300005341 | Bacteria | 8534 |
| 84 | Ga0070691_10589218 | 3300005341 | Bacteria | 655 |
| 85 | Ga0070687_100000277 | 3300005343 | Bacteria | 17398 |
| 86 | Ga0070661_100000827 | 3300005344 | Bacteria | 22257 |
| 87 | Ga0070661_100449196 | 3300005344 | Bacteria | 1025 |
| 88 | Ga0070661_100867110 | 3300005344 | Bacteria | 744 |
| 89 | Ga0070692_10142335 | 3300005345 | Bacteria | 1358 |
| 90 | Ga0070668_100010921 | 3300005347 | Bacteria | 6757 |
| 91 | Ga0070668_100121809 | 3300005347 | Bacteria | 2085 |
| 92 | Ga0070669_100002399 | 3300005353 | Bacteria | 13560 |
| 93 | Ga0070675_100005703 | 3300005354 | Bacteria | 9530 |
| 94 | Ga0070671_100000736 | 3300005355 | Bacteria | 23441 |
| 95 | Ga0070671_100119314 | 3300005355 | Bacteria | 2219 |
| 96 | Ga0070674_100010959 | 3300005356 | Bacteria | 5499 |
| 97 | Ga0070673_100000302 | 3300005364 | Bacteria | 25831 |
| 98 | Ga0070673_100092031 | 3300005364 | Bacteria | 2480 |
| 99 | Ga0070688_100050588 | 3300005365 | Bacteria | 2589 |
| 100 | Ga0070659_100001555 | 3300005366 | Bacteria | 16548 |
| 101 | Ga0070659_101766058 | 3300005366 | Bacteria | 554 |
| 102 | Ga0070667_100002272 | 3300005367 | Bacteria | 16919 |
| 103 | Ga0070667_100065449 | 3300005367 | Bacteria | 3086 |
| 104 | Ga0070667_100120120 | 3300005367 | Bacteria | 2286 |
| 105 | Ga0070667_100197812 | 3300005367 | Bacteria | 1783 |
| 106 | Ga0070703_10001123 | 3300005406 | Bacteria | 8283 |
| 107 | Ga0070703_10339458 | 3300005406 | Bacteria | 638 |
| 108 | Ga0070709_10016552 | 3300005434 | Bacteria | 4213 |
| 109 | Ga0070709_11366045 | 3300005434 | Bacteria | 573 |
| 110 | Ga0070714_100043457 | 3300005435 | Bacteria | 3800 |
| 111 | Ga0070714_100080604 | 3300005435 | Bacteria | 2832 |
| 112 | Ga0070714_100175959 | 3300005435 | Bacteria | 1944 |
| 113 | Ga0070714_100775192 | 3300005435 | Bacteria | 928 |
| 114 | Ga0070714_100792006 | 3300005435 | Bacteria | 918 |
| 115 | Ga0070713_100121443 | 3300005436 | Bacteria | 2292 |
| 116 | Ga0070713_101071508 | 3300005436 | Bacteria | 779 |
| 117 | Ga0070710_10016794 | 3300005437 | Bacteria | 3732 |
| 118 | Ga0070710_10022905 | 3300005437 | Bacteria | 3274 |
| 119 | Ga0070710_10242047 | 3300005437 | Bacteria | 1156 |
| 120 | Ga0070710_10421542 | 3300005437 | Bacteria | 899 |
| 121 | Ga0070710_10538825 | 3300005437 | Bacteria | 804 |
| 122 | Ga0070710_10773454 | 3300005437 | Bacteria | 684 |
| 123 | Ga0070710_10955315 | 3300005437 | Bacteria | 622 |
| 124 | Ga0070701_10000864 | 3300005438 | Bacteria | 10897 |
| 125 | Ga0070701_10358656 | 3300005438 | Bacteria | 913 |
| 126 | Ga0070711_100080319 | 3300005439 | Bacteria | 2322 |
| 127 | Ga0070711_100098761 | 3300005439 | Bacteria | 2120 |
| 128 | Ga0070711_100103656 | 3300005439 | Bacteria | 2074 |
| 129 | Ga0070711_100115857 | 3300005439 | Bacteria | 1974 |
| 130 | Ga0070711_100157542 | 3300005439 | Bacteria | 1718 |
| 131 | Ga0070711_100369247 | 3300005439 | Bacteria | 1157 |
| 132 | Ga0070705_100001212 | 3300005440 | Bacteria | 13972 |
| 133 | Ga0070705_100030515 | 3300005440 | Bacteria | 2977 |
| 134 | Ga0070705_100100465 | 3300005440 | Bacteria | 1825 |
| 135 | Ga0070705_100342026 | 3300005440 | Bacteria | 1088 |
| 136 | Ga0070705_100558195 | 3300005440 | Bacteria | 879 |
| 137 | Ga0070700_100001313 | 3300005441 | Bacteria | 12331 |
| 138 | Ga0070694_100003865 | 3300005444 | Bacteria | 8952 |
| 139 | Ga0070694_100071827 | 3300005444 | Bacteria | 2386 |
| 140 | Ga0070694_100148829 | 3300005444 | Bacteria | 1708 |
| 141 | Ga0070694_101206258 | 3300005444 | Bacteria | 634 |
| 142 | Ga0070694_101371431 | 3300005444 | Bacteria | 596 |
| 143 | Ga0070708_100784682 | 3300005445 | Bacteria | 896 |
| 144 | Ga0070663_100021939 | 3300005455 | Bacteria | 4258 |
| 145 | Ga0070663_100199586 | 3300005455 | Bacteria | 1560 |
| 146 | Ga0070663_100408366 | 3300005455 | Bacteria | 1112 |
| 147 | Ga0070663_101257870 | 3300005455 | Bacteria | 652 |
| 148 | Ga0070678_100005062 | 3300005456 | Bacteria | 7560 |
| 149 | Ga0070678_100013987 | 3300005456 | Bacteria | 5046 |
| 150 | Ga0070678_100133772 | 3300005456 | Bacteria | 1974 |
| 151 | Ga0070662_100086416 | 3300005457 | Bacteria | 2346 |
| 152 | Ga0070662_100141427 | 3300005457 | Bacteria | 1865 |
| 153 | Ga0070662_100212296 | 3300005457 | Bacteria | 1541 |
| 154 | Ga0070662_101191028 | 3300005457 | Bacteria | 655 |
| 155 | Ga0070662_101399376 | 3300005457 | Bacteria | 603 |
| 156 | Ga0070662_101603045 | 3300005457 | Bacteria | 562 |
| 157 | Ga0070681_10058442 | 3300005458 | Bacteria | 3836 |
| 158 | Ga0070681_10325957 | 3300005458 | Bacteria | 1445 |
| 159 | Ga0070681_10358326 | 3300005458 | Bacteria | 1369 |
| 160 | Ga0070681_10934986 | 3300005458 | Bacteria | 786 |
| 161 | Ga0070681_10961182 | 3300005458 | Bacteria | 773 |
| 162 | Ga0070681_11840253 | 3300005458 | Bacteria | 532 |
| 163 | Ga0068867_100001495 | 3300005459 | Bacteria | 16179 |
| 164 | Ga0068867_100306529 | 3300005459 | Bacteria | 1311 |
| 165 | Ga0070685_10005500 | 3300005466 | Bacteria | 6420 |
| 166 | Ga0070685_10005707 | 3300005466 | Bacteria | 6320 |
| 167 | Ga0070679_100021336 | 3300005530 | Bacteria | 6322 |
| 168 | Ga0070679_100064229 | 3300005530 | Bacteria | 3659 |
| 169 | Ga0070679_100179346 | 3300005530 | Bacteria | 2091 |
| 170 | Ga0070679_100333473 | 3300005530 | Bacteria | 1465 |
| 171 | Ga0070679_100422294 | 3300005530 | Bacteria | 1279 |
| 172 | Ga0070679_100651388 | 3300005530 | Bacteria | 996 |
| 173 | Ga0070679_100711874 | 3300005530 | Bacteria | 947 |
| 174 | Ga0070684_100005932 | 3300005535 | Bacteria | 9408 |
| 175 | Ga0070684_100368497 | 3300005535 | Bacteria | 1322 |
| 176 | Ga0070684_100526769 | 3300005535 | Bacteria | 1095 |
| 177 | Ga0070684_100727907 | 3300005535 | Bacteria | 925 |
| 178 | Ga0070684_100746006 | 3300005535 | Bacteria | 914 |
| 179 | Ga0070697_100028994 | 3300005536 | Bacteria | 4436 |
| 180 | Ga0070697_100216417 | 3300005536 | Bacteria | 1632 |
| 181 | Ga0070697_100432428 | 3300005536 | Bacteria | 1145 |
| 182 | Ga0068853_100000919 | 3300005539 | Bacteria | 20601 |
| 183 | Ga0068853_100201197 | 3300005539 | Bacteria | 1813 |
| 184 | Ga0068853_100228999 | 3300005539 | Bacteria | 1699 |
| 185 | Ga0068853_100237770 | 3300005539 | Bacteria | 1668 |
| 186 | Ga0068853_102200717 | 3300005539 | Bacteria | 534 |
| 187 | Ga0070672_100004500 | 3300005543 | Bacteria | 9131 |
| 188 | Ga0070672_100278007 | 3300005543 | Bacteria | 1415 |
| 189 | Ga0070686_100000488 | 3300005544 | Bacteria | 24002 |
| 190 | Ga0070686_100154611 | 3300005544 | Bacteria | 1609 |
| 191 | Ga0070686_100323971 | 3300005544 | Bacteria | 1150 |
| 192 | Ga0070695_100002834 | 3300005545 | Bacteria | 10077 |
| 193 | Ga0070695_100137259 | 3300005545 | Bacteria | 1691 |
| 194 | Ga0070695_100210334 | 3300005545 | Bacteria | 1396 |
| 195 | Ga0070696_100038159 | 3300005546 | Bacteria | 3315 |
| 196 | Ga0070696_100039045 | 3300005546 | Bacteria | 3278 |
| 197 | Ga0070696_100134549 | 3300005546 | Bacteria | 1801 |
| 198 | Ga0070693_100002155 | 3300005547 | Bacteria | 9028 |
| 199 | Ga0070665_100949159 | 3300005548 | Bacteria | 872 |
| 200 | Ga0070665_102256935 | 3300005548 | Bacteria | 548 |
| 201 | Ga0070704_100009996 | 3300005549 | Bacteria | 5761 |
| 202 | Ga0070704_100016677 | 3300005549 | Bacteria | 4648 |
| 203 | Ga0068855_100007603 | 3300005563 | Bacteria | 13112 |
| 204 | Ga0068855_100147201 | 3300005563 | Bacteria | 2680 |
| 205 | Ga0068855_100210414 | 3300005563 | Bacteria | 2185 |
| 206 | Ga0068855_100518535 | 3300005563 | Bacteria | 1293 |
| 207 | Ga0068855_100535350 | 3300005563 | Bacteria | 1269 |
| 208 | Ga0068855_102128311 | 3300005563 | Bacteria | 564 |
| 209 | Ga0070664_100002753 | 3300005564 | Bacteria | 14191 |
| 210 | Ga0070664_100059778 | 3300005564 | Bacteria | 3243 |
| 211 | Ga0070664_100405934 | 3300005564 | Bacteria | 1246 |
| 212 | Ga0070664_100878764 | 3300005564 | Bacteria | 840 |
| 213 | Ga0068857_100001539 | 3300005577 | Bacteria | 18457 |
| 214 | Ga0068857_100860048 | 3300005577 | Bacteria | 868 |
| 215 | Ga0068854_100002718 | 3300005578 | Bacteria | 10971 |
| 216 | Ga0068854_100873230 | 3300005578 | Bacteria | 789 |
| 217 | Ga0068854_101185016 | 3300005578 | Bacteria | 684 |
| 218 | Ga0068856_100001722 | 3300005614 | Bacteria | 22877 |
| 219 | Ga0068856_100472386 | 3300005614 | Bacteria | 1275 |
| 220 | Ga0068856_100978601 | 3300005614 | Bacteria | 864 |
| 221 | Ga0068856_101898933 | 3300005614 | Bacteria | 606 |
| 222 | Ga0070702_100007674 | 3300005615 | Bacteria | 5177 |
| 223 | Ga0070702_100074487 | 3300005615 | Bacteria | 2014 |
| 224 | Ga0068852_100001817 | 3300005616 | Bacteria | 14500 |
| 225 | Ga0068852_100101514 | 3300005616 | Bacteria | 2598 |
| 226 | Ga0068852_100345453 | 3300005616 | Bacteria | 1451 |
| 227 | Ga0068852_100388936 | 3300005616 | Bacteria | 1369 |
| 228 | Ga0068852_100923046 | 3300005616 | Bacteria | 890 |
| 229 | Ga0068852_100927546 | 3300005616 | Bacteria | 888 |
| 230 | Ga0068859_100010286 | 3300005617 | Bacteria | 9417 |
| 231 | Ga0068859_100055055 | 3300005617 | Bacteria | 4002 |
| 232 | Ga0068859_100067731 | 3300005617 | Bacteria | 3605 |
| 233 | Ga0068859_100445196 | 3300005617 | Bacteria | 1391 |
| 234 | Ga0068864_100002498 | 3300005618 | Bacteria | 15204 |
| 235 | Ga0068866_10004287 | 3300005718 | Bacteria | 5858 |
| 236 | Ga0068866_10079424 | 3300005718 | Bacteria | 1758 |
| 237 | Ga0068861_100000668 | 3300005719 | Bacteria | 20402 |
| 238 | Ga0068870_10000676 | 3300005840 | Bacteria | 13010 |
| 239 | Ga0068863_100004649 | 3300005841 | Bacteria | 13532 |
| 240 | Ga0068863_100576179 | 3300005841 | Bacteria | 1113 |
| 241 | Ga0068858_100008130 | 3300005842 | Bacteria | 10087 |
| 242 | Ga0068858_100190014 | 3300005842 | Bacteria | 1941 |
| 243 | Ga0068858_100266723 | 3300005842 | Bacteria | 1628 |
| 244 | Ga0068858_100435170 | 3300005842 | Bacteria | 1263 |
| 245 | Ga0068858_101283400 | 3300005842 | Bacteria | 720 |
| 246 | Ga0068860_100007431 | 3300005843 | Bacteria | 10959 |
| 247 | Ga0068860_100055702 | 3300005843 | Bacteria | 3759 |
| 248 | Ga0068860_100209915 | 3300005843 | Bacteria | 1889 |
| 249 | Ga0068862_100008906 | 3300005844 | Bacteria | 8308 |
| 250 | Ga0068862_100317644 | 3300005844 | Bacteria | 1437 |
| 251 | Ga0068862_100324628 | 3300005844 | Bacteria | 1422 |
| 252 | Ga0068862_101889509 | 3300005844 | Bacteria | 607 |
| 253 | Ga0081455_10000327 | 3300005937 | Bacteria | 62253 |
| 254 | Ga0070717_10001681 | 3300006028 | Bacteria | 15390 |
| 255 | Ga0070717_10089694 | 3300006028 | Bacteria | 2593 |
| 256 | Ga0070717_10186052 | 3300006028 | Bacteria | 1813 |
| 257 | Ga0070717_10350141 | 3300006028 | Bacteria | 1320 |
| 258 | Ga0070717_11575011 | 3300006028 | Bacteria | 596 |
| 259 | Ga0075365_10742849 | 3300006038 | Bacteria | 693 |
| 260 | Ga0075363_100062100 | 3300006048 | Bacteria | 2014 |
| 261 | Ga0075432_10008052 | 3300006058 | Bacteria | 3597 |
| 262 | Ga0075432_10053567 | 3300006058 | Bacteria | 1427 |
| 263 | Ga0070715_10023768 | 3300006163 | Bacteria | 2405 |
| 264 | Ga0070715_10143730 | 3300006163 | Bacteria | 1161 |
| 265 | Ga0070716_100007734 | 3300006173 | Bacteria | 5305 |
| 266 | Ga0070716_100494529 | 3300006173 | Bacteria | 901 |
| 267 | Ga0070712_100006392 | 3300006175 | Bacteria | 7307 |
| 268 | Ga0070712_100150712 | 3300006175 | Bacteria | 1785 |
| 269 | Ga0070712_100160167 | 3300006175 | Bacteria | 1737 |
| 270 | Ga0070712_100260740 | 3300006175 | Bacteria | 1389 |
| 271 | Ga0070712_100267571 | 3300006175 | Bacteria | 1372 |
| 272 | Ga0075427_10003431 | 3300006194 | Bacteria | 2182 |
| 273 | Ga0097621_100000892 | 3300006237 | Bacteria | 20916 |
| 274 | Ga0097621_100097765 | 3300006237 | Bacteria | 2465 |
| 275 | Ga0097621_100152142 | 3300006237 | Bacteria | 1984 |
| 276 | Ga0075370_10490443 | 3300006353 | Bacteria | 741 |
| 277 | Ga0068871_100010466 | 3300006358 | Bacteria | 6771 |
| 278 | Ga0068871_100034066 | 3300006358 | Bacteria | 4038 |
| 279 | Ga0068871_100086509 | 3300006358 | Bacteria | 2604 |
| 280 | Ga0075428_100035887 | 3300006844 | Bacteria | 5464 |
| 281 | Ga0075428_101735292 | 3300006844 | Bacteria | 651 |
| 282 | Ga0075430_100007678 | 3300006846 | Bacteria | 9110 |
| 283 | Ga0075430_100042524 | 3300006846 | Bacteria | 3842 |
| 284 | Ga0075431_100007378 | 3300006847 | Bacteria | 10949 |
| 285 | Ga0075431_100438823 | 3300006847 | Bacteria | 1303 |
| 286 | Ga0075433_10002306 | 3300006852 | Bacteria | 14532 |
| 287 | Ga0075433_10090055 | 3300006852 | Bacteria | 2712 |
| 288 | Ga0075434_100000110 | 3300006871 | Bacteria | 46873 |
| 289 | Ga0075434_100023586 | 3300006871 | Bacteria | 5999 |
| 290 | Ga0075434_100023964 | 3300006871 | Bacteria | 5959 |
| 291 | Ga0075434_101468170 | 3300006871 | Unclassified | 691 |
| 292 | Ga0075434_101632825 | 3300006871 | Bacteria | 653 |
| 293 | Ga0075429_100006496 | 3300006880 | Bacteria | 10126 |
| 294 | Ga0068865_100000452 | 3300006881 | Bacteria | 22857 |
| 295 | Ga0068865_100127075 | 3300006881 | Bacteria | 1905 |
| 296 | Ga0068865_100523928 | 3300006881 | Bacteria | 992 |
| 297 | Ga0075436_100251899 | 3300006914 | Bacteria | 1258 |
| 298 | Ga0075436_100342127 | 3300006914 | Bacteria | 1077 |
| 299 | Ga0097620_100010289 | 3300006931 | Bacteria | 9417 |
| 300 | Ga0097620_100055055 | 3300006931 | Bacteria | 4002 |
| 301 | Ga0097620_100067730 | 3300006931 | Bacteria | 3605 |
| 302 | Ga0097620_100445196 | 3300006931 | Bacteria | 1391 |
| 303 | Ga0075435_100066443 | 3300007076 | Bacteria | 2934 |
| 304 | Ga0075435_100069762 | 3300007076 | Bacteria | 2867 |
| 305 | Ga0075435_100277272 | 3300007076 | Bacteria | 1431 |
| 306 | Ga0105251_10032957 | 3300009011 | Bacteria | 2576 |
| 307 | Ga0105251_10227641 | 3300009011 | Bacteria | 840 |
| 308 | Ga0105240_10377979 | 3300009093 | Bacteria | 1600 |
| 309 | Ga0105240_11153613 | 3300009093 | Bacteria | 822 |
| 310 | Ga0111539_10002712 | 3300009094 | Bacteria | 23487 |
| 311 | Ga0111539_10011154 | 3300009094 | Bacteria | 11302 |
| 312 | Ga0111539_10016303 | 3300009094 | Bacteria | 9213 |
| 313 | Ga0111539_10379568 | 3300009094 | Bacteria | 1646 |
| 314 | Ga0111539_11230264 | 3300009094 | Bacteria | 869 |
