F491988

General Info

Members Datasets Scaffolds Average Seq Length
1230 456 1121 372

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000017|Ga0395901_0000017_85192_86409
Length 405
Sequence MARVACVVLTQRAIRVVVSAYSPYWPLLDCKHTMALEPFINSKPFTFGVELEIQVVNTHDYDLTKAASDLMRLVKDQKIPGNITPEITESMIELSTGICNSHEEALSQLRLLRDTLVAAADQLNVGLAGGGTHAFQQWSERQIFDAPRFQYLSELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHAMSRFIPHFIALSASSPYVQGVDTGFHSARLNSVFAFPLSGRAPFVLTWAGFEEYFSKMVATGVVNSMKDFYWDIRPKPGFGTIEVRVMDTPLSVDRAAAIACYIQTLARHLLVDRPFTPKEDDYLVYTFNRFEACRFGLGGTCINPQTGERRTIFEDILDTLRVIEPHAQALQSSAALREIANIAQGQVNDATWLRGIVAKEKSLHEAVRQQCLRWRGV

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
20 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
21 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
22 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
23 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
24 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
25 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
26 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
27 2643221585 Pelomonas sp. Root662 Isolate Unclassified
28 2643221638 Duganella sp. Root336D2 Isolate Unclassified
29 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
30 2643221645 Massilia sp. Root351 Isolate Unclassified
31 2643221656 Pelomonas sp. Root405 Isolate Unclassified
32 2643221664 Massilia sp. Root418 Isolate Unclassified
33 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
34 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
35 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
36 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
37 2738541280 Massilia sp. GV090 Isolate Unclassified
38 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
39 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
40 2738541300 Massilia sp. GV016 Isolate Unclassified
41 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
42 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
43 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
44 2738543018 Massilia sp. GV045 Isolate Unclassified
45 2738543030 Massilia sp. GV097 Isolate Unclassified
46 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
47 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
48 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
49 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
50 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
51 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
52 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
53 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
54 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
55 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
56 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
57 2818991450 Burkholderia sp. 604 Isolate Unclassified
58 2818991452 Burkholderia cepacia 561 Isolate Unclassified
59 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
60 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
61 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
62 2842711865 Duganella sp. R-73148 Isolate Unclassified
63 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
64 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
65 2857553236 Duganella sp. R-74557 Isolate Unclassified
66 2857558681 Duganella sp. R-74565 Isolate Unclassified
67 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
68 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
69 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
70 2885266251 Ralstonia sp. SET104 Isolate Nodule
71 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
72 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
73 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
74 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
75 2904424332 Duganella sp. 1411 Isolate Rhizosphere
76 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
77 2904564687 Burkholderia sp. 571 Isolate Unclassified
78 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
79 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
80 2919476304 Duganella sp. 3397 Isolate Unclassified
81 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
82 2928058823 Ralstonia sp. 1138 Isolate Unclassified
83 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
84 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
85 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
86 2928163908 Burkholderia sp. 567 Isolate Unclassified
87 2928170801 Burkholderia sp. 572 Isolate Unclassified
88 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
89 2928536128 Burkholderia sola 565 Isolate Unclassified
90 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
91 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
92 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
93 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
94 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
95 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
96 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
97 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
98 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
99 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
100 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
101 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
102 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
103 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
104 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
105 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
106 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
107 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
108 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
109 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
110 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
111 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
112 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
113 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
114 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
115 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
116 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
117 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
118 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
119 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
120 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
121 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
122 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
123 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
124 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
125 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
126 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
127 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
128 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
129 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
130 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
131 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
132 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
133 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
134 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
135 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
136 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
137 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
142 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
143 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
144 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
145 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
150 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
151 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
153 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
154 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
155 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
156 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
176 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
177 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
184 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
186 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
196 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
197 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
198 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
201 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
202 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
203 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
207 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
210 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
248 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
249 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
250 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
251 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
266 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
267 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
268 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
271 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
272 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
287 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
310 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
311 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
314 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
315 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
316 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
321 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
322 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
323 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
324 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
325 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
326 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
327 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
328 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
329 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
332 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
341 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
347 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
348 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
349 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
350 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
351 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
352 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
353 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
354 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
355 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
356 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
366 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
367 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
368 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
369 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
370 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
371 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
372 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
373 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
374 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
375 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
379 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
380 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
381 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
382 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
383 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
384 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
385 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
386 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
387 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
388 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
389 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
390 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
391 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
392 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
393 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
394 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
395 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
396 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
397 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
398 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
399 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
400 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
401 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
402 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
403 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
407 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
408 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
409 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
410 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
411 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
417 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
418 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
419 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
420 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
421 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
422 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
423 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
424 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
425 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
426 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
427 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
428 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
429 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
430 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
431 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
432 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
433 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
436 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
437 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
438 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
440 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
441 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
442 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
443 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
444 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
445 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
446 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
447 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
448 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
449 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
450 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
451 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
452 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
453 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
454 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
455 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
456 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 0.65
Isolates 8.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 1.95
Rhizoplane 3.09
Rhizosphere 74.07
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001242 3300001915 Bacteria 7507