| 315 | Ga0105245_10000380 | 3300009098 | Bacteria | 41293 |
| 316 | Ga0105245_10175950 | 3300009098 | Bacteria | 2041 |
| 317 | Ga0105245_10495036 | 3300009098 | Bacteria | 1238 |
| 318 | Ga0105245_10998244 | 3300009098 | Bacteria | 881 |
| 319 | Ga0105245_11129873 | 3300009098 | Bacteria | 830 |
| 320 | Ga0105247_10095025 | 3300009101 | Bacteria | 1897 |
| 321 | Ga0105247_10095195 | 3300009101 | Bacteria | 1896 |
| 322 | Ga0114129_10058215 | 3300009147 | Bacteria | 5405 |
| 323 | Ga0114129_10086721 | 3300009147 | Bacteria | 4341 |
| 324 | Ga0105243_10002254 | 3300009148 | Bacteria | 16204 |
| 325 | Ga0105243_12385601 | 3300009148 | Unclassified | 567 |
| 326 | Ga0105241_10000342 | 3300009174 | Bacteria | 35383 |
| 327 | Ga0105241_10273046 | 3300009174 | Bacteria | 1441 |
| 328 | Ga0105241_10321033 | 3300009174 | Bacteria | 1335 |
| 329 | Ga0105241_10469851 | 3300009174 | Bacteria | 1116 |
| 330 | Ga0105242_10000855 | 3300009176 | Bacteria | 23621 |
| 331 | Ga0105242_10114826 | 3300009176 | Bacteria | 2301 |
| 332 | Ga0105242_10126470 | 3300009176 | Bacteria | 2200 |
| 333 | Ga0105242_10455389 | 3300009176 | Bacteria | 1207 |
| 334 | Ga0105248_10012394 | 3300009177 | Bacteria | 9405 |
| 335 | Ga0105248_10027173 | 3300009177 | Bacteria | 6366 |
| 336 | Ga0105248_10227162 | 3300009177 | Bacteria | 2101 |
| 337 | Ga0105248_10566771 | 3300009177 | Bacteria | 1281 |
| 338 | Ga0105237_10165865 | 3300009545 | Bacteria | 2208 |
| 339 | Ga0105237_10350105 | 3300009545 | Bacteria | 1482 |
| 340 | Ga0105237_10670432 | 3300009545 | Bacteria | 1044 |
| 341 | Ga0105237_12039233 | 3300009545 | Bacteria | 582 |
| 342 | Ga0105238_10053194 | 3300009551 | Bacteria | 4068 |
| 343 | Ga0105238_10161315 | 3300009551 | Bacteria | 2217 |
| 344 | Ga0105238_10282017 | 3300009551 | Bacteria | 1643 |
| 345 | Ga0105238_10791792 | 3300009551 | Bacteria | 963 |
| 346 | Ga0105238_10865163 | 3300009551 | Bacteria | 921 |
| 347 | Ga0105249_10001982 | 3300009553 | Bacteria | 17778 |
| 348 | Ga0105249_10019413 | 3300009553 | Bacteria | 6064 |
| 349 | Ga0105249_10089178 | 3300009553 | Bacteria | 2881 |
| 350 | Ga0105249_10818843 | 3300009553 | Bacteria | 996 |
| 351 | Ga0105249_11646056 | 3300009553 | Bacteria | 714 |
| 352 | Ga0105239_10012830 | 3300010375 | Bacteria | 9320 |
| 353 | Ga0105239_10042492 | 3300010375 | Bacteria | 4981 |
| 354 | Ga0105239_10132145 | 3300010375 | Bacteria | 2777 |
| 355 | Ga0105239_10172256 | 3300010375 | Bacteria | 2421 |
| 356 | Ga0105239_11111307 | 3300010375 | Bacteria | 910 |
| 357 | Ga0105246_10000185 | 3300011119 | Bacteria | 30744 |
| 358 | Ga0105246_10231406 | 3300011119 | Bacteria | 1455 |
| 359 | Ga0157337_1015808 | 3300012483 | Bacteria | 647 |
| 360 | Ga0157323_1021068 | 3300012495 | Bacteria | 621 |
| 361 | Ga0157319_1045173 | 3300012497 | Bacteria | 529 |
| 362 | Ga0157345_1041907 | 3300012498 | Unclassified | 554 |
| 363 | Ga0157314_1017101 | 3300012500 | Bacteria | 702 |
| 364 | Ga0157347_1021434 | 3300012502 | Bacteria | 759 |
| 365 | Ga0157339_1015113 | 3300012505 | Bacteria | 757 |
| 366 | Ga0157339_1026226 | 3300012505 | Bacteria | 654 |
| 367 | Ga0157324_1027005 | 3300012506 | Bacteria | 626 |
| 368 | Ga0157327_1029806 | 3300012512 | Bacteria | 674 |
| 369 | Ga0157326_1002949 | 3300012513 | Bacteria | 1798 |
| 370 | Ga0157373_10130966 | 3300013100 | Bacteria | 1764 |
| 371 | Ga0157373_10162794 | 3300013100 | Bacteria | 1570 |
| 372 | Ga0157373_10296751 | 3300013100 | Bacteria | 1146 |
| 373 | Ga0157373_10867538 | 3300013100 | Bacteria | 668 |
| 374 | Ga0157373_11148155 | 3300013100 | Unclassified | 584 |
| 375 | Ga0157371_10006659 | 3300013102 | Bacteria | 9456 |
| 376 | Ga0157371_10648232 | 3300013102 | Bacteria | 788 |
| 377 | Ga0157370_10577840 | 3300013104 | Bacteria | 1030 |
| 378 | Ga0157369_10323622 | 3300013105 | Bacteria | 1603 |
| 379 | Ga0157369_10777524 | 3300013105 | Bacteria | 984 |
| 380 | Ga0157369_12367953 | 3300013105 | Bacteria | 538 |
| 381 | Ga0157374_10001986 | 3300013296 | Bacteria | 17156 |
| 382 | Ga0157374_10033399 | 3300013296 | Bacteria | 4694 |
| 383 | Ga0157378_10001729 | 3300013297 | Bacteria | 19618 |
| 384 | Ga0157378_10166278 | 3300013297 | Bacteria | 2066 |
| 385 | Ga0157378_10322366 | 3300013297 | Bacteria | 1501 |
| 386 | Ga0157378_10846386 | 3300013297 | Unclassified | 943 |
| 387 | Ga0163162_10012026 | 3300013306 | Bacteria | 8439 |
| 388 | Ga0163162_10026532 | 3300013306 | Bacteria | 5725 |
| 389 | Ga0163162_10057878 | 3300013306 | Bacteria | 3904 |
| 390 | Ga0163162_10990683 | 3300013306 | Bacteria | 950 |
| 391 | Ga0163162_12184061 | 3300013306 | Bacteria | 635 |
| 392 | Ga0157372_10024601 | 3300013307 | Bacteria | 6544 |
| 393 | Ga0157372_10593975 | 3300013307 | Bacteria | 1290 |
| 394 | Ga0157372_10632801 | 3300013307 | Bacteria | 1246 |
| 395 | Ga0157372_10645343 | 3300013307 | Bacteria | 1233 |
| 396 | Ga0157372_12640263 | 3300013307 | Bacteria | 576 |
| 397 | Ga0157375_10001883 | 3300013308 | Bacteria | 18038 |
| 398 | Ga0157375_10030202 | 3300013308 | Bacteria | 5107 |
| 399 | Ga0163163_10010785 | 3300014325 | Bacteria | 8246 |
| 400 | Ga0163163_10295679 | 3300014325 | Bacteria | 1671 |
| 401 | Ga0157380_10007676 | 3300014326 | Bacteria | 7677 |
| 402 | Ga0157380_10869299 | 3300014326 | Bacteria | 925 |
| 403 | Ga0157377_10000643 | 3300014745 | Bacteria | 14554 |
| 404 | Ga0157379_10010633 | 3300014968 | Bacteria | 8021 |
| 405 | Ga0157379_10026543 | 3300014968 | Bacteria | 5156 |
| 406 | Ga0157379_10599353 | 3300014968 | Bacteria | 1028 |
| 407 | Ga0157376_10000920 | 3300014969 | Bacteria | 19113 |
| 408 | Ga0157376_10426233 | 3300014969 | Bacteria | 1288 |
| 409 | Ga0157376_10578466 | 3300014969 | Bacteria | 1115 |
| 410 | Ga0157376_10680057 | 3300014969 | Unclassified | 1032 |
| 411 | Ga0163161_10000379 | 3300017792 | Bacteria | 37281 |
| 412 | Ga0163161_10737962 | 3300017792 | Bacteria | 823 |
| 413 | Ga0163161_11339248 | 3300017792 | Bacteria | 623 |
| 414 | Ga0206354_11424105 | 3300020081 | Bacteria | 760 |
| 415 | Ga0213874_10147432 | 3300021377 | Bacteria | 819 |
| 416 | Ga0213871_10124861 | 3300021441 | Bacteria | 769 |
| 417 | Ga0207666_1000046 | 3300025271 | Bacteria | 24194 |
| 418 | Ga0207673_1000461 | 3300025290 | Bacteria | 4236 |
| 419 | Ga0207697_10000714 | 3300025315 | Bacteria | 18891 |
| 420 | Ga0207697_10045981 | 3300025315 | Bacteria | 1797 |
| 421 | Ga0207713_1076792 | 3300025735 | Bacteria | 1215 |
| 422 | Ga0207653_10004733 | 3300025885 | Bacteria | 4259 |
| 423 | Ga0207682_10000043 | 3300025893 | Bacteria | 52108 |
| 424 | Ga0207692_10007751 | 3300025898 | Bacteria | 4414 |
| 425 | Ga0207692_10055266 | 3300025898 | Bacteria | 2031 |
| 426 | Ga0207692_10641073 | 3300025898 | Bacteria | 686 |
| 427 | Ga0207692_10931279 | 3300025898 | Bacteria | 572 |
| 428 | Ga0207642_10002212 | 3300025899 | Bacteria | 6031 |
| 429 | Ga0207710_10002657 | 3300025900 | Bacteria | 8239 |
| 430 | Ga0207710_10004284 | 3300025900 | Bacteria | 6246 |
| 431 | Ga0207710_10079101 | 3300025900 | Bacteria | 1522 |
| 432 | Ga0207710_10086258 | 3300025900 | Bacteria | 1463 |
| 433 | Ga0207688_10000083 | 3300025901 | Bacteria | 36050 |
| 434 | Ga0207688_10036653 | 3300025901 | Bacteria | 2719 |
| 435 | Ga0207680_10005187 | 3300025903 | Bacteria | 6214 |
| 436 | Ga0207680_10116964 | 3300025903 | Bacteria | 1738 |
| 437 | Ga0207647_10025829 | 3300025904 | Bacteria | 3851 |
| 438 | Ga0207685_10015847 | 3300025905 | Bacteria | 2399 |
| 439 | Ga0207685_10064252 | 3300025905 | Bacteria | 1465 |
| 440 | Ga0207699_10012561 | 3300025906 | Bacteria | 4310 |
| 441 | Ga0207699_10035800 | 3300025906 | Bacteria | 2826 |
| 442 | Ga0207699_10065818 | 3300025906 | Bacteria | 2198 |
| 443 | Ga0207645_10002954 | 3300025907 | Bacteria | 13126 |
| 444 | Ga0207645_10015101 | 3300025907 | Bacteria | 5143 |
| 445 | Ga0207645_10160586 | 3300025907 | Bacteria | 1470 |
| 446 | Ga0207643_10000128 | 3300025908 | Bacteria | 51191 |
| 447 | Ga0207705_10397009 | 3300025909 | Bacteria | 1066 |
| 448 | Ga0207654_10001559 | 3300025911 | Bacteria | 12036 |
| 449 | Ga0207654_10550168 | 3300025911 | Bacteria | 820 |
| 450 | Ga0207707_10004600 | 3300025912 | Bacteria | 12117 |
| 451 | Ga0207707_10210462 | 3300025912 | Bacteria | 1694 |
| 452 | Ga0207707_10619673 | 3300025912 | Bacteria | 914 |
| 453 | Ga0207707_11349131 | 3300025912 | Bacteria | 571 |
| 454 | Ga0207695_10598098 | 3300025913 | Bacteria | 984 |
| 455 | Ga0207671_10013743 | 3300025914 | Bacteria | 6427 |
| 456 | Ga0207671_10151757 | 3300025914 | Bacteria | 1790 |
| 457 | Ga0207671_10422168 | 3300025914 | Bacteria | 1061 |
| 458 | Ga0207671_10529717 | 3300025914 | Bacteria | 939 |
| 459 | Ga0207693_10008254 | 3300025915 | Bacteria | 8526 |
| 460 | Ga0207693_10012476 | 3300025915 | Bacteria | 6864 |
| 461 | Ga0207693_10022622 | 3300025915 | Bacteria | 4994 |
| 462 | Ga0207693_10116477 | 3300025915 | Bacteria | 2098 |
| 463 | Ga0207693_10208215 | 3300025915 | Bacteria | 1537 |
| 464 | Ga0207663_10016239 | 3300025916 | Bacteria | 4123 |
| 465 | Ga0207663_10197595 | 3300025916 | Bacteria | 1448 |
| 466 | Ga0207663_10253841 | 3300025916 | Bacteria | 1295 |
| 467 | Ga0207663_10470974 | 3300025916 | Bacteria | 972 |
| 468 | Ga0207663_10931645 | 3300025916 | Bacteria | 695 |
| 469 | Ga0207660_10001486 | 3300025917 | Bacteria | 15770 |
| 470 | Ga0207660_10483731 | 3300025917 | Bacteria | 1003 |
| 471 | Ga0207660_10484894 | 3300025917 | Bacteria | 1002 |
| 472 | Ga0207660_10535411 | 3300025917 | Bacteria | 952 |
| 473 | Ga0207660_10790831 | 3300025917 | Bacteria | 774 |
| 474 | Ga0207662_10000301 | 3300025918 | Bacteria | 22744 |
| 475 | Ga0207657_10001859 | 3300025919 | Bacteria | 22810 |
| 476 | Ga0207657_10047359 | 3300025919 | Bacteria | 3760 |
| 477 | Ga0207657_10107787 | 3300025919 | Bacteria | 2304 |
| 478 | Ga0207657_10327325 | 3300025919 | Bacteria | 1211 |
| 479 | Ga0207649_10003562 | 3300025920 | Bacteria | 8508 |
| 480 | Ga0207649_10046661 | 3300025920 | Bacteria | 2663 |
| 481 | Ga0207649_10650080 | 3300025920 | Bacteria | 815 |
| 482 | Ga0207649_10718638 | 3300025920 | Bacteria | 776 |
| 483 | Ga0207652_10016674 | 3300025921 | Bacteria | 6003 |
| 484 | Ga0207652_10046330 | 3300025921 | Bacteria | 3710 |
| 485 | Ga0207652_10153811 | 3300025921 | Bacteria | 2060 |
| 486 | Ga0207652_10259840 | 3300025921 | Bacteria | 1566 |
| 487 | Ga0207652_10441052 | 3300025921 | Bacteria | 1174 |
| 488 | Ga0207652_10561912 | 3300025921 | Bacteria | 1025 |
| 489 | Ga0207681_10004864 | 3300025923 | Bacteria | 8251 |
| 490 | Ga0207694_10076101 | 3300025924 | Bacteria | 2628 |
| 491 | Ga0207694_10457974 | 3300025924 | Bacteria | 1065 |
| 492 | Ga0207694_10570376 | 3300025924 | Bacteria | 951 |
| 493 | Ga0207650_10019558 | 3300025925 | Bacteria | 4761 |
| 494 | Ga0207650_10690913 | 3300025925 | Bacteria | 862 |
| 495 | Ga0207659_10000411 | 3300025926 | Bacteria | 25858 |
| 496 | Ga0207659_10374250 | 3300025926 | Bacteria | 1186 |
| 497 | Ga0207687_10000667 | 3300025927 | Bacteria | 23099 |
| 498 | Ga0207687_10259128 | 3300025927 | Bacteria | 1386 |
| 499 | Ga0207687_10473587 | 3300025927 | Bacteria | 1042 |
| 500 | Ga0207687_10675276 | 3300025927 | Bacteria | 875 |
| 501 | Ga0207700_10000412 | 3300025928 | Bacteria | 25028 |
| 502 | Ga0207700_10040508 | 3300025928 | Bacteria | 3401 |
| 503 | Ga0207700_10189586 | 3300025928 | Bacteria | 1727 |
| 504 | Ga0207664_10107056 | 3300025929 | Bacteria | 2319 |
| 505 | Ga0207664_10202163 | 3300025929 | Bacteria | 1715 |
| 506 | Ga0207664_10385539 | 3300025929 | Bacteria | 1244 |
| 507 | Ga0207664_10731138 | 3300025929 | Bacteria | 890 |
| 508 | Ga0207664_10882667 | 3300025929 | Bacteria | 803 |
| 509 | Ga0207644_10005279 | 3300025931 | Bacteria | 8432 |
| 510 | Ga0207644_10009684 | 3300025931 | Bacteria | 6334 |
| 511 | Ga0207644_10100107 | 3300025931 | Bacteria | 2176 |
| 512 | Ga0207644_10280769 | 3300025931 | Bacteria | 1337 |
| 513 | Ga0207690_10002854 | 3300025932 | Bacteria | 10412 |
| 514 | Ga0207690_10015321 | 3300025932 | Bacteria | 4644 |
| 515 | Ga0207706_10004082 | 3300025933 | Bacteria | 13792 |
| 516 | Ga0207706_10031063 | 3300025933 | Bacteria | 4760 |
| 517 | Ga0207706_10211589 | 3300025933 | Bacteria | 1700 |
| 518 | Ga0207686_10000579 | 3300025934 | Bacteria | 22963 |
| 519 | Ga0207686_10033530 | 3300025934 | Bacteria | 3066 |
| 520 | Ga0207709_10000551 | 3300025935 | Bacteria | 32038 |
| 521 | Ga0207709_10104027 | 3300025935 | Bacteria | 1883 |
| 522 | Ga0207709_10171562 | 3300025935 | Bacteria | 1523 |
| 523 | Ga0207709_10183425 | 3300025935 | Bacteria | 1480 |
| 524 | Ga0207670_10000556 | 3300025936 | Bacteria | 20667 |
| 525 | Ga0207670_10394064 | 3300025936 | Bacteria | 1106 |
| 526 | Ga0207669_10000675 | 3300025937 | Bacteria | 14703 |
| 527 | Ga0207704_10002887 | 3300025938 | Bacteria | 7772 |
| 528 | Ga0207704_10109694 | 3300025938 | Bacteria | 1862 |
| 529 | Ga0207704_10501021 | 3300025938 | Bacteria | 979 |
| 530 | Ga0207665_10014619 | 3300025939 | Bacteria | 5167 |
| 531 | Ga0207665_10146009 | 3300025939 | Bacteria | 1690 |
| 532 | Ga0207665_10214421 | 3300025939 | Bacteria | 1408 |
| 533 | Ga0207665_10453868 | 3300025939 | Bacteria | 984 |
| 534 | Ga0207665_10736491 | 3300025939 | Bacteria | 776 |
| 535 | Ga0207691_10000599 | 3300025940 | Bacteria | 35997 |
| 536 | Ga0207691_10063150 | 3300025940 | Bacteria | 3360 |
| 537 | Ga0207691_10118905 | 3300025940 | Bacteria | 2344 |
| 538 | Ga0207711_10010308 | 3300025941 | Bacteria | 7762 |
| 539 | Ga0207711_10073399 | 3300025941 | Bacteria | 2973 |
| 540 | Ga0207711_10312423 | 3300025941 | Bacteria | 1451 |
| 541 | Ga0207689_10000165 | 3300025942 | Bacteria | 57494 |
| 542 | Ga0207661_10008897 | 3300025944 | Bacteria | 7188 |
| 543 | Ga0207679_10000112 | 3300025945 | Bacteria | 65716 |
| 544 | Ga0207679_10044874 | 3300025945 | Bacteria | 3193 |
| 545 | Ga0207667_10017788 | 3300025949 | Bacteria | 7992 |
| 546 | Ga0207667_10038289 | 3300025949 | Bacteria | 5123 |
| 547 | Ga0207667_10091380 | 3300025949 | Bacteria | 3145 |
| 548 | Ga0207667_10614442 | 3300025949 | Bacteria | 1095 |
| 549 | Ga0207667_10842176 | 3300025949 | Bacteria | 912 |
| 550 | Ga0207651_10000099 | 3300025960 | Bacteria | 38059 |
| 551 | Ga0207651_10555171 | 3300025960 | Bacteria | 999 |
| 552 | Ga0207712_10019595 | 3300025961 | Bacteria | 4422 |
| 553 | Ga0207712_10135889 | 3300025961 | Bacteria | 1880 |
| 554 | Ga0207712_10267370 | 3300025961 | Bacteria | 1389 |
| 555 | Ga0207712_11515422 | 3300025961 | Bacteria | 601 |
| 556 | Ga0207668_10000713 | 3300025972 | Bacteria | 20303 |
| 557 | Ga0207668_10142168 | 3300025972 | Bacteria | 1847 |
| 558 | Ga0207640_10002957 | 3300025981 | Bacteria | 9147 |
| 559 | Ga0207640_10619175 | 3300025981 | Bacteria | 919 |
| 560 | Ga0207658_10003702 | 3300025986 | Bacteria | 10772 |
| 561 | Ga0207658_10067675 | 3300025986 | Bacteria | 2691 |
| 562 | Ga0207658_10206505 | 3300025986 | Bacteria | 1643 |
| 563 | Ga0207658_11001604 | 3300025986 | Bacteria | 762 |
| 564 | Ga0207677_10010465 | 3300026023 | Bacteria | 5249 |
| 565 | Ga0207703_10018016 | 3300026035 | Bacteria | 5515 |
| 566 | Ga0207703_10058062 | 3300026035 | Bacteria | 3157 |
| 567 | Ga0207703_10122787 | 3300026035 | Bacteria | 2232 |
| 568 | Ga0207703_10336333 | 3300026035 | Bacteria | 1386 |
| 569 | Ga0207639_10002883 | 3300026041 | Bacteria | 11555 |
| 570 | Ga0207639_10250332 | 3300026041 | Bacteria | 1545 |
| 571 | Ga0207639_10449624 | 3300026041 | Bacteria | 1169 |
| 572 | Ga0207639_10925591 | 3300026041 | Bacteria | 815 |
| 573 | Ga0207639_11053468 | 3300026041 | Bacteria | 762 |
| 574 | Ga0207678_10001329 | 3300026067 | Bacteria | 22814 |
| 575 | Ga0207678_10029433 | 3300026067 | Bacteria | 4793 |
| 576 | Ga0207678_10036192 | 3300026067 | Bacteria | 4297 |
| 577 | Ga0207678_10328559 | 3300026067 | Bacteria | 1316 |
| 578 | Ga0207678_11000848 | 3300026067 | Bacteria | 740 |
| 579 | Ga0207708_10000862 | 3300026075 | Bacteria | 22870 |
| 580 | Ga0207708_10113285 | 3300026075 | Bacteria | 2107 |
| 581 | Ga0207708_10458939 | 3300026075 | Bacteria | 1062 |
| 582 | Ga0207702_10007796 | 3300026078 | Bacteria | 9086 |
| 583 | Ga0207702_10148575 | 3300026078 | Bacteria | 2129 |
| 584 | Ga0207702_10606172 | 3300026078 | Bacteria | 1075 |
| 585 | Ga0207702_11838734 | 3300026078 | Bacteria | 597 |
| 586 | Ga0207641_10001462 | 3300026088 | Bacteria | 23160 |
| 587 | Ga0207641_10242043 | 3300026088 | Bacteria | 1681 |
| 588 | Ga0207641_10730699 | 3300026088 | Bacteria | 976 |
| 589 | Ga0207648_10001891 | 3300026089 | Bacteria | 22870 |
| 590 | Ga0207648_10081422 | 3300026089 | Bacteria | 2824 |
| 591 | Ga0207648_10288236 | 3300026089 | Bacteria | 1469 |
| 592 | Ga0207676_10001459 | 3300026095 | Bacteria | 17574 |
| 593 | Ga0207676_10136555 | 3300026095 | Bacteria | 2093 |
| 594 | Ga0207676_10376323 | 3300026095 | Bacteria | 1320 |
| 595 | Ga0207674_10006899 | 3300026116 | Bacteria | 13310 |
| 596 | Ga0207674_10212794 | 3300026116 | Bacteria | 1882 |
| 597 | Ga0207674_10333507 | 3300026116 | Bacteria | 1467 |
| 598 | Ga0207675_100001575 | 3300026118 | Bacteria | 22801 |
| 599 | Ga0207675_100040944 | 3300026118 | Bacteria | 4328 |
| 600 | Ga0207675_100387886 | 3300026118 | Bacteria | 1375 |
| 601 | Ga0207683_10001273 | 3300026121 | Bacteria | 22829 |
| 602 | Ga0207683_10004182 | 3300026121 | Bacteria | 12489 |
| 603 | Ga0207683_10026331 | 3300026121 | Bacteria | 5020 |
| 604 | Ga0207698_10000511 | 3300026142 | Bacteria | 22568 |
| 605 | Ga0207698_10006111 | 3300026142 | Bacteria | 7493 |
| 606 | Ga0207698_11324611 | 3300026142 | Bacteria | 735 |
| 607 | Ga0207698_12227675 | 3300026142 | Bacteria | 560 |
| 608 | Ga0209984_1026426 | 3300027424 | Bacteria | 811 |
| 609 | Ga0209999_1042707 | 3300027543 | Bacteria | 851 |
| 610 | Ga0210002_1002548 | 3300027617 | Bacteria | 2635 |
| 611 | Ga0210002_1036553 | 3300027617 | Bacteria | 827 |
| 612 | Ga0209971_1020926 | 3300027682 | Bacteria | 1556 |
| 613 | Ga0209966_1002413 | 3300027695 | Bacteria | 3117 |
| 614 | Ga0209966_1007471 | 3300027695 | Bacteria | 1917 |
| 615 | Ga0209998_10001602 | 3300027717 | Bacteria | 5437 |
| 616 | Ga0209998_10009907 | 3300027717 | Bacteria | 1975 |
| 617 | Ga0209974_10020171 | 3300027876 | Bacteria | 2210 |
| 618 | Ga0207428_10000064 | 3300027907 | Bacteria | 151185 |
| 619 | Ga0207428_10003078 | 3300027907 | Bacteria | 16410 |
| 620 | Ga0207428_10006523 | 3300027907 | Bacteria | 10765 |
| 621 | Ga0268266_10010320 | 3300028379 | Bacteria | 8170 |
| 622 | Ga0268266_10052520 | 3300028379 | Bacteria | 3500 |
| 623 | Ga0268266_10741623 | 3300028379 | Bacteria | 948 |
| 624 | Ga0268265_10003386 | 3300028380 | Bacteria | 11479 |
| 625 | Ga0268265_10064227 | 3300028380 | Bacteria | 2827 |
| 626 | Ga0268265_10312259 | 3300028380 | Bacteria | 1420 |
| 627 | Ga0268264_10003086 | 3300028381 | Bacteria | 14418 |
| 628 | Ga0268264_10162583 | 3300028381 | Bacteria | 2013 |
| 629 | Ga0268264_10508122 | 3300028381 | Bacteria | 1176 |
| 630 | Ga0265334_10062241 | 3300028573 | Bacteria | 1405 |
| 631 | Ga0265338_10258059 | 3300028800 | Bacteria | 1283 |
| 632 | Ga0265338_10396420 | 3300028800 | Bacteria | 984 |
| 633 | Ga0265338_10727185 | 3300028800 | Bacteria | 683 |
| 634 | Ga0265330_10288310 | 3300031235 | Bacteria | 691 |
| 635 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 636 | Ga0265325_10015951 | 3300031241 | Bacteria | 4208 |
| 637 | Ga0265325_10049438 | 3300031241 | Bacteria | 2170 |
| 638 | Ga0265325_10086875 | 3300031241 | Bacteria | 1547 |
| 639 | Ga0265325_10304470 | 3300031241 | Bacteria | 711 |
| 640 | Ga0265340_10216027 | 3300031247 | Bacteria | 860 |
| 641 | Ga0265339_10060333 | 3300031249 | Bacteria | 2044 |
| 642 | Ga0265339_10233286 | 3300031249 | Bacteria | 896 |
| 643 | Ga0265339_10329985 | 3300031249 | Bacteria | 722 |
| 644 | Ga0265327_10001075 | 3300031251 | Bacteria | 38065 |
| 645 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 646 | Ga0265313_10001122 | 3300031595 | Bacteria | 25603 |
| 647 | Ga0265313_10005418 | 3300031595 | Bacteria | 9399 |
| 648 | Ga0265313_10009773 | 3300031595 | Bacteria | 6181 |
| 649 | Ga0265313_10065468 | 3300031595 | Bacteria | 1687 |
| 650 | Ga0265314_10078013 | 3300031711 | Bacteria | 2195 |
| 651 | Ga0265314_10254593 | 3300031711 | Bacteria | 1006 |
| 652 | Ga0265342_10001631 | 3300031712 | Bacteria | 20687 |
| 653 | Ga0265342_10109886 | 3300031712 | Bacteria | 1561 |
| 654 | Ga0307405_10764607 | 3300031731 | Bacteria | 806 |
| 655 | Ga0307413_10613995 | 3300031824 | Bacteria | 892 |
| 656 | Ga0307412_10328399 | 3300031911 | Bacteria | 1220 |
| 657 | Ga0307416_100416024 | 3300032002 | Bacteria | 1387 |
| 658 | Ga0307411_10771220 | 3300032005 | Bacteria | 844 |
| 659 | Ga0307411_12094042 | 3300032005 | Unclassified | 529 |
| 660 | Ga0307415_101150037 | 3300032126 | Bacteria | 729 |
| 661 | Ga0373930_0153620 | 3300034816 | Bacteria | 579 |
| 662 | Ga0373948_0008375 | 3300034817 | Bacteria | 1759 |
| 663 | Ga0373950_0000575 | 3300034818 | Bacteria | 4508 |
| 664 | Ga0373958_0002130 | 3300034819 | Bacteria | 2742 |
| 665 | Ga0373958_0002762 | 3300034819 | Bacteria | 2489 |
| 666 | Ga0373958_0004921 | 3300034819 | Bacteria | 2002 |
| 667 | Ga0373958_0005151 | 3300034819 | Bacteria | 1972 |
| 668 | Ga0373959_0001506 | 3300034820 | Bacteria | 3726 |
| 669 | Ga0373959_0014183 | 3300034820 | Bacteria | 1447 |
| 670 | Ga0373938_0000276 | 3300034957 | Bacteria | 8189 |
| 671 | Ga0373926_0022405 | 3300035083 | Bacteria | 2192 |
| 672 | Ga0373926_0059886 | 3300035083 | Bacteria | 1386 |
| 673 | Ga0373926_0093256 | 3300035083 | Bacteria | 1121 |
| 674 | Ga0373928_0000820 | 3300035084 | Bacteria | 6070 |
| 675 | Ga0373928_0146245 | 3300035084 | Bacteria | 651 |
| 676 | Ga0373929_0002326 | 3300035085 | Bacteria | 3496 |
| 677 | Ga0373929_0027503 | 3300035085 | Bacteria | 1195 |
| 678 | Ga0373934_0023173 | 3300035086 | Bacteria | 2398 |
| 679 | Ga0373934_0088919 | 3300035086 | Bacteria | 1244 |
| 680 | Ga0373940_0000049 | 3300035088 | Bacteria | 13501 |
| 681 | Ga0373940_0002067 | 3300035088 | Bacteria | 3814 |
| 682 | Ga0373940_0378973 | 3300035088 | Unclassified | 501 |
| 683 | Ga0373944_0006580 | 3300035089 | Bacteria | 3087 |
| 684 | Ga0373944_0037658 | 3300035089 | Bacteria | 1482 |
| 685 | Ga0373949_0001191 | 3300035090 | Bacteria | 7712 |
| 686 | Ga0373949_0002203 | 3300035090 | Bacteria | 5099 |
| 687 | Ga0373949_0007218 | 3300035090 | Bacteria | 2435 |
| 688 | Ga0373951_0000518 | 3300035091 | Bacteria | 10973 |
| 689 | Ga0373951_0022569 | 3300035091 | Bacteria | 1449 |
| 690 | Ga0373951_0036363 | 3300035091 | Bacteria | 1175 |
| 691 | Ga0373952_0000453 | 3300035092 | Bacteria | 7153 |
| 692 | Ga0373952_0000483 | 3300035092 | Bacteria | 6949 |
| 693 | Ga0373952_0023287 | 3300035092 | Bacteria | 1322 |
| 694 | Ga0373923_0001175 | 3300035111 | Bacteria | 7302 |
| 695 | Ga0373923_0068057 | 3300035111 | Bacteria | 1524 |
| 696 | Ga0373923_0071871 | 3300035111 | Bacteria | 1487 |
| 697 | Ga0373923_0139502 | 3300035111 | Bacteria | 1095 |
| 698 | Ga0373932_0000462 | 3300035112 | Bacteria | 12458 |
| 699 | Ga0373932_0018167 | 3300035112 | Bacteria | 1815 |
| 700 | Ga0373932_0059751 | 3300035112 | Bacteria | 1155 |
| 701 | Ga0373936_0000328 | 3300035113 | Bacteria | 16031 |
| 702 | Ga0373936_0393460 | 3300035113 | Bacteria | 635 |
| 703 | Ga0373939_0001076 | 3300035114 | Bacteria | 6716 |
| 704 | Ga0373939_0003300 | 3300035114 | Bacteria | 3787 |
| 705 | Ga0373939_0003626 | 3300035114 | Bacteria | 3630 |
| 706 | Ga0373939_0014317 | 3300035114 | Bacteria | 2056 |
| 707 | Ga0373941_0048238 | 3300035115 | Bacteria | 1344 |
| 708 | Ga0373945_0000123 | 3300035116 | Bacteria | 19133 |
| 709 | Ga0373945_0075580 | 3300035116 | Bacteria | 1282 |
| 710 | Ga0373953_0017796 | 3300035117 | Bacteria | 2618 |
| 711 | Ga0373953_0035216 | 3300035117 | Bacteria | 1966 |
| 712 | Ga0373953_0394016 | 3300035117 | Bacteria | 609 |
| 713 | Ga0373954_0012572 | 3300035118 | Bacteria | 3765 |
| 714 | Ga0373954_0503934 | 3300035118 | Bacteria | 600 |
| 715 | Ga0373956_0045117 | 3300035119 | Bacteria | 1966 |
| 716 | Ga0373956_0083075 | 3300035119 | Bacteria | 1472 |
| 717 | Ga0373956_0139840 | 3300035119 | Bacteria | 1136 |
| 718 | Ga0373956_0218800 | 3300035119 | Bacteria | 904 |
| 719 | Ga0373957_0002486 | 3300035120 | Bacteria | 5276 |
| 720 | Ga0373957_0004774 | 3300035120 | Bacteria | 4152 |
| 721 | Ga0373957_0047990 | 3300035120 | Bacteria | 1626 |
| 722 | Ga0373957_0123089 | 3300035120 | Bacteria | 1051 |
| 723 | Ga0373960_0001504 | 3300035121 | Bacteria | 5184 |
| 724 | Ga0373960_0008556 | 3300035121 | Bacteria | 2455 |
| 725 | Ga0373943_0001821 | 3300035170 | Bacteria | 9632 |
| 726 | Ga0373943_0028120 | 3300035170 | Bacteria | 2648 |
| 727 | Ga0373943_0079624 | 3300035170 | Bacteria | 1677 |
| 728 | Ga0373943_0117503 | 3300035170 | Bacteria | 1410 |
| 729 | Ga0373943_0156385 | 3300035170 | Bacteria | 1238 |
| 730 | Ga0373943_0183007 | 3300035170 | Bacteria | 1152 |
| 731 | Ga0373946_0003579 | 3300035171 | Bacteria | 5512 |
| 732 | Ga0373946_0006894 | 3300035171 | Bacteria | 4135 |
| 733 | Ga0373946_0018373 | 3300035171 | Bacteria | 2685 |
| 734 | Ga0373946_0029864 | 3300035171 | Bacteria | 2173 |
| 735 | Ga0373955_0001781 | 3300035172 | Bacteria | 9242 |
| 736 | Ga0373955_0003764 | 3300035172 | Bacteria | 6683 |
| 737 | Ga0373955_0008163 | 3300035172 | Bacteria | 4847 |
| 738 | Ga0373955_0053359 | 3300035172 | Bacteria | 2207 |
| 739 | Ga0373955_0125793 | 3300035172 | Bacteria | 1493 |
| 740 | Ga0373955_0445025 | 3300035172 | Bacteria | 789 |
| 741 | Ga0373942_0004252 | 3300035207 | Bacteria | 3335 |
| 742 | Ga0373942_0023528 | 3300035207 | Bacteria | 1573 |
| 743 | Ga0373942_0226159 | 3300035207 | Bacteria | 629 |
| 744 | Ga0373961_0260354 | 3300035241 | Bacteria | 630 |
| 745 | Ga0373962_0000215 | 3300035242 | Bacteria | 12190 |
| 746 | Ga0373962_0001429 | 3300035242 | Bacteria | 5635 |
| 747 | Ga0373962_0002252 | 3300035242 | Bacteria | 4611 |
| 748 | Ga0373962_0041030 | 3300035242 | Bacteria | 1303 |
| 749 | Ga0373924_0005980 | 3300035410 | Bacteria | 4339 |
| 750 | Ga0373924_0145520 | 3300035410 | Bacteria | 1035 |
| 751 | Ga0373924_0202229 | 3300035410 | Bacteria | 876 |
| 752 | Ga0373924_0292737 | 3300035410 | Bacteria | 722 |
| 753 | Ga0373931_0004700 | 3300035691 | Bacteria | 6252 |
| 754 | Ga0373931_0014856 | 3300035691 | Bacteria | 3813 |
| 755 | Ga0373931_0021068 | 3300035691 | Bacteria | 3268 |
| 756 | Ga0373931_0047512 | 3300035691 | Bacteria | 2272 |
| 757 | Ga0373931_0047908 | 3300035691 | Bacteria | 2263 |
| 758 | Ga0373931_0149622 | 3300035691 | Bacteria | 1359 |
| 759 | Ga0373935_0008365 | 3300035692 | Bacteria | 6190 |
| 760 | Ga0373935_0008371 | 3300035692 | Bacteria | 6188 |
| 761 | Ga0373935_0010930 | 3300035692 | Bacteria | 5449 |
| 762 | Ga0373935_0128672 | 3300035692 | Bacteria | 1699 |
| 763 | Ga0373935_0136849 | 3300035692 | Bacteria | 1651 |
| 764 | Ga0373935_0162733 | 3300035692 | Bacteria | 1522 |
| 765 | Ga0373935_0243858 | 3300035692 | Bacteria | 1255 |
| 766 | Ga0373927_0002377 | 3300035695 | Bacteria | 13712 |
| 767 | Ga0373927_0009145 | 3300035695 | Bacteria | 6651 |
| 768 | Ga0373927_0059332 | 3300035695 | Bacteria | 2474 |
| 769 | Ga0373927_0357911 | 3300035695 | Bacteria | 962 |
| 770 | Ga0373927_0822108 | 3300035695 | Bacteria | 613 |
| 771 | Ga0373933_0003512 | 3300035724 | Bacteria | 8728 |
| 772 | Ga0373933_0005999 | 3300035724 | Bacteria | 6610 |
| 773 | Ga0373933_0014137 | 3300035724 | Bacteria | 4433 |
| 774 | Ga0373933_0502505 | 3300035724 | Bacteria | 794 |
| 775 | Ga0373933_0563715 | 3300035724 | Bacteria | 747 |
| 776 | Ga0373947_0002454 | 3300035725 | Bacteria | 11164 |
| 777 | Ga0373947_0003283 | 3300035725 | Bacteria | 9588 |
| 778 | Ga0373947_0005390 | 3300035725 | Bacteria | 7462 |
| 779 | Ga0373947_0028558 | 3300035725 | Bacteria | 3271 |
| 780 | Ga0373947_0155628 | 3300035725 | Bacteria | 1475 |
| 781 | Ga0373947_0203221 | 3300035725 | Bacteria | 1297 |
| 782 | Ga0373937_0000977 | 3300036401 | Bacteria | 24260 |
| 783 | Ga0373937_0000998 | 3300036401 | Bacteria | 23980 |
| 784 | Ga0373937_0011819 | 3300036401 | Bacteria | 7666 |
| 785 | Ga0373937_0067460 | 3300036401 | Bacteria | 3296 |
| 786 | Ga0373937_0075420 | 3300036401 | Bacteria | 3113 |