2 JGI24740J21852_10001764 3300001979 Bacteria 9924
3 JGI24740J21852_10004026 3300001979 Bacteria 6367
4 JGI24739J22299_10003401 3300001989 Bacteria 6071
5 JGI24739J22299_10004196 3300001989 Bacteria 5514
6 JGI24737J22298_10003060 3300001990 Bacteria 5922
7 JGI24737J22298_10014717 3300001990 Bacteria 2538
8 JGI24735J21928_10000065 3300002067 Bacteria 43385
9 JGI24735J21928_10000495 3300002067 Bacteria 13982
10 JGI24735J21928_10000604 3300002067 Bacteria 12630
11 JGI24735J21928_10002748 3300002067 Bacteria 6067
12 JGI24735J21928_10004710 3300002067 Bacteria 4555
13 JGI24735J21928_10006897 3300002067 Bacteria 3719
14 JGI24738J21930_10000758 3300002075 Bacteria 9245
15 JGI25156J39149_1002277 3300002705 Bacteria 7055
16 JGI25156J39149_1005822 3300002705 Bacteria 3483
17 JGI25154J39366_1000553 3300002738 Bacteria 18498
18 JGI25154J39366_1002494 3300002738 Bacteria 4712
19 JGI25158J39367_1000007 3300002739 Bacteria 54539
20 JGI25158J39367_1010914 3300002739 Bacteria 1220
21 JGI25152J39213_1000242 3300002773 Bacteria 36400
22 JGI25152J39213_1011033 3300002773 Bacteria 2022
23 JGI25150J39212_1000487 3300002774 Bacteria 16704
24 JGI25150J39212_1005864 3300002774 Bacteria 2582
25 JGI25159J45721_1000127 3300002987 Bacteria 36369
26 JGI25159J45721_1000340 3300002987 Bacteria 21597
27 JGI25159J45721_1001229 3300002987 Bacteria 10850
28 JGI25153J46596_10014274 3300003215 Bacteria 3311
29 JGI25153J46596_10032011 3300003215 Bacteria 1761
30 rootL2_10049059 3300003322 Bacteria 4562
31 rootL2_10277707 3300003322 Bacteria 1517
32 rootH1_10023956 3300003323 Bacteria 1491
33 JGI25160J50197_1000016 3300003354 Bacteria 247819
34 JGI25160J50197_1000132 3300003354 Bacteria 67285
35 JGI25161J50226_1000105 3300003374 Bacteria 67332
36 Ga0007417J51691_1034284 3300003544 Bacteria 1824
37 Ga0007410J51695_1042566 3300003574 Bacteria 1900
38 Ga0055539_1000541 3300003752 Bacteria 11274
39 Ga0055532_1000022 3300003758 Bacteria 248737
40 Ga0055532_1000761 3300003758 Bacteria 11499
41 Ga0055532_1000786 3300003758 Bacteria 11029
42 Ga0055525_1001433 3300003759 Bacteria 4363
43 Ga0055527_1000016 3300003760 Bacteria 248736
44 Ga0055527_1000604 3300003760 Bacteria 11562
45 Ga0055527_1000990 3300003760 Bacteria 6904
46 Ga0055535_1000017 3300003761 Bacteria 248735
47 Ga0055535_1001501 3300003761 Bacteria 11618
48 Ga0055535_1001507 3300003761 Bacteria 11562
49 Ga0055535_1001576 3300003761 Bacteria 11029
50 Ga0055542_1000030 3300003762 Bacteria 248717
51 Ga0055542_1001136 3300003762 Bacteria 15773
52 Ga0055542_1001580 3300003762 Bacteria 10591
53 Ga0055542_1002027 3300003762 Bacteria 7756
54 Ga0055542_1007268 3300003762 Bacteria 2267
55 Ga0055529_1000033 3300003763 Bacteria 248734
56 Ga0055529_1000688 3300003763 Bacteria 23075
57 Ga0055529_1001155 3300003763 Bacteria 11029
58 Ga0055526_1000018 3300003771 Bacteria 198838
59 Ga0055526_1000053 3300003771 Bacteria 114820
60 Ga0055526_1000133 3300003771 Bacteria 66252
61 Ga0055526_1000602 3300003771 Bacteria 28135
62 Ga0055526_1001869 3300003771 Bacteria 14583
63 Ga0055526_1015807 3300003771 Bacteria 3003
64 Ga0055537_1000093 3300003773 Bacteria 66252
65 Ga0055537_1000191 3300003773 Bacteria 45803
66 Ga0055537_1004892 3300003773 Bacteria 3710
67 Ga0055524_1000003 3300003775 Bacteria 399748
68 Ga0055524_1000192 3300003775 Bacteria 67279
69 Ga0055524_1000223 3300003775 Bacteria 60211
70 Ga0055524_1006395 3300003775 Bacteria 5111
71 Ga0055524_1006501 3300003775 Bacteria 5062
72 Ga0055534_1000051 3300003784 Bacteria 92183
73 Ga0055534_1000098 3300003784 Bacteria 67094
74 Ga0055534_1006053 3300003784 Bacteria 3115
75 Ga0055528_1000174 3300003790 Bacteria 54435
76 Ga0055528_1009739 3300003790 Bacteria 3988
77 Ga0055530_10000262 3300003791 Bacteria 47466
78 Ga0055531_10009510 3300003794 Bacteria 4962
79 Ga0055541_1001057 3300003841 Bacteria 6363
80 Ga0055541_1012002 3300003841 Bacteria 1253
81 Ga0058692_1000568 3300003856 Bacteria 15736
82 Ga0055543_1000101 3300004625 Bacteria 74568
83 Ga0055543_1000136 3300004625 Bacteria 60943
84 Ga0065165_1000282 3300005262 Bacteria 86839
85 Ga0065165_1000612 3300005262 Bacteria 51854
86 Ga0065165_1000677 3300005262 Bacteria 49085
87 Ga0065165_1000875 3300005262 Bacteria 38986
88 Ga0065165_1001278 3300005262 Bacteria 28419
89 Ga0065715_10101354 3300005293 Bacteria 3213
90 Ga0070658_10002494 3300005327 Bacteria 15370
91 Ga0070658_10033012 3300005327 Bacteria 4162
92 Ga0070658_10035402 3300005327 Bacteria 4021
93 Ga0070658_10264974 3300005327 Bacteria 1460
94 Ga0070682_100061547 3300005337 Bacteria 2376
95 Ga0070660_100000108 3300005339 Bacteria 51014
96 Ga0070660_100002533 3300005339 Bacteria 12521
97 Ga0070660_100068203 3300005339 Bacteria 2772
98 Ga0070661_100000892 3300005344 Bacteria 21428
99 Ga0070661_100049980 3300005344 Bacteria 3061
100 Ga0070659_100000070 3300005366 Bacteria 79815
101 Ga0070659_100002030 3300005366 Bacteria 14474
102 Ga0070659_100033866 3300005366 Bacteria 3971
103 Ga0070667_100009565 3300005367 Bacteria 8036
104 Ga0070663_100000463 3300005455 Bacteria 21428
105 Ga0070663_100000496 3300005455 Bacteria 20757
106 Ga0070663_100003045 3300005455 Bacteria 9576
107 Ga0070678_100105428 3300005456 Bacteria 2194
108 Ga0070672_100092786 3300005543 Bacteria 2438
109 Ga0070665_100178582 3300005548 Bacteria 2124
110 Ga0068855_100002049 3300005563 Bacteria 24988
111 Ga0068855_100029356 3300005563 Bacteria 6576
112 Ga0068855_100109969 3300005563 Bacteria 3164
113 Ga0070664_100002094 3300005564 Bacteria 15946
114 Ga0068857_100014572 3300005577 Bacteria 6858
115 Ga0068854_100000776 3300005578 Bacteria 18959
116 Ga0068856_100003674 3300005614 Bacteria 15391
117 Ga0068852_100016151 3300005616 Bacteria 5812
118 Ga0068859_100457272 3300005617 Bacteria 1373
119 Ga0068860_100001092 3300005843 Bacteria 29866
120 Ga0068860_100084407 3300005843 Bacteria 3021
121 Ga0070717_10013109 3300006028 Bacteria 6336
122 Ga0068865_100015058 3300006881 Bacteria 4927
123 Ga0097620_100457272 3300006931 Bacteria 1373
124 Ga0079104_1008017 3300006946 Bacteria 3751
125 Ga0099826_10000002 3300006948 Bacteria 1125830
126 Ga0105251_10000324 3300009011 Bacteria 47966
127 Ga0105251_10000937 3300009011 Bacteria 26103
128 Ga0105251_10034380 3300009011 Bacteria 2509
129 Ga0105244_10002111 3300009036 Bacteria 15285
130 Ga0105244_10004090 3300009036 Bacteria 10175
131 Ga0105244_10034717 3300009036 Bacteria 2653
132 Ga0105250_10001043 3300009092 Bacteria 15884
133 Ga0105240_10002436 3300009093 Bacteria 29913
134 Ga0105240_10019691 3300009093 Bacteria 9014
135 Ga0105240_10338906 3300009093 Bacteria 1709
136 Ga0105242_10021383 3300009176 Bacteria 5079
137 Ga0105248_10006077 3300009177 Bacteria 13252
138 Ga0105248_10182053 3300009177 Bacteria 2368
139 Ga0105237_10001786 3300009545 Bacteria 27810
140 Ga0105237_10227872 3300009545 Bacteria 1864
141 Ga0105238_10011315 3300009551 Bacteria 8976
142 Ga0105238_10066755 3300009551 Bacteria 3598
143 Ga0105249_10009272 3300009553 Bacteria 8607
144 Ga0105239_10001217 3300010375 Bacteria 35079
145 Ga0105239_10201891 3300010375 Bacteria 2227
146 Ga0157373_10005365 3300013100 Bacteria 9631
147 Ga0157373_10013675 3300013100 Bacteria 5952
148 Ga0157373_10119483 3300013100 Bacteria 1852
149 Ga0157371_10001831 3300013102 Bacteria 21433
150 Ga0157370_10000900 3300013104 Bacteria 37716
151 Ga0157370_10001175 3300013104 Bacteria 32662
152 Ga0157370_10014987 3300013104 Bacteria 7903
153 Ga0157370_10042205 3300013104 Bacteria 4397
154 Ga0157369_10000304 3300013105 Bacteria 65926
155 Ga0157369_10001395 3300013105 Bacteria 29676
156 Ga0157369_10001472 3300013105 Bacteria 28859
157 Ga0157369_10009847 3300013105 Bacteria 10920
158 Ga0157369_10034147 3300013105 Bacteria 5584
159 Ga0157369_10063750 3300013105 Bacteria 3970
160 Ga0157369_10105783 3300013105 Bacteria 2995
161 Ga0157374_10001412 3300013296 Bacteria 20367
162 Ga0157374_10017669 3300013296 Bacteria 6284
163 Ga0157378_10033324 3300013297 Bacteria 4553
164 Ga0163162_10004078 3300013306 Bacteria 14016
165 Ga0163162_10011991 3300013306 Bacteria 8453
166 Ga0163162_10034105 3300013306 Bacteria 5063
167 Ga0157372_10002150 3300013307 Bacteria 21434
168 Ga0157372_10012810 3300013307 Bacteria 8937
169 Ga0182008_10023466 3300014497 Bacteria 3150
170 Ga0182008_10030084 3300014497 Bacteria 2739
171 Ga0157379_10189956 3300014968 Bacteria 1856
172 Ga0157376_10168730 3300014969 Bacteria 1991
173 Ga0182006_1000040 3300015261 Bacteria 209209
174 Ga0182006_1001529 3300015261 Bacteria 13840
175 Ga0182007_10031221 3300015262 Bacteria 1816
176 Ga0183361_10001 3300016635 Bacteria 908583
177 Ga0163161_10012823 3300017792 Bacteria 5823
178 Ga0197907_10873026 3300020069 Bacteria 3292
179 Ga0206356_10848462 3300020070 Bacteria 4741
180 Ga0206351_10868641 3300020077 Bacteria 5218
181 Ga0154015_1236554 3300020610 Bacteria 5931
182 Ga0213872_10000001 3300021361 Bacteria 662532
183 Ga0224712_10000838 3300022467 Bacteria 6537
184 Ga0209435_101584 3300025206 Bacteria 2812
185 Ga0209436_100028 3300025208 Bacteria 86801
186 Ga0209436_100216 3300025208 Bacteria 26447
187 Ga0209784_100006 3300025224 Bacteria 930704
188 Ga0209784_100753 3300025224 Bacteria 8221
189 Ga0209784_101546 3300025224 Bacteria 2917
190 Ga0209566_100002 3300025225 Bacteria 2614868
191 Ga0209566_100244 3300025225 Bacteria 52194
192 Ga0209674_100010 3300025226 Bacteria 1038638
193 Ga0209674_100017 3300025226 Bacteria 689087
194 Ga0209674_100176 3300025226 Bacteria 79399
195 Ga0209674_100291 3300025226 Bacteria 35684
196 Ga0209674_100320 3300025226 Bacteria 30743
197 Ga0209674_102227 3300025226 Bacteria 4300
198 Ga0209672_100001 3300025228 Bacteria 2828210
199 Ga0209672_100110 3300025228 Bacteria 95441
200 Ga0209672_100115 3300025228 Bacteria 89213
201 Ga0209672_100136 3300025228 Bacteria 72753
202 Ga0209672_101102 3300025228 Bacteria 11427
203 Ga0209147_100018 3300025229 Bacteria 515719
204 Ga0209147_100022 3300025229 Bacteria 443906
205 Ga0209147_100164 3300025229 Bacteria 90422
206 Ga0209147_100215 3300025229 Bacteria 60346
207 Ga0209563_100041 3300025230 Bacteria 407467
208 Ga0209563_100603 3300025230 Bacteria 11745
209 Ga0207427_102931 3300025231 Bacteria 4008
210 Ga0209258_100028 3300025242 Bacteria 515719
211 Ga0209258_100033 3300025242 Bacteria 443845
212 Ga0209258_100261 3300025242 Bacteria 90726
213 Ga0209258_100271 3300025242 Bacteria 89095
214 Ga0207425_1000001 3300025245 Bacteria 2525432
215 Ga0207425_1000039 3300025245 Bacteria 219078
216 Ga0209646_1000043 3300025246 Bacteria 343652
217 Ga0209026_1003044 3300025250 Bacteria 5762
218 Ga0209677_100007 3300025253 Bacteria 1021332
219 Ga0209677_103393 3300025253 Bacteria 5209
220 Ga0209148_1000046 3300025254 Bacteria 443881
221 Ga0209148_1000104 3300025254 Bacteria 214254
222 Ga0209148_1000151 3300025254 Bacteria 156553
223 Ga0209148_1000609 3300025254 Bacteria 32035
224 Ga0209148_1001656 3300025254 Bacteria 10082
225 Ga0209759_1000180 3300025256 Bacteria 103458
226 Ga0209759_1000231 3300025256 Bacteria 83320
227 Ga0209759_1000568 3300025256 Bacteria 37118
228 Ga0209759_1001163 3300025256 Bacteria 16645
229 Ga0209759_1001504 3300025256 Bacteria 12856
230 Ga0209759_1001749 3300025256 Bacteria 11148
231 Ga0209759_1002276 3300025256 Bacteria 8678
232 Ga0209759_1026497 3300025256 Bacteria 1214
233 Ga0209129_1000001 3300025258 Bacteria 1452436
234 Ga0209129_1001725 3300025258 Bacteria 11783
235 Ga0209233_1000050 3300025261 Bacteria 450736
236 Ga0209565_1000017 3300025263 Bacteria 462438
237 Ga0209565_1000157 3300025263 Bacteria 90679
238 Ga0209565_1000901 3300025263 Bacteria 16057
239 Ga0209565_1002806 3300025263 Bacteria 6029
240 Ga0209565_1004699 3300025263 Bacteria 4103
241 Ga0209565_1004992 3300025263 Bacteria 3930
242 Ga0209455_1000038 3300025272 Bacteria 443899
243 Ga0209455_1000065 3300025272 Bacteria 321272
244 Ga0209455_1000097 3300025272 Bacteria 214136
245 Ga0209455_1001610 3300025272 Bacteria 9902
246 Ga0209673_1000007 3300025273 Bacteria 634477
247 Ga0209673_1000124 3300025273 Bacteria 169015
248 Ga0209673_1028792 3300025273 Bacteria 1781
249 Ga0209673_1030592 3300025273 Bacteria 1693
250 Ga0209130_1000078 3300025284 Bacteria 169374
251 Ga0209130_1000189 3300025284 Bacteria 86853
252 Ga0209130_1001043 3300025284 Bacteria 21026
253 Ga0209130_1003615 3300025284 Bacteria 6428
254 Ga0209675_1000009 3300025291 Bacteria 562872
255 Ga0209675_1000158 3300025291 Bacteria 87345
256 Ga0209675_1001665 3300025291 Bacteria 12372
257 Ga0209675_1002349 3300025291 Bacteria 9767
258 Ga0209564_1000036 3300025295 Bacteria 423455
259 Ga0209564_1000055 3300025295 Bacteria 343782
260 Ga0209564_1000068 3300025295 Bacteria 311171
261 Ga0209564_1000109 3300025295 Bacteria 212912
262 Ga0209564_1000342 3300025295 Bacteria 89220
263 Ga0209564_1004204 3300025295 Bacteria 8975
264 Ga0209564_1006074 3300025295 Bacteria 6651
265 Ga0209564_1008762 3300025295 Bacteria 4933
266 Ga0209758_1000020 3300025297 Bacteria 734220
267 Ga0209050_1000074 3300025298 Bacteria 289334
268 Ga0209050_1006726 3300025298 Bacteria 6716
269 Ga0209050_1007129 3300025298 Bacteria 6381
270 Ga0209256_1000007 3300025299 Bacteria 1136599
271 Ga0209256_1000028 3300025299 Bacteria 420213
272 Ga0209256_1000167 3300025299 Bacteria 133419
273 Ga0209256_1000214 3300025299 Bacteria 107799
274 Ga0209256_1002827 3300025299 Bacteria 13252
275 Ga0209256_1008481 3300025299 Bacteria 4755
276 Ga0207426_1000007 3300025302 Bacteria 971011
277 Ga0207426_1000343 3300025302 Bacteria 86853
278 Ga0207426_1002201 3300025302 Bacteria 13112
279 Ga0207426_1002710 3300025302 Bacteria 10785
280 Ga0207426_1012629 3300025302 Bacteria 3166
281 Ga0209257_1000003 3300025304 Bacteria 1702593
282 Ga0207696_1002613 3300025711 Bacteria 8731
283 Ga0207655_1005932 3300025728 Bacteria 8182
284 Ga0207713_1000064 3300025735 Bacteria 200324
285 Ga0207713_1010707 3300025735 Bacteria 5051
286 Ga0207688_10130275 3300025901 Bacteria 1474
287 Ga0207647_10000160 3300025904 Bacteria 53192
288 Ga0207647_10001680 3300025904 Bacteria 17038
289 Ga0207647_10002319 3300025904 Bacteria 14476
290 Ga0207647_10011447 3300025904 Bacteria 6221
291 Ga0207647_10011897 3300025904 Bacteria 6080
292 Ga0207705_10000377 3300025909 Bacteria 40143
293 Ga0207705_10028057 3300025909 Bacteria 4013
294 Ga0207705_10133170 3300025909 Bacteria 1851
295 Ga0207695_10000872 3300025913 Bacteria 54945
296 Ga0207695_10008234 3300025913 Bacteria 13088
297 Ga0207695_10009754 3300025913 Bacteria 11815
298 Ga0207695_10011993 3300025913 Bacteria 10428
299 Ga0207695_10047753 3300025913 Bacteria 4526
300 Ga0207657_10000183 3300025919 Bacteria 64955
301 Ga0207657_10024202 3300025919 Bacteria 5634
302 Ga0207649_10002344 3300025920 Bacteria 10614
303 Ga0207649_10129405 3300025920 Bacteria 1713
304 Ga0207694_10019921 3300025924 Bacteria 5075
305 Ga0207694_10027835 3300025924 Bacteria 4307
306 Ga0207690_10000012 3300025932 Bacteria 269610
307 Ga0207690_10007640 3300025932 Bacteria 6413
308 Ga0207690_10018067 3300025932 Bacteria 4319
309 Ga0207669_10008954 3300025937 Bacteria 4733
310 Ga0207704_10005345 3300025938 Bacteria 5917
311 Ga0207691_10106253 3300025940 Bacteria 2500
312 Ga0207711_10063159 3300025941 Bacteria 3196
313 Ga0207679_10000012 3300025945 Bacteria 339773
314 Ga0207679_10153330 3300025945 Bacteria 1878
315 Ga0207667_10000889 3300025949 Bacteria 38091
316 Ga0207667_10003325 3300025949 Bacteria 19847
317 Ga0207712_10038851 3300025961 Bacteria 3257
318 Ga0207640_10000047 3300025981 Bacteria 98563
319 Ga0207658_10039833 3300025986 Bacteria 3392
320 Ga0207658_10173798 3300025986 Bacteria 1777
321 Ga0207703_10032912 3300026035 Bacteria 4106