| 787 | Ga0373937_0076111 | 3300036401 | Bacteria | 3099 |
| 788 | Ga0373937_0281737 | 3300036401 | Unclassified | 1570 |
| 789 | Ga0316582_0590448 | 3300036647 | Bacteria | 765 |
| 790 | Ga0373925_0002457 | 3300037068 | Bacteria | 14848 |
| 791 | Ga0373925_0005022 | 3300037068 | Bacteria | 9926 |
| 792 | Ga0373925_0027418 | 3300037068 | Bacteria | 4169 |
| 793 | Ga0373925_0109865 | 3300037068 | Bacteria | 2128 |
| 794 | Ga0436364_0196077 | 3300037853 | Bacteria | 3393 |
| 795 | Ga0436364_0693652 | 3300037853 | Bacteria | 667 |
| 796 | Ga0242419_003577 | 3300038698 | Bacteria | 1057 |
| 797 | Ga0436365_1561377 | 3300039437 | Bacteria | 1136 |
| 798 | Ga0436365_1844700 | 3300039437 | Bacteria | 631 |
| 799 | Ga0436360_0067312 | 3300039438 | Bacteria | 2249 |
| 800 | Ga0436360_0689073 | 3300039438 | Bacteria | 1181 |
| 801 | Ga0436360_0906468 | 3300039438 | Bacteria | 686 |
| 802 | Ga0436360_1257893 | 3300039438 | Bacteria | 1398 |
| 803 | Ga0436363_0533112 | 3300039450 | Bacteria | 1019 |
| 804 | Ga0436363_0628984 | 3300039450 | Bacteria | 596 |
| 805 | Ga0436363_1506293 | 3300039450 | Bacteria | 1953 |
| 806 | Ga0436363_1544118 | 3300039450 | Unclassified | 655 |
| 807 | Ga0439453_0029892 | 3300041408 | Bacteria | 1027 |
| 808 | Ga0451793_1469895 | 3300041452 | Bacteria | 627 |
| 809 | Ga0439441_017992 | 3300042001 | Bacteria | 1275 |
| 810 | Ga0439450_025650 | 3300042008 | Bacteria | 1294 |
| 811 | Ga0439455_0106715 | 3300042012 | Bacteria | 777 |
| 812 | Ga0450923_174744 | 3300042125 | Unclassified | 527 |
| 813 | Ga0439464_0150717 | 3300042439 | Bacteria | 727 |
| 814 | Ga0451577_0110442 | 3300042876 | Bacteria | 2460 |
| 815 | Ga0451577_1318351 | 3300042876 | Bacteria | 642 |
| 816 | Ga0439440_0213986 | 3300042993 | Bacteria | 576 |
| 817 | Ga0466966_0993832 | 3300044684 | Bacteria | 506 |
| 818 | Ga0451576_0105771 | 3300045051 | Bacteria | 2928 |
| 819 | Ga0451576_0433355 | 3300045051 | Unclassified | 1380 |
| 820 | Ga0495592_0002187 | 3300046454 | Bacteria | 13770 |
| 821 | Ga0495592_0003145 | 3300046454 | Bacteria | 11808 |
| 822 | Ga0495592_0011852 | 3300046454 | Bacteria | 6605 |
| 823 | Ga0495592_0153609 | 3300046454 | Bacteria | 1589 |
| 824 | Ga0495603_0000127 | 3300046455 | Bacteria | 37048 |
| 825 | Ga0495603_0006157 | 3300046455 | Bacteria | 7172 |
| 826 | Ga0495603_0010152 | 3300046455 | Bacteria | 5698 |
| 827 | Ga0495629_0000474 | 3300046459 | Bacteria | 33674 |
| 828 | Ga0495629_0001081 | 3300046459 | Bacteria | 21648 |
| 829 | Ga0495629_0001491 | 3300046459 | Bacteria | 18414 |
| 830 | Ga0495629_0095292 | 3300046459 | Bacteria | 2076 |
| 831 | Ga0495629_0241009 | 3300046459 | Bacteria | 1245 |
| 832 | Ga0495641_0000716 | 3300046461 | Bacteria | 28072 |
| 833 | Ga0495641_0042565 | 3300046461 | Bacteria | 2104 |
| 834 | Ga0495641_0079762 | 3300046461 | Bacteria | 1466 |
| 835 | Ga0495651_0001830 | 3300046462 | Bacteria | 16422 |
| 836 | Ga0495651_0005021 | 3300046462 | Bacteria | 10109 |
| 837 | Ga0495651_0063498 | 3300046462 | Bacteria | 2822 |
| 838 | Ga0495651_0076902 | 3300046462 | Bacteria | 2527 |
| 839 | Ga0495651_0191302 | 3300046462 | Bacteria | 1440 |
| 840 | Ga0495653_0001477 | 3300046463 | Bacteria | 18333 |
| 841 | Ga0495653_0002011 | 3300046463 | Bacteria | 16000 |
| 842 | Ga0495653_0117615 | 3300046463 | Bacteria | 1899 |
| 843 | Ga0495653_0302595 | 3300046463 | Bacteria | 1042 |
| 844 | Ga0495580_0000533 | 3300046472 | Bacteria | 32237 |
| 845 | Ga0495580_0001373 | 3300046472 | Bacteria | 21360 |
| 846 | Ga0495580_0029341 | 3300046472 | Bacteria | 3993 |
| 847 | Ga0495582_0000310 | 3300046473 | Bacteria | 26965 |
| 848 | Ga0495582_0001241 | 3300046473 | Bacteria | 14349 |
| 849 | Ga0495582_0088147 | 3300046473 | Bacteria | 1728 |
| 850 | Ga0495582_0126967 | 3300046473 | Bacteria | 1439 |
| 851 | Ga0495605_0061919 | 3300046474 | Bacteria | 1789 |
| 852 | Ga0495639_0000593 | 3300046475 | Bacteria | 16896 |
| 853 | Ga0495639_0000991 | 3300046475 | Bacteria | 12814 |
| 854 | Ga0495639_0005266 | 3300046475 | Bacteria | 5562 |
| 855 | Ga0495662_0000599 | 3300046476 | Bacteria | 16654 |
| 856 | Ga0495662_0032239 | 3300046476 | Bacteria | 2531 |
| 857 | Ga0495662_0041930 | 3300046476 | Bacteria | 2209 |
| 858 | Ga0495662_0152150 | 3300046476 | Bacteria | 1139 |
| 859 | Ga0495662_0491309 | 3300046476 | Unclassified | 602 |
| 860 | Ga0495664_0001780 | 3300046477 | Bacteria | 11436 |
| 861 | Ga0495664_0008385 | 3300046477 | Bacteria | 5765 |
| 862 | Ga0495664_0089917 | 3300046477 | Bacteria | 1846 |
| 863 | Ga0495664_0120397 | 3300046477 | Bacteria | 1587 |
| 864 | Ga0495664_0173742 | 3300046477 | Bacteria | 1307 |
| 865 | Ga0495584_0019476 | 3300046491 | Bacteria | 3447 |
| 866 | Ga0495584_0036802 | 3300046491 | Bacteria | 2472 |
| 867 | Ga0495584_0292132 | 3300046491 | Bacteria | 828 |
| 868 | Ga0495585_0012307 | 3300046492 | Bacteria | 5040 |
| 869 | Ga0495594_0000660 | 3300046499 | Bacteria | 17845 |
| 870 | Ga0495594_0023664 | 3300046499 | Bacteria | 3293 |
| 871 | Ga0495607_0012298 | 3300046501 | Bacteria | 5658 |
| 872 | Ga0495608_0000844 | 3300046511 | Bacteria | 21431 |
| 873 | Ga0495608_0029605 | 3300046511 | Bacteria | 3712 |
| 874 | Ga0495608_0160962 | 3300046511 | Bacteria | 1427 |
| 875 | Ga0495608_0299470 | 3300046511 | Bacteria | 996 |
| 876 | Ga0495618_0003351 | 3300046514 | Bacteria | 9989 |
| 877 | Ga0495618_0006349 | 3300046514 | Bacteria | 7176 |
| 878 | Ga0495618_0010591 | 3300046514 | Bacteria | 5579 |
| 879 | Ga0495618_0112356 | 3300046514 | Bacteria | 1744 |
| 880 | Ga0495618_0239850 | 3300046514 | Bacteria | 1140 |
| 881 | Ga0495628_0017046 | 3300046516 | Bacteria | 6053 |
| 882 | Ga0495628_0022156 | 3300046516 | Bacteria | 5221 |
| 883 | Ga0495628_0079335 | 3300046516 | Bacteria | 2552 |
| 884 | Ga0495628_0201198 | 3300046516 | Bacteria | 1501 |
| 885 | Ga0495628_0743799 | 3300046516 | Bacteria | 689 |
| 886 | Ga0495630_0031825 | 3300046517 | Bacteria | 3928 |
| 887 | Ga0495630_0093594 | 3300046517 | Bacteria | 2271 |
| 888 | Ga0495630_0282768 | 3300046517 | Bacteria | 1267 |
| 889 | Ga0495630_0718255 | 3300046517 | Bacteria | 764 |
| 890 | Ga0495630_0733912 | 3300046517 | Bacteria | 755 |
| 891 | Ga0495631_0137035 | 3300046518 | Bacteria | 1051 |
| 892 | Ga0495637_0020659 | 3300046520 | Bacteria | 3027 |
| 893 | Ga0495644_0001924 | 3300046523 | Bacteria | 8344 |
| 894 | Ga0495666_0005432 | 3300046526 | Bacteria | 6419 |
| 895 | Ga0495666_0020312 | 3300046526 | Bacteria | 3292 |
| 896 | Ga0495666_0087088 | 3300046526 | Bacteria | 1475 |
| 897 | Ga0495652_0001947 | 3300046529 | Bacteria | 21945 |
| 898 | Ga0495652_0003249 | 3300046529 | Bacteria | 16200 |
| 899 | Ga0495652_0012241 | 3300046529 | Bacteria | 7747 |
| 900 | Ga0495652_0026434 | 3300046529 | Bacteria | 5129 |
| 901 | Ga0495652_0681172 | 3300046529 | Bacteria | 693 |
| 902 | Ga0495665_0000185 | 3300046531 | Bacteria | 31863 |
| 903 | Ga0495665_0007528 | 3300046531 | Bacteria | 5894 |
| 904 | Ga0495665_0009023 | 3300046531 | Bacteria | 5410 |
| 905 | Ga0495640_0006612 | 3300046533 | Bacteria | 9144 |
| 906 | Ga0495640_0006875 | 3300046533 | Bacteria | 8963 |
| 907 | Ga0495640_0113867 | 3300046533 | Bacteria | 1764 |
| 908 | Ga0495640_0149666 | 3300046533 | Bacteria | 1500 |
| 909 | Ga0495640_0153330 | 3300046533 | Bacteria | 1479 |
| 910 | Ga0495586_0003393 | 3300046535 | Bacteria | 8540 |
| 911 | Ga0495586_0028093 | 3300046535 | Bacteria | 3010 |
| 912 | Ga0495586_0302512 | 3300046535 | Bacteria | 916 |
| 913 | Ga0495587_0000732 | 3300046536 | Bacteria | 21969 |
| 914 | Ga0495587_0011211 | 3300046536 | Bacteria | 5683 |
| 915 | Ga0495587_0045682 | 3300046536 | Bacteria | 2602 |
| 916 | Ga0495587_0525530 | 3300046536 | Bacteria | 653 |
| 917 | Ga0495645_0003961 | 3300046543 | Bacteria | 10097 |
| 918 | Ga0495645_0005829 | 3300046543 | Bacteria | 8500 |
| 919 | Ga0495645_0028789 | 3300046543 | Bacteria | 4037 |
| 920 | Ga0495645_0080798 | 3300046543 | Bacteria | 2333 |
| 921 | Ga0495622_0001379 | 3300046557 | Bacteria | 12379 |
| 922 | Ga0495622_0028177 | 3300046557 | Bacteria | 2622 |
| 923 | Ga0495622_0277214 | 3300046557 | Bacteria | 734 |
| 924 | Ga0495633_0004731 | 3300046558 | Bacteria | 8549 |
| 925 | Ga0495667_0002039 | 3300046559 | Bacteria | 13390 |
| 926 | Ga0495667_0002260 | 3300046559 | Bacteria | 12888 |
| 927 | Ga0495667_0007395 | 3300046559 | Bacteria | 7447 |
| 928 | Ga0495667_0008839 | 3300046559 | Bacteria | 6849 |
| 929 | Ga0495667_0076054 | 3300046559 | Bacteria | 2184 |
| 930 | Ga0495667_0451324 | 3300046559 | Bacteria | 808 |
| 931 | Ga0495656_0000505 | 3300046615 | Bacteria | 12799 |
| 932 | Ga0495634_0005916 | 3300046642 | Bacteria | 9344 |
| 933 | Ga0495634_0006195 | 3300046642 | Bacteria | 9115 |
| 934 | Ga0495634_0027885 | 3300046642 | Bacteria | 3925 |
| 935 | Ga0495634_0047227 | 3300046642 | Bacteria | 2902 |
| 936 | Ga0495634_0136594 | 3300046642 | Bacteria | 1559 |
| 937 | Ga0495611_0018877 | 3300046648 | Bacteria | 2959 |
| 938 | Ga0495635_0002667 | 3300046663 | Bacteria | 12193 |
| 939 | Ga0495635_0008996 | 3300046663 | Bacteria | 6966 |
| 940 | Ga0495635_0018383 | 3300046663 | Bacteria | 4878 |
| 941 | Ga0495635_0035752 | 3300046663 | Bacteria | 3444 |
| 942 | Ga0495635_0145691 | 3300046663 | Bacteria | 1612 |
| 943 | Ga0495635_0374113 | 3300046663 | Bacteria | 948 |
| 944 | Ga0495635_0485779 | 3300046663 | Bacteria | 814 |
| 945 | Ga0495659_0000862 | 3300046664 | Bacteria | 10792 |
| 946 | Ga0495661_0063190 | 3300046665 | Bacteria | 2190 |
| 947 | Ga0495588_0000855 | 3300046674 | Bacteria | 13493 |
| 948 | Ga0495588_0039197 | 3300046674 | Bacteria | 2413 |
| 949 | Ga0495588_0042747 | 3300046674 | Bacteria | 2317 |
| 950 | Ga0495657_0019080 | 3300046675 | Bacteria | 4953 |
| 951 | Ga0495657_0037513 | 3300046675 | Bacteria | 3340 |
| 952 | Ga0495657_0061658 | 3300046675 | Bacteria | 2480 |
| 953 | Ga0495657_0257047 | 3300046675 | Bacteria | 1050 |
| 954 | Ga0495599_0013241 | 3300046678 | Bacteria | 5096 |
| 955 | Ga0495599_0037130 | 3300046678 | Bacteria | 3060 |
| 956 | Ga0495599_0052645 | 3300046678 | Bacteria | 2550 |
| 957 | Ga0495599_0149186 | 3300046678 | Bacteria | 1449 |
| 958 | Ga0495623_0003160 | 3300046679 | Bacteria | 10870 |
| 959 | Ga0495623_0040188 | 3300046679 | Bacteria | 2987 |
| 960 | Ga0495623_0078630 | 3300046679 | Bacteria | 2044 |
| 961 | Ga0495646_0000681 | 3300046680 | Bacteria | 18660 |
| 962 | Ga0495646_0009918 | 3300046680 | Bacteria | 6052 |
| 963 | Ga0495646_0316385 | 3300046680 | Bacteria | 823 |
| 964 | Ga0495647_0001556 | 3300046681 | Bacteria | 7080 |
| 965 | Ga0495647_0006977 | 3300046681 | Bacteria | 3765 |
| 966 | Ga0495647_0010913 | 3300046681 | Bacteria | 3103 |
| 967 | Ga0495647_0016276 | 3300046681 | Bacteria | 2615 |
| 968 | Ga0495647_0392571 | 3300046681 | Bacteria | 636 |
| 969 | Ga0495658_0000453 | 3300046683 | Bacteria | 22768 |
| 970 | Ga0495658_0000640 | 3300046683 | Bacteria | 18972 |
| 971 | Ga0495658_0003124 | 3300046683 | Bacteria | 8268 |
| 972 | Ga0495658_0011916 | 3300046683 | Bacteria | 4387 |
| 973 | Ga0495658_0303236 | 3300046683 | Bacteria | 1011 |
| 974 | Ga0495669_0000388 | 3300046684 | Bacteria | 21895 |
| 975 | Ga0495613_0000450 | 3300046689 | Bacteria | 35062 |
| 976 | Ga0495613_0010177 | 3300046689 | Bacteria | 6988 |
| 977 | Ga0495613_0059445 | 3300046689 | Bacteria | 2802 |
| 978 | Ga0495624_0000990 | 3300046690 | Bacteria | 22455 |
| 979 | Ga0495624_0168685 | 3300046690 | Bacteria | 1335 |
| 980 | Ga0495624_0178317 | 3300046690 | Bacteria | 1295 |
| 981 | Ga0495624_0352902 | 3300046690 | Bacteria | 884 |
| 982 | Ga0495670_0014504 | 3300046691 | Bacteria | 3873 |
| 983 | Ga0495600_0000326 | 3300046809 | Bacteria | 25282 |
| 984 | Ga0495600_0001691 | 3300046809 | Bacteria | 12333 |
| 985 | Ga0495600_0055531 | 3300046809 | Bacteria | 2586 |
| 986 | Ga0495600_0088439 | 3300046809 | Bacteria | 2021 |
| 987 | Ga0495581_0000462 | 3300047315 | Bacteria | 20789 |
| 988 | Ga0495581_0002835 | 3300047315 | Bacteria | 9903 |
| 989 | Ga0495581_0010642 | 3300047315 | Bacteria | 5317 |
| 990 | Ga0495581_0034799 | 3300047315 | Bacteria | 2915 |
| 991 | Ga0495604_0000643 | 3300047317 | Bacteria | 29876 |
| 992 | Ga0495604_0001763 | 3300047317 | Bacteria | 17689 |
| 993 | Ga0495604_0002511 | 3300047317 | Bacteria | 14648 |
| 994 | Ga0495604_0050376 | 3300047317 | Bacteria | 3234 |
| 995 | Ga0495674_0003479 | 3300047319 | Bacteria | 15302 |
| 996 | Ga0495674_0008425 | 3300047319 | Bacteria | 9822 |
| 997 | Ga0495674_0027234 | 3300047319 | Bacteria | 5224 |
| 998 | Ga0495674_0039411 | 3300047319 | Bacteria | 4235 |
| 999 | Ga0495674_0064848 | 3300047319 | Bacteria | 3174 |
| 1000 | Ga0495676_0003716 | 3300047321 | Bacteria | 13857 |
| 1001 | Ga0495676_0054793 | 3300047321 | Bacteria | 3167 |
| 1002 | Ga0495680_0001401 | 3300047322 | Bacteria | 26002 |
| 1003 | Ga0495680_0006685 | 3300047322 | Bacteria | 10678 |
| 1004 | Ga0495680_0006889 | 3300047322 | Bacteria | 10490 |
| 1005 | Ga0495680_0012123 | 3300047322 | Bacteria | 7605 |
| 1006 | Ga0495680_0021937 | 3300047322 | Bacteria | 5336 |
| 1007 | Ga0495680_0086555 | 3300047322 | Bacteria | 2357 |
| 1008 | Ga0495680_0094543 | 3300047322 | Bacteria | 2236 |
| 1009 | Ga0495675_0005017 | 3300047444 | Bacteria | 8053 |
| 1010 | Ga0495675_0031377 | 3300047444 | Bacteria | 3392 |
| 1011 | Ga0495675_0033575 | 3300047444 | Bacteria | 3275 |
| 1012 | Ga0495679_013128 | 3300047446 | Bacteria | 3123 |
| 1013 | Ga0495684_0020107 | 3300047471 | Bacteria | 5142 |
| 1014 | Ga0495684_0042671 | 3300047471 | Bacteria | 3473 |
| 1015 | Ga0495684_0052577 | 3300047471 | Bacteria | 3109 |
| 1016 | Ga0495684_0087324 | 3300047471 | Bacteria | 2364 |
| 1017 | Ga0495684_0317133 | 3300047471 | Bacteria | 1115 |
| 1018 | Ga0495593_0000730 | 3300047673 | Bacteria | 19058 |
| 1019 | Ga0495593_0002845 | 3300047673 | Bacteria | 10425 |
| 1020 | Ga0495593_0245199 | 3300047673 | Bacteria | 897 |
| 1021 | Ga0495593_0326769 | 3300047673 | Bacteria | 767 |
| 1022 | Ga0495602_0003673 | 3300048088 | Bacteria | 15906 |
| 1023 | Ga0495602_0005637 | 3300048088 | Bacteria | 13125 |
| 1024 | Ga0495602_0010516 | 3300048088 | Bacteria | 9605 |
| 1025 | Ga0495602_0405624 | 3300048088 | Bacteria | 971 |
| 1026 | Ga0495602_0427578 | 3300048088 | Bacteria | 939 |
| 1027 | Ga0495602_0434578 | 3300048088 | Bacteria | 929 |
| 1028 | Ga0495614_0013295 | 3300048089 | Bacteria | 3610 |
| 1029 | Ga0495614_0021658 | 3300048089 | Bacteria | 2775 |
| 1030 | Ga0495614_0064188 | 3300048089 | Bacteria | 1579 |
| 1031 | Ga0496100_0003708 | 3300048903 | Bacteria | 8002 |
| 1032 | Ga0496100_0076198 | 3300048903 | Bacteria | 2251 |
| 1033 | Ga0496100_0158496 | 3300048903 | Bacteria | 1621 |
| 1034 | Ga0496100_0507676 | 3300048903 | Bacteria | 929 |
| 1035 | Ga0496101_0012951 | 3300048904 | Bacteria | 5577 |
| 1036 | Ga0496101_0074915 | 3300048904 | Bacteria | 2490 |
| 1037 | Ga0496101_0310860 | 3300048904 | Bacteria | 1235 |
| 1038 | Ga0496101_0405182 | 3300048904 | Bacteria | 1074 |
| 1039 | Ga0496102_0002938 | 3300048905 | Bacteria | 14454 |
| 1040 | Ga0496102_0131440 | 3300048905 | Bacteria | 2344 |
| 1041 | Ga0496102_0332539 | 3300048905 | Bacteria | 1431 |
| 1042 | Ga0496102_0515200 | 3300048905 | Bacteria | 1118 |
| 1043 | Ga0496103_0003026 | 3300048906 | Bacteria | 10356 |
| 1044 | Ga0496103_0013998 | 3300048906 | Bacteria | 4762 |
| 1045 | Ga0496103_0028943 | 3300048906 | Bacteria | 3365 |
| 1046 | Ga0496103_0279927 | 3300048906 | Bacteria | 1073 |
| 1047 | Ga0496103_0455931 | 3300048906 | Bacteria | 820 |
| 1048 | Ga0496103_1020430 | 3300048906 | Bacteria | 514 |
| 1049 | Ga0496104_0000741 | 3300048907 | Bacteria | 27998 |
| 1050 | Ga0496104_0194289 | 3300048907 | Bacteria | 1941 |
| 1051 | Ga0496104_0208547 | 3300048907 | Bacteria | 1866 |
| 1052 | Ga0496104_0303240 | 3300048907 | Bacteria | 1509 |
| 1053 | Ga0496104_0342230 | 3300048907 | Bacteria | 1408 |
| 1054 | Ga0496104_0424694 | 3300048907 | Bacteria | 1241 |
| 1055 | Ga0496105_0011046 | 3300048908 | Bacteria | 7119 |
| 1056 | Ga0496105_0019370 | 3300048908 | Bacteria | 5488 |
| 1057 | Ga0496106_0009990 | 3300048909 | Bacteria | 7008 |
| 1058 | Ga0496106_0037988 | 3300048909 | Bacteria | 3602 |
| 1059 | Ga0496106_0062646 | 3300048909 | Bacteria | 2824 |
| 1060 | Ga0496106_0088279 | 3300048909 | Bacteria | 2390 |
| 1061 | Ga0496106_0195793 | 3300048909 | Bacteria | 1608 |
| 1062 | Ga0496106_0342064 | 3300048909 | Bacteria | 1201 |
| 1063 | Ga0496106_1027894 | 3300048909 | Bacteria | 647 |
| 1064 | Ga0496107_0015547 | 3300048910 | Bacteria | 5336 |
| 1065 | Ga0496107_0054442 | 3300048910 | Bacteria | 2887 |
| 1066 | Ga0496107_0104657 | 3300048910 | Bacteria | 2077 |
| 1067 | Ga0496107_0301202 | 3300048910 | Bacteria | 1193 |
| 1068 | Ga0496107_0411688 | 3300048910 | Bacteria | 1005 |
| 1069 | Ga0496108_0007653 | 3300048911 | Bacteria | 8745 |
| 1070 | Ga0496108_0078821 | 3300048911 | Bacteria | 2788 |
| 1071 | Ga0496108_0092967 | 3300048911 | Bacteria | 2565 |
| 1072 | Ga0496108_0241538 | 3300048911 | Bacteria | 1571 |
| 1073 | Ga0496108_0322150 | 3300048911 | Bacteria | 1347 |
| 1074 | Ga0496108_0975060 | 3300048911 | Bacteria | 725 |
| 1075 | Ga0496109_0000526 | 3300048912 | Bacteria | 32410 |
| 1076 | Ga0496109_0040880 | 3300048912 | Bacteria | 4200 |
| 1077 | Ga0496109_0064201 | 3300048912 | Bacteria | 3359 |
| 1078 | Ga0496109_0286158 | 3300048912 | Bacteria | 1554 |
| 1079 | Ga0496109_0500862 | 3300048912 | Bacteria | 1146 |
| 1080 | Ga0496109_0910820 | 3300048912 | Bacteria | 817 |
| 1081 | Ga0496110_0079401 | 3300048913 | Bacteria | 2922 |
| 1082 | Ga0496110_0080027 | 3300048913 | Bacteria | 2910 |
| 1083 | Ga0496110_0483296 | 3300048913 | Bacteria | 1128 |
| 1084 | Ga0496110_1383825 | 3300048913 | Bacteria | 613 |
| 1085 | Ga0496111_0030122 | 3300048914 | Bacteria | 3858 |
| 1086 | Ga0496111_0199372 | 3300048914 | Bacteria | 1488 |
| 1087 | Ga0496111_0206615 | 3300048914 | Bacteria | 1459 |
| 1088 | Ga0496112_0046760 | 3300048915 | Bacteria | 4245 |
| 1089 | Ga0496112_0084195 | 3300048915 | Bacteria | 3145 |
| 1090 | Ga0496112_0207537 | 3300048915 | Bacteria | 1917 |
| 1091 | Ga0496112_0279844 | 3300048915 | Bacteria | 1616 |
| 1092 | Ga0496112_1113207 | 3300048915 | Bacteria | 708 |
| 1093 | Ga0496113_0001026 | 3300048916 | Bacteria | 15018 |
| 1094 | Ga0496113_0041681 | 3300048916 | Bacteria | 3389 |
| 1095 | Ga0496113_0075727 | 3300048916 | Bacteria | 2569 |
| 1096 | Ga0496113_0184655 | 3300048916 | Bacteria | 1653 |
| 1097 | Ga0496113_0233463 | 3300048916 | Bacteria | 1467 |
| 1098 | Ga0496113_0401727 | 3300048916 | Bacteria | 1100 |
| 1099 | Ga0496113_0962263 | 3300048916 | Bacteria | 673 |
| 1100 | Ga0496114_0018559 | 3300048917 | Bacteria | 5626 |
| 1101 | Ga0496114_0019225 | 3300048917 | Bacteria | 5535 |
| 1102 | Ga0496114_0023712 | 3300048917 | Bacteria | 5008 |
| 1103 | Ga0496115_0019401 | 3300048918 | Bacteria | 5231 |
| 1104 | Ga0496115_0046484 | 3300048918 | Bacteria | 3469 |
| 1105 | Ga0496115_0205546 | 3300048918 | Bacteria | 1626 |
| 1106 | Ga0496115_0397562 | 3300048918 | Bacteria | 1119 |
| 1107 | Ga0496115_0821283 | 3300048918 | Bacteria | 722 |
| 1108 | Ga0501031_0131424 | 3300049568 | Bacteria | 1635 |
| 1109 | Ga0501031_0271447 | 3300049568 | Bacteria | 1101 |
| 1110 | Ga0501031_0492068 | 3300049568 | Bacteria | 791 |
| 1111 | Ga0501032_0037119 | 3300049569 | Bacteria | 3324 |
| 1112 | Ga0501032_0116694 | 3300049569 | Bacteria | 1765 |
| 1113 | Ga0501033_0067408 | 3300049570 | Bacteria | 2631 |
| 1114 | Ga0501034_0000097 | 3300049571 | Bacteria | 161027 |
| 1115 | Ga0501034_0119692 | 3300049571 | Bacteria | 2619 |
| 1116 | Ga0501034_0127255 | 3300049571 | Bacteria | 2532 |
| 1117 | Ga0501034_0154152 | 3300049571 | Bacteria | 2272 |
| 1118 | Ga0501034_0307575 | 3300049571 | Bacteria | 1520 |
| 1119 | Ga0501034_1279021 | 3300049571 | Bacteria | 611 |
| 1120 | Ga0501036_0100044 | 3300049572 | Bacteria | 2452 |
| 1121 | Ga0501036_0662789 | 3300049572 | Bacteria | 863 |
| 1122 | Ga0501037_0033917 | 3300049573 | Bacteria | 3769 |
| 1123 | Ga0501037_0113612 | 3300049573 | Bacteria | 1949 |
| 1124 | Ga0501037_0129663 | 3300049573 | Bacteria | 1809 |
| 1125 | Ga0501038_0014583 | 3300049574 | Bacteria | 7162 |
| 1126 | Ga0501038_0044497 | 3300049574 | Bacteria | 3856 |
| 1127 | Ga0501039_0262273 | 3300049575 | Bacteria | 1358 |
| 1128 | Ga0501039_0569401 | 3300049575 | Bacteria | 889 |
| 1129 | Ga0501042_1403239 | 3300049578 | Bacteria | 509 |
| 1130 | Ga0501043_0004428 | 3300049579 | Bacteria | 11409 |
| 1131 | Ga0501043_0241481 | 3300049579 | Bacteria | 1393 |
| 1132 | Ga0501043_0350381 | 3300049579 | Bacteria | 1122 |
| 1133 | Ga0501043_0502099 | 3300049579 | Bacteria | 906 |
| 1134 | Ga0501046_0000592 | 3300049580 | Bacteria | 35637 |
| 1135 | Ga0501046_0184946 | 3300049580 | Bacteria | 1556 |
| 1136 | Ga0501046_0973063 | 3300049580 | Bacteria | 590 |
| 1137 | Ga0501046_0982833 | 3300049580 | Bacteria | 586 |
| 1138 | Ga0501047_0063697 | 3300049581 | Bacteria | 3556 |
| 1139 | Ga0501047_0079115 | 3300049581 | Bacteria | 3161 |
| 1140 | Ga0501047_0138641 | 3300049581 | Bacteria | 2311 |
| 1141 | Ga0501047_0211652 | 3300049581 | Bacteria | 1797 |
| 1142 | Ga0501047_0380733 | 3300049581 | Bacteria | 1245 |
| 1143 | Ga0501047_0488879 | 3300049581 | Bacteria | 1058 |
| 1144 | Ga0501048_0402738 | 3300049582 | Bacteria | 978 |
| 1145 | Ga0501067_0203147 | 3300049583 | Bacteria | 1104 |
| 1146 | Ga0501068_0485764 | 3300049584 | Bacteria | 800 |
| 1147 | Ga0501070_0110549 | 3300049586 | Bacteria | 2271 |
| 1148 | Ga0501070_0200175 | 3300049586 | Bacteria | 1640 |
| 1149 | Ga0501070_0209609 | 3300049586 | Bacteria | 1600 |
| 1150 | Ga0501070_0274029 | 3300049586 | Bacteria | 1377 |
| 1151 | Ga0501071_0144258 | 3300049587 | Bacteria | 1774 |
| 1152 | Ga0501072_0356753 | 3300049588 | Bacteria | 1161 |
| 1153 | Ga0501072_0745018 | 3300049588 | Bacteria | 769 |
| 1154 | Ga0501073_0072222 | 3300049589 | Bacteria | 2403 |
| 1155 | Ga0501073_0505909 | 3300049589 | Bacteria | 835 |
| 1156 | Ga0501074_0029297 | 3300049590 | Bacteria | 3988 |
| 1157 | Ga0501074_0175972 | 3300049590 | Bacteria | 1527 |
| 1158 | Ga0501074_1124237 | 3300049590 | Bacteria | 551 |
| 1159 | Ga0501076_0464933 | 3300049592 | Bacteria | 1042 |
| 1160 | Ga0501080_0122468 | 3300049742 | Bacteria | 2409 |
| 1161 | Ga0501080_0340580 | 3300049742 | Bacteria | 1355 |
| 1162 | Ga0501080_1020047 | 3300049742 | Bacteria | 717 |
| 1163 | Ga0501081_0621635 | 3300049743 | Bacteria | 809 |
| 1164 | Ga0501083_0037630 | 3300049744 | Bacteria | 3294 |
| 1165 | Ga0501035_0076196 | 3300049822 | Bacteria | 2966 |
| 1166 | Ga0501035_0155636 | 3300049822 | Bacteria | 1981 |
| 1167 | Ga0501035_0435187 | 3300049822 | Bacteria | 1087 |
| 1168 | Ga0501035_1524383 | 3300049822 | Bacteria | 509 |
| 1169 | Ga0501044_0137076 | 3300049823 | Bacteria | 2438 |
| 1170 | Ga0501044_0179838 | 3300049823 | Bacteria | 2082 |
| 1171 | Ga0501044_0320487 | 3300049823 | Bacteria | 1474 |
| 1172 | Ga0501044_1140455 | 3300049823 | Bacteria | 648 |
| 1173 | Ga0501045_0255643 | 3300049824 | Bacteria | 1304 |
| 1174 | nmdc:mga00v17_304884_c1 | 3300050491 | Bacteria | 1034 |
| 1175 | nmdc:mga06z11_294277_c1 | 3300050494 | Bacteria | 964 |
| 1176 | nmdc:mga06z11_426718_c1 | 3300050494 | Bacteria | 799 |
| 1177 | nmdc:mga07m45_367446_c1 | 3300050496 | Bacteria | 836 |
| 1178 | nmdc:mga05p37_13983_c1 | 3300050507 | Bacteria | 9625 |
| 1179 | nmdc:mga05p37_30534_c1 | 3300050507 | Bacteria | 6575 |
| 1180 | nmdc:mga09592_5091_c1 | 3300050508 | Bacteria | 10670 |
| 1181 | nmdc:mga0qj67_15114_c1 | 3300050509 | Bacteria | 5842 |
| 1182 | nmdc:mga06r32_14111_c1 | 3300050510 | Bacteria | 7248 |
| 1183 | nmdc:mga06r32_764267_c1 | 3300050510 | Bacteria | 929 |
| 1184 | nmdc:mga06r32_88354_c1 | 3300050510 | Bacteria | 3025 |
| 1185 | nmdc:mga08y16_15444_c1 | 3300050511 | Bacteria | 8031 |
| 1186 | nmdc:mga08y16_56956_c1 | 3300050511 | Bacteria | 4085 |
| 1187 | nmdc:mga0n895_1237189_c1 | 3300050512 | Bacteria | 719 |
| 1188 | nmdc:mga0n895_14103_c1 | 3300050512 | Bacteria | 7245 |
| 1189 | nmdc:mga0n895_18419_c1 | 3300050512 | Bacteria | 6462 |
| 1190 | nmdc:mga0n895_272211_c1 | 3300050512 | Bacteria | 1718 |
| 1191 | nmdc:mga0n895_27429_c1 | 3300050512 | Bacteria | 5411 |
| 1192 | nmdc:mga0n895_384110_c1 | 3300050512 | Bacteria | 1421 |
| 1193 | nmdc:mga0rr50_106723_c1 | 3300050513 | Bacteria | 2210 |
| 1194 | nmdc:mga0rr50_247171_c1 | 3300050513 | Bacteria | 1480 |
| 1195 | nmdc:mga0rr50_324699_c1 | 3300050513 | Bacteria | 1291 |
| 1196 | nmdc:mga0rr50_52572_c1 | 3300050513 | Bacteria | 3028 |
| 1197 | nmdc:mga0rr50_55233_c1 | 3300050513 | Bacteria | 2962 |
| 1198 | nmdc:mga0rr50_7345_c1 | 3300050513 | Bacteria | 6788 |
| 1199 | nmdc:mga08x19_178479_c1 | 3300050514 | Bacteria | 1449 |
| 1200 | nmdc:mga08x19_198907_c1 | 3300050514 | Bacteria | 1373 |
| 1201 | nmdc:mga08x19_352423_c1 | 3300050514 | Bacteria | 1028 |
| 1202 | nmdc:mga0a205_19729_c1 | 3300050515 | Bacteria | 6361 |
| 1203 | nmdc:mga0a205_295825_c2 | 3300050515 | Bacteria | 856 |
| 1204 | nmdc:mga0a205_4498_c1 | 3300050515 | Bacteria | 12508 |
| 1205 | nmdc:mga0a205_51984_c1 | 3300050515 | Bacteria | 3955 |
| 1206 | Ga0495601_0001598 | 3300053077 | Bacteria | 12496 |
| 1207 | Ga0495601_0003108 | 3300053077 | Bacteria | 9482 |
| 1208 | Ga0495601_0005987 | 3300053077 | Bacteria | 7095 |
| 1209 | Ga0495601_0016195 | 3300053077 | Bacteria | 4515 |
| 1210 | Ga0495601_0376490 | 3300053077 | Bacteria | 922 |
| 1211 | Ga0495612_0000389 | 3300053078 | Bacteria | 17611 |
| 1212 | Ga0495612_0001478 | 3300053078 | Bacteria | 9675 |
| 1213 | Ga0495612_0001959 | 3300053078 | Bacteria | 8479 |
| 1214 | Ga0495612_0002008 | 3300053078 | Bacteria | 8382 |
| 1215 | Ga0495612_0011538 | 3300053078 | Bacteria | 3560 |
| 1216 | Ga0495612_0089477 | 3300053078 | Bacteria | 1301 |
| 1217 | Ga0495595_0000245 | 3300053084 | Bacteria | 21413 |
| 1218 | Ga0495595_0000948 | 3300053084 | Bacteria | 11166 |
| 1219 | Ga0495595_0001617 | 3300053084 | Bacteria | 8798 |
| 1220 | Ga0495595_0003200 | 3300053084 | Bacteria | 6495 |
| 1221 | Ga0495595_0012754 | 3300053084 | Bacteria | 3540 |
| 1222 | Ga0495619_0000097 | 3300053085 | Bacteria | 65411 |
| 1223 | Ga0495619_0000374 | 3300053085 | Bacteria | 30825 |
| 1224 | Ga0495619_0000478 | 3300053085 | Bacteria | 26805 |
| 1225 | Ga0495619_0003878 | 3300053085 | Bacteria | 9612 |
| 1226 | Ga0495619_0004827 | 3300053085 | Bacteria | 8559 |
| 1227 | Ga0495619_0004978 | 3300053085 | Bacteria | 8438 |
| 1228 | Ga0495619_0012506 | 3300053085 | Bacteria | 5346 |
| 1229 | Ga0495619_0022784 | 3300053085 | Bacteria | 4010 |
| 1230 | Ga0500566_0103427 | 3300053094 | Bacteria | 1558 |
| 1231 | Ga0501084_0602417 | 3300054114 | Bacteria | 928 |
| 1232 | Ga0501082_0230356 | 3300060353 | Bacteria | 1612 |
| 1233 | Ga0501082_0465872 | 3300060353 | Bacteria | 1104 |
| 1234 | Ga0373928_0028627 | |||
| 1235 | SwRhRL2b_contig_309045 | |||
| 1236 | 2214770210 | |||
| 1237 | ARcpr5oldR_c000101 | |||
| 1238 | ARSoilYngRDRAFT_c00241 | |||
| 1239 | ARcpr5yngRDRAFT_c000102 | |||
| 1240 | ARSoilOldRDRAFT_c000134 | |||
| 1241 | ARCol0oldRDRAFT_c00121 | |||
| 1242 | ARCol0yngRDRAFT_1000058 | |||
| 1243 | JGI24032J14994_100156 | |||
| 1244 | JGI24741J21665_1022680 | |||
| 1245 | JGI24752J21851_1000685 | |||
| 1246 | JGI24746J21847_1000232 | |||
| 1247 | JGI24747J21853_1000155 | |||
| 1248 | JGI24739J22299_10000103 | |||
| 1249 | JGI24737J22298_10001448 | |||
| 1250 | JGI24737J22298_10029151 | |||
| 1251 | JGI24743J22301_10004796 | |||
| 1252 | JGI24750J21931_1000146 | |||
| 1253 | JGI24745J21846_1000381 | |||
| 1254 | JGI24748J21848_1000880 | |||
| 1255 | JGI24738J21930_10000080 | |||
| 1256 | JGI24749J21850_1007989 | |||
| 1257 | JGI24749J21850_1021711 | |||
| 1258 | JGI24744J21845_10034652 | |||
| 1259 | JGI24035J26624_1000077 | |||
| 1260 | JGI24033J26618_1000650 | |||
| 1261 | JGI24034J26672_10000241 | |||
| 1262 | JGI24742J22300_10000066 | |||
| 1263 | JGI24751J29686_10004621 | |||
| 1264 | JGI25405J52794_10022384 | |||
| 1265 | JGI25405J52794_10038502 | |||
| 1266 | Ga0065717_1002263 | |||
| 1267 | Ga0065716_1001748 | |||
| 1268 | Ga0065714_10034947 | |||