322 Ga0207678_10000076 3300026067 Bacteria 78938
323 Ga0207678_10001558 3300026067 Bacteria 21044
324 Ga0207678_10004352 3300026067 Bacteria 12716
325 Ga0207678_10008226 3300026067 Bacteria 9191
326 Ga0207678_10032652 3300026067 Bacteria 4537
327 Ga0207702_10001737 3300026078 Bacteria 21442
328 Ga0207702_10052435 3300026078 Bacteria 3451
329 Ga0207648_10001123 3300026089 Bacteria 30040
330 Ga0207674_10020244 3300026116 Bacteria 7194
331 Ga0207674_10073877 3300026116 Bacteria 3422
332 Ga0207675_100166478 3300026118 Bacteria 2105
333 Ga0207683_10147890 3300026121 Bacteria 2120
334 Ga0207698_10031168 3300026142 Bacteria 3845
335 Ga0209281_1002903 3300027111 Bacteria 6199
336 Ga0209371_1000185 3300027312 Bacteria 90613
337 Ga0209371_1008576 3300027312 Bacteria 3369
338 Ga0209282_1000001 3300027666 Bacteria 2450367
339 Ga0268264_10007100 3300028381 Bacteria 9387
340 Ga0265338_10000187 3300028800 Bacteria 116160
341 Ga0265338_10000590 3300028800 Bacteria 64098
342 Ga0268256_1000211 3300030500 Bacteria 65693
343 Ga0268256_1005547 3300030500 Bacteria 4921
344 Ga0316177_1084301 3300030731 Bacteria 2571
345 Ga0316180_1145736 3300030736 Bacteria 2217
346 Ga0316181_1071815 3300030744 Bacteria 3973
347 Ga0316182_1005578 3300030745 Bacteria 2782
348 Ga0307408_100000126 3300031548 Bacteria 84345
349 Ga0307408_100000463 3300031548 Bacteria 35519
350 Ga0307408_100001241 3300031548 Bacteria 19160
351 Ga0307408_100149765 3300031548 Bacteria 1841
352 Ga0307412_10000011 3300031911 Bacteria 405842
353 Ga0307416_100025826 3300032002 Bacteria 4315
354 Ga0307416_100057331 3300032002 Bacteria 3150
355 Ga0307414_10048541 3300032004 Bacteria 2929
356 Ga0307411_10006659 3300032005 Bacteria 5802
357 Ga0307411_10109399 3300032005 Bacteria 1974
358 Ga0373925_0001962 3300037068 Bacteria 17023
359 Ga0395899_0000093 3300037312 Bacteria 153541
360 Ga0395899_0000149 3300037312 Bacteria 105958
361 Ga0395899_0000802 3300037312 Bacteria 30773
362 Ga0395899_0057731 3300037312 Bacteria 2864
363 Ga0395899_0127966 3300037312 Bacteria 1815
364 Ga0395900_0000169 3300037418 Bacteria 105954
365 Ga0395900_0001006 3300037418 Bacteria 36517
366 Ga0395900_0013095 3300037418 Bacteria 8473
367 Ga0395900_0030583 3300037418 Bacteria 5529
368 Ga0395900_0036169 3300037418 Bacteria 5089
369 Ga0395900_0048251 3300037418 Bacteria 4386
370 Ga0395900_0063130 3300037418 Bacteria 3807
371 Ga0395900_0064826 3300037418 Bacteria 3753
372 Ga0395900_0364682 3300037418 Bacteria 1415
373 Ga0395898_0000338 3300037466 Bacteria 105954
374 Ga0395898_0006942 3300037466 Bacteria 12035
375 Ga0395898_0053289 3300037466 Bacteria 3951
376 Ga0395898_0067730 3300037466 Bacteria 3455
377 Ga0395898_0082800 3300037466 Bacteria 3093
378 Ga0395898_0094911 3300037466 Bacteria 2866
379 Ga0395905_0000079 3300037471 Bacteria 160663
380 Ga0395905_0000249 3300037471 Bacteria 80584
381 Ga0395905_0021786 3300037471 Bacteria 6061
382 Ga0395905_0260691 3300037471 Bacteria 1618
383 Ga0395901_0000017 3300038443 Bacteria 345003
384 Ga0395901_0000084 3300038443 Bacteria 127737
385 Ga0395901_0001099 3300038443 Bacteria 28762
386 Ga0395901_0009132 3300038443 Bacteria 10040
387 Ga0395901_0165706 3300038443 Bacteria 2320
388 Ga0436365_0245511 3300039437 Bacteria 2513
389 Ga0436361_0093744 3300039447 Bacteria 8061
390 Ga0436361_1185928 3300039447 Bacteria 172199
391 Ga0439448_0000325 3300042005 Bacteria 10568
392 Ga0450897_001105 3300042128 Bacteria 1747
393 Ga0450899_010921 3300042135 Bacteria 1009
394 Ga0450904_000600 3300042139 Bacteria 6694
395 Ga0451577_0009948 3300042876 Bacteria 9117
396 Ga0451577_0033475 3300042876 Bacteria 4633
397 Ga0451577_0069542 3300042876 Bacteria 3139
398 Ga0466969_0014035 3300044656 Bacteria 4215
399 Ga0466969_0084910 3300044656 Bacteria 1505
400 Ga0466972_0018823 3300044658 Bacteria 3451
401 Ga0453683_0016909 3300044673 Bacteria 4702
402 Ga0466966_0000277 3300044684 Bacteria 33571
403 Ga0466966_0002148 3300044684 Bacteria 12784
404 Ga0466966_0002376 3300044684 Bacteria 12288
405 Ga0466966_0008254 3300044684 Bacteria 6907
406 Ga0466966_0010101 3300044684 Bacteria 6261
407 Ga0466966_0017218 3300044684 Bacteria 4778
408 Ga0466966_0020096 3300044684 Bacteria 4394
409 Ga0466966_0043405 3300044684 Bacteria 2882
410 Ga0466966_0127820 3300044684 Bacteria 1557
411 Ga0466961_0000344 3300044693 Bacteria 30339
412 Ga0466961_0004968 3300044693 Bacteria 8367
413 Ga0466961_0007588 3300044693 Bacteria 6907
414 Ga0466963_0000554 3300044694 Bacteria 17590
415 Ga0466964_0002478 3300044706 Bacteria 6561
416 Ga0453684_0000193 3300044712 Bacteria 266146
417 Ga0453684_0002276 3300044712 Bacteria 47408
418 Ga0453684_0021760 3300044712 Bacteria 9557
419 Ga0453684_0023287 3300044712 Bacteria 9133
420 Ga0466971_0000270 3300044719 Bacteria 19965
421 Ga0466971_0006464 3300044719 Bacteria 5091
422 Ga0466968_0005379 3300044735 Bacteria 4791
423 Ga0466968_0010283 3300044735 Bacteria 3625
424 Ga0466970_0004253 3300044765 Bacteria 7047
425 Ga0466957_0001982 3300044842 Bacteria 10901
426 Ga0466957_0056022 3300044842 Bacteria 2410
427 Ga0466960_0029263 3300044901 Bacteria 2527
428 Ga0466960_0091677 3300044901 Bacteria 1550
429 Ga0466959_0007383 3300045049 Bacteria 7711
430 Ga0451576_0003152 3300045051 Bacteria 23079
431 Ga0451576_0004673 3300045051 Bacteria 17635
432 Ga0451576_0009113 3300045051 Bacteria 11543
433 Ga0451576_0035379 3300045051 Bacteria 5299
434 Ga0451576_0231898 3300045051 Bacteria 1928
435 Ga0466958_0007390 3300045836 Bacteria 6040
436 Ga0466958_0009629 3300045836 Bacteria 5388
437 Ga0495617_000002 3300046452 Bacteria 710121
438 Ga0495617_000003 3300046452 Bacteria 541914
439 Ga0495617_000210 3300046452 Bacteria 36010
440 Ga0495617_001586 3300046452 Bacteria 9824
441 Ga0495627_000001 3300046453 Bacteria 1104709
442 Ga0495627_000176 3300046453 Bacteria 72651
443 Ga0495627_003352 3300046453 Bacteria 7120
444 Ga0495627_015484 3300046453 Bacteria 2632
445 Ga0495592_0005288 3300046454 Bacteria 9514
446 Ga0495592_0014560 3300046454 Bacteria 5968
447 Ga0495603_0000867 3300046455 Bacteria 17335
448 Ga0495603_0027090 3300046455 Bacteria 3460
449 Ga0495603_0043618 3300046455 Bacteria 2677
450 Ga0495590_0000001 3300046457 Bacteria 762984
451 Ga0495590_0000044 3300046457 Bacteria 119833
452 Ga0495590_0004382 3300046457 Bacteria 5701
453 Ga0495590_0006826 3300046457 Bacteria 4436
454 Ga0495590_0009964 3300046457 Bacteria 3592
455 Ga0495591_000052 3300046458 Bacteria 136101
456 Ga0495591_001869 3300046458 Bacteria 12398
457 Ga0495591_009331 3300046458 Bacteria 3909
458 Ga0495629_0000178 3300046459 Bacteria 56903
459 Ga0495629_0000285 3300046459 Bacteria 43774
460 Ga0495629_0001888 3300046459 Bacteria 16327
461 Ga0495629_0002120 3300046459 Bacteria 15369
462 Ga0495629_0003648 3300046459 Bacteria 11640
463 Ga0495629_0021875 3300046459 Bacteria 4563
464 Ga0495629_0032812 3300046459 Bacteria 3675
465 Ga0495638_0000017 3300046460 Bacteria 391117
466 Ga0495638_0000945 3300046460 Bacteria 29442
467 Ga0495638_0006104 3300046460 Bacteria 8820
468 Ga0495638_0007524 3300046460 Bacteria 7797
469 Ga0495638_0016040 3300046460 Bacteria 5021
470 Ga0495638_0127793 3300046460 Bacteria 1496
471 Ga0495641_0005571 3300046461 Bacteria 8448
472 Ga0495651_0011625 3300046462 Bacteria 6766
473 Ga0495651_0015143 3300046462 Bacteria 5959
474 Ga0495651_0125527 3300046462 Bacteria 1880
475 Ga0495653_0002764 3300046463 Bacteria 14004
476 Ga0495653_0003463 3300046463 Bacteria 12692
477 Ga0495653_0038731 3300046463 Bacteria 3740
478 Ga0495653_0049525 3300046463 Bacteria 3235
479 Ga0495653_0080085 3300046463 Bacteria 2417
480 Ga0495653_0166329 3300046463 Bacteria 1526
481 Ga0495650_0000456 3300046471 Bacteria 64008
482 Ga0495650_0000806 3300046471 Bacteria 38200
483 Ga0495650_0004206 3300046471 Bacteria 9970
484 Ga0495650_0011361 3300046471 Bacteria 4886
485 Ga0495650_0015319 3300046471 Bacteria 3938
486 Ga0495650_0021095 3300046471 Bacteria 3157
487 Ga0495580_0000001 3300046472 Bacteria 180598
488 Ga0495580_0010297 3300046472 Bacteria 7292
489 Ga0495580_0011524 3300046472 Bacteria 6840
490 Ga0495580_0131327 3300046472 Bacteria 1737
491 Ga0495582_0001582 3300046473 Bacteria 12836
492 Ga0495582_0004982 3300046473 Bacteria 7440
493 Ga0495582_0005649 3300046473 Bacteria 6962
494 Ga0495582_0013662 3300046473 Bacteria 4469
495 Ga0495582_0030386 3300046473 Bacteria 2966
496 Ga0495605_0000028 3300046474 Bacteria 218471
497 Ga0495605_0000081 3300046474 Bacteria 125302
498 Ga0495605_0000087 3300046474 Bacteria 120256
499 Ga0495605_0002871 3300046474 Bacteria 10477
500 Ga0495605_0003749 3300046474 Bacteria 9020
501 Ga0495605_0009089 3300046474 Bacteria 5591
502 Ga0495605_0009309 3300046474 Bacteria 5521
503 Ga0495605_0011963 3300046474 Bacteria 4824
504 Ga0495605_0012019 3300046474 Bacteria 4814
505 Ga0495605_0014479 3300046474 Bacteria 4319
506 Ga0495605_0042078 3300046474 Bacteria 2272
507 Ga0495605_0082788 3300046474 Bacteria 1499
508 Ga0495664_0001897 3300046477 Bacteria 11117
509 Ga0495664_0018631 3300046477 Bacteria 3981
510 Ga0495664_0268186 3300046477 Bacteria 1032
511 Ga0495584_0000011 3300046491 Bacteria 208322
512 Ga0495584_0000057 3300046491 Bacteria 81182
513 Ga0495584_0000460 3300046491 Bacteria 28068
514 Ga0495584_0002846 3300046491 Bacteria 9661
515 Ga0495584_0003929 3300046491 Bacteria 8032
516 Ga0495584_0005971 3300046491 Bacteria 6414
517 Ga0495584_0006863 3300046491 Bacteria 5951
518 Ga0495584_0014505 3300046491 Bacteria 4014
519 Ga0495584_0022193 3300046491 Bacteria 3222
520 Ga0495584_0022301 3300046491 Bacteria 3214
521 Ga0495584_0023259 3300046491 Bacteria 3142
522 Ga0495584_0036884 3300046491 Bacteria 2469
523 Ga0495584_0050473 3300046491 Bacteria 2095
524 Ga0495585_0000004 3300046492 Bacteria 348260
525 Ga0495585_0000814 3300046492 Bacteria 27169
526 Ga0495585_0000863 3300046492 Bacteria 25902
527 Ga0495585_0006024 3300046492 Bacteria 7588
528 Ga0495585_0008368 3300046492 Bacteria 6273
529 Ga0495585_0008688 3300046492 Bacteria 6140
530 Ga0495585_0014155 3300046492 Bacteria 4654
531 Ga0495585_0016163 3300046492 Bacteria 4325
532 Ga0495585_0037637 3300046492 Bacteria 2724
533 Ga0495585_0089551 3300046492 Bacteria 1658
534 Ga0495594_0002589 3300046499 Bacteria 9403
535 Ga0495594_0003551 3300046499 Bacteria 8029
536 Ga0495594_0010723 3300046499 Bacteria 4755
537 Ga0495594_0018124 3300046499 Bacteria 3728
538 Ga0495594_0183424 3300046499 Bacteria 1191
539 Ga0495596_0000633 3300046500 Bacteria 22131
540 Ga0495596_0001840 3300046500 Bacteria 11774
541 Ga0495596_0004150 3300046500 Bacteria 7119
542 Ga0495596_0006018 3300046500 Bacteria 5660
543 Ga0495596_0006065 3300046500 Bacteria 5631
544 Ga0495596_0008424 3300046500 Bacteria 4590
545 Ga0495596_0009225 3300046500 Bacteria 4350
546 Ga0495596_0011133 3300046500 Bacteria 3889
547 Ga0495596_0030815 3300046500 Bacteria 2145
548 Ga0495596_0030977 3300046500 Bacteria 2139
549 Ga0495607_0002567 3300046501 Bacteria 14672
550 Ga0495607_0003451 3300046501 Bacteria 12100
551 Ga0495607_0005170 3300046501 Bacteria 9415
552 Ga0495607_0007144 3300046501 Bacteria 7760
553 Ga0495607_0010718 3300046501 Bacteria 6141
554 Ga0495607_0015241 3300046501 Bacteria 4985
555 Ga0495607_0031243 3300046501 Bacteria 3261
556 Ga0495607_0032512 3300046501 Bacteria 3183
557 Ga0495607_0034340 3300046501 Bacteria 3077
558 Ga0495607_0043436 3300046501 Bacteria 2657
559 Ga0495607_0058904 3300046501 Bacteria 2193
560 Ga0495583_0000050 3300046506 Bacteria 213627
561 Ga0495583_0000067 3300046506 Bacteria 189381
562 Ga0495583_0000241 3300046506 Bacteria 90735
563 Ga0495583_0000430 3300046506 Bacteria 63194
564 Ga0495583_0001408 3300046506 Bacteria 24506
565 Ga0495583_0001716 3300046506 Bacteria 21053
566 Ga0495583_0003837 3300046506 Bacteria 11137
567 Ga0495583_0010073 3300046506 Bacteria 5562
568 Ga0495583_0010118 3300046506 Bacteria 5543
569 Ga0495583_0015715 3300046506 Bacteria 4102
570 Ga0495583_0022997 3300046506 Bacteria 3164
571 Ga0495583_0028050 3300046506 Bacteria 2772
572 Ga0495583_0049103 3300046506 Bacteria 1934
573 Ga0495583_0062359 3300046506 Bacteria 1660
574 Ga0495583_0073904 3300046506 Bacteria 1493
575 Ga0495583_0076467 3300046506 Bacteria 1462
576 Ga0495606_0000563 3300046507 Bacteria 58807
577 Ga0495606_0000820 3300046507 Bacteria 47128
578 Ga0495606_0003201 3300046507 Bacteria 17648
579 Ga0495606_0003747 3300046507 Bacteria 15823
580 Ga0495606_0006662 3300046507 Bacteria 10595
581 Ga0495606_0011903 3300046507 Bacteria 7037
582 Ga0495606_0012318 3300046507 Bacteria 6875
583 Ga0495606_0027799 3300046507 Bacteria 4003
584 Ga0495606_0028347 3300046507 Bacteria 3952
585 Ga0495606_0048740 3300046507 Bacteria 2783
586 Ga0495606_0049990 3300046507 Bacteria 2738
587 Ga0495606_0062801 3300046507 Bacteria 2369
588 Ga0495606_0235338 3300046507 Bacteria 1024
589 Ga0495608_0009419 3300046511 Bacteria 6826
590 Ga0495608_0017053 3300046511 Bacteria 5026
591 Ga0495610_0000506 3300046512 Bacteria 39776
592 Ga0495610_0005396 3300046512 Bacteria 9106
593 Ga0495610_0006646 3300046512 Bacteria 7889
594 Ga0495610_0024568 3300046512 Bacteria 3249
595 Ga0495610_0043323 3300046512 Bacteria 2243
596 Ga0495610_0090828 3300046512 Bacteria 1384
597 Ga0495616_0000218 3300046513 Bacteria 47146
598 Ga0495616_0001339 3300046513 Bacteria 17196
599 Ga0495616_0002294 3300046513 Bacteria 12797
600 Ga0495616_0004089 3300046513 Bacteria 9257
601 Ga0495616_0006247 3300046513 Bacteria 7238
602 Ga0495616_0006363 3300046513 Bacteria 7158
603 Ga0495616_0013987 3300046513 Bacteria 4508
604 Ga0495616_0017342 3300046513 Bacteria 3972
605 Ga0495618_0007168 3300046514 Bacteria 6749
606 Ga0495618_0013665 3300046514 Bacteria 4940
607 Ga0495618_0017662 3300046514 Bacteria 4377
608 Ga0495620_0022583 3300046515 Bacteria 3027
609 Ga0495628_0001900 3300046516 Bacteria 18959
610 Ga0495628_0032607 3300046516 Bacteria 4204
611 Ga0495628_0117777 3300046516 Bacteria 2039
612 Ga0495628_0161007 3300046516 Bacteria 1705
613 Ga0495630_0007017 3300046517 Bacteria 8028
614 Ga0495630_0014192 3300046517 Bacteria 5799
615 Ga0495630_0051251 3300046517 Bacteria 3089
616 Ga0495630_0182640 3300046517 Bacteria 1600
617 Ga0495631_0000556 3300046518 Bacteria 25004
618 Ga0495631_0002191 3300046518 Bacteria 11249
619 Ga0495631_0005244 3300046518 Bacteria 6816
620 Ga0495631_0006335 3300046518 Bacteria 6122
621 Ga0495631_0008026 3300046518 Bacteria 5334
622 Ga0495631_0012942 3300046518 Bacteria 4062
623 Ga0495631_0021299 3300046518 Bacteria 3019
624 Ga0495631_0030852 3300046518 Bacteria 2429
625 Ga0495631_0037413 3300046518 Bacteria 2162
626 Ga0495631_0037447 3300046518 Bacteria 2161
627 Ga0495631_0063583 3300046518 Bacteria 1598
628 Ga0495632_0000040 3300046519 Bacteria 149644
629 Ga0495632_0000114 3300046519 Bacteria 82098
630 Ga0495632_0002437 3300046519 Bacteria 14155
631 Ga0495632_0007437 3300046519 Bacteria 6879
632 Ga0495632_0008625 3300046519 Bacteria 6225
633 Ga0495632_0011980 3300046519 Bacteria 5027
634 Ga0495632_0012370 3300046519 Bacteria 4925
635 Ga0495632_0089230 3300046519 Bacteria 1463
636 Ga0495637_0000006 3300046520 Bacteria 435763
637 Ga0495637_0002126 3300046520 Bacteria 11122
638 Ga0495637_0009761 3300046520 Bacteria 4672
639 Ga0495637_0013100 3300046520 Bacteria 3945
640 Ga0495643_0000028 3300046522 Bacteria 262886
641 Ga0495643_0000192 3300046522 Bacteria 96511
642 Ga0495643_0000285 3300046522 Bacteria 72233
643 Ga0495643_0002723 3300046522 Bacteria 13603
644 Ga0495643_0004024 3300046522 Bacteria 10485
645 Ga0495643_0009197 3300046522 Bacteria 6165
646 Ga0495643_0017628 3300046522 Bacteria 4169