| 1269 | Ga0065704_10073258 | |||
| 1270 | Ga0065712_10006326 | |||
| 1271 | Ga0065712_10077314 | |||
| 1272 | Ga0065712_10082297 | |||
| 1273 | Ga0065715_10089784 | |||
| 1274 | Ga0065715_10119480 | |||
| 1275 | Ga0065715_10153183 | |||
| 1276 | Ga0065715_10328988 | |||
| 1277 | Ga0065707_10406550 | |||
| 1278 | Ga0070658_10216384 | |||
| 1279 | Ga0070676_10010179 | |||
| 1280 | Ga0070676_10865739 | |||
| 1281 | Ga0070676_10910558 | |||
| 1282 | Ga0070676_11497590 | |||
| 1283 | Ga0070683_100000001 | |||
| 1284 | Ga0070683_100001199 | |||
| 1285 | Ga0070683_100102147 | |||
| 1286 | Ga0070683_100216813 | |||
| 1287 | Ga0070683_100304765 | |||
| 1288 | Ga0070690_100034038 | |||
| 1289 | Ga0070690_100041801 | |||
| 1290 | Ga0070690_100217576 | |||
| 1291 | Ga0070690_100666964 | |||
| 1292 | Ga0070670_100037807 | |||
| 1293 | Ga0070670_100057926 | |||
| 1294 | Ga0070677_10000497 | |||
| 1295 | Ga0068869_100000236 | |||
| 1296 | Ga0070666_10008751 | |||
| 1297 | Ga0070666_10085825 | |||
| 1298 | Ga0070680_100007477 | |||
| 1299 | Ga0070680_100152783 | |||
| 1300 | Ga0070680_100287481 | |||
| 1301 | Ga0070680_100343346 | |||
| 1302 | Ga0070680_100879356 | |||
| 1303 | Ga0070682_100002602 | |||
| 1304 | Ga0070682_100692923 | |||
| 1305 | Ga0070682_101076809 | |||
| 1306 | Ga0068868_100013245 | |||
| 1307 | Ga0070660_100003492 | |||
| 1308 | Ga0070660_100101864 | |||
| 1309 | Ga0070660_100102357 | |||
| 1310 | Ga0070660_100293168 | |||
| 1311 | Ga0070660_100553695 | |||
| 1312 | Ga0070689_100000466 | |||
| 1313 | Ga0070689_100116539 | |||
| 1314 | Ga0070689_100345745 | |||
| 1315 | Ga0070689_100655852 | |||
| 1316 | Ga0070691_10002256 | |||
| 1317 | Ga0070691_10589218 | |||
| 1318 | Ga0070687_100000277 | |||
| 1319 | Ga0070661_100000827 | |||
| 1320 | Ga0070661_100449196 | |||
| 1321 | Ga0070661_100867110 | |||
| 1322 | Ga0070692_10142335 | |||
| 1323 | Ga0070668_100010921 | |||
| 1324 | Ga0070668_100121809 | |||
| 1325 | Ga0070669_100002399 | |||
| 1326 | Ga0070675_100005703 | |||
| 1327 | Ga0070671_100000736 | |||
| 1328 | Ga0070671_100119314 | |||
| 1329 | Ga0070674_100010959 | |||
| 1330 | Ga0070673_100000302 | |||
| 1331 | Ga0070673_100092031 | |||
| 1332 | Ga0070688_100050588 | |||
| 1333 | Ga0070659_100001555 | |||
| 1334 | Ga0070659_101766058 | |||
| 1335 | Ga0070667_100002272 | |||
| 1336 | Ga0070667_100065449 | |||
| 1337 | Ga0070667_100120120 | |||
| 1338 | Ga0070667_100197812 | |||
| 1339 | Ga0070703_10001123 | |||
| 1340 | Ga0070703_10339458 | |||
| 1341 | Ga0070709_10016552 | |||
| 1342 | Ga0070709_11366045 | |||
| 1343 | Ga0070714_100043457 | |||
| 1344 | Ga0070714_100080604 | |||
| 1345 | Ga0070714_100175959 | |||
| 1346 | Ga0070714_100775192 | |||
| 1347 | Ga0070714_100792006 | |||
| 1348 | Ga0070713_100121443 | |||
| 1349 | Ga0070713_101071508 | |||
| 1350 | Ga0070710_10016794 | |||
| 1351 | Ga0070710_10022905 | |||
| 1352 | Ga0070710_10242047 | |||
| 1353 | Ga0070710_10421542 | |||
| 1354 | Ga0070710_10538825 | |||
| 1355 | Ga0070710_10773454 | |||
| 1356 | Ga0070710_10955315 | |||
| 1357 | Ga0070701_10000864 | |||
| 1358 | Ga0070701_10358656 | |||
| 1359 | Ga0070711_100080319 | |||
| 1360 | Ga0070711_100098761 | |||
| 1361 | Ga0070711_100103656 | |||
| 1362 | Ga0070711_100115857 | |||
| 1363 | Ga0070711_100157542 | |||
| 1364 | Ga0070711_100369247 | |||
| 1365 | Ga0070705_100001212 | |||
| 1366 | Ga0070705_100030515 | |||
| 1367 | Ga0070705_100100465 | |||
| 1368 | Ga0070705_100342026 | |||
| 1369 | Ga0070705_100558195 | |||
| 1370 | Ga0070700_100001313 | |||
| 1371 | Ga0070694_100003865 | |||
| 1372 | Ga0070694_100071827 | |||
| 1373 | Ga0070694_100148829 | |||
| 1374 | Ga0070694_101206258 | |||
| 1375 | Ga0070694_101371431 | |||
| 1376 | Ga0070708_100784682 | |||
| 1377 | Ga0070663_100021939 | |||
| 1378 | Ga0070663_100199586 | |||
| 1379 | Ga0070663_100408366 | |||
| 1380 | Ga0070663_101257870 | |||
| 1381 | Ga0070678_100005062 | |||
| 1382 | Ga0070678_100013987 | |||
| 1383 | Ga0070678_100133772 | |||
| 1384 | Ga0070662_100086416 | |||
| 1385 | Ga0070662_100141427 | |||
| 1386 | Ga0070662_100212296 | |||
| 1387 | Ga0070662_101191028 | |||
| 1388 | Ga0070662_101399376 | |||
| 1389 | Ga0070662_101603045 | |||
| 1390 | Ga0070681_10058442 | |||
| 1391 | Ga0070681_10325957 | |||
| 1392 | Ga0070681_10358326 | |||
| 1393 | Ga0070681_10934986 | |||
| 1394 | Ga0070681_10961182 | |||
| 1395 | Ga0070681_11840253 | |||
| 1396 | Ga0068867_100001495 | |||
| 1397 | Ga0068867_100306529 | |||
| 1398 | Ga0070685_10005500 | |||
| 1399 | Ga0070685_10005707 | |||
| 1400 | Ga0070679_100021336 | |||
| 1401 | Ga0070679_100064229 | |||
| 1402 | Ga0070679_100179346 | |||
| 1403 | Ga0070679_100333473 | |||
| 1404 | Ga0070679_100422294 | |||
| 1405 | Ga0070679_100651388 | |||
| 1406 | Ga0070679_100711874 | |||
| 1407 | Ga0070684_100005932 | |||
| 1408 | Ga0070684_100368497 | |||
| 1409 | Ga0070684_100526769 | |||
| 1410 | Ga0070684_100727907 | |||
| 1411 | Ga0070684_100746006 | |||
| 1412 | Ga0070697_100028994 | |||
| 1413 | Ga0070697_100216417 | |||
| 1414 | Ga0070697_100432428 | |||
| 1415 | Ga0068853_100000919 | |||
| 1416 | Ga0068853_100201197 | |||
| 1417 | Ga0068853_100228999 | |||
| 1418 | Ga0068853_100237770 | |||
| 1419 | Ga0068853_102200717 | |||
| 1420 | Ga0070672_100004500 | |||
| 1421 | Ga0070672_100278007 | |||
| 1422 | Ga0070686_100000488 | |||
| 1423 | Ga0070686_100154611 | |||
| 1424 | Ga0070686_100323971 | |||
| 1425 | Ga0070695_100002834 | |||
| 1426 | Ga0070695_100137259 | |||
| 1427 | Ga0070695_100210334 | |||
| 1428 | Ga0070696_100038159 | |||
| 1429 | Ga0070696_100039045 | |||
| 1430 | Ga0070696_100134549 | |||
| 1431 | Ga0070693_100002155 | |||
| 1432 | Ga0070665_100949159 | |||
| 1433 | Ga0070665_102256935 | |||
| 1434 | Ga0070704_100009996 | |||
| 1435 | Ga0070704_100016677 | |||
| 1436 | Ga0068855_100007603 | |||
| 1437 | Ga0068855_100147201 | |||
| 1438 | Ga0068855_100210414 | |||
| 1439 | Ga0068855_100518535 | |||
| 1440 | Ga0068855_100535350 | |||
| 1441 | Ga0068855_102128311 | |||
| 1442 | Ga0070664_100002753 | |||
| 1443 | Ga0070664_100059778 | |||
| 1444 | Ga0070664_100405934 | |||
| 1445 | Ga0070664_100878764 | |||
| 1446 | Ga0068857_100001539 | |||
| 1447 | Ga0068857_100860048 | |||
| 1448 | Ga0068854_100002718 | |||
| 1449 | Ga0068854_100873230 | |||
| 1450 | Ga0068854_101185016 | |||
| 1451 | Ga0068856_100001722 | |||
| 1452 | Ga0068856_100472386 | |||
| 1453 | Ga0068856_100978601 | |||
| 1454 | Ga0068856_101898933 | |||
| 1455 | Ga0070702_100007674 | |||
| 1456 | Ga0070702_100074487 | |||
| 1457 | Ga0068852_100001817 | |||
| 1458 | Ga0068852_100101514 | |||
| 1459 | Ga0068852_100345453 | |||
| 1460 | Ga0068852_100388936 | |||
| 1461 | Ga0068852_100923046 | |||
| 1462 | Ga0068852_100927546 | |||
| 1463 | Ga0068859_100010286 | |||
| 1464 | Ga0068859_100055055 | |||
| 1465 | Ga0068859_100067731 | |||
| 1466 | Ga0068859_100445196 | |||
| 1467 | Ga0068864_100002498 | |||
| 1468 | Ga0068866_10004287 | |||
| 1469 | Ga0068866_10079424 | |||
| 1470 | Ga0068861_100000668 | |||
| 1471 | Ga0068870_10000676 | |||
| 1472 | Ga0068863_100004649 | |||
| 1473 | Ga0068863_100576179 | |||
| 1474 | Ga0068858_100008130 | |||
| 1475 | Ga0068858_100190014 | |||
| 1476 | Ga0068858_100266723 | |||
| 1477 | Ga0068858_100435170 | |||
| 1478 | Ga0068858_101283400 | |||
| 1479 | Ga0068860_100007431 | |||
| 1480 | Ga0068860_100055702 | |||
| 1481 | Ga0068860_100209915 | |||
| 1482 | Ga0068862_100008906 | |||
| 1483 | Ga0068862_100317644 | |||
| 1484 | Ga0068862_100324628 | |||
| 1485 | Ga0068862_101889509 | |||
| 1486 | Ga0081455_10000327 | |||
| 1487 | Ga0070717_10001681 | |||
| 1488 | Ga0070717_10089694 | |||
| 1489 | Ga0070717_10186052 | |||
| 1490 | Ga0070717_10350141 | |||
| 1491 | Ga0070717_11575011 | |||
| 1492 | Ga0075365_10742849 | |||
| 1493 | Ga0075363_100062100 | |||
| 1494 | Ga0075432_10008052 | |||
| 1495 | Ga0075432_10053567 | |||
| 1496 | Ga0070715_10023768 | |||
| 1497 | Ga0070715_10143730 | |||
| 1498 | Ga0070716_100007734 | |||
| 1499 | Ga0070716_100494529 | |||
| 1500 | Ga0070712_100006392 | |||
| 1501 | Ga0070712_100150712 | |||
| 1502 | Ga0070712_100160167 | |||
| 1503 | Ga0070712_100260740 | |||
| 1504 | Ga0070712_100267571 | |||
| 1505 | Ga0075427_10003431 | |||
| 1506 | Ga0097621_100000892 | |||
| 1507 | Ga0097621_100097765 | |||
| 1508 | Ga0097621_100152142 | |||
| 1509 | Ga0075370_10490443 | |||
| 1510 | Ga0068871_100010466 | |||
| 1511 | Ga0068871_100034066 | |||
| 1512 | Ga0068871_100086509 | |||
| 1513 | Ga0075428_100035887 | |||
| 1514 | Ga0075428_101735292 | |||
| 1515 | Ga0075430_100007678 | |||
| 1516 | Ga0075430_100042524 | |||
| 1517 | Ga0075431_100007378 | |||
| 1518 | Ga0075431_100438823 | |||
| 1519 | Ga0075433_10002306 | |||
| 1520 | Ga0075433_10090055 | |||
| 1521 | Ga0075434_100000110 | |||
| 1522 | Ga0075434_100023586 | |||
| 1523 | Ga0075434_100023964 | |||
| 1524 | Ga0075434_101468170 | |||
| 1525 | Ga0075434_101632825 | |||
| 1526 | Ga0075429_100006496 | |||
| 1527 | Ga0068865_100000452 | |||
| 1528 | Ga0068865_100127075 | |||
| 1529 | Ga0068865_100523928 | |||
| 1530 | Ga0075436_100251899 | |||
| 1531 | Ga0075436_100342127 | |||
| 1532 | Ga0097620_100010289 | |||
| 1533 | Ga0097620_100055055 | |||
| 1534 | Ga0097620_100067730 | |||
| 1535 | Ga0097620_100445196 | |||
| 1536 | Ga0075435_100066443 | |||
| 1537 | Ga0075435_100069762 | |||
| 1538 | Ga0075435_100277272 | |||
| 1539 | Ga0105251_10032957 | |||
| 1540 | Ga0105251_10227641 | |||
| 1541 | Ga0105240_10377979 | |||
| 1542 | Ga0105240_11153613 | |||
| 1543 | Ga0111539_10002712 | |||
| 1544 | Ga0111539_10011154 | |||
| 1545 | Ga0111539_10016303 | |||
| 1546 | Ga0111539_10379568 | |||
| 1547 | Ga0111539_11230264 | |||
| 1548 | Ga0105245_10000380 | |||
| 1549 | Ga0105245_10175950 | |||
| 1550 | Ga0105245_10495036 | |||
| 1551 | Ga0105245_10998244 | |||
| 1552 | Ga0105245_11129873 | |||
| 1553 | Ga0105247_10095025 | |||
| 1554 | Ga0105247_10095195 | |||
| 1555 | Ga0114129_10058215 | |||
| 1556 | Ga0114129_10086721 | |||
| 1557 | Ga0105243_10002254 | |||
| 1558 | Ga0105243_12385601 | |||
| 1559 | Ga0105241_10000342 | |||
| 1560 | Ga0105241_10273046 | |||
| 1561 | Ga0105241_10321033 | |||
| 1562 | Ga0105241_10469851 | |||
| 1563 | Ga0105242_10000855 | |||
| 1564 | Ga0105242_10114826 | |||
| 1565 | Ga0105242_10126470 | |||
| 1566 | Ga0105242_10455389 | |||
| 1567 | Ga0105248_10012394 | |||
| 1568 | Ga0105248_10027173 | |||
| 1569 | Ga0105248_10227162 | |||
| 1570 | Ga0105248_10566771 | |||
| 1571 | Ga0105237_10165865 | |||
| 1572 | Ga0105237_10350105 | |||
| 1573 | Ga0105237_10670432 | |||
| 1574 | Ga0105237_12039233 | |||
| 1575 | Ga0105238_10053194 | |||
| 1576 | Ga0105238_10161315 | |||
| 1577 | Ga0105238_10282017 | |||
| 1578 | Ga0105238_10791792 | |||
| 1579 | Ga0105238_10865163 | |||
| 1580 | Ga0105249_10001982 | |||
| 1581 | Ga0105249_10019413 | |||
| 1582 | Ga0105249_10089178 | |||
| 1583 | Ga0105249_10818843 | |||
| 1584 | Ga0105249_11646056 | |||
| 1585 | Ga0105239_10012830 | |||
| 1586 | Ga0105239_10042492 | |||
| 1587 | Ga0105239_10132145 | |||
| 1588 | Ga0105239_10172256 | |||
| 1589 | Ga0105239_11111307 | |||
| 1590 | Ga0105246_10000185 | |||
| 1591 | Ga0105246_10231406 | |||
| 1592 | Ga0157337_1015808 | |||
| 1593 | Ga0157323_1021068 | |||
| 1594 | Ga0157319_1045173 | |||
| 1595 | Ga0157345_1041907 | |||
| 1596 | Ga0157314_1017101 | |||
| 1597 | Ga0157347_1021434 | |||
| 1598 | Ga0157339_1015113 | |||
| 1599 | Ga0157339_1026226 | |||
| 1600 | Ga0157324_1027005 | |||
| 1601 | Ga0157327_1029806 | |||
| 1602 | Ga0157326_1002949 | |||
| 1603 | Ga0157373_10130966 | |||
| 1604 | Ga0157373_10162794 | |||
| 1605 | Ga0157373_10296751 | |||
| 1606 | Ga0157373_10867538 | |||
| 1607 | Ga0157373_11148155 | |||
| 1608 | Ga0157371_10006659 | |||
| 1609 | Ga0157371_10648232 | |||
| 1610 | Ga0157370_10577840 | |||
| 1611 | Ga0157369_10323622 | |||
| 1612 | Ga0157369_10777524 | |||
| 1613 | Ga0157369_12367953 | |||
| 1614 | Ga0157374_10001986 | |||
| 1615 | Ga0157374_10033399 | |||
| 1616 | Ga0157378_10001729 | |||
| 1617 | Ga0157378_10166278 | |||
| 1618 | Ga0157378_10322366 | |||
| 1619 | Ga0157378_10846386 | |||
| 1620 | Ga0163162_10012026 | |||
| 1621 | Ga0163162_10026532 | |||
| 1622 | Ga0163162_10057878 | |||
| 1623 | Ga0163162_10990683 | |||
| 1624 | Ga0163162_12184061 | |||
| 1625 | Ga0157372_10024601 | |||
| 1626 | Ga0157372_10593975 | |||
| 1627 | Ga0157372_10632801 | |||
| 1628 | Ga0157372_10645343 | |||
| 1629 | Ga0157372_12640263 | |||
| 1630 | Ga0157375_10001883 | |||
| 1631 | Ga0157375_10030202 | |||
| 1632 | Ga0163163_10010785 | |||
| 1633 | Ga0163163_10295679 | |||
| 1634 | Ga0157380_10007676 | |||
| 1635 | Ga0157380_10869299 | |||
| 1636 | Ga0157377_10000643 | |||
| 1637 | Ga0157379_10010633 | |||
| 1638 | Ga0157379_10026543 | |||
| 1639 | Ga0157379_10599353 | |||
| 1640 | Ga0157376_10000920 | |||
| 1641 | Ga0157376_10426233 | |||
| 1642 | Ga0157376_10578466 | |||
| 1643 | Ga0157376_10680057 | |||
| 1644 | Ga0163161_10000379 | |||
| 1645 | Ga0163161_10737962 | |||
| 1646 | Ga0163161_11339248 | |||
| 1647 | Ga0206354_11424105 | |||
| 1648 | Ga0213874_10147432 | |||
| 1649 | Ga0213871_10124861 | |||
| 1650 | Ga0207666_1000046 | |||
| 1651 | Ga0207673_1000461 | |||
| 1652 | Ga0207697_10000714 | |||
| 1653 | Ga0207697_10045981 | |||
| 1654 | Ga0207713_1076792 | |||
| 1655 | Ga0207653_10004733 | |||
| 1656 | Ga0207682_10000043 | |||
| 1657 | Ga0207692_10007751 | |||
| 1658 | Ga0207692_10055266 | |||
| 1659 | Ga0207692_10641073 | |||
| 1660 | Ga0207692_10931279 | |||
| 1661 | Ga0207642_10002212 | |||
| 1662 | Ga0207710_10002657 | |||
| 1663 | Ga0207710_10004284 | |||
| 1664 | Ga0207710_10079101 | |||
| 1665 | Ga0207710_10086258 | |||
| 1666 | Ga0207688_10000083 | |||
| 1667 | Ga0207688_10036653 | |||
| 1668 | Ga0207680_10005187 | |||
| 1669 | Ga0207680_10116964 | |||
| 1670 | Ga0207647_10025829 | |||
| 1671 | Ga0207685_10015847 | |||
| 1672 | Ga0207685_10064252 | |||
| 1673 | Ga0207699_10012561 | |||
| 1674 | Ga0207699_10035800 | |||
| 1675 | Ga0207699_10065818 | |||
| 1676 | Ga0207645_10002954 | |||
| 1677 | Ga0207645_10015101 | |||
| 1678 | Ga0207645_10160586 | |||
| 1679 | Ga0207643_10000128 | |||
| 1680 | Ga0207705_10397009 | |||
| 1681 | Ga0207654_10001559 | |||
| 1682 | Ga0207654_10550168 | |||
| 1683 | Ga0207707_10004600 | |||
| 1684 | Ga0207707_10210462 | |||
| 1685 | Ga0207707_10619673 | |||
| 1686 | Ga0207707_11349131 | |||
| 1687 | Ga0207695_10598098 | |||
| 1688 | Ga0207671_10013743 | |||
| 1689 | Ga0207671_10151757 | |||
| 1690 | Ga0207671_10422168 | |||
| 1691 | Ga0207671_10529717 | |||
| 1692 | Ga0207693_10008254 | |||
| 1693 | Ga0207693_10012476 | |||
| 1694 | Ga0207693_10022622 | |||
| 1695 | Ga0207693_10116477 | |||
| 1696 | Ga0207693_10208215 | |||
| 1697 | Ga0207663_10016239 | |||
| 1698 | Ga0207663_10197595 | |||
| 1699 | Ga0207663_10253841 | |||
| 1700 | Ga0207663_10470974 | |||
| 1701 | Ga0207663_10931645 | |||
| 1702 | Ga0207660_10001486 | |||
| 1703 | Ga0207660_10483731 | |||
| 1704 | Ga0207660_10484894 | |||
| 1705 | Ga0207660_10535411 | |||
| 1706 | Ga0207660_10790831 | |||
| 1707 | Ga0207662_10000301 | |||
| 1708 | Ga0207657_10001859 | |||
| 1709 | Ga0207657_10047359 | |||
| 1710 | Ga0207657_10107787 | |||
| 1711 | Ga0207657_10327325 | |||
| 1712 | Ga0207649_10003562 | |||
| 1713 | Ga0207649_10046661 | |||
| 1714 | Ga0207649_10650080 | |||
| 1715 | Ga0207649_10718638 | |||
| 1716 | Ga0207652_10016674 | |||
| 1717 | Ga0207652_10046330 | |||
| 1718 | Ga0207652_10153811 | |||
| 1719 | Ga0207652_10259840 | |||
| 1720 | Ga0207652_10441052 | |||
| 1721 | Ga0207652_10561912 | |||
| 1722 | Ga0207681_10004864 | |||
| 1723 | Ga0207694_10076101 | |||
| 1724 | Ga0207694_10457974 | |||
| 1725 | Ga0207694_10570376 | |||
| 1726 | Ga0207650_10019558 | |||
| 1727 | Ga0207650_10690913 | |||
| 1728 | Ga0207659_10000411 | |||
| 1729 | Ga0207659_10374250 | |||
| 1730 | Ga0207687_10000667 | |||
| 1731 | Ga0207687_10259128 | |||
| 1732 | Ga0207687_10473587 | |||
| 1733 | Ga0207687_10675276 | |||
| 1734 | Ga0207700_10000412 | |||
| 1735 | Ga0207700_10040508 | |||
| 1736 | Ga0207700_10189586 | |||
| 1737 | Ga0207664_10107056 | |||
| 1738 | Ga0207664_10202163 | |||
| 1739 | Ga0207664_10385539 | |||
| 1740 | Ga0207664_10731138 | |||
| 1741 | Ga0207664_10882667 | |||
| 1742 | Ga0207644_10005279 | |||
| 1743 | Ga0207644_10009684 | |||
| 1744 | Ga0207644_10100107 | |||
| 1745 | Ga0207644_10280769 | |||
| 1746 | Ga0207690_10002854 | |||
| 1747 | Ga0207690_10015321 | |||
| 1748 | Ga0207706_10004082 | |||
| 1749 | Ga0207706_10031063 | |||
| 1750 | Ga0207706_10211589 | |||
| 1751 | Ga0207686_10000579 | |||
| 1752 | Ga0207686_10033530 | |||
| 1753 | Ga0207709_10000551 | |||
| 1754 | Ga0207709_10104027 | |||
| 1755 | Ga0207709_10171562 | |||
| 1756 | Ga0207709_10183425 | |||
| 1757 | Ga0207670_10000556 | |||
| 1758 | Ga0207670_10394064 | |||
| 1759 | Ga0207669_10000675 | |||
| 1760 | Ga0207704_10002887 | |||
| 1761 | Ga0207704_10109694 | |||
| 1762 | Ga0207704_10501021 | |||
| 1763 | Ga0207665_10014619 | |||
| 1764 | Ga0207665_10146009 | |||
| 1765 | Ga0207665_10214421 | |||
| 1766 | Ga0207665_10453868 | |||
| 1767 | Ga0207665_10736491 | |||
| 1768 | Ga0207691_10000599 | |||
| 1769 | Ga0207691_10063150 | |||
| 1770 | Ga0207691_10118905 | |||
| 1771 | Ga0207711_10010308 | |||
| 1772 | Ga0207711_10073399 | |||
| 1773 | Ga0207711_10312423 | |||
| 1774 | Ga0207689_10000165 | |||
| 1775 | Ga0207661_10008897 | |||
| 1776 | Ga0207679_10000112 | |||
| 1777 | Ga0207679_10044874 | |||
| 1778 | Ga0207667_10017788 | |||
| 1779 | Ga0207667_10038289 | |||
| 1780 | Ga0207667_10091380 | |||
| 1781 | Ga0207667_10614442 | |||
| 1782 | Ga0207667_10842176 | |||
| 1783 | Ga0207651_10000099 | |||
| 1784 | Ga0207651_10555171 | |||
| 1785 | Ga0207712_10019595 | |||
| 1786 | Ga0207712_10135889 | |||
| 1787 | Ga0207712_10267370 | |||
| 1788 | Ga0207712_11515422 | |||
| 1789 | Ga0207668_10000713 | |||
| 1790 | Ga0207668_10142168 | |||
| 1791 | Ga0207640_10002957 | |||
| 1792 | Ga0207640_10619175 | |||
| 1793 | Ga0207658_10003702 | |||
| 1794 | Ga0207658_10067675 | |||
| 1795 | Ga0207658_10206505 | |||
| 1796 | Ga0207658_11001604 | |||
| 1797 | Ga0207677_10010465 | |||
| 1798 | Ga0207703_10018016 | |||
| 1799 | Ga0207703_10058062 | |||
| 1800 | Ga0207703_10122787 | |||
| 1801 | Ga0207703_10336333 | |||
| 1802 | Ga0207639_10002883 | |||
| 1803 | Ga0207639_10250332 | |||
| 1804 | Ga0207639_10449624 | |||
| 1805 | Ga0207639_10925591 | |||
| 1806 | Ga0207639_11053468 | |||
| 1807 | Ga0207678_10001329 | |||
| 1808 | Ga0207678_10029433 | |||
| 1809 | Ga0207678_10036192 | |||
| 1810 | Ga0207678_10328559 | |||
| 1811 | Ga0207678_11000848 | |||
| 1812 | Ga0207708_10000862 | |||
| 1813 | Ga0207708_10113285 | |||
| 1814 | Ga0207708_10458939 | |||
| 1815 | Ga0207702_10007796 | |||
| 1816 | Ga0207702_10148575 | |||
| 1817 | Ga0207702_10606172 | |||
| 1818 | Ga0207702_11838734 | |||
| 1819 | Ga0207641_10001462 | |||
| 1820 | Ga0207641_10242043 | |||
| 1821 | Ga0207641_10730699 | |||
| 1822 | Ga0207648_10001891 | |||
| 1823 | Ga0207648_10081422 | |||
| 1824 | Ga0207648_10288236 | |||
| 1825 | Ga0207676_10001459 | |||
| 1826 | Ga0207676_10136555 | |||
| 1827 | Ga0207676_10376323 | |||
| 1828 | Ga0207674_10006899 | |||
| 1829 | Ga0207674_10212794 | |||
| 1830 | Ga0207674_10333507 | |||
| 1831 | Ga0207675_100001575 | |||
| 1832 | Ga0207675_100040944 | |||
| 1833 | Ga0207675_100387886 | |||
| 1834 | Ga0207683_10001273 | |||
| 1835 | Ga0207683_10004182 | |||
| 1836 | Ga0207683_10026331 | |||
| 1837 | Ga0207698_10000511 | |||
| 1838 | Ga0207698_10006111 | |||
| 1839 | Ga0207698_11324611 | |||
| 1840 | Ga0207698_12227675 | |||
| 1841 | Ga0209984_1026426 | |||
| 1842 | Ga0209999_1042707 | |||
| 1843 | Ga0210002_1002548 | |||
| 1844 | Ga0210002_1036553 | |||
| 1845 | Ga0209971_1020926 | |||
| 1846 | Ga0209966_1002413 | |||
| 1847 | Ga0209966_1007471 | |||
| 1848 | Ga0209998_10001602 | |||
| 1849 | Ga0209998_10009907 | |||
| 1850 | Ga0209974_10020171 | |||
| 1851 | Ga0207428_10000064 | |||
| 1852 | Ga0207428_10003078 | |||
| 1853 | Ga0207428_10006523 | |||
| 1854 | Ga0268266_10010320 | |||
| 1855 | Ga0268266_10052520 | |||
| 1856 | Ga0268266_10741623 | |||
| 1857 | Ga0268265_10003386 | |||
| 1858 | Ga0268265_10064227 | |||
| 1859 | Ga0268265_10312259 | |||
| 1860 | Ga0268264_10003086 | |||
| 1861 | Ga0268264_10162583 | |||
| 1862 | Ga0268264_10508122 | |||
| 1863 | Ga0265334_10062241 | |||
| 1864 | Ga0265338_10258059 | |||
| 1865 | Ga0265338_10396420 | |||
| 1866 | Ga0265338_10727185 | |||
| 1867 | Ga0265330_10288310 | |||
| 1868 | Ga0265325_10000006 | |||
| 1869 | Ga0265325_10015951 | |||
| 1870 | Ga0265325_10049438 | |||
| 1871 | Ga0265325_10086875 | |||
| 1872 | Ga0265325_10304470 | |||
| 1873 | Ga0265340_10216027 | |||
| 1874 | Ga0265339_10060333 | |||
| 1875 | Ga0265339_10233286 | |||
| 1876 | Ga0265339_10329985 | |||
| 1877 | Ga0265327_10001075 | |||
| 1878 | Ga0307513_10000010 | |||
| 1879 | Ga0265313_10001122 | |||
| 1880 | Ga0265313_10005418 | |||
| 1881 | Ga0265313_10009773 | |||
| 1882 | Ga0265313_10065468 | |||
| 1883 | Ga0265314_10078013 | |||
| 1884 | Ga0265314_10254593 | |||
| 1885 | Ga0265342_10001631 | |||
| 1886 | Ga0265342_10109886 | |||
| 1887 | Ga0307405_10764607 | |||
| 1888 | Ga0307413_10613995 | |||
| 1889 | Ga0307412_10328399 | |||
| 1890 | Ga0307416_100416024 | |||
| 1891 | Ga0307411_10771220 | |||
| 1892 | Ga0307411_12094042 | |||
| 1893 | Ga0307415_101150037 | |||
| 1894 | Ga0373930_0153620 | |||
| 1895 | Ga0373948_0008375 | |||
| 1896 | Ga0373950_0000575 | |||
| 1897 | Ga0373958_0002130 | |||
| 1898 | Ga0373958_0002762 | |||
| 1899 | Ga0373958_0004921 | |||
| 1900 | Ga0373958_0005151 | |||
| 1901 | Ga0373959_0001506 | |||
| 1902 | Ga0373959_0014183 | |||
| 1903 | Ga0373938_0000276 | |||
| 1904 | Ga0373926_0022405 | |||
| 1905 | Ga0373926_0059886 | |||
| 1906 | Ga0373926_0093256 | |||
| 1907 | Ga0373928_0000820 | |||
| 1908 | Ga0373928_0146245 | |||
| 1909 | Ga0373929_0002326 | |||
| 1910 | Ga0373929_0027503 | |||
| 1911 | Ga0373934_0023173 | |||
| 1912 | Ga0373934_0088919 | |||
| 1913 | Ga0373940_0000049 | |||
| 1914 | Ga0373940_0002067 | |||
| 1915 | Ga0373940_0378973 | |||
| 1916 | Ga0373944_0006580 | |||
| 1917 | Ga0373944_0037658 | |||
| 1918 | Ga0373949_0001191 | |||
| 1919 | Ga0373949_0002203 | |||
| 1920 | Ga0373949_0007218 | |||
| 1921 | Ga0373951_0000518 | |||
| 1922 | Ga0373951_0022569 | |||
| 1923 | Ga0373951_0036363 | |||
| 1924 | Ga0373952_0000453 | |||
| 1925 | Ga0373952_0000483 | |||
| 1926 | Ga0373952_0023287 | |||
| 1927 | Ga0373923_0001175 | |||
| 1928 | Ga0373923_0068057 | |||
| 1929 | Ga0373923_0071871 | |||
| 1930 | Ga0373923_0139502 | |||
| 1931 | Ga0373932_0000462 | |||
| 1932 | Ga0373932_0018167 | |||
| 1933 | Ga0373932_0059751 | |||
| 1934 | Ga0373936_0000328 | |||
| 1935 | Ga0373936_0393460 | |||
| 1936 | Ga0373939_0001076 | |||
| 1937 | Ga0373939_0003300 | |||
| 1938 | Ga0373939_0003626 | |||
| 1939 | Ga0373939_0014317 | |||
| 1940 | Ga0373941_0048238 | |||
| 1941 | Ga0373945_0000123 | |||
| 1942 | Ga0373945_0075580 | |||
| 1943 | Ga0373953_0017796 | |||
| 1944 | Ga0373953_0035216 | |||
| 1945 | Ga0373953_0394016 | |||
| 1946 | Ga0373954_0012572 | |||
| 1947 | Ga0373954_0503934 | |||
| 1948 | Ga0373956_0045117 | |||
| 1949 | Ga0373956_0083075 | |||
| 1950 | Ga0373956_0139840 | |||
| 1951 | Ga0373956_0218800 | |||
| 1952 | Ga0373957_0002486 | |||
| 1953 | Ga0373957_0004774 | |||
| 1954 | Ga0373957_0047990 | |||
| 1955 | Ga0373957_0123089 | |||
| 1956 | Ga0373960_0001504 | |||
| 1957 | Ga0373960_0008556 | |||
| 1958 | Ga0373943_0001821 | |||
| 1959 | Ga0373943_0028120 | |||
| 1960 | Ga0373943_0079624 | |||
| 1961 | Ga0373943_0117503 | |||
| 1962 | Ga0373943_0156385 | |||
| 1963 | Ga0373943_0183007 | |||
| 1964 | Ga0373946_0003579 | |||
| 1965 | Ga0373946_0006894 | |||
| 1966 | Ga0373946_0018373 | |||
| 1967 | Ga0373946_0029864 | |||
| 1968 | Ga0373955_0001781 | |||
| 1969 | Ga0373955_0003764 | |||
| 1970 | Ga0373955_0008163 | |||
| 1971 | Ga0373955_0053359 | |||
| 1972 | Ga0373955_0125793 | |||
| 1973 | Ga0373955_0445025 | |||
| 1974 | Ga0373942_0004252 | |||
| 1975 | Ga0373942_0023528 | |||
| 1976 | Ga0373942_0226159 | |||
| 1977 | Ga0373961_0260354 | |||
| 1978 | Ga0373962_0000215 | |||
| 1979 | Ga0373962_0001429 | |||
| 1980 | Ga0373962_0002252 | |||
| 1981 | Ga0373962_0041030 | |||
| 1982 | Ga0373924_0005980 | |||
| 1983 | Ga0373924_0145520 | |||
| 1984 | Ga0373924_0202229 | |||
| 1985 | Ga0373924_0292737 | |||
| 1986 | Ga0373931_0004700 | |||
| 1987 | Ga0373931_0014856 | |||
| 1988 | Ga0373931_0021068 | |||
| 1989 | Ga0373931_0047512 | |||
| 1990 | Ga0373931_0047908 | |||
| 1991 | Ga0373931_0149622 | |||
| 1992 | Ga0373935_0008365 | |||
| 1993 | Ga0373935_0008371 | |||
| 1994 | Ga0373935_0010930 | |||
| 1995 | Ga0373935_0128672 | |||
| 1996 | Ga0373935_0136849 | |||
| 1997 | Ga0373935_0162733 | |||
| 1998 | Ga0373935_0243858 | |||
| 1999 | Ga0373927_0002377 | |||
| 2000 | Ga0373927_0009145 | |||
| 2001 | Ga0373927_0059332 | |||
| 2002 | Ga0373927_0357911 | |||
| 2003 | Ga0373927_0822108 | |||
| 2004 | Ga0373933_0003512 | |||
| 2005 | Ga0373933_0005999 | |||
| 2006 | Ga0373933_0014137 | |||
| 2007 | Ga0373933_0502505 | |||
| 2008 | Ga0373933_0563715 | |||
| 2009 | Ga0373947_0002454 | |||
| 2010 | Ga0373947_0003283 | |||
| 2011 | Ga0373947_0005390 | |||
| 2012 | Ga0373947_0028558 | |||
| 2013 | Ga0373947_0155628 | |||
| 2014 | Ga0373947_0203221 | |||
| 2015 | Ga0373937_0000977 | |||
| 2016 | Ga0373937_0000998 | |||
| 2017 | Ga0373937_0011819 | |||
| 2018 | Ga0373937_0067460 | |||
| 2019 | Ga0373937_0075420 | |||
| 2020 | Ga0373937_0076111 | |||
| 2021 | Ga0373937_0281737 | |||
| 2022 | Ga0316582_0590448 | |||
| 2023 | Ga0373925_0002457 | |||
| 2024 | Ga0373925_0005022 | |||
| 2025 | Ga0373925_0027418 | |||
| 2026 | Ga0373925_0109865 | |||
| 2027 | Ga0436364_0196077 | |||
| 2028 | Ga0436364_0693652 | |||
| 2029 | Ga0242419_003577 | |||
| 2030 | Ga0436365_1561377 | |||
| 2031 | Ga0436365_1844700 | |||
| 2032 | Ga0436360_0067312 | |||
| 2033 | Ga0436360_0689073 | |||
| 2034 | Ga0436360_0906468 | |||
| 2035 | Ga0436360_1257893 | |||
| 2036 | Ga0436363_0533112 | |||
| 2037 | Ga0436363_0628984 | |||
| 2038 | Ga0436363_1506293 | |||
| 2039 | Ga0436363_1544118 | |||
| 2040 | Ga0439453_0029892 | |||
| 2041 | Ga0451793_1469895 | |||
| 2042 | Ga0439441_017992 | |||
| 2043 | Ga0439450_025650 | |||
| 2044 | Ga0439455_0106715 | |||
| 2045 | Ga0450923_174744 | |||
| 2046 | Ga0439464_0150717 | |||
| 2047 | Ga0451577_0110442 | |||
| 2048 | Ga0451577_1318351 | |||
| 2049 | Ga0439440_0213986 | |||
| 2050 | Ga0466966_0993832 | |||
| 2051 | Ga0451576_0105771 | |||
| 2052 | Ga0451576_0433355 | |||
| 2053 | Ga0495592_0002187 | |||
| 2054 | Ga0495592_0003145 | |||
| 2055 | Ga0495592_0011852 | |||
| 2056 | Ga0495592_0153609 | |||
| 2057 | Ga0495603_0000127 | |||
| 2058 | Ga0495603_0006157 | |||
| 2059 | Ga0495603_0010152 | |||
| 2060 | Ga0495629_0000474 | |||
| 2061 | Ga0495629_0001081 | |||
| 2062 | Ga0495629_0001491 | |||
| 2063 | Ga0495629_0095292 | |||
| 2064 | Ga0495629_0241009 | |||
| 2065 | Ga0495641_0000716 | |||
| 2066 | Ga0495641_0042565 | |||
| 2067 | Ga0495641_0079762 | |||
| 2068 | Ga0495651_0001830 | |||
| 2069 | Ga0495651_0005021 | |||
| 2070 | Ga0495651_0063498 | |||
| 2071 | Ga0495651_0076902 | |||
| 2072 | Ga0495651_0191302 | |||
| 2073 | Ga0495653_0001477 | |||
| 2074 | Ga0495653_0002011 | |||
| 2075 | Ga0495653_0117615 | |||
| 2076 | Ga0495653_0302595 | |||
| 2077 | Ga0495580_0000533 | |||
| 2078 | Ga0495580_0001373 | |||
| 2079 | Ga0495580_0029341 | |||
| 2080 | Ga0495582_0000310 | |||
| 2081 | Ga0495582_0001241 | |||
| 2082 | Ga0495582_0088147 | |||
| 2083 | Ga0495582_0126967 | |||
| 2084 | Ga0495605_0061919 | |||
| 2085 | Ga0495639_0000593 | |||
| 2086 | Ga0495639_0000991 | |||
| 2087 | Ga0495639_0005266 | |||
| 2088 | Ga0495662_0000599 | |||
| 2089 | Ga0495662_0032239 | |||
| 2090 | Ga0495662_0041930 | |||
| 2091 | Ga0495662_0152150 | |||
| 2092 | Ga0495662_0491309 | |||
| 2093 | Ga0495664_0001780 | |||
| 2094 | Ga0495664_0008385 | |||
| 2095 | Ga0495664_0089917 | |||
| 2096 | Ga0495664_0120397 | |||