647 Ga0495643_0037000 3300046522 Bacteria 2679
648 Ga0495643_0155334 3300046522 Bacteria 1129
649 Ga0495644_0001463 3300046523 Bacteria 9635
650 Ga0495644_0007508 3300046523 Bacteria 4202
651 Ga0495644_0010273 3300046523 Bacteria 3606
652 Ga0495644_0018694 3300046523 Bacteria 2644
653 Ga0495644_0037979 3300046523 Bacteria 1817
654 Ga0495648_0000001 3300046524 Bacteria 696872
655 Ga0495648_0000802 3300046524 Bacteria 33272
656 Ga0495648_0001359 3300046524 Bacteria 24164
657 Ga0495648_0003099 3300046524 Bacteria 14837
658 Ga0495648_0007560 3300046524 Bacteria 8685
659 Ga0495648_0011159 3300046524 Bacteria 6789
660 Ga0495648_0014398 3300046524 Bacteria 5792
661 Ga0495648_0020179 3300046524 Bacteria 4659
662 Ga0495648_0045197 3300046524 Bacteria 2741
663 Ga0495648_0047136 3300046524 Bacteria 2666
664 Ga0495648_0067678 3300046524 Bacteria 2087
665 Ga0495648_0092890 3300046524 Bacteria 1684
666 Ga0495663_0003544 3300046525 Bacteria 4492
667 Ga0495666_0001627 3300046526 Bacteria 11057
668 Ga0495666_0002374 3300046526 Bacteria 9387
669 Ga0495666_0006592 3300046526 Bacteria 5838
670 Ga0495666_0008866 3300046526 Bacteria 5038
671 Ga0495666_0015604 3300046526 Bacteria 3781
672 Ga0495642_0000813 3300046528 Bacteria 15134
673 Ga0495642_0001190 3300046528 Bacteria 11964
674 Ga0495642_0002336 3300046528 Bacteria 7736
675 Ga0495642_0002344 3300046528 Bacteria 7718
676 Ga0495642_0002537 3300046528 Bacteria 7384
677 Ga0495642_0004410 3300046528 Bacteria 5462
678 Ga0495642_0005459 3300046528 Bacteria 4883
679 Ga0495642_0006314 3300046528 Bacteria 4546
680 Ga0495642_0006627 3300046528 Bacteria 4445
681 Ga0495642_0006928 3300046528 Bacteria 4347
682 Ga0495642_0046984 3300046528 Bacteria 1766
683 Ga0495652_0013316 3300046529 Bacteria 7402
684 Ga0495652_0054241 3300046529 Bacteria 3413
685 Ga0495654_0005270 3300046530 Bacteria 7542
686 Ga0495654_0013309 3300046530 Bacteria 4406
687 Ga0495654_0017765 3300046530 Bacteria 3733
688 Ga0495665_0006958 3300046531 Bacteria 6100
689 Ga0495665_0007081 3300046531 Bacteria 6052
690 Ga0495665_0009119 3300046531 Bacteria 5376
691 Ga0495665_0051567 3300046531 Bacteria 2179
692 Ga0495665_0073064 3300046531 Bacteria 1806
693 Ga0495640_0004099 3300046533 Bacteria 11657
694 Ga0495640_0005465 3300046533 Bacteria 10109
695 Ga0495640_0008491 3300046533 Bacteria 8052
696 Ga0495640_0032792 3300046533 Bacteria 3696
697 Ga0495586_0019439 3300046535 Bacteria 3616
698 Ga0495586_0039934 3300046535 Bacteria 2523
699 Ga0495587_0018997 3300046536 Bacteria 4259
700 Ga0495609_0000096 3300046538 Bacteria 104135
701 Ga0495609_0000110 3300046538 Bacteria 96998
702 Ga0495609_0000497 3300046538 Bacteria 31519
703 Ga0495609_0001124 3300046538 Bacteria 18539
704 Ga0495609_0001475 3300046538 Bacteria 15604
705 Ga0495609_0005063 3300046538 Bacteria 7030
706 Ga0495609_0007366 3300046538 Bacteria 5501
707 Ga0495609_0008283 3300046538 Bacteria 5098
708 Ga0495609_0028135 3300046538 Bacteria 2566
709 Ga0495609_0079776 3300046538 Bacteria 1431
710 Ga0495597_0000459 3300046542 Bacteria 34870
711 Ga0495597_0000579 3300046542 Bacteria 30352
712 Ga0495597_0000587 3300046542 Bacteria 30136
713 Ga0495597_0002689 3300046542 Bacteria 10982
714 Ga0495597_0007925 3300046542 Bacteria 5354
715 Ga0495597_0011861 3300046542 Bacteria 4218
716 Ga0495645_0003031 3300046543 Bacteria 11365
717 Ga0495645_0095089 3300046543 Bacteria 2124
718 Ga0495622_0000075 3300046557 Bacteria 87816
719 Ga0495622_0000131 3300046557 Bacteria 64280
720 Ga0495622_0016534 3300046557 Bacteria 3437
721 Ga0495622_0016605 3300046557 Bacteria 3428
722 Ga0495622_0019672 3300046557 Bacteria 3143
723 Ga0495622_0020634 3300046557 Bacteria 3068
724 Ga0495622_0045703 3300046557 Bacteria 2034
725 Ga0495633_0000106 3300046558 Bacteria 113381
726 Ga0495633_0001152 3300046558 Bacteria 21220
727 Ga0495633_0001289 3300046558 Bacteria 19834
728 Ga0495633_0001422 3300046558 Bacteria 18622
729 Ga0495633_0002045 3300046558 Bacteria 14548
730 Ga0495633_0002751 3300046558 Bacteria 12161
731 Ga0495633_0006201 3300046558 Bacteria 7142
732 Ga0495667_0027758 3300046559 Bacteria 3812
733 Ga0495667_0119081 3300046559 Bacteria 1705
734 Ga0495656_0003042 3300046615 Bacteria 5640
735 Ga0495656_0027660 3300046615 Bacteria 2267
736 Ga0495656_0057445 3300046615 Bacteria 1685
737 Ga0495668_0000018 3300046616 Bacteria 417480
738 Ga0495668_0000686 3300046616 Bacteria 40735
739 Ga0495668_0001608 3300046616 Bacteria 21175
740 Ga0495668_0002567 3300046616 Bacteria 14753
741 Ga0495668_0008369 3300046616 Bacteria 6470
742 Ga0495668_0009745 3300046616 Bacteria 5869
743 Ga0495668_0030115 3300046616 Bacteria 3065
744 Ga0495668_0030610 3300046616 Bacteria 3037
745 Ga0495668_0032574 3300046616 Bacteria 2931
746 Ga0495668_0055641 3300046616 Bacteria 2184
747 Ga0495668_0062633 3300046616 Bacteria 2049
748 Ga0495668_0144427 3300046616 Bacteria 1302
749 Ga0495634_0001455 3300046642 Bacteria 21032
750 Ga0495634_0013434 3300046642 Bacteria 5915
751 Ga0495634_0036626 3300046642 Bacteria 3355
752 Ga0495611_0000376 3300046648 Bacteria 28720
753 Ga0495611_0000476 3300046648 Bacteria 23975
754 Ga0495611_0001009 3300046648 Bacteria 14914
755 Ga0495611_0003480 3300046648 Bacteria 6934
756 Ga0495611_0004540 3300046648 Bacteria 5987
757 Ga0495611_0005280 3300046648 Bacteria 5534
758 Ga0495611_0009665 3300046648 Bacteria 4075
759 Ga0495611_0015041 3300046648 Bacteria 3307
760 Ga0495611_0015073 3300046648 Bacteria 3304
761 Ga0495611_0022450 3300046648 Bacteria 2730
762 Ga0495611_0040260 3300046648 Bacteria 2083
763 Ga0495625_0000035 3300046660 Bacteria 224323
764 Ga0495625_0002479 3300046660 Bacteria 19887
765 Ga0495625_0005030 3300046660 Bacteria 12268
766 Ga0495625_0022401 3300046660 Bacteria 4844
767 Ga0495625_0034649 3300046660 Bacteria 3725
768 Ga0495625_0040226 3300046660 Bacteria 3411
769 Ga0495625_0043584 3300046660 Bacteria 3253
770 Ga0495625_0059374 3300046660 Bacteria 2714
771 Ga0495625_0117308 3300046660 Bacteria 1814
772 Ga0495625_0166865 3300046660 Bacteria 1471
773 Ga0495635_0001789 3300046663 Bacteria 14524
774 Ga0495635_0013372 3300046663 Bacteria 5744
775 Ga0495635_0022968 3300046663 Bacteria 4347
776 Ga0495659_0000052 3300046664 Bacteria 52258
777 Ga0495659_0000529 3300046664 Bacteria 14098
778 Ga0495661_0000164 3300046665 Bacteria 78742
779 Ga0495661_0003522 3300046665 Bacteria 11537
780 Ga0495661_0006009 3300046665 Bacteria 8566
781 Ga0495661_0014949 3300046665 Bacteria 5188
782 Ga0495661_0015784 3300046665 Bacteria 5029
783 Ga0495661_0025238 3300046665 Bacteria 3840
784 Ga0495661_0037776 3300046665 Bacteria 3012
785 Ga0495661_0041408 3300046665 Bacteria 2850
786 Ga0495661_0058289 3300046665 Bacteria 2302
787 Ga0495661_0115723 3300046665 Bacteria 1488
788 Ga0495588_0000070 3300046674 Bacteria 227611
789 Ga0495588_0005552 3300046674 Bacteria 5619
790 Ga0495588_0040498 3300046674 Bacteria 2376
791 Ga0495588_0053203 3300046674 Bacteria 2087
792 Ga0495588_0102827 3300046674 Bacteria 1502
793 Ga0495599_0002742 3300046678 Bacteria 10274
794 Ga0495599_0021770 3300046678 Bacteria 4001
795 Ga0495623_0001396 3300046679 Bacteria 16416
796 Ga0495623_0019259 3300046679 Bacteria 4411
797 Ga0495623_0024796 3300046679 Bacteria 3863
798 Ga0495623_0028769 3300046679 Bacteria 3575
799 Ga0495623_0140067 3300046679 Bacteria 1440
800 Ga0495646_0001118 3300046680 Bacteria 15653
801 Ga0495646_0016250 3300046680 Bacteria 4724
802 Ga0495646_0032109 3300046680 Bacteria 3268
803 Ga0495646_0033623 3300046680 Bacteria 3187
804 Ga0495646_0041268 3300046680 Bacteria 2836
805 Ga0495647_0015333 3300046681 Bacteria 2684
806 Ga0495669_0000098 3300046684 Bacteria 54514
807 Ga0495669_0000122 3300046684 Bacteria 50338
808 Ga0495669_0000598 3300046684 Bacteria 15808
809 Ga0495669_0008372 3300046684 Bacteria 4347
810 Ga0495669_0010848 3300046684 Bacteria 3857
811 Ga0495669_0026673 3300046684 Bacteria 2525
812 Ga0495613_0003533 3300046689 Bacteria 11716
813 Ga0495613_0003579 3300046689 Bacteria 11641
814 Ga0495613_0013125 3300046689 Bacteria 6155
815 Ga0495613_0017802 3300046689 Bacteria 5295
816 Ga0495624_0005465 3300046690 Bacteria 9155
817 Ga0495624_0015533 3300046690 Bacteria 5138
818 Ga0495624_0018907 3300046690 Bacteria 4603
819 Ga0495624_0027815 3300046690 Bacteria 3698
820 Ga0495624_0072286 3300046690 Bacteria 2145
821 Ga0495670_0000604 3300046691 Bacteria 17142
822 Ga0495670_0000716 3300046691 Bacteria 15813
823 Ga0495670_0002986 3300046691 Bacteria 8343
824 Ga0495670_0006409 3300046691 Bacteria 5780
825 Ga0495670_0028216 3300046691 Bacteria 2782
826 Ga0495670_0030634 3300046691 Bacteria 2672
827 Ga0495670_0070736 3300046691 Bacteria 1765
828 Ga0495670_0079364 3300046691 Bacteria 1670
829 Ga0495671_0000128 3300046692 Bacteria 68354
830 Ga0495671_0000132 3300046692 Bacteria 67269
831 Ga0495671_0014662 3300046692 Bacteria 4211
832 Ga0495671_0018445 3300046692 Bacteria 3703
833 Ga0495671_0020725 3300046692 Bacteria 3462
834 Ga0495671_0026082 3300046692 Bacteria 3032
835 Ga0495671_0035134 3300046692 Bacteria 2547
836 Ga0495671_0036103 3300046692 Bacteria 2506
837 Ga0495649_0001317 3300046694 Bacteria 18939
838 Ga0495649_0004297 3300046694 Bacteria 9346
839 Ga0495649_0004408 3300046694 Bacteria 9197
840 Ga0495649_0016046 3300046694 Bacteria 4252
841 Ga0495649_0029298 3300046694 Bacteria 3046
842 Ga0495649_0049349 3300046694 Bacteria 2286
843 Ga0495649_0052366 3300046694 Bacteria 2212
844 Ga0495649_0114136 3300046694 Bacteria 1431
845 Ga0495589_0000036 3300046794 Bacteria 153299
846 Ga0495589_0000092 3300046794 Bacteria 85372
847 Ga0495589_0001941 3300046794 Bacteria 11711
848 Ga0495589_0002400 3300046794 Bacteria 10520
849 Ga0495589_0002441 3300046794 Bacteria 10434
850 Ga0495589_0011466 3300046794 Bacteria 4602
851 Ga0495589_0016187 3300046794 Bacteria 3832
852 Ga0495589_0022789 3300046794 Bacteria 3193
853 Ga0495589_0035130 3300046794 Bacteria 2514
854 Ga0495589_0096429 3300046794 Bacteria 1433
855 Ga0495600_0000510 3300046809 Bacteria 20142
856 Ga0495600_0005990 3300046809 Bacteria 7361
857 Ga0495600_0148196 3300046809 Bacteria 1520
858 Ga0495660_0000117 3300046810 Bacteria 85237
859 Ga0495660_0000839 3300046810 Bacteria 22805
860 Ga0495660_0002463 3300046810 Bacteria 11811
861 Ga0495660_0003009 3300046810 Bacteria 10514
862 Ga0495660_0003124 3300046810 Bacteria 10316
863 Ga0495660_0008761 3300046810 Bacteria 5910
864 Ga0495660_0009567 3300046810 Bacteria 5651
865 Ga0495660_0010570 3300046810 Bacteria 5369
866 Ga0495660_0022679 3300046810 Bacteria 3583
867 Ga0495660_0023686 3300046810 Bacteria 3502
868 Ga0495660_0055809 3300046810 Bacteria 2137
869 Ga0495581_0004434 3300047315 Bacteria 8113
870 Ga0495581_0004715 3300047315 Bacteria 7872
871 Ga0495581_0016557 3300047315 Bacteria 4284
872 Ga0495581_0093981 3300047315 Bacteria 1740
873 Ga0495604_0000854 3300047317 Bacteria 25462
874 Ga0495604_0005257 3300047317 Bacteria 10259
875 Ga0495604_0007320 3300047317 Bacteria 8740
876 Ga0495604_0017852 3300047317 Bacteria 5675
877 Ga0495604_0037992 3300047317 Bacteria 3788
878 Ga0495604_0072199 3300047317 Bacteria 2609
879 Ga0495604_0128199 3300047317 Bacteria 1826
880 Ga0495636_0000126 3300047318 Bacteria 31355
881 Ga0495636_0007400 3300047318 Bacteria 4320
882 Ga0495636_0010263 3300047318 Bacteria 3695
883 Ga0495636_0012275 3300047318 Bacteria 3392
884 Ga0495636_0034643 3300047318 Bacteria 2078
885 Ga0495636_0067059 3300047318 Bacteria 1527
886 Ga0495674_0024972 3300047319 Bacteria 5484
887 Ga0495674_0039283 3300047319 Bacteria 4243
888 Ga0495674_0062982 3300047319 Bacteria 3227
889 Ga0495674_0080830 3300047319 Bacteria 2788
890 Ga0495674_0112723 3300047319 Bacteria 2304
891 Ga0495674_0131503 3300047319 Bacteria 2108
892 Ga0495674_0230197 3300047319 Bacteria 1529
893 Ga0495672_0000066 3300047320 Bacteria 193318
894 Ga0495672_0000086 3300047320 Bacteria 155010
895 Ga0495672_0000349 3300047320 Bacteria 59139
896 Ga0495672_0000400 3300047320 Bacteria 52696
897 Ga0495672_0000556 3300047320 Bacteria 42391
898 Ga0495672_0002183 3300047320 Bacteria 18230
899 Ga0495672_0003253 3300047320 Bacteria 14086
900 Ga0495672_0003913 3300047320 Bacteria 12501
901 Ga0495672_0013316 3300047320 Bacteria 5679
902 Ga0495672_0021041 3300047320 Bacteria 4260
903 Ga0495672_0026319 3300047320 Bacteria 3713
904 Ga0495676_0000035 3300047321 Bacteria 120519
905 Ga0495676_0006502 3300047321 Bacteria 10769
906 Ga0495676_0009421 3300047321 Bacteria 8894
907 Ga0495676_0033173 3300047321 Bacteria 4351
908 Ga0495680_0015543 3300047322 Bacteria 6565
909 Ga0495680_0017177 3300047322 Bacteria 6189
910 Ga0495680_0032120 3300047322 Bacteria 4265
911 Ga0495680_0034256 3300047322 Bacteria 4104
912 Ga0495680_0053360 3300047322 Bacteria 3146
913 Ga0495680_0260151 3300047322 Bacteria 1227
914 Ga0495683_0000080 3300047323 Bacteria 95388
915 Ga0495683_0000576 3300047323 Bacteria 27760
916 Ga0495683_0002800 3300047323 Bacteria 10350
917 Ga0495683_0005543 3300047323 Bacteria 6998
918 Ga0495683_0006408 3300047323 Bacteria 6433
919 Ga0495683_0009633 3300047323 Bacteria 5142
920 Ga0495683_0012554 3300047323 Bacteria 4447
921 Ga0495683_0037783 3300047323 Bacteria 2446
922 Ga0495683_0047557 3300047323 Bacteria 2152
923 Ga0495683_0059501 3300047323 Bacteria 1895
924 Ga0495683_0063414 3300047323 Bacteria 1826
925 Ga0495687_000053 3300047443 Bacteria 195897
926 Ga0495687_000074 3300047443 Bacteria 153464
927 Ga0495687_000154 3300047443 Bacteria 104740
928 Ga0495687_000946 3300047443 Bacteria 29935
929 Ga0495687_001241 3300047443 Bacteria 24342
930 Ga0495687_002558 3300047443 Bacteria 14385
931 Ga0495687_002852 3300047443 Bacteria 13266
932 Ga0495687_003354 3300047443 Bacteria 11695
933 Ga0495687_005143 3300047443 Bacteria 8468
934 Ga0495687_005425 3300047443 Bacteria 8131
935 Ga0495687_015073 3300047443 Bacteria 3944
936 Ga0495687_065664 3300047443 Bacteria 1476
937 Ga0495675_0008503 3300047444 Bacteria 6360
938 Ga0495675_0009650 3300047444 Bacteria 6012
939 Ga0495675_0017405 3300047444 Bacteria 4555
940 Ga0495675_0022719 3300047444 Bacteria 4000
941 Ga0495675_0213444 3300047444 Bacteria 1170
942 Ga0495677_0000037 3300047445 Bacteria 78595
943 Ga0495677_0000214 3300047445 Bacteria 26463
944 Ga0495677_0001397 3300047445 Bacteria 9674
945 Ga0495677_0001947 3300047445 Bacteria 8248
946 Ga0495677_0002817 3300047445 Bacteria 6780
947 Ga0495677_0003246 3300047445 Bacteria 6342
948 Ga0495677_0006506 3300047445 Bacteria 4413
949 Ga0495677_0006565 3300047445 Bacteria 4393
950 Ga0495677_0044671 3300047445 Bacteria 1624
951 Ga0495679_000156 3300047446 Bacteria 61428
952 Ga0495679_000453 3300047446 Bacteria 30221
953 Ga0495679_000509 3300047446 Bacteria 27643
954 Ga0495679_005672 3300047446 Bacteria 5506
955 Ga0495679_013858 3300047446 Bacteria 3007
956 Ga0495685_000011 3300047447 Bacteria 83484
957 Ga0495685_001153 3300047447 Bacteria 8068
958 Ga0495685_006655 3300047447 Bacteria 3794
959 Ga0495685_011400 3300047447 Bacteria 2997
960 Ga0495685_064024 3300047447 Bacteria 1237
961 Ga0495673_0000035 3300047469 Bacteria 316861
962 Ga0495673_0011035 3300047469 Bacteria 4886
963 Ga0495673_0011984 3300047469 Bacteria 4628
964 Ga0495673_0025556 3300047469 Bacteria 2832
965 Ga0495673_0097075 3300047469 Bacteria 1196
966 Ga0495681_0006038 3300047470 Bacteria 8009
967 Ga0495681_0006668 3300047470 Bacteria 7539
968 Ga0495681_0007470 3300047470 Bacteria 6975
969 Ga0495681_0010931 3300047470 Bacteria 5452
970 Ga0495681_0013150 3300047470 Bacteria 4822
971 Ga0495681_0016636 3300047470 Bacteria 4112
972 Ga0495681_0018349 3300047470 Bacteria 3857
973 Ga0495681_0056618 3300047470 Bacteria 1823