| 2097 | Ga0495664_0173742 | |||
| 2098 | Ga0495584_0019476 | |||
| 2099 | Ga0495584_0036802 | |||
| 2100 | Ga0495584_0292132 | |||
| 2101 | Ga0495585_0012307 | |||
| 2102 | Ga0495594_0000660 | |||
| 2103 | Ga0495594_0023664 | |||
| 2104 | Ga0495607_0012298 | |||
| 2105 | Ga0495608_0000844 | |||
| 2106 | Ga0495608_0029605 | |||
| 2107 | Ga0495608_0160962 | |||
| 2108 | Ga0495608_0299470 | |||
| 2109 | Ga0495618_0003351 | |||
| 2110 | Ga0495618_0006349 | |||
| 2111 | Ga0495618_0010591 | |||
| 2112 | Ga0495618_0112356 | |||
| 2113 | Ga0495618_0239850 | |||
| 2114 | Ga0495628_0017046 | |||
| 2115 | Ga0495628_0022156 | |||
| 2116 | Ga0495628_0079335 | |||
| 2117 | Ga0495628_0201198 | |||
| 2118 | Ga0495628_0743799 | |||
| 2119 | Ga0495630_0031825 | |||
| 2120 | Ga0495630_0093594 | |||
| 2121 | Ga0495630_0282768 | |||
| 2122 | Ga0495630_0718255 | |||
| 2123 | Ga0495630_0733912 | |||
| 2124 | Ga0495631_0137035 | |||
| 2125 | Ga0495637_0020659 | |||
| 2126 | Ga0495644_0001924 | |||
| 2127 | Ga0495666_0005432 | |||
| 2128 | Ga0495666_0020312 | |||
| 2129 | Ga0495666_0087088 | |||
| 2130 | Ga0495652_0001947 | |||
| 2131 | Ga0495652_0003249 | |||
| 2132 | Ga0495652_0012241 | |||
| 2133 | Ga0495652_0026434 | |||
| 2134 | Ga0495652_0681172 | |||
| 2135 | Ga0495665_0000185 | |||
| 2136 | Ga0495665_0007528 | |||
| 2137 | Ga0495665_0009023 | |||
| 2138 | Ga0495640_0006612 | |||
| 2139 | Ga0495640_0006875 | |||
| 2140 | Ga0495640_0113867 | |||
| 2141 | Ga0495640_0149666 | |||
| 2142 | Ga0495640_0153330 | |||
| 2143 | Ga0495586_0003393 | |||
| 2144 | Ga0495586_0028093 | |||
| 2145 | Ga0495586_0302512 | |||
| 2146 | Ga0495587_0000732 | |||
| 2147 | Ga0495587_0011211 | |||
| 2148 | Ga0495587_0045682 | |||
| 2149 | Ga0495587_0525530 | |||
| 2150 | Ga0495645_0003961 | |||
| 2151 | Ga0495645_0005829 | |||
| 2152 | Ga0495645_0028789 | |||
| 2153 | Ga0495645_0080798 | |||
| 2154 | Ga0495622_0001379 | |||
| 2155 | Ga0495622_0028177 | |||
| 2156 | Ga0495622_0277214 | |||
| 2157 | Ga0495633_0004731 | |||
| 2158 | Ga0495667_0002039 | |||
| 2159 | Ga0495667_0002260 | |||
| 2160 | Ga0495667_0007395 | |||
| 2161 | Ga0495667_0008839 | |||
| 2162 | Ga0495667_0076054 | |||
| 2163 | Ga0495667_0451324 | |||
| 2164 | Ga0495656_0000505 | |||
| 2165 | Ga0495634_0005916 | |||
| 2166 | Ga0495634_0006195 | |||
| 2167 | Ga0495634_0027885 | |||
| 2168 | Ga0495634_0047227 | |||
| 2169 | Ga0495634_0136594 | |||
| 2170 | Ga0495611_0018877 | |||
| 2171 | Ga0495635_0002667 | |||
| 2172 | Ga0495635_0008996 | |||
| 2173 | Ga0495635_0018383 | |||
| 2174 | Ga0495635_0035752 | |||
| 2175 | Ga0495635_0145691 | |||
| 2176 | Ga0495635_0374113 | |||
| 2177 | Ga0495635_0485779 | |||
| 2178 | Ga0495659_0000862 | |||
| 2179 | Ga0495661_0063190 | |||
| 2180 | Ga0495588_0000855 | |||
| 2181 | Ga0495588_0039197 | |||
| 2182 | Ga0495588_0042747 | |||
| 2183 | Ga0495657_0019080 | |||
| 2184 | Ga0495657_0037513 | |||
| 2185 | Ga0495657_0061658 | |||
| 2186 | Ga0495657_0257047 | |||
| 2187 | Ga0495599_0013241 | |||
| 2188 | Ga0495599_0037130 | |||
| 2189 | Ga0495599_0052645 | |||
| 2190 | Ga0495599_0149186 | |||
| 2191 | Ga0495623_0003160 | |||
| 2192 | Ga0495623_0040188 | |||
| 2193 | Ga0495623_0078630 | |||
| 2194 | Ga0495646_0000681 | |||
| 2195 | Ga0495646_0009918 | |||
| 2196 | Ga0495646_0316385 | |||
| 2197 | Ga0495647_0001556 | |||
| 2198 | Ga0495647_0006977 | |||
| 2199 | Ga0495647_0010913 | |||
| 2200 | Ga0495647_0016276 | |||
| 2201 | Ga0495647_0392571 | |||
| 2202 | Ga0495658_0000453 | |||
| 2203 | Ga0495658_0000640 | |||
| 2204 | Ga0495658_0003124 | |||
| 2205 | Ga0495658_0011916 | |||
| 2206 | Ga0495658_0303236 | |||
| 2207 | Ga0495669_0000388 | |||
| 2208 | Ga0495613_0000450 | |||
| 2209 | Ga0495613_0010177 | |||
| 2210 | Ga0495613_0059445 | |||
| 2211 | Ga0495624_0000990 | |||
| 2212 | Ga0495624_0168685 | |||
| 2213 | Ga0495624_0178317 | |||
| 2214 | Ga0495624_0352902 | |||
| 2215 | Ga0495670_0014504 | |||
| 2216 | Ga0495600_0000326 | |||
| 2217 | Ga0495600_0001691 | |||
| 2218 | Ga0495600_0055531 | |||
| 2219 | Ga0495600_0088439 | |||
| 2220 | Ga0495581_0000462 | |||
| 2221 | Ga0495581_0002835 | |||
| 2222 | Ga0495581_0010642 | |||
| 2223 | Ga0495581_0034799 | |||
| 2224 | Ga0495604_0000643 | |||
| 2225 | Ga0495604_0001763 | |||
| 2226 | Ga0495604_0002511 | |||
| 2227 | Ga0495604_0050376 | |||
| 2228 | Ga0495674_0003479 | |||
| 2229 | Ga0495674_0008425 | |||
| 2230 | Ga0495674_0027234 | |||
| 2231 | Ga0495674_0039411 | |||
| 2232 | Ga0495674_0064848 | |||
| 2233 | Ga0495676_0003716 | |||
| 2234 | Ga0495676_0054793 | |||
| 2235 | Ga0495680_0001401 | |||
| 2236 | Ga0495680_0006685 | |||
| 2237 | Ga0495680_0006889 | |||
| 2238 | Ga0495680_0012123 | |||
| 2239 | Ga0495680_0021937 | |||
| 2240 | Ga0495680_0086555 | |||
| 2241 | Ga0495680_0094543 | |||
| 2242 | Ga0495675_0005017 | |||
| 2243 | Ga0495675_0031377 | |||
| 2244 | Ga0495675_0033575 | |||
| 2245 | Ga0495679_013128 | |||
| 2246 | Ga0495684_0020107 | |||
| 2247 | Ga0495684_0042671 | |||
| 2248 | Ga0495684_0052577 | |||
| 2249 | Ga0495684_0087324 | |||
| 2250 | Ga0495684_0317133 | |||
| 2251 | Ga0495593_0000730 | |||
| 2252 | Ga0495593_0002845 | |||
| 2253 | Ga0495593_0245199 | |||
| 2254 | Ga0495593_0326769 | |||
| 2255 | Ga0495602_0003673 | |||
| 2256 | Ga0495602_0005637 | |||
| 2257 | Ga0495602_0010516 | |||
| 2258 | Ga0495602_0405624 | |||
| 2259 | Ga0495602_0427578 | |||
| 2260 | Ga0495602_0434578 | |||
| 2261 | Ga0495614_0013295 | |||
| 2262 | Ga0495614_0021658 | |||
| 2263 | Ga0495614_0064188 | |||
| 2264 | Ga0496100_0003708 | |||
| 2265 | Ga0496100_0076198 | |||
| 2266 | Ga0496100_0158496 | |||
| 2267 | Ga0496100_0507676 | |||
| 2268 | Ga0496101_0012951 | |||
| 2269 | Ga0496101_0074915 | |||
| 2270 | Ga0496101_0310860 | |||
| 2271 | Ga0496101_0405182 | |||
| 2272 | Ga0496102_0002938 | |||
| 2273 | Ga0496102_0131440 | |||
| 2274 | Ga0496102_0332539 | |||
| 2275 | Ga0496102_0515200 | |||
| 2276 | Ga0496103_0003026 | |||
| 2277 | Ga0496103_0013998 | |||
| 2278 | Ga0496103_0028943 | |||
| 2279 | Ga0496103_0279927 | |||
| 2280 | Ga0496103_0455931 | |||
| 2281 | Ga0496103_1020430 | |||
| 2282 | Ga0496104_0000741 | |||
| 2283 | Ga0496104_0194289 | |||
| 2284 | Ga0496104_0208547 | |||
| 2285 | Ga0496104_0303240 | |||
| 2286 | Ga0496104_0342230 | |||
| 2287 | Ga0496104_0424694 | |||
| 2288 | Ga0496105_0011046 | |||
| 2289 | Ga0496105_0019370 | |||
| 2290 | Ga0496106_0009990 | |||
| 2291 | Ga0496106_0037988 | |||
| 2292 | Ga0496106_0062646 | |||
| 2293 | Ga0496106_0088279 | |||
| 2294 | Ga0496106_0195793 | |||
| 2295 | Ga0496106_0342064 | |||
| 2296 | Ga0496106_1027894 | |||
| 2297 | Ga0496107_0015547 | |||
| 2298 | Ga0496107_0054442 | |||
| 2299 | Ga0496107_0104657 | |||
| 2300 | Ga0496107_0301202 | |||
| 2301 | Ga0496107_0411688 | |||
| 2302 | Ga0496108_0007653 | |||
| 2303 | Ga0496108_0078821 | |||
| 2304 | Ga0496108_0092967 | |||
| 2305 | Ga0496108_0241538 | |||
| 2306 | Ga0496108_0322150 | |||
| 2307 | Ga0496108_0975060 | |||
| 2308 | Ga0496109_0000526 | |||
| 2309 | Ga0496109_0040880 | |||
| 2310 | Ga0496109_0064201 | |||
| 2311 | Ga0496109_0286158 | |||
| 2312 | Ga0496109_0500862 | |||
| 2313 | Ga0496109_0910820 | |||
| 2314 | Ga0496110_0079401 | |||
| 2315 | Ga0496110_0080027 | |||
| 2316 | Ga0496110_0483296 | |||
| 2317 | Ga0496110_1383825 | |||
| 2318 | Ga0496111_0030122 | |||
| 2319 | Ga0496111_0199372 | |||
| 2320 | Ga0496111_0206615 | |||
| 2321 | Ga0496112_0046760 | |||
| 2322 | Ga0496112_0084195 | |||
| 2323 | Ga0496112_0207537 | |||
| 2324 | Ga0496112_0279844 | |||
| 2325 | Ga0496112_1113207 | |||
| 2326 | Ga0496113_0001026 | |||
| 2327 | Ga0496113_0041681 | |||
| 2328 | Ga0496113_0075727 | |||
| 2329 | Ga0496113_0184655 | |||
| 2330 | Ga0496113_0233463 | |||
| 2331 | Ga0496113_0401727 | |||
| 2332 | Ga0496113_0962263 | |||
| 2333 | Ga0496114_0018559 | |||
| 2334 | Ga0496114_0019225 | |||
| 2335 | Ga0496114_0023712 | |||
| 2336 | Ga0496115_0019401 | |||
| 2337 | Ga0496115_0046484 | |||
| 2338 | Ga0496115_0205546 | |||
| 2339 | Ga0496115_0397562 | |||
| 2340 | Ga0496115_0821283 | |||
| 2341 | Ga0501031_0131424 | |||
| 2342 | Ga0501031_0271447 | |||
| 2343 | Ga0501031_0492068 | |||
| 2344 | Ga0501032_0037119 | |||
| 2345 | Ga0501032_0116694 | |||
| 2346 | Ga0501033_0067408 | |||
| 2347 | Ga0501034_0000097 | |||
| 2348 | Ga0501034_0119692 | |||
| 2349 | Ga0501034_0127255 | |||
| 2350 | Ga0501034_0154152 | |||
| 2351 | Ga0501034_0307575 | |||
| 2352 | Ga0501034_1279021 | |||
| 2353 | Ga0501036_0100044 | |||
| 2354 | Ga0501036_0662789 | |||
| 2355 | Ga0501037_0033917 | |||
| 2356 | Ga0501037_0113612 | |||
| 2357 | Ga0501037_0129663 | |||
| 2358 | Ga0501038_0014583 | |||
| 2359 | Ga0501038_0044497 | |||
| 2360 | Ga0501039_0262273 | |||
| 2361 | Ga0501039_0569401 | |||
| 2362 | Ga0501042_1403239 | |||
| 2363 | Ga0501043_0004428 | |||
| 2364 | Ga0501043_0241481 | |||
| 2365 | Ga0501043_0350381 | |||
| 2366 | Ga0501043_0502099 | |||
| 2367 | Ga0501046_0000592 | |||
| 2368 | Ga0501046_0184946 | |||
| 2369 | Ga0501046_0973063 | |||
| 2370 | Ga0501046_0982833 | |||
| 2371 | Ga0501047_0063697 | |||
| 2372 | Ga0501047_0079115 | |||
| 2373 | Ga0501047_0138641 | |||
| 2374 | Ga0501047_0211652 | |||
| 2375 | Ga0501047_0380733 | |||
| 2376 | Ga0501047_0488879 | |||
| 2377 | Ga0501048_0402738 | |||
| 2378 | Ga0501067_0203147 | |||
| 2379 | Ga0501068_0485764 | |||
| 2380 | Ga0501070_0110549 | |||
| 2381 | Ga0501070_0200175 | |||
| 2382 | Ga0501070_0209609 | |||
| 2383 | Ga0501070_0274029 | |||
| 2384 | Ga0501071_0144258 | |||
| 2385 | Ga0501072_0356753 | |||
| 2386 | Ga0501072_0745018 | |||
| 2387 | Ga0501073_0072222 | |||
| 2388 | Ga0501073_0505909 | |||
| 2389 | Ga0501074_0029297 | |||
| 2390 | Ga0501074_0175972 | |||
| 2391 | Ga0501074_1124237 | |||
| 2392 | Ga0501076_0464933 | |||
| 2393 | Ga0501080_0122468 | |||
| 2394 | Ga0501080_0340580 | |||
| 2395 | Ga0501080_1020047 | |||
| 2396 | Ga0501081_0621635 | |||
| 2397 | Ga0501083_0037630 | |||
| 2398 | Ga0501035_0076196 | |||
| 2399 | Ga0501035_0155636 | |||
| 2400 | Ga0501035_0435187 | |||
| 2401 | Ga0501035_1524383 | |||
| 2402 | Ga0501044_0137076 | |||
| 2403 | Ga0501044_0179838 | |||
| 2404 | Ga0501044_0320487 | |||
| 2405 | Ga0501044_1140455 | |||
| 2406 | Ga0501045_0255643 | |||
| 2407 | nmdc:mga00v17_304884_c1 | |||
| 2408 | nmdc:mga06z11_294277_c1 | |||
| 2409 | nmdc:mga06z11_426718_c1 | |||
| 2410 | nmdc:mga07m45_367446_c1 | |||
| 2411 | nmdc:mga05p37_13983_c1 | |||
| 2412 | nmdc:mga05p37_30534_c1 | |||
| 2413 | nmdc:mga09592_5091_c1 | |||
| 2414 | nmdc:mga0qj67_15114_c1 | |||
| 2415 | nmdc:mga06r32_14111_c1 | |||
| 2416 | nmdc:mga06r32_764267_c1 | |||
| 2417 | nmdc:mga06r32_88354_c1 | |||
| 2418 | nmdc:mga08y16_15444_c1 | |||
| 2419 | nmdc:mga08y16_56956_c1 | |||
| 2420 | nmdc:mga0n895_1237189_c1 | |||
| 2421 | nmdc:mga0n895_14103_c1 | |||
| 2422 | nmdc:mga0n895_18419_c1 | |||
| 2423 | nmdc:mga0n895_272211_c1 | |||
| 2424 | nmdc:mga0n895_27429_c1 | |||
| 2425 | nmdc:mga0n895_384110_c1 | |||
| 2426 | nmdc:mga0rr50_106723_c1 | |||
| 2427 | nmdc:mga0rr50_247171_c1 | |||
| 2428 | nmdc:mga0rr50_324699_c1 | |||
| 2429 | nmdc:mga0rr50_52572_c1 | |||
| 2430 | nmdc:mga0rr50_55233_c1 | |||
| 2431 | nmdc:mga0rr50_7345_c1 | |||
| 2432 | nmdc:mga08x19_178479_c1 | |||
| 2433 | nmdc:mga08x19_198907_c1 | |||
| 2434 | nmdc:mga08x19_352423_c1 | |||
| 2435 | nmdc:mga0a205_19729_c1 | |||
| 2436 | nmdc:mga0a205_295825_c2 | |||
| 2437 | nmdc:mga0a205_4498_c1 | |||
| 2438 | nmdc:mga0a205_51984_c1 | |||
| 2439 | Ga0495601_0001598 | |||
| 2440 | Ga0495601_0003108 | |||
| 2441 | Ga0495601_0005987 | |||
| 2442 | Ga0495601_0016195 | |||
| 2443 | Ga0495601_0376490 | |||
| 2444 | Ga0495612_0000389 | |||
| 2445 | Ga0495612_0001478 | |||
| 2446 | Ga0495612_0001959 | |||
| 2447 | Ga0495612_0002008 | |||
| 2448 | Ga0495612_0011538 | |||
| 2449 | Ga0495612_0089477 | |||
| 2450 | Ga0495595_0000245 | |||
| 2451 | Ga0495595_0000948 | |||
| 2452 | Ga0495595_0001617 | |||
| 2453 | Ga0495595_0003200 | |||
| 2454 | Ga0495595_0012754 | |||
| 2455 | Ga0495619_0000097 | |||
| 2456 | Ga0495619_0000374 | |||
| 2457 | Ga0495619_0000478 | |||
| 2458 | Ga0495619_0003878 | |||
| 2459 | Ga0495619_0004827 | |||
| 2460 | Ga0495619_0004978 | |||
| 2461 | Ga0495619_0012506 | |||
| 2462 | Ga0495619_0022784 | |||
| 2463 | Ga0500566_0103427 | |||
| 2464 | Ga0501084_0602417 | |||
| 2465 | Ga0501082_0230356 | |||
| 2466 | Ga0501082_0465872 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kvu-assembly1.cif.gz_A | structural basis of the activity and substrate specificity of the fluoroacetyl-coa flk - t42s mutant in complex with acetyl-coa | 0.9957 | 5 | 135 |
| 3kvi-assembly1.cif.gz_B | structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk - t42a mutant in complex with fluoro-acetate | 0.9873 | 5 | 135 |
| 3kx8-assembly1.cif.gz_B | structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk | 0.9873 | 5 | 135 |
| 3p3f-assembly2.cif.gz_D | crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk | 0.985 | 5 | 132 |
| 3p3f-assembly3.cif.gz_E | crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk | 0.9793 | 12 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3p3iA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9769 | 5 | 135 | 3.10.129.10 |
| 3p3iA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9416 | 5 | 135 | 3.10.129.10 |
| af_Q54KW1_1_129_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9398 | 5 | 136 | 3.10.129.10 |
| af_Q54KW1_1_129_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9257 | 5 | 136 | 3.10.129.10 |
| 2q78A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8894 | 1 | 133 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8CHT1-F1-model_v4 | Thioesterase | 0.9953 | 1 | 131 |
|
| AF-A0A164MI44-F1-model_v4 | Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein | 0.9937 | 5 | 140 |
|
| AF-A0A257UHG3-F1-model_v4 | deleted | 0.9926 | 1 | 138 |
|
| AF-A0A2N3PU70-F1-model_v4 | Thioesterase | 0.9925 | 1 | 138 |
|
| AF-A0A1U7JCY2-F1-model_v4 | Fluoroacetyl-CoA-specific thioesterase-like domain-containing protein | 0.9922 | 1 | 144 |
|