974 Ga0495684_0012061 3300047471 Bacteria 6666
975 Ga0495684_0032107 3300047471 Bacteria 4030
976 Ga0495686_0000374 3300047472 Bacteria 71938
977 Ga0495686_0000987 3300047472 Bacteria 34762
978 Ga0495686_0001443 3300047472 Bacteria 25925
979 Ga0495686_0031754 3300047472 Bacteria 3421
980 Ga0495686_0102380 3300047472 Bacteria 1725
981 Ga0495593_0001403 3300047673 Bacteria 14099
982 Ga0495593_0002194 3300047673 Bacteria 11682
983 Ga0495593_0006680 3300047673 Bacteria 6752
984 Ga0495593_0007353 3300047673 Bacteria 6448
985 Ga0495593_0007784 3300047673 Bacteria 6246
986 Ga0495593_0015255 3300047673 Bacteria 4357
987 Ga0495593_0018108 3300047673 Bacteria 3960
988 Ga0495593_0018949 3300047673 Bacteria 3861
989 Ga0495602_0012983 3300048088 Bacteria 8525
990 Ga0495602_0030419 3300048088 Bacteria 5120
991 Ga0495602_0044457 3300048088 Bacteria 4028
992 Ga0495602_0092244 3300048088 Bacteria 2509
993 Ga0495614_0000783 3300048089 Bacteria 13467
994 Ga0495614_0005325 3300048089 Bacteria 5802
995 Ga0495614_0010341 3300048089 Bacteria 4115
996 Ga0495615_0001382 3300048090 Bacteria 3583
997 Ga0495626_0000006 3300048091 Bacteria 284977
998 Ga0495626_0004153 3300048091 Bacteria 8994
999 Ga0495626_0005034 3300048091 Bacteria 7889
1000 Ga0495626_0007142 3300048091 Bacteria 6249
1001 Ga0495626_0007834 3300048091 Bacteria 5916
1002 Ga0495626_0008937 3300048091 Bacteria 5440
1003 Ga0495626_0011758 3300048091 Bacteria 4615
1004 Ga0495626_0012887 3300048091 Bacteria 4362
1005 Ga0495626_0014301 3300048091 Bacteria 4098
1006 Ga0495626_0014308 3300048091 Bacteria 4097
1007 Ga0495626_0014620 3300048091 Bacteria 4041
1008 Ga0495626_0017883 3300048091 Bacteria 3573
1009 Ga0495626_0021946 3300048091 Bacteria 3159
1010 Ga0495626_0029228 3300048091 Bacteria 2668
1011 Ga0495626_0048408 3300048091 Bacteria 1972
1012 Ga0495626_0050272 3300048091 Bacteria 1926
1013 Ga0496100_0060197 3300048903 Bacteria 2498
1014 Ga0496101_0031754 3300048904 Bacteria 3715
1015 Ga0496102_0000253 3300048905 Bacteria 69634
1016 Ga0496102_0001543 3300048905 Bacteria 20339
1017 Ga0496102_0027708 3300048905 Bacteria 5060
1018 Ga0496102_0067864 3300048905 Bacteria 3271
1019 Ga0496103_0002496 3300048906 Bacteria 11545
1020 Ga0496103_0005279 3300048906 Bacteria 7756
1021 Ga0496103_0012509 3300048906 Bacteria 5032
1022 Ga0496103_0015687 3300048906 Bacteria 4515
1023 Ga0496103_0068660 3300048906 Bacteria 2215
1024 Ga0496104_0060011 3300048907 Bacteria 3602
1025 Ga0496105_0085793 3300048908 Bacteria 2601
1026 Ga0496105_0203378 3300048908 Bacteria 1616
1027 Ga0496106_0000432 3300048909 Bacteria 29842
1028 Ga0496106_0037342 3300048909 Bacteria 3634
1029 Ga0496106_0228507 3300048909 Bacteria 1485
1030 Ga0496107_0031164 3300048910 Bacteria 3803
1031 Ga0496107_0043503 3300048910 Bacteria 3227
1032 Ga0496108_0150383 3300048911 Bacteria 2009
1033 Ga0496109_0591084 3300048912 Bacteria 1046
1034 Ga0496110_0001139 3300048913 Bacteria 18808
1035 Ga0496110_0025312 3300048913 Bacteria 5070
1036 Ga0496111_0016215 3300048914 Bacteria 5133
1037 Ga0496112_0025900 3300048915 Bacteria 5636
1038 Ga0496112_0279718 3300048915 Bacteria 1616
1039 Ga0496113_0011257 3300048916 Bacteria 5958
1040 Ga0496113_0015185 3300048916 Bacteria 5283
1041 Ga0496114_0078837 3300048917 Bacteria 2779
1042 Ga0496114_0179791 3300048917 Bacteria 1847
1043 Ga0496115_0013062 3300048918 Bacteria 6270
1044 Ga0496115_0170008 3300048918 Bacteria 1803
1045 Ga0496116_0011621 3300048919 Bacteria 7266
1046 Ga0496116_0027112 3300048919 Bacteria 4175
1047 Ga0496117_0002566 3300048920 Bacteria 22609
1048 Ga0496117_0005210 3300048920 Bacteria 13829
1049 Ga0496117_0007716 3300048920 Bacteria 10404
1050 Ga0496117_0067616 3300048920 Bacteria 2417
1051 Ga0496118_0002656 3300048921 Bacteria 23672
1052 Ga0496118_0004550 3300048921 Bacteria 16356
1053 Ga0496118_0056467 3300048921 Bacteria 2951
1054 Ga0496118_0118332 3300048921 Bacteria 1735
1055 Ga0496121_0002254 3300048924 Bacteria 30068
1056 Ga0496121_0006277 3300048924 Bacteria 14863
1057 Ga0496121_0012852 3300048924 Bacteria 9057
1058 Ga0496121_0021795 3300048924 Bacteria 6257
1059 Ga0496121_0165506 3300048924 Bacteria 1612
1060 Ga0496122_0005543 3300048925 Bacteria 14967
1061 Ga0496122_0010101 3300048925 Bacteria 9797
1062 Ga0496122_0072569 3300048925 Bacteria 2447
1063 Ga0496123_0009734 3300048926 Bacteria 8602
1064 Ga0496124_0000079 3300048927 Bacteria 212057
1065 Ga0496124_0015326 3300048927 Bacteria 7356
1066 Ga0496124_0018387 3300048927 Bacteria 6546
1067 Ga0496124_0026346 3300048927 Bacteria 5244
1068 Ga0496125_0036903 3300048928 Bacteria 4257
1069 Ga0496125_0047293 3300048928 Bacteria 3600
1070 Ga0496126_0000118 3300048929 Bacteria 184719
1071 Ga0496126_0001912 3300048929 Bacteria 29879
1072 Ga0496126_0004117 3300048929 Bacteria 17594
1073 Ga0496126_0007469 3300048929 Bacteria 11975
1074 Ga0496126_0012774 3300048929 Bacteria 8584
1075 Ga0496126_0117942 3300048929 Bacteria 2305
1076 Ga0495678_000002 3300049459 Bacteria 999613
1077 Ga0495678_000029 3300049459 Bacteria 219803
1078 Ga0495678_000064 3300049459 Bacteria 138380
1079 Ga0495678_001683 3300049459 Bacteria 16763
1080 Ga0495678_002660 3300049459 Bacteria 11833
1081 Ga0495678_018210 3300049459 Bacteria 3163
1082 Ga0495682_0000592 3300049460 Bacteria 24625
1083 Ga0495682_0000726 3300049460 Bacteria 21381
1084 Ga0495682_0012560 3300049460 Bacteria 3244
1085 Ga0501292_002034 3300049515 Bacteria 2564
1086 Ga0501297_004592 3300049520 Bacteria 1417
1087 Ga0501300_005419 3300049523 Bacteria 1879
1088 Ga0501039_0044216 3300049575 Bacteria 3440
1089 Ga0501043_0000072 3300049579 Bacteria 89021
1090 Ga0501046_0000112 3300049580 Bacteria 86313
1091 Ga0501047_0000138 3300049581 Bacteria 89028
1092 Ga0501048_0001221 3300049582 Bacteria 19469
1093 Ga0501075_0121025 3300049591 Bacteria 1992
1094 Ga0501201_000825 3300049651 Bacteria 2908
1095 Ga0501207_003795 3300049654 Bacteria 2028
1096 Ga0501211_000079 3300049658 Bacteria 6780
1097 Ga0501222_001066 3300049662 Bacteria 3884
1098 Ga0501227_006353 3300049665 Bacteria 2542
1099 Ga0501233_000690 3300049668 Bacteria 5566
1100 Ga0501249_006134 3300049679 Bacteria 2470
1101 Ga0501253_015142 3300049683 Bacteria 1261
1102 Ga0501255_000839 3300049684 Bacteria 2271
1103 Ga0501221_000470 3300049704 Bacteria 6302
1104 Ga0501232_003431 3300049757 Bacteria 1446
1105 Ga0501262_000761 3300049759 Bacteria 3716
1106 Ga0501262_002795 3300049759 Bacteria 1975
1107 Ga0501265_002219 3300049762 Bacteria 2203
1108 Ga0501269_000010 3300049766 Bacteria 70454
1109 Ga0501272_000733 3300049769 Bacteria 2960
1110 Ga0501274_000666 3300049771 Bacteria 2497
1111 Ga0501279_002908 3300049775 Bacteria 2230
1112 Ga0501279_009393 3300049775 Bacteria 1309
1113 Ga0501044_0278396 3300049823 Bacteria 1607
1114 Ga0501045_0001874 3300049824 Bacteria 14253
1115 Ga0500618_025783 3300053125 Bacteria 1407
1116 Ga0500586_000998 3300053145 Bacteria 5848
1117 Ga0587072_001186 3300059643 Bacteria 3122
1118 Ga0466962_0000108 3300061719 Bacteria 33805
1119 Ga0466962_0000704 3300061719 Bacteria 14880
1120 Ga0466962_0001877 3300061719 Bacteria 9894
1121 Ga0466962_0005173 3300061719 Bacteria 6279

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049654 Ga0501207_003795 Ga0501207_003795_21_944 304
2 3300002739 JGI25158J39367_1010914 JGI25158J39367_10109142 309
3 3300046501 Ga0495607_0031243 Ga0495607_0031243_2300_3244 311
4 3300046507 Ga0495606_0235338 Ga0495606_0235338_49_1002 311
5 3300002774 JGI25150J39212_1005864 JGI25150J39212_10058643 312
6 3300042135 Ga0450899_010921 Ga0450899_010921_46_993 312
7 3300046810 Ga0495660_0055809 Ga0495660_0055809_10_960 313
8 3300048912 Ga0496109_0591084 Ga0496109_0591084_79_1029 313
9 3300046453 Ga0495627_003352 Ga0495627_003352_22_981 316
10 3300046477 Ga0495664_0268186 Ga0495664_0268186_54_1013 316
11 3300046499 Ga0495594_0183424 Ga0495594_0183424_222_1181 316
12 3300046557 Ga0495622_0020634 Ga0495622_0020634_19_993 318
13 3300048091 Ga0495626_0021946 Ga0495626_0021946_2167_3141 318
14 3300048928 Ga0496125_0036903 Ga0496125_0036903_23_1024 333
15 3300046471 Ga0495650_0011361 Ga0495650_0011361_3807_4865 352
16 3300046507 Ga0495606_0062801 Ga0495606_0062801_1274_2332 352
17 3300046514 Ga0495618_0017662 Ga0495618_0017662_39_1097 352
18 3300046516 Ga0495628_0161007 Ga0495628_0161007_39_1097 352
19 3300047319 Ga0495674_0230197 Ga0495674_0230197_39_1097 352
20 3300048903 Ga0496100_0060197 Ga0496100_0060197_17_1075 352
21 3300048921 Ga0496118_0118332 Ga0496118_0118332_57_1115 352
22 3300047445 Ga0495677_0000214 Ga0495677_0000214_12084_13226 354
23 3300042128 Ga0450897_001105 Ga0450897_001105_457_1533 355
24 3300044901 Ga0466960_0091677 Ga0466960_0091677_462_1538 355
25 3300047469 Ga0495673_0097075 Ga0495673_0097075_22_1098 355
26 3300002773 JGI25152J39213_1011033 JGI25152J39213_10110331 356
27 3300046501 Ga0495607_0005170 Ga0495607_0005170_4066_5145 356
28 3300046507 Ga0495606_0000820 Ga0495606_0000820_11292_12371 356
29 3300046522 Ga0495643_0000285 Ga0495643_0000285_27724_28803 356
30 3300046542 Ga0495597_0000459 Ga0495597_0000459_9715_10794 356
31 3300046557 Ga0495622_0000131 Ga0495622_0000131_43321_44400 356
32 3300046660 Ga0495625_0000035 Ga0495625_0000035_149804_150883 356
33 3300046660 Ga0495625_0117308 Ga0495625_0117308_591_1670 356
34 3300047443 Ga0495687_002558 Ga0495687_002558_2747_3826 356
35 3300047469 Ga0495673_0000035 Ga0495673_0000035_156960_158039 356
36 3300048906 Ga0496103_0015687 Ga0496103_0015687_2784_3863 356
37 3300048917 Ga0496114_0078837 Ga0496114_0078837_1482_2561 356
38 3300049665 Ga0501227_006353 Ga0501227_006353_598_1671 356
39 3300049766 Ga0501269_000010 Ga0501269_000010_35224_36303 356
40 3300053125 Ga0500618_025783 Ga0500618_025783_26_1105 356
41 3300046522 Ga0495643_0155334 Ga0495643_0155334_31_1116 358
42 3300046473 Ga0495582_0030386 Ga0495582_0030386_32_1120 359
43 3300049823 Ga0501044_0278396 Ga0501044_0278396_16_1107 359
44 3300046471 Ga0495650_0000806 Ga0495650_0000806_14613_15818 360
45 3300046474 Ga0495605_0014479 Ga0495605_0014479_1304_2494 360
46 3300046500 Ga0495596_0001840 Ga0495596_0001840_1984_3174 360
47 3300046518 Ga0495631_0021299 Ga0495631_0021299_710_1831 360
48 3300046524 Ga0495648_0020179 Ga0495648_0020179_1328_2518 360
49 3300046538 Ga0495609_0001475 Ga0495609_0001475_3989_5179 360
50 3300046648 Ga0495611_0015041 Ga0495611_0015041_1828_2949 360
51 3300046794 Ga0495589_0011466 Ga0495589_0011466_2758_3948 360
52 3300047318 Ga0495636_0007400 Ga0495636_0007400_1501_2622 360
53 3300047320 Ga0495672_0000349 Ga0495672_0000349_26039_27229 360
54 3300048091 Ga0495626_0007142 Ga0495626_0007142_3019_4155 361
55 3300046522 Ga0495643_0000028 Ga0495643_0000028_33029_34147 363
56 3300046524 Ga0495648_0045197 Ga0495648_0045197_259_1377 363
57 3300046660 Ga0495625_0043584 Ga0495625_0043584_976_2094 363
58 3300047320 Ga0495672_0000400 Ga0495672_0000400_16877_17995 363
59 3300049459 Ga0495678_000029 Ga0495678_000029_202834_203952 363
60 iso_pu_bacteria 2643221645 2644251314 364
61 iso_pu_bacteria 2643221664 2644357486 364
62 iso_pu_bacteria 2738541280 2738740079 364
63 iso_pu_bacteria 2738541300 2738844161 364
64 iso_pu_bacteria 2738543018 2739274279 364
65 iso_pu_bacteria 2738543030 2739343323 364
66 iso_pu_bacteria 8047673197 8047679037 364
67 3300049575 Ga0501039_0044216 Ga0501039_0044216_1865_2986 365
68 3300049591 Ga0501075_0121025 Ga0501075_0121025_656_1777 365
69 iso_pu_bacteria 2643221554 2643790800 365
70 iso_pu_bacteria 2643221638 2644211721 365
71 iso_pu_bacteria 2842711865 2842715566 365
72 iso_pu_bacteria 2857553236 2857555888 365
73 iso_pu_bacteria 2857558681 2857561787 365
74 iso_pu_bacteria 2904424332 2904425677 365
75 iso_pu_bacteria 2919476304 2919478231 365
76 3300009551 Ga0105238_10011315 Ga0105238_100113156 366
77 3300025924 Ga0207694_10027835 Ga0207694_100278353 366
78 3300048927 Ga0496124_0018387 Ga0496124_0018387_4500_5642 367
79 3300049771 Ga0501274_000666 Ga0501274_000666_259_1365 367
80 iso_pu_bacteria 2501025501 2501074628 367
81 iso_pu_bacteria 2501025502 2501078321 367
82 iso_pu_bacteria 2501025504 2501410090 367
83 iso_pu_bacteria 2508501125 2509128021 367
84 iso_pu_bacteria 2510065045 2510252836 367
85 iso_pu_bacteria 2510917013 2511090027 367
86 iso_pu_bacteria 2510917014 2511095412 367
87 iso_pu_bacteria 2510917015 2511105070 367
88 iso_pu_bacteria 2512047030 2512346926 367
89 iso_pu_bacteria 2513237082 2513556048 367
90 iso_pu_bacteria 2513237083 2513561322 367
91 iso_pu_bacteria 2513237151 2513959523 367
92 iso_pu_bacteria 2513237166 2514046856 367
93 iso_pu_bacteria 2515154122 2515683293 367
94 iso_pu_bacteria 2519103095 2519457279 367
95 iso_pu_bacteria 2526164713 2527078463 367
96 iso_pu_bacteria 2562617112 2563055466 367
97 iso_pu_bacteria 2582581311 2585292177 367
98 iso_pu_bacteria 2599185239 2599738779 367
99 iso_pu_bacteria 2599185240 2599747611 367
100 iso_pu_bacteria 2599185355 2600209495 367
101 iso_pu_bacteria 2600255067 2600814262 367
102 iso_pu_bacteria 2675903129 2676745554 367
103 iso_pu_bacteria 2711768613 2713478889 367
104 iso_pu_bacteria 2718217991 2719641937 367
105 iso_pu_bacteria 2734482258 2735816427 367
106 iso_pu_bacteria 2738541296 2738823053 367
107 iso_pu_bacteria 2738541298 2738835260 367
108 iso_pu_bacteria 2738541306 2738876739 367
109 iso_pu_bacteria 2738543002 2739188798 367
110 iso_pu_bacteria 2738543008 2739223450 367
111 iso_pu_bacteria 2744054900 2746086743 367
112 iso_pu_bacteria 2744054901 2746094142 367
113 iso_pu_bacteria 2751185846 2753568571 367
114 iso_pu_bacteria 2791355137 2792839312 367
115 iso_pu_bacteria 2808606384 2808971310 367
116 iso_pu_bacteria 2808606390 2809006306 367
117 iso_pu_bacteria 2808606391 2809013277 367
118 iso_pu_bacteria 2816332253 2817259482 367
119 iso_pu_bacteria 2816332256 2817277151 367
120 iso_pu_bacteria 2816332286 2817454065 367
121 iso_pu_bacteria 2818991450 2819622590 367
122 iso_pu_bacteria 2818991452 2819634732 367
123 iso_pu_bacteria 2842324504 2842329079 367
124 iso_pu_bacteria 2842348783 2842353502 367
125 iso_pu_bacteria 2842454564 2842459025 367
126 iso_pu_bacteria 2856287931 2856290397 367
127 iso_pu_bacteria 2857357740 2857359932 367
128 iso_pu_bacteria 2863421361 2863425420 367
129 iso_pu_bacteria 2870068957 2870069660 367
130 iso_pu_bacteria 2883087390 2883096083 367
131 iso_pu_bacteria 2885270888 2885276190 367
132 iso_pu_bacteria 2900634093 2900636795 367
133 iso_pu_bacteria 2902682994 2902691643 367
134 iso_pu_bacteria 2904483920 2904488163 367
135 iso_pu_bacteria 2904564687 2904570169 367
136 iso_pu_bacteria 2904571731 2904577299 367
137 iso_pu_bacteria 2904615490 2904617536 367
138 iso_pu_bacteria 2919527303 2919531076 367
139 iso_pu_bacteria 2928108538 2928112687 367
140 iso_pu_bacteria 2928135762 2928139660 367
141 iso_pu_bacteria 2928157003 2928163699 367
142 iso_pu_bacteria 2928163908 2928170548 367
143 iso_pu_bacteria 2928170801 2928175869 367
144 iso_pu_bacteria 2928503688 2928508457 367
145 iso_pu_bacteria 2928536128 2928541512 367
146 iso_pu_bacteria 2945934425 2945934858 367
147 iso_pu_bacteria 2981990288 2981995740 367
148 iso_pu_bacteria 2990703756 2990704565 367
149 iso_pu_bacteria 641736151 642425124 367
150 iso_pu_bacteria 641736154 642416044 367
151 iso_pu_bacteria 642555112 642594866 367
152 iso_pu_bacteria 642555113 642623517 367
153 iso_pu_bacteria 8003955200 8003958777 367
154 iso_pu_bacteria 8018845410 8018848072 367
155 iso_pu_bacteria 8020807995 8020810272 367
156 iso_pu_bacteria 8020938398 8020939206 367
157 iso_pu_bacteria 8020945358 8020948503 367
158 iso_pu_bacteria 8020953355 8020956264 367
159 iso_pu_bacteria 8021120328 8021127065 367
160 iso_pu_bacteria 8039098773 8039100658 367
161 iso_pu_bacteria 8040167225 8040169578 367
162 iso_pu_bacteria 8040173305 8040174611 367
163 iso_pu_bacteria 8055266321 8055270757 367
164 iso_pu_bacteria 8055301274 8055305559 367
165 3300003762 Ga0055542_1007268 Ga0055542_10072682 368
166 3300003771 Ga0055526_1000053 Ga0055526_100005386 368
167 3300009036 Ga0105244_10002111 Ga0105244_100021112 368
168 3300009176 Ga0105242_10021383 Ga0105242_100213833 368
169 3300013100 Ga0157373_10119483 Ga0157373_101194832 368
170 3300021361 Ga0213872_10000001 Ga0213872_10000001486 368
171 3300025254 Ga0209148_1001656 Ga0209148_10016566 368
172 3300025920 Ga0207649_10129405 Ga0207649_101294052 368
173 3300025945 Ga0207679_10153330 Ga0207679_101533301 368
174 3300026116 Ga0207674_10073877 Ga0207674_100738772 368
175 3300031548 Ga0307408_100001241 Ga0307408_1000012417 368
176 3300032002 Ga0307416_100025826 Ga0307416_1000258263 368
177 3300032005 Ga0307411_10109399 Ga0307411_101093992 368
178 3300037312 Ga0395899_0057731 Ga0395899_0057731_452_1570 368
179 3300037312 Ga0395899_0127966 Ga0395899_0127966_160_1278 368
180 3300037418 Ga0395900_0030583 Ga0395900_0030583_2450_3568 368
181 3300037418 Ga0395900_0063130 Ga0395900_0063130_2530_3648 368
182 3300037418 Ga0395900_0364682 Ga0395900_0364682_281_1399 368
183 3300037466 Ga0395898_0082800 Ga0395898_0082800_887_2005 368
184 3300037471 Ga0395905_0000249 Ga0395905_0000249_2297_3412 368
185 3300037471 Ga0395905_0260691 Ga0395905_0260691_233_1351 368
186 3300038443 Ga0395901_0000084 Ga0395901_0000084_99186_100304 368
187 3300039447 Ga0436361_1185928 Ga0436361_1185928_61438_62553 368
188 3300044656 Ga0466969_0014035 Ga0466969_0014035_1698_2816 368
189 3300044658 Ga0466972_0018823 Ga0466972_0018823_565_1683 368
190 3300044684 Ga0466966_0017218 Ga0466966_0017218_3573_4691 368
191 3300044684 Ga0466966_0127820 Ga0466966_0127820_357_1475 368
192 3300044706 Ga0466964_0002478 Ga0466964_0002478_2959_4077 368
193 3300044712 Ga0453684_0021760 Ga0453684_0021760_4187_5302 368
194 3300044735 Ga0466968_0005379 Ga0466968_0005379_271_1389 368
195 3300044901 Ga0466960_0029263 Ga0466960_0029263_489_1607 368
196 3300045051 Ga0451576_0004673 Ga0451576_0004673_14276_15391 368
197 3300046457 Ga0495590_0006826 Ga0495590_0006826_1233_2351 368
198 3300046460 Ga0495638_0016040 Ga0495638_0016040_1788_2903 368
199 3300046474 Ga0495605_0000087 Ga0495605_0000087_96136_97254 368
200 3300046474 Ga0495605_0011963 Ga0495605_0011963_511_1626 368
201 3300046491 Ga0495584_0000057 Ga0495584_0000057_19471_20586 368
202 3300046491 Ga0495584_0005971 Ga0495584_0005971_1280_2398 368
203 3300046492 Ga0495585_0016163 Ga0495585_0016163_2640_3755 368
204 3300046501 Ga0495607_0002567 Ga0495607_0002567_8086_9204 368
205 3300046506 Ga0495583_0000067 Ga0495583_0000067_42368_43483 368
206 3300046507 Ga0495606_0011903 Ga0495606_0011903_3961_5076 368
207 3300046507 Ga0495606_0049990 Ga0495606_0049990_209_1324 368
208 3300046513 Ga0495616_0017342 Ga0495616_0017342_407_1522 368
209 3300046522 Ga0495643_0009197 Ga0495643_0009197_2279_3397 368
210 3300046524 Ga0495648_0001359 Ga0495648_0001359_22988_24103 368
211 3300046524 Ga0495648_0007560 Ga0495648_0007560_6087_7205 368
212 3300046528 Ga0495642_0002336 Ga0495642_0002336_2531_3649 368
213 3300046530 Ga0495654_0017765 Ga0495654_0017765_1681_2796 368
214 3300046538 Ga0495609_0001124 Ga0495609_0001124_8346_9461 368
215 3300046538 Ga0495609_0028135 Ga0495609_0028135_319_1434 368
216 3300046558 Ga0495633_0001422 Ga0495633_0001422_14568_15683 368
217 3300046558 Ga0495633_0002751 Ga0495633_0002751_1132_2247 368
218 3300046615 Ga0495656_0027660 Ga0495656_0027660_450_1565 368
219 3300046615 Ga0495656_0057445 Ga0495656_0057445_55_1173 368
220 3300046648 Ga0495611_0001009 Ga0495611_0001009_2923_4038 368
221 3300046648 Ga0495611_0003480 Ga0495611_0003480_2347_3462 368
222 3300046648 Ga0495611_0009665 Ga0495611_0009665_269_1384 368
223 3300046660 Ga0495625_0005030 Ga0495625_0005030_6467_7582 368
224 3300046664 Ga0495659_0000052 Ga0495659_0000052_22652_23767 368
225 3300046664 Ga0495659_0000529 Ga0495659_0000529_2880_3995 368
226 3300046665 Ga0495661_0041408 Ga0495661_0041408_1618_2736 368
227 3300046674 Ga0495588_0000070 Ga0495588_0000070_38383_39501 368
228 3300046691 Ga0495670_0000716 Ga0495670_0000716_2339_3454 368
229 3300046692 Ga0495671_0000128 Ga0495671_0000128_28526_29641 368
230 3300046694 Ga0495649_0114136 Ga0495649_0114136_249_1367 368
231 3300046794 Ga0495589_0000092 Ga0495589_0000092_44983_46101 368
232 3300046810 Ga0495660_0000117 Ga0495660_0000117_25205_26323 368
233 3300046810 Ga0495660_0003009 Ga0495660_0003009_258_1373 368
234 3300047318 Ga0495636_0000126 Ga0495636_0000126_20827_21942 368
235 3300047318 Ga0495636_0067059 Ga0495636_0067059_311_1426 368
236 3300047320 Ga0495672_0000066 Ga0495672_0000066_170132_171247 368
237 3300047320 Ga0495672_0002183 Ga0495672_0002183_5922_7040 368
238 3300047320 Ga0495672_0013316 Ga0495672_0013316_2490_3605 368
239 3300047323 Ga0495683_0002800 Ga0495683_0002800_1525_2640 368
240 3300047323 Ga0495683_0037783 Ga0495683_0037783_774_1892 368
241 3300047443 Ga0495687_001241 Ga0495687_001241_22161_23276 368
242 3300047443 Ga0495687_002852 Ga0495687_002852_4811_5929 368
243 3300047445 Ga0495677_0001397 Ga0495677_0001397_3435_4553 368
244 3300047447 Ga0495685_000011 Ga0495685_000011_22988_24103 368
245 3300048090 Ga0495615_0001382 Ga0495615_0001382_1718_2833 368
246 3300048091 Ga0495626_0000006 Ga0495626_0000006_122814_123932 368
247 3300048908 Ga0496105_0203378 Ga0496105_0203378_49_1167 368
248 3300048909 Ga0496106_0037342 Ga0496106_0037342_2048_3166 368
249 3300048910 Ga0496107_0043503 Ga0496107_0043503_411_1529 368
250 3300048925 Ga0496122_0010101 Ga0496122_0010101_3590_4708 368
251 3300048926 Ga0496123_0009734 Ga0496123_0009734_1296_2414 368
252 3300049459 Ga0495678_001683 Ga0495678_001683_3231_4346 368
253 3300049460 Ga0495682_0000592 Ga0495682_0000592_13062_14177 368
254 3300049775 Ga0501279_009393 Ga0501279_009393_107_1222 368
255 iso_pu_bacteria 2515154123 2515688301 368
256 3300002773 JGI25152J39213_1000242 JGI25152J39213_10002425 369
257 3300002774 JGI25150J39212_1000487 JGI25150J39212_10004872 369
258 3300002987 JGI25159J45721_1000340 JGI25159J45721_10003404 369
259 3300002987 JGI25159J45721_1001229 JGI25159J45721_10012294 369
260 3300003215 JGI25153J46596_10014274 JGI25153J46596_100142744 369
261 3300003215 JGI25153J46596_10032011 JGI25153J46596_100320112 369
262 3300003544 Ga0007417J51691_1034284 Ga0007417J51691_10342842 369
263 3300003574 Ga0007410J51695_1042566 Ga0007410J51695_10425662 369
264 3300003771 Ga0055526_1000018 Ga0055526_1000018167 369
265 3300003771 Ga0055526_1000602 Ga0055526_100060228 369
266 3300003771 Ga0055526_1015807 Ga0055526_10158072 369
267 3300003773 Ga0055537_1004892 Ga0055537_10048923 369
268 3300003775 Ga0055524_1000003 Ga0055524_1000003197 369
269 3300003775 Ga0055524_1000223 Ga0055524_100022326 369
270 3300003775 Ga0055524_1006395 Ga0055524_10063954 369
271 3300003775 Ga0055524_1006501 Ga0055524_10065013 369
272 3300003784 Ga0055534_1006053 Ga0055534_10060533 369
273 3300003790 Ga0055528_1009739 Ga0055528_10097392 369
274 3300003791 Ga0055530_10000262 Ga0055530_100002622 369
275 3300003794 Ga0055531_10009510 Ga0055531_100095104 369
276 3300004625 Ga0055543_1000136 Ga0055543_100013650 369
277 3300005262 Ga0065165_1000612 Ga0065165_100061231 369
278 3300005262 Ga0065165_1001278 Ga0065165_100127829 369
279 3300005293 Ga0065715_10101354 Ga0065715_101013541 369
280 3300006946 Ga0079104_1008017 Ga0079104_10080172 369
281 3300006948 Ga0099826_10000002 Ga0099826_10000002639 369
282 3300009036 Ga0105244_10004090 Ga0105244_100040908 369
283 3300015261 Ga0182006_1000040 Ga0182006_100004035 369
284 3300015262 Ga0182007_10031221 Ga0182007_100312212 369
285 3300025208 Ga0209436_100216 Ga0209436_1002166 369
286 3300025245 Ga0207425_1000001 Ga0207425_10000011065 369
287 3300025245 Ga0207425_1000039 Ga0207425_1000039184 369
288 3300025258 Ga0209129_1000001 Ga0209129_1000001242 369
289 3300025258 Ga0209129_1001725 Ga0209129_10017259 369
290 3300025263 Ga0209565_1000901 Ga0209565_10009019 369
291 3300025263 Ga0209565_1002806 Ga0209565_10028064 369
292 3300025263 Ga0209565_1004699 Ga0209565_10046994 369
293 3300025273 Ga0209673_1030592 Ga0209673_10305922 369
294 3300025284 Ga0209130_1000078 Ga0209130_1000078118 369
295 3300025284 Ga0209130_1001043 Ga0209130_100104310 369
296 3300025284 Ga0209130_1003615 Ga0209130_10036155 369
297 3300025291 Ga0209675_1001665 Ga0209675_100166511 369
298 3300025291 Ga0209675_1002349 Ga0209675_10023494 369
299 3300025295 Ga0209564_1000068 Ga0209564_1000068273 369
300 3300025295 Ga0209564_1000109 Ga0209564_1000109195 369
301 3300025295 Ga0209564_1004204 Ga0209564_100420411 369
302 3300025297 Ga0209758_1000020 Ga0209758_1000020211 369
303 3300025298 Ga0209050_1000074 Ga0209050_1000074195 369
304 3300025298 Ga0209050_1006726 Ga0209050_10067262 369
305 3300025298 Ga0209050_1007129 Ga0209050_10071297 369
306 3300025299 Ga0209256_1000007 Ga0209256_1000007169 369
307 3300025299 Ga0209256_1000028 Ga0209256_1000028184 369
308 3300025299 Ga0209256_1002827 Ga0209256_100282711 369
309 3300025299 Ga0209256_1008481 Ga0209256_10084814 369
310 3300025302 Ga0207426_1002201 Ga0207426_10022016 369
311 3300025302 Ga0207426_1012629 Ga0207426_10126293 369
312 3300025304 Ga0209257_1000003 Ga0209257_100000326 369
313 3300025728 Ga0207655_1005932 Ga0207655_10059324 369
314 3300027111 Ga0209281_1002903 Ga0209281_10029032 369
315 3300027666 Ga0209282_1000001 Ga0209282_1000001515 369
316 3300030744 Ga0316181_1071815 Ga0316181_10718153 369
317 3300031548 Ga0307408_100000126 Ga0307408_10000012679 369
318 3300031548 Ga0307408_100149765 Ga0307408_1001497653 369
319 3300046452 Ga0495617_000003 Ga0495617_000003_301184_302302 369
320 3300046452 Ga0495617_001586 Ga0495617_001586_2923_4041 369
321 3300046453 Ga0495627_000001 Ga0495627_000001_1096396_1097514 369
322 3300046457 Ga0495590_0000001 Ga0495590_0000001_161346_162464 369
323 3300046460 Ga0495638_0000017 Ga0495638_0000017_200900_202018 369
324 3300046471 Ga0495650_0000456 Ga0495650_0000456_16269_17387 369
325 3300046471 Ga0495650_0004206 Ga0495650_0004206_4022_5140 369
326 3300046474 Ga0495605_0000028 Ga0495605_0000028_201034_202152 369
327 3300046474 Ga0495605_0009089 Ga0495605_0009089_1720_2850 369
328 3300046491 Ga0495584_0014505 Ga0495584_0014505_1082_2212 369
329 3300046501 Ga0495607_0007144 Ga0495607_0007144_3893_5023 369
330 3300046506 Ga0495583_0000050 Ga0495583_0000050_69612_70730 369
331 3300046506 Ga0495583_0010118 Ga0495583_0010118_1314_2432 369
332 3300046507 Ga0495606_0000563 Ga0495606_0000563_31360_32478 369
333 3300046507 Ga0495606_0003201 Ga0495606_0003201_11140_12258 369
334 3300046507 Ga0495606_0003747 Ga0495606_0003747_6621_7739 369
335 3300046512 Ga0495610_0006646 Ga0495610_0006646_6481_7599 369
336 3300046512 Ga0495610_0043323 Ga0495610_0043323_900_2018 369
337 3300046512 Ga0495610_0090828 Ga0495610_0090828_163_1281 369
338 3300046520 Ga0495637_0002126 Ga0495637_0002126_599_1717 369
339 3300046524 Ga0495648_0000001 Ga0495648_0000001_688203_689321 369
340 3300046528 Ga0495642_0002537 Ga0495642_0002537_3298_4416 369
341 3300046538 Ga0495609_0000096 Ga0495609_0000096_76586_77716 369
342 3300046538 Ga0495609_0000497 Ga0495609_0000497_29891_31009 369
343 3300046538 Ga0495609_0079776 Ga0495609_0079776_240_1358 369
344 3300046558 Ga0495633_0000106 Ga0495633_0000106_48588_49706 369
345 3300046558 Ga0495633_0001289 Ga0495633_0001289_3471_4589 369
346 3300046616 Ga0495668_0000018 Ga0495668_0000018_315317_316435 369
347 3300046616 Ga0495668_0000686 Ga0495668_0000686_6161_7279 369
348 3300046660 Ga0495625_0002479 Ga0495625_0002479_15235_16353 369
349 3300046665 Ga0495661_0000164 Ga0495661_0000164_53604_54734 369
350 3300046694 Ga0495649_0004297 Ga0495649_0004297_4343_5461 369
351 3300046794 Ga0495589_0000036 Ga0495589_0000036_23919_25049 369
352 3300046810 Ga0495660_0000839 Ga0495660_0000839_350_1468 369
353 3300046810 Ga0495660_0008761 Ga0495660_0008761_2569_3687 369
354 3300046810 Ga0495660_0009567 Ga0495660_0009567_866_1984 369
355 3300047318 Ga0495636_0034643 Ga0495636_0034643_162_1280 369
356 3300047443 Ga0495687_000074 Ga0495687_000074_24058_25188 369
357 3300047443 Ga0495687_000946 Ga0495687_000946_2708_3826 369
358 3300047445 Ga0495677_0000037 Ga0495677_0000037_53651_54781 369
359 3300047470 Ga0495681_0010931 Ga0495681_0010931_4296_5414 369
360 3300047472 Ga0495686_0001443 Ga0495686_0001443_13902_15020 369
361 3300048091 Ga0495626_0004153 Ga0495626_0004153_3397_4527 369
362 3300048906 Ga0496103_0068660 Ga0496103_0068660_645_1763 369
363 3300048927 Ga0496124_0026346 Ga0496124_0026346_3103_4221 369
364 3300049459 Ga0495678_000002 Ga0495678_000002_917679_918797 369
365 3300049775 Ga0501279_002908 Ga0501279_002908_426_1544 369
366 3300053145 Ga0500586_000998 Ga0500586_000998_466_1584 369
367 iso_pu_bacteria 2643221639 2644221945 369
368 3300001990 JGI24737J22298_10014717 JGI24737J22298_100147172 370
369 3300002067 JGI24735J21928_10000065 JGI24735J21928_1000006537 370
370 3300002738 JGI25154J39366_1000553 JGI25154J39366_10005533 370
371 3300002739 JGI25158J39367_1000007 JGI25158J39367_100000720 370
372 3300002987 JGI25159J45721_1000127 JGI25159J45721_100012712 370
373 3300003322 rootL2_10049059 rootL2_100490597 370
374 3300003354 JGI25160J50197_1000132 JGI25160J50197_100013243 370
375 3300003374 JGI25161J50226_1000105 JGI25161J50226_100010543 370
376 3300003771 Ga0055526_1000133 Ga0055526_100013342 370
377 3300003773 Ga0055537_1000093 Ga0055537_100009342 370
378 3300003775 Ga0055524_1000192 Ga0055524_100019243 370
379 3300003784 Ga0055534_1000098 Ga0055534_100009843 370
380 3300004625 Ga0055543_1000101 Ga0055543_100010143 370
381 3300005262 Ga0065165_1000282 Ga0065165_100028264 370
382 3300005543 Ga0070672_100092786 Ga0070672_1000927862 370
383 3300005617 Ga0068859_100457272 Ga0068859_1004572721 370
384 3300005843 Ga0068860_100001092 Ga0068860_10000109212 370
385 3300005843 Ga0068860_100084407 Ga0068860_1000844072 370
386 3300006881 Ga0068865_100015058 Ga0068865_1000150582 370
387 3300006931 Ga0097620_100457272 Ga0097620_1004572721 370
388 3300009011 Ga0105251_10000937 Ga0105251_1000093727 370
389 3300009036 Ga0105244_10034717 Ga0105244_100347172 370
390 3300009545 Ga0105237_10227872 Ga0105237_102278721 370
391 3300009553 Ga0105249_10009272 Ga0105249_100092725 370
392 3300013105 Ga0157369_10034147 Ga0157369_100341473 370
393 3300013296 Ga0157374_10017669 Ga0157374_100176696 370
394 3300013297 Ga0157378_10033324 Ga0157378_100333242 370
395 3300013306 Ga0163162_10004078 Ga0163162_100040782 370
396 3300014968 Ga0157379_10189956 Ga0157379_101899562 370
397 3300014969 Ga0157376_10168730 Ga0157376_101687302 370
398 3300017792 Ga0163161_10012823 Ga0163161_100128232 370
399 3300025208 Ga0209436_100028 Ga0209436_10002844 370
400 3300025263 Ga0209565_1000157 Ga0209565_100015748 370
401 3300025273 Ga0209673_1028792 Ga0209673_10287921 370
402 3300025284 Ga0209130_1000189 Ga0209130_100018944 370
403 3300025291 Ga0209675_1000158 Ga0209675_100015845 370
404 3300025295 Ga0209564_1000342 Ga0209564_100034246 370
405 3300025299 Ga0209256_1000214 Ga0209256_100021461 370
406 3300025302 Ga0207426_1000343 Ga0207426_100034344 370
407 3300025302 Ga0207426_1002710 Ga0207426_10027107 370
408 3300025735 Ga0207713_1010707 Ga0207713_10107072 370
409 3300025904 Ga0207647_10011447 Ga0207647_100114473 370
410 3300025937 Ga0207669_10008954 Ga0207669_100089543 370
411 3300025938 Ga0207704_10005345 Ga0207704_100053452 370
412 3300025940 Ga0207691_10106253 Ga0207691_101062532 370
413 3300025961 Ga0207712_10038851 Ga0207712_100388512 370
414 3300026067 Ga0207678_10032652 Ga0207678_100326521 370
415 3300026089 Ga0207648_10001123 Ga0207648_100011236 370
416 3300026118 Ga0207675_100166478 Ga0207675_1001664782 370
417 3300028381 Ga0268264_10007100 Ga0268264_100071005 370
418 3300030731 Ga0316177_1084301 Ga0316177_10843013 370
419 3300030736 Ga0316180_1145736 Ga0316180_11457363 370
420 3300030745 Ga0316182_1005578 Ga0316182_10055783 370
421 3300032004 Ga0307414_10048541 Ga0307414_100485412 370
422 3300032005 Ga0307411_10006659 Ga0307411_100066595 370
423 3300037471 Ga0395905_0021786 Ga0395905_0021786_2826_3938 370
424 3300044712 Ga0453684_0000193 Ga0453684_0000193_85709_86830 370
425 3300046457 Ga0495590_0009964 Ga0495590_0009964_2064_3176 370
426 3300046477 Ga0495664_0018631 Ga0495664_0018631_1610_2722 370
427 3300046501 Ga0495607_0015241 Ga0495607_0015241_911_2032 370
428 3300046538 Ga0495609_0000110 Ga0495609_0000110_47289_48410 370
429 3300046542 Ga0495597_0002689 Ga0495597_0002689_8117_9229 370
430 3300046543 Ga0495645_0095089 Ga0495645_0095089_660_1772 370
431 3300046660 Ga0495625_0040226 Ga0495625_0040226_1852_2973 370
432 3300046684 Ga0495669_0000598 Ga0495669_0000598_14098_15219 370
433 3300046690 Ga0495624_0015533 Ga0495624_0015533_728_1840 370
434 3300046694 Ga0495649_0052366 Ga0495649_0052366_502_1623 370
435 3300047318 Ga0495636_0010263 Ga0495636_0010263_474_1595 370
436 3300047319 Ga0495674_0131503 Ga0495674_0131503_786_1898 370
437 3300047322 Ga0495680_0017177 Ga0495680_0017177_2981_4093 370
438 3300047322 Ga0495680_0260151 Ga0495680_0260151_67_1179 370
439 3300047443 Ga0495687_065664 Ga0495687_065664_236_1357 370
440 3300047446 Ga0495679_013858 Ga0495679_013858_1823_2944 370
441 3300047447 Ga0495685_006655 Ga0495685_006655_2641_3762 370
442 3300047447 Ga0495685_064024 Ga0495685_064024_70_1191 370
443 3300047470 Ga0495681_0013150 Ga0495681_0013150_2579_3700 370
444 3300047673 Ga0495593_0015255 Ga0495593_0015255_1065_2177 370
445 3300048905 Ga0496102_0067864 Ga0496102_0067864_813_1925 370
446 3300048906 Ga0496103_0012509 Ga0496103_0012509_2128_3240 370
447 3300048907 Ga0496104_0060011 Ga0496104_0060011_1820_2932 370
448 3300048908 Ga0496105_0085793 Ga0496105_0085793_435_1547 370
449 3300048913 Ga0496110_0001139 Ga0496110_0001139_15589_16701 370
450 3300048914 Ga0496111_0016215 Ga0496111_0016215_2247_3359 370
451 3300048915 Ga0496112_0025900 Ga0496112_0025900_4359_5471 370
452 3300048916 Ga0496113_0015185 Ga0496113_0015185_3878_4990 370
453 3300048919 Ga0496116_0011621 Ga0496116_0011621_1904_3016 370
454 3300048924 Ga0496121_0012852 Ga0496121_0012852_5475_6587 370
455 3300048925 Ga0496122_0005543 Ga0496122_0005543_5758_6870 370
456 3300048929 Ga0496126_0117942 Ga0496126_0117942_814_1926 370
457 3300049523 Ga0501300_005419 Ga0501300_005419_562_1677 370
458 3300049651 Ga0501201_000825 Ga0501201_000825_855_1970 370
459 3300049658 Ga0501211_000079 Ga0501211_000079_1903_3018 370
460 3300049662 Ga0501222_001066 Ga0501222_001066_1627_2742 370
461 3300049668 Ga0501233_000690 Ga0501233_000690_409_1524 370
462 3300049679 Ga0501249_006134 Ga0501249_006134_886_2007 370
463 3300049683 Ga0501253_015142 Ga0501253_015142_76_1191 370
464 3300049684 Ga0501255_000839 Ga0501255_000839_1118_2233 370
465 3300049704 Ga0501221_000470 Ga0501221_000470_3503_4618 370
466 3300049757 Ga0501232_003431 Ga0501232_003431_13_1128 370
467 3300049759 Ga0501262_002795 Ga0501262_002795_269_1384 370
468 3300049769 Ga0501272_000733 Ga0501272_000733_1197_2312 370
469 iso_pu_bacteria 2643221585 2643935710 370
470 iso_pu_bacteria 2643221656 2644317493 370
471 3300001989 JGI24739J22299_10003401 JGI24739J22299_100034013 371
472 3300001989 JGI24739J22299_10004196 JGI24739J22299_100041965 371
473 3300001990 JGI24737J22298_10003060 JGI24737J22298_100030603 371
474 3300002067 JGI24735J21928_10000495 JGI24735J21928_100004953 371
475 3300002067 JGI24735J21928_10002748 JGI24735J21928_100027482 371
476 3300002067 JGI24735J21928_10004710 JGI24735J21928_100047103 371
477 3300002067 JGI24735J21928_10006897 JGI24735J21928_100068972 371
478 3300002075 JGI24738J21930_10000758 JGI24738J21930_100007586 371
479 3300002705 JGI25156J39149_1002277 JGI25156J39149_10022774 371
480 3300003322 rootL2_10277707 rootL2_102777072 371
481 3300003323 rootH1_10023956 rootH1_100239561 371
482 3300003354 JGI25160J50197_1000016 JGI25160J50197_1000016124 371
483 3300003758 Ga0055532_1000022 Ga0055532_100002232 371
484 3300003758 Ga0055532_1000761 Ga0055532_10007618 371
485 3300003760 Ga0055527_1000016 Ga0055527_100001632 371
486 3300003760 Ga0055527_1000604 Ga0055527_10006048 371
487 3300003760 Ga0055527_1000990 Ga0055527_10009905 371
488 3300003761 Ga0055535_1000017 Ga0055535_100001732 371
489 3300003761 Ga0055535_1001501 Ga0055535_10015017 371
490 3300003761 Ga0055535_1001507 Ga0055535_10015078 371
491 3300003762 Ga0055542_1000030 Ga0055542_1000030207 371
492 3300003762 Ga0055542_1001136 Ga0055542_10011367 371
493 3300003762 Ga0055542_1002027 Ga0055542_10020273 371
494 3300003763 Ga0055529_1000033 Ga0055529_1000033207 371
495 3300003763 Ga0055529_1000688 Ga0055529_100068815 371
496 3300003771 Ga0055526_1001869 Ga0055526_100186913 371
497 3300003773 Ga0055537_1000191 Ga0055537_10001915 371
498 3300003784 Ga0055534_1000051 Ga0055534_100005175 371
499 3300003790 Ga0055528_1000174 Ga0055528_100017427 371
500 3300003841 Ga0055541_1012002 Ga0055541_10120021 371
501 3300003856 Ga0058692_1000568 Ga0058692_10005686 371
502 3300005262 Ga0065165_1000875 Ga0065165_10008759 371
503 3300005327 Ga0070658_10033012 Ga0070658_100330124 371
504 3300005327 Ga0070658_10264974 Ga0070658_102649742 371
505 3300005339 Ga0070660_100000108 Ga0070660_10000010840 371
506 3300005344 Ga0070661_100049980 Ga0070661_1000499802 371
507 3300005366 Ga0070659_100000070 Ga0070659_10000007028 371
508 3300005367 Ga0070667_100009565 Ga0070667_1000095656 371
509 3300005455 Ga0070663_100000496 Ga0070663_1000004964 371
510 3300005455 Ga0070663_100003045 Ga0070663_1000030453 371
511 3300005456 Ga0070678_100105428 Ga0070678_1001054282 371
512 3300005548 Ga0070665_100178582 Ga0070665_1001785821 371
513 3300005563 Ga0068855_100029356 Ga0068855_1000293562 371
514 3300005563 Ga0068855_100109969 Ga0068855_1001099692 371
515 3300005616 Ga0068852_100016151 Ga0068852_1000161513 371
516 3300009011 Ga0105251_10000324 Ga0105251_100003242 371
517 3300009011 Ga0105251_10034380 Ga0105251_100343801 371
518 3300009092 Ga0105250_10001043 Ga0105250_100010437 371
519 3300009093 Ga0105240_10019691 Ga0105240_100196912 371
520 3300009177 Ga0105248_10006077 Ga0105248_100060773 371
521 3300009177 Ga0105248_10182053 Ga0105248_101820531 371
522 3300009551 Ga0105238_10066755 Ga0105238_100667552 371
523 3300010375 Ga0105239_10201891 Ga0105239_102018912 371
524 3300013105 Ga0157369_10063750 Ga0157369_100637501 371
525 3300013105 Ga0157369_10105783 Ga0157369_101057833 371
526 3300013306 Ga0163162_10011991 Ga0163162_100119914 371
527 3300013306 Ga0163162_10034105 Ga0163162_100341054 371
528 3300016635 Ga0183361_10001 Ga0183361_10001607 371
529 3300025206 Ga0209435_101584 Ga0209435_1015843 371
530 3300025225 Ga0209566_100244 Ga0209566_1002444 371
531 3300025226 Ga0209674_100017 Ga0209674_100017355 371
532 3300025226 Ga0209674_100291 Ga0209674_1002913 371
533 3300025226 Ga0209674_102227 Ga0209674_1022273 371
534 3300025228 Ga0209672_100001 Ga0209672_1000012299 371
535 3300025228 Ga0209672_100115 Ga0209672_10011532 371
536 3300025228 Ga0209672_100136 Ga0209672_10013637 371
537 3300025229 Ga0209147_100022 Ga0209147_100022209 371
538 3300025229 Ga0209147_100164 Ga0209147_10016436 371
539 3300025229 Ga0209147_100215 Ga0209147_10021532 371
540 3300025230 Ga0209563_100603 Ga0209563_1006037 371
541 3300025231 Ga0207427_102931 Ga0207427_1029313 371
542 3300025242 Ga0209258_100033 Ga0209258_100033204 371
543 3300025242 Ga0209258_100261 Ga0209258_10026137 371
544 3300025242 Ga0209258_100271 Ga0209258_10027132 371
545 3300025254 Ga0209148_1000046 Ga0209148_1000046210 371
546 3300025254 Ga0209148_1000104 Ga0209148_100010462 371
547 3300025254 Ga0209148_1000609 Ga0209148_10006094 371
548 3300025256 Ga0209759_1000180 Ga0209759_100018057 371
549 3300025256 Ga0209759_1000231 Ga0209759_100023146 371
550 3300025256 Ga0209759_1000568 Ga0209759_100056829 371
551 3300025261 Ga0209233_1000050 Ga0209233_1000050210 371
552 3300025263 Ga0209565_1000017 Ga0209565_1000017188 371
553 3300025263 Ga0209565_1004992 Ga0209565_10049922 371
554 3300025272 Ga0209455_1000038 Ga0209455_1000038210 371
555 3300025272 Ga0209455_1000097 Ga0209455_1000097137 371
556 3300025272 Ga0209455_1001610 Ga0209455_10016103 371
557 3300025273 Ga0209673_1000007 Ga0209673_1000007241 371
558 3300025273 Ga0209673_1000124 Ga0209673_100012461 371
559 3300025291 Ga0209675_1000009 Ga0209675_1000009277 371
560 3300025295 Ga0209564_1000036 Ga0209564_1000036241 371
561 3300025295 Ga0209564_1000055 Ga0209564_1000055212 371
562 3300025295 Ga0209564_1006074 Ga0209564_10060743 371
563 3300025295 Ga0209564_1008762 Ga0209564_10087622 371
564 3300025299 Ga0209256_1000167 Ga0209256_100016756 371
565 3300025302 Ga0207426_1000007 Ga0207426_1000007646 371
566 3300025711 Ga0207696_1002613 Ga0207696_10026133 371
567 3300025735 Ga0207713_1000064 Ga0207713_1000064126 371
568 3300025901 Ga0207688_10130275 Ga0207688_101302751 371
569 3300025904 Ga0207647_10001680 Ga0207647_100016803 371
570 3300025904 Ga0207647_10002319 Ga0207647_100023196 371
571 3300025904 Ga0207647_10011897 Ga0207647_100118973 371
572 3300025909 Ga0207705_10028057 Ga0207705_100280573 371
573 3300025913 Ga0207695_10008234 Ga0207695_1000823411 371
574 3300025913 Ga0207695_10009754 Ga0207695_100097544 371
575 3300025913 Ga0207695_10047753 Ga0207695_100477532 371
576 3300025919 Ga0207657_10000183 Ga0207657_1000018354 371
577 3300025924 Ga0207694_10019921 Ga0207694_100199213 371
578 3300025932 Ga0207690_10000012 Ga0207690_10000012199 371
579 3300025941 Ga0207711_10063159 Ga0207711_100631593 371
580 3300025986 Ga0207658_10039833 Ga0207658_100398332 371
581 3300025986 Ga0207658_10173798 Ga0207658_101737982 371
582 3300026035 Ga0207703_10032912 Ga0207703_100329122 371
583 3300026067 Ga0207678_10000076 Ga0207678_1000007641 371
584 3300026067 Ga0207678_10004352 Ga0207678_100043527 371
585 3300026067 Ga0207678_10008226 Ga0207678_100082262 371
586 3300026078 Ga0207702_10052435 Ga0207702_100524352 371
587 3300026121 Ga0207683_10147890 Ga0207683_101478902 371
588 3300026142 Ga0207698_10031168 Ga0207698_100311683 371
589 3300027312 Ga0209371_1000185 Ga0209371_100018562 371
590 3300027312 Ga0209371_1008576 Ga0209371_10085762 371
591 3300028800 Ga0265338_10000187 Ga0265338_1000018765 371
592 3300030500 Ga0268256_1000211 Ga0268256_100021162 371
593 3300030500 Ga0268256_1005547 Ga0268256_10055472 371
594 3300031548 Ga0307408_100000463 Ga0307408_1000004636 371
595 3300031911 Ga0307412_10000011 Ga0307412_10000011206 371
596 3300032002 Ga0307416_100057331 Ga0307416_1000573313 371
597 3300037471 Ga0395905_0000079 Ga0395905_0000079_124958_126073 371
598 3300039437 Ga0436365_0245511 Ga0436365_0245511_1007_2122 371
599 3300039447 Ga0436361_0093744 Ga0436361_0093744_3526_4641 371
600 3300042876 Ga0451577_0069542 Ga0451577_0069542_1033_2154 371
601 3300044673 Ga0453683_0016909 Ga0453683_0016909_2542_3663 371
602 3300044684 Ga0466966_0043405 Ga0466966_0043405_1649_2764 371
603 3300045051 Ga0451576_0009113 Ga0451576_0009113_1234_2355 371
604 3300045051 Ga0451576_0035379 Ga0451576_0035379_4018_5139 371
605 3300046454 Ga0495592_0005288 Ga0495592_0005288_4506_5621 371
606 3300046454 Ga0495592_0014560 Ga0495592_0014560_2851_3966 371
607 3300046455 Ga0495603_0000867 Ga0495603_0000867_15648_16763 371
608 3300046455 Ga0495603_0027090 Ga0495603_0027090_59_1174 371
609 3300046457 Ga0495590_0004382 Ga0495590_0004382_1739_2854 371
610 3300046458 Ga0495591_001869 Ga0495591_001869_2828_3943 371
611 3300046459 Ga0495629_0000178 Ga0495629_0000178_38515_39630 371
612 3300046459 Ga0495629_0000285 Ga0495629_0000285_29231_30346 371
613 3300046459 Ga0495629_0001888 Ga0495629_0001888_12886_14001 371
614 3300046459 Ga0495629_0002120 Ga0495629_0002120_4734_5849 371
615 3300046460 Ga0495638_0000945 Ga0495638_0000945_9453_10568 371
616 3300046460 Ga0495638_0007524 Ga0495638_0007524_2396_3520 371
617 3300046461 Ga0495641_0005571 Ga0495641_0005571_4601_5716 371
618 3300046462 Ga0495651_0011625 Ga0495651_0011625_3285_4400 371
619 3300046462 Ga0495651_0015143 Ga0495651_0015143_4665_5780 371
620 3300046462 Ga0495651_0125527 Ga0495651_0125527_654_1769 371
621 3300046463 Ga0495653_0003463 Ga0495653_0003463_1709_2824 371
622 3300046463 Ga0495653_0049525 Ga0495653_0049525_1271_2386 371
623 3300046463 Ga0495653_0080085 Ga0495653_0080085_63_1178 371
624 3300046463 Ga0495653_0166329 Ga0495653_0166329_257_1372 371
625 3300046471 Ga0495650_0015319 Ga0495650_0015319_1847_2962 371
626 3300046471 Ga0495650_0021095 Ga0495650_0021095_54_1169 371
627 3300046472 Ga0495580_0000001 Ga0495580_0000001_171136_172251 371
628 3300046472 Ga0495580_0010297 Ga0495580_0010297_4397_5512 371
629 3300046472 Ga0495580_0011524 Ga0495580_0011524_1900_3015 371
630 3300046473 Ga0495582_0001582 Ga0495582_0001582_6297_7412 371
631 3300046473 Ga0495582_0005649 Ga0495582_0005649_2644_3759 371
632 3300046473 Ga0495582_0013662 Ga0495582_0013662_136_1251 371
633 3300046474 Ga0495605_0002871 Ga0495605_0002871_572_1687 371
634 3300046474 Ga0495605_0003749 Ga0495605_0003749_4977_6092 371
635 3300046477 Ga0495664_0001897 Ga0495664_0001897_2639_3754 371
636 3300046500 Ga0495596_0006065 Ga0495596_0006065_3976_5091 371
637 3300046500 Ga0495596_0030815 Ga0495596_0030815_978_2093 371
638 3300046501 Ga0495607_0034340 Ga0495607_0034340_370_1494 371
639 3300046501 Ga0495607_0058904 Ga0495607_0058904_830_1945 371
640 3300046506 Ga0495583_0015715 Ga0495583_0015715_2619_3734 371
641 3300046506 Ga0495583_0073904 Ga0495583_0073904_166_1281 371
642 3300046507 Ga0495606_0012318 Ga0495606_0012318_2311_3426 371
643 3300046507 Ga0495606_0048740 Ga0495606_0048740_51_1166 371
644 3300046511 Ga0495608_0009419 Ga0495608_0009419_3206_4321 371
645 3300046511 Ga0495608_0017053 Ga0495608_0017053_422_1537 371
646 3300046512 Ga0495610_0005396 Ga0495610_0005396_5415_6530 371
647 3300046514 Ga0495618_0007168 Ga0495618_0007168_4740_5855 371
648 3300046514 Ga0495618_0013665 Ga0495618_0013665_269_1384 371
649 3300046516 Ga0495628_0001900 Ga0495628_0001900_12460_13575 371
650 3300046516 Ga0495628_0032607 Ga0495628_0032607_2472_3587 371
651 3300046516 Ga0495628_0117777 Ga0495628_0117777_481_1596 371
652 3300046517 Ga0495630_0007017 Ga0495630_0007017_6817_7932 371
653 3300046517 Ga0495630_0014192 Ga0495630_0014192_2903_4018 371
654 3300046517 Ga0495630_0051251 Ga0495630_0051251_1366_2481 371
655 3300046517 Ga0495630_0182640 Ga0495630_0182640_350_1465 371
656 3300046519 Ga0495632_0007437 Ga0495632_0007437_1724_2848 371
657 3300046524 Ga0495648_0011159 Ga0495648_0011159_384_1499 371
658 3300046524 Ga0495648_0067678 Ga0495648_0067678_858_1973 371
659 3300046526 Ga0495666_0001627 Ga0495666_0001627_5385_6500 371
660 3300046526 Ga0495666_0002374 Ga0495666_0002374_4020_5144 371
661 3300046526 Ga0495666_0006592 Ga0495666_0006592_2063_3178 371
662 3300046526 Ga0495666_0008866 Ga0495666_0008866_2568_3683 371
663 3300046528 Ga0495642_0006928 Ga0495642_0006928_2889_4013 371
664 3300046529 Ga0495652_0013316 Ga0495652_0013316_4507_5622 371
665 3300046529 Ga0495652_0054241 Ga0495652_0054241_1639_2754 371
666 3300046531 Ga0495665_0006958 Ga0495665_0006958_4094_5209 371
667 3300046531 Ga0495665_0009119 Ga0495665_0009119_1693_2808 371
668 3300046531 Ga0495665_0051567 Ga0495665_0051567_189_1304 371
669 3300046531 Ga0495665_0073064 Ga0495665_0073064_292_1407 371
670 3300046533 Ga0495640_0004099 Ga0495640_0004099_576_1691 371
671 3300046533 Ga0495640_0005465 Ga0495640_0005465_6289_7404 371
672 3300046533 Ga0495640_0008491 Ga0495640_0008491_3863_4978 371
673 3300046533 Ga0495640_0032792 Ga0495640_0032792_364_1488 371
674 3300046535 Ga0495586_0019439 Ga0495586_0019439_386_1501 371
675 3300046536 Ga0495587_0018997 Ga0495587_0018997_444_1559 371
676 3300046538 Ga0495609_0008283 Ga0495609_0008283_1678_2802 371
677 3300046543 Ga0495645_0003031 Ga0495645_0003031_3530_4645 371
678 3300046557 Ga0495622_0000075 Ga0495622_0000075_17956_19071 371
679 3300046559 Ga0495667_0027758 Ga0495667_0027758_2214_3329 371
680 3300046616 Ga0495668_0030610 Ga0495668_0030610_1262_2386 371
681 3300046642 Ga0495634_0001455 Ga0495634_0001455_2362_3477 371
682 3300046642 Ga0495634_0013434 Ga0495634_0013434_4229_5344 371
683 3300046648 Ga0495611_0000376 Ga0495611_0000376_7812_8936 371
684 3300046648 Ga0495611_0015073 Ga0495611_0015073_25_1140 371
685 3300046663 Ga0495635_0001789 Ga0495635_0001789_3443_4558 371
686 3300046663 Ga0495635_0013372 Ga0495635_0013372_3187_4302 371
687 3300046665 Ga0495661_0003522 Ga0495661_0003522_6896_8011 371
688 3300046665 Ga0495661_0058289 Ga0495661_0058289_100_1215 371
689 3300046678 Ga0495599_0002742 Ga0495599_0002742_7657_8772 371
690 3300046678 Ga0495599_0021770 Ga0495599_0021770_2588_3703 371
691 3300046679 Ga0495623_0001396 Ga0495623_0001396_12060_13175 371
692 3300046679 Ga0495623_0019259 Ga0495623_0019259_533_1648 371
693 3300046679 Ga0495623_0028769 Ga0495623_0028769_737_1852 371
694 3300046679 Ga0495623_0140067 Ga0495623_0140067_138_1253 371
695 3300046680 Ga0495646_0001118 Ga0495646_0001118_3346_4461 371
696 3300046680 Ga0495646_0016250 Ga0495646_0016250_349_1464 371
697 3300046680 Ga0495646_0032109 Ga0495646_0032109_807_1922 371
698 3300046680 Ga0495646_0033623 Ga0495646_0033623_1351_2466 371
699 3300046684 Ga0495669_0008372 Ga0495669_0008372_149_1264 371
700 3300046689 Ga0495613_0003533 Ga0495613_0003533_2955_4070 371
701 3300046689 Ga0495613_0013125 Ga0495613_0013125_4598_5713 371
702 3300046690 Ga0495624_0018907 Ga0495624_0018907_1342_2457 371
703 3300046690 Ga0495624_0027815 Ga0495624_0027815_223_1338 371
704 3300046690 Ga0495624_0072286 Ga0495624_0072286_609_1724 371
705 3300046692 Ga0495671_0026082 Ga0495671_0026082_180_1295 371
706 3300046692 Ga0495671_0036103 Ga0495671_0036103_1369_2484 371
707 3300046794 Ga0495589_0016187 Ga0495589_0016187_1435_2550 371
708 3300046809 Ga0495600_0000510 Ga0495600_0000510_1914_3029 371
709 3300046809 Ga0495600_0005990 Ga0495600_0005990_4539_5654 371
710 3300046809 Ga0495600_0148196 Ga0495600_0148196_79_1194 371
711 3300047315 Ga0495581_0004434 Ga0495581_0004434_2356_3471 371
712 3300047315 Ga0495581_0016557 Ga0495581_0016557_1895_3010 371
713 3300047317 Ga0495604_0000854 Ga0495604_0000854_7554_8669 371
714 3300047317 Ga0495604_0007320 Ga0495604_0007320_5247_6362 371
715 3300047317 Ga0495604_0017852 Ga0495604_0017852_3824_4939 371
716 3300047319 Ga0495674_0039283 Ga0495674_0039283_636_1751 371
717 3300047319 Ga0495674_0062982 Ga0495674_0062982_1781_2896 371
718 3300047319 Ga0495674_0080830 Ga0495674_0080830_1102_2217 371
719 3300047320 Ga0495672_0021041 Ga0495672_0021041_1618_2733 371
720 3300047321 Ga0495676_0006502 Ga0495676_0006502_2776_3891 371
721 3300047322 Ga0495680_0015543 Ga0495680_0015543_3009_4124 371
722 3300047322 Ga0495680_0032120 Ga0495680_0032120_1833_2948 371
723 3300047322 Ga0495680_0053360 Ga0495680_0053360_623_1738 371
724 3300047323 Ga0495683_0006408 Ga0495683_0006408_4696_5811 371
725 3300047323 Ga0495683_0009633 Ga0495683_0009633_3022_4137 371
726 3300047323 Ga0495683_0047557 Ga0495683_0047557_372_1487 371
727 3300047323 Ga0495683_0063414 Ga0495683_0063414_694_1809 371
728 3300047443 Ga0495687_000053 Ga0495687_000053_142522_143637 371
729 3300047443 Ga0495687_005143 Ga0495687_005143_6728_7843 371
730 3300047443 Ga0495687_005425 Ga0495687_005425_2559_3674 371
731 3300047443 Ga0495687_015073 Ga0495687_015073_135_1250 371
732 3300047444 Ga0495675_0008503 Ga0495675_0008503_609_1724 371
733 3300047444 Ga0495675_0009650 Ga0495675_0009650_204_1319 371
734 3300047444 Ga0495675_0017405 Ga0495675_0017405_1269_2384 371
735 3300047444 Ga0495675_0022719 Ga0495675_0022719_494_1609 371
736 3300047446 Ga0495679_000156 Ga0495679_000156_37448_38563 371
737 3300047446 Ga0495679_000453 Ga0495679_000453_4497_5612 371
738 3300047446 Ga0495679_000509 Ga0495679_000509_14908_16023 371
739 3300047447 Ga0495685_011400 Ga0495685_011400_824_1948 371
740 3300047469 Ga0495673_0011035 Ga0495673_0011035_920_2035 371
741 3300047469 Ga0495673_0025556 Ga0495673_0025556_1084_2199 371
742 3300047471 Ga0495684_0012061 Ga0495684_0012061_3362_4477 371
743 3300047471 Ga0495684_0032107 Ga0495684_0032107_2234_3349 371
744 3300047472 Ga0495686_0000374 Ga0495686_0000374_67516_68631 371
745 3300047673 Ga0495593_0002194 Ga0495593_0002194_6171_7286 371
746 3300047673 Ga0495593_0006680 Ga0495593_0006680_1409_2524 371
747 3300047673 Ga0495593_0007784 Ga0495593_0007784_880_1995 371
748 3300047673 Ga0495593_0018949 Ga0495593_0018949_1381_2496 371
749 3300048088 Ga0495602_0012983 Ga0495602_0012983_3476_4591 371
750 3300048088 Ga0495602_0030419 Ga0495602_0030419_2225_3340 371
751 3300048088 Ga0495602_0092244 Ga0495602_0092244_29_1144 371
752 3300048089 Ga0495614_0000783 Ga0495614_0000783_6688_7803 371
753 3300048089 Ga0495614_0005325 Ga0495614_0005325_4662_5777 371
754 3300048091 Ga0495626_0050272 Ga0495626_0050272_558_1673 371
755 3300048904 Ga0496101_0031754 Ga0496101_0031754_2004_3119 371
756 3300048905 Ga0496102_0001543 Ga0496102_0001543_1224_2339 371
757 3300048905 Ga0496102_0027708 Ga0496102_0027708_193_1308 371
758 3300048906 Ga0496103_0002496 Ga0496103_0002496_9291_10406 371
759 3300048906 Ga0496103_0005279 Ga0496103_0005279_367_1482 371
760 3300048909 Ga0496106_0000432 Ga0496106_0000432_11569_12684 371
761 3300048909 Ga0496106_0228507 Ga0496106_0228507_333_1448 371
762 3300048910 Ga0496107_0031164 Ga0496107_0031164_2312_3427 371
763 3300048915 Ga0496112_0279718 Ga0496112_0279718_330_1445 371
764 3300048916 Ga0496113_0011257 Ga0496113_0011257_2026_3141 371
765 3300048917 Ga0496114_0179791 Ga0496114_0179791_363_1478 371
766 3300048918 Ga0496115_0170008 Ga0496115_0170008_358_1473 371
767 3300048919 Ga0496116_0027112 Ga0496116_0027112_1992_3107 371
768 3300048920 Ga0496117_0002566 Ga0496117_0002566_18633_19748 371
769 3300048920 Ga0496117_0005210 Ga0496117_0005210_3147_4262 371
770 3300048920 Ga0496117_0007716 Ga0496117_0007716_4086_5201 371
771 3300048920 Ga0496117_0067616 Ga0496117_0067616_572_1687 371
772 3300048921 Ga0496118_0002656 Ga0496118_0002656_17912_19027 371
773 3300048921 Ga0496118_0004550 Ga0496118_0004550_7621_8736 371
774 3300048921 Ga0496118_0056467 Ga0496118_0056467_1283_2398 371
775 3300048924 Ga0496121_0002254 Ga0496121_0002254_10597_11781 371
776 3300048924 Ga0496121_0006277 Ga0496121_0006277_9783_10898 371
777 3300048924 Ga0496121_0021795 Ga0496121_0021795_1817_2932 371
778 3300048925 Ga0496122_0072569 Ga0496122_0072569_1090_2205 371
779 3300048927 Ga0496124_0000079 Ga0496124_0000079_83742_84860 371
780 3300048928 Ga0496125_0047293 Ga0496125_0047293_2439_3557 371
781 3300048929 Ga0496126_0000118 Ga0496126_0000118_30806_31921 371
782 3300048929 Ga0496126_0001912 Ga0496126_0001912_18166_19281 371
783 3300048929 Ga0496126_0004117 Ga0496126_0004117_13600_14715 371
784 3300048929 Ga0496126_0007469 Ga0496126_0007469_2471_3586 371
785 3300048929 Ga0496126_0012774 Ga0496126_0012774_6746_7930 371
786 3300049460 Ga0495682_0012560 Ga0495682_0012560_1012_2136 371
787 iso_pu_bacteria 2808606418 2809144230 371
788 3300002067 JGI24735J21928_10000604 JGI24735J21928_1000060411 372
789 3300005327 Ga0070658_10002494 Ga0070658_100024946 372
790 3300005327 Ga0070658_10035402 Ga0070658_100354024 372
791 3300005339 Ga0070660_100002533 Ga0070660_10000253310 372
792 3300005339 Ga0070660_100068203 Ga0070660_1000682031 372
793 3300005366 Ga0070659_100033866 Ga0070659_1000338662 372
794 3300005563 Ga0068855_100002049 Ga0068855_10000204922 372
795 3300009093 Ga0105240_10002436 Ga0105240_1000243629 372
796 3300009545 Ga0105237_10001786 Ga0105237_1000178619 372
797 3300010375 Ga0105239_10001217 Ga0105239_100012174 372
798 3300013100 Ga0157373_10013675 Ga0157373_100136754 372
799 3300013104 Ga0157370_10000900 Ga0157370_1000090025 372
800 3300013104 Ga0157370_10014987 Ga0157370_100149873 372
801 3300013104 Ga0157370_10042205 Ga0157370_100422054 372
802 3300013105 Ga0157369_10000304 Ga0157369_1000030435 372
803 3300013105 Ga0157369_10001395 Ga0157369_100013952 372
804 3300013105 Ga0157369_10001472 Ga0157369_100014729 372
805 3300013296 Ga0157374_10001412 Ga0157374_100014126 372
806 3300013307 Ga0157372_10012810 Ga0157372_100128109 372
807 3300014497 Ga0182008_10030084 Ga0182008_100300842 372
808 3300022467 Ga0224712_10000838 Ga0224712_100008385 372
809 3300025228 Ga0209672_101102 Ga0209672_1011025 372
810 3300025256 Ga0209759_1002276 Ga0209759_10022766 372
811 3300025904 Ga0207647_10000160 Ga0207647_1000016037 372
812 3300025909 Ga0207705_10000377 Ga0207705_100003775 372
813 3300025909 Ga0207705_10133170 Ga0207705_101331701 372
814 3300025913 Ga0207695_10011993 Ga0207695_100119934 372
815 3300025919 Ga0207657_10024202 Ga0207657_100242023 372
816 3300025932 Ga0207690_10018067 Ga0207690_100180672 372
817 3300025949 Ga0207667_10000889 Ga0207667_1000088912 372
818 3300025949 Ga0207667_10003325 Ga0207667_100033255 372
819 3300037312 Ga0395899_0000093 Ga0395899_0000093_119647_120774 372
820 3300037312 Ga0395899_0000149 Ga0395899_0000149_36274_37392 372
821 3300037312 Ga0395899_0000802 Ga0395899_0000802_22758_23876 372
822 3300037418 Ga0395900_0000169 Ga0395900_0000169_68567_69685 372
823 3300037418 Ga0395900_0001006 Ga0395900_0001006_4327_5502 372
824 3300037418 Ga0395900_0036169 Ga0395900_0036169_1253_2371 372
825 3300037418 Ga0395900_0048251 Ga0395900_0048251_1113_2231 372
826 3300037418 Ga0395900_0064826 Ga0395900_0064826_2328_3446 372
827 3300037466 Ga0395898_0000338 Ga0395898_0000338_36270_37388 372
828 3300037466 Ga0395898_0006942 Ga0395898_0006942_4568_5686 372
829 3300037466 Ga0395898_0053289 Ga0395898_0053289_1829_2947 372
830 3300037466 Ga0395898_0067730 Ga0395898_0067730_494_1612 372
831 3300037466 Ga0395898_0094911 Ga0395898_0094911_1427_2563 372
832 3300038443 Ga0395901_0000017 Ga0395901_0000017_85192_86409 372
833 3300038443 Ga0395901_0001099 Ga0395901_0001099_5469_6626 372
834 3300038443 Ga0395901_0009132 Ga0395901_0009132_4516_5652 372
835 3300038443 Ga0395901_0165706 Ga0395901_0165706_1120_2238 372
836 3300042005 Ga0439448_0000325 Ga0439448_0000325_7144_8262 372
837 3300042139 Ga0450904_000600 Ga0450904_000600_4944_6071 372
838 3300044656 Ga0466969_0084910 Ga0466969_0084910_128_1246 372
839 3300044684 Ga0466966_0000277 Ga0466966_0000277_6423_7541 372
840 3300044684 Ga0466966_0002148 Ga0466966_0002148_6788_7906 372
841 3300044684 Ga0466966_0002376 Ga0466966_0002376_150_1268 372
842 3300044684 Ga0466966_0020096 Ga0466966_0020096_1633_2751 372
843 3300044693 Ga0466961_0000344 Ga0466961_0000344_11134_12252 372
844 3300044693 Ga0466961_0004968 Ga0466961_0004968_360_1478 372
845 3300044693 Ga0466961_0007588 Ga0466961_0007588_2137_3255 372
846 3300044694 Ga0466963_0000554 Ga0466963_0000554_12820_13938 372
847 3300044719 Ga0466971_0000270 Ga0466971_0000270_336_1454 372
848 3300044719 Ga0466971_0006464 Ga0466971_0006464_1704_2822 372
849 3300044735 Ga0466968_0010283 Ga0466968_0010283_2180_3298 372
850 3300044765 Ga0466970_0004253 Ga0466970_0004253_4534_5652 372
851 3300044842 Ga0466957_0001982 Ga0466957_0001982_7573_8691 372
852 3300044842 Ga0466957_0056022 Ga0466957_0056022_767_1885 372
853 3300045049 Ga0466959_0007383 Ga0466959_0007383_3213_4331 372
854 3300045836 Ga0466958_0007390 Ga0466958_0007390_2841_3959 372
855 3300045836 Ga0466958_0009629 Ga0466958_0009629_1952_3070 372
856 3300046491 Ga0495584_0002846 Ga0495584_0002846_2467_3594 372
857 3300046491 Ga0495584_0050473 Ga0495584_0050473_653_1780 372
858 3300046499 Ga0495594_0002589 Ga0495594_0002589_4543_5670 372
859 3300046499 Ga0495594_0003551 Ga0495594_0003551_4819_5946 372
860 3300046507 Ga0495606_0006662 Ga0495606_0006662_3828_4955 372
861 3300046542 Ga0495597_0000579 Ga0495597_0000579_15295_16422 372
862 3300046557 Ga0495622_0019672 Ga0495622_0019672_10_1137 372
863 3300046559 Ga0495667_0119081 Ga0495667_0119081_330_1457 372
864 3300046616 Ga0495668_0009745 Ga0495668_0009745_3546_4673 372
865 3300046674 Ga0495588_0102827 Ga0495588_0102827_34_1161 372
866 3300046691 Ga0495670_0006409 Ga0495670_0006409_1571_2698 372
867 3300046691 Ga0495670_0079364 Ga0495670_0079364_158_1285 372
868 3300046692 Ga0495671_0035134 Ga0495671_0035134_1188_2315 372
869 3300047317 Ga0495604_0128199 Ga0495604_0128199_455_1582 372
870 3300047318 Ga0495636_0012275 Ga0495636_0012275_902_2029 372
871 3300047319 Ga0495674_0112723 Ga0495674_0112723_651_1778 372
872 3300047321 Ga0495676_0033173 Ga0495676_0033173_1063_2190 372
873 3300047444 Ga0495675_0213444 Ga0495675_0213444_30_1157 372
874 3300047673 Ga0495593_0018108 Ga0495593_0018108_510_1637 372
875 3300048091 Ga0495626_0011758 Ga0495626_0011758_951_2078 372
876 3300049579 Ga0501043_0000072 Ga0501043_0000072_75797_76927 372
877 3300049580 Ga0501046_0000112 Ga0501046_0000112_73148_74278 372
878 3300049581 Ga0501047_0000138 Ga0501047_0000138_12095_13225 372
879 3300049582 Ga0501048_0001221 Ga0501048_0001221_13249_14379 372
880 3300049824 Ga0501045_0001874 Ga0501045_0001874_7808_8938 372
881 3300061719 Ga0466962_0000108 Ga0466962_0000108_4937_6055 372
882 3300061719 Ga0466962_0000704 Ga0466962_0000704_13223_14341 372
883 3300061719 Ga0466962_0001877 Ga0466962_0001877_2145_3263 372
884 3300005262 Ga0065165_1000677 Ga0065165_100067725 373
885 3300028800 Ga0265338_10000590 Ga0265338_1000059040 373
886 3300037068 Ga0373925_0001962 Ga0373925_0001962_2514_3635 373
887 3300042876 Ga0451577_0009948 Ga0451577_0009948_5817_6941 373
888 3300044684 Ga0466966_0008254 Ga0466966_0008254_4266_5402 373
889 3300046452 Ga0495617_000002 Ga0495617_000002_181327_182457 373
890 3300046452 Ga0495617_000210 Ga0495617_000210_17846_18976 373
891 3300046453 Ga0495627_000176 Ga0495627_000176_4196_5326 373
892 3300046457 Ga0495590_0000044 Ga0495590_0000044_33292_34422 373
893 3300046458 Ga0495591_000052 Ga0495591_000052_12109_13239 373
894 3300046458 Ga0495591_009331 Ga0495591_009331_763_1893 373
895 3300046459 Ga0495629_0003648 Ga0495629_0003648_7739_8869 373
896 3300046459 Ga0495629_0021875 Ga0495629_0021875_52_1182 373
897 3300046459 Ga0495629_0032812 Ga0495629_0032812_12_1142 373
898 3300046460 Ga0495638_0006104 Ga0495638_0006104_4214_5344 373
899 3300046460 Ga0495638_0127793 Ga0495638_0127793_104_1234 373
900 3300046463 Ga0495653_0002764 Ga0495653_0002764_9911_11041 373
901 3300046463 Ga0495653_0038731 Ga0495653_0038731_149_1279 373
902 3300046472 Ga0495580_0131327 Ga0495580_0131327_462_1592 373
903 3300046474 Ga0495605_0000081 Ga0495605_0000081_115004_116134 373
904 3300046491 Ga0495584_0000011 Ga0495584_0000011_25797_26927 373
905 3300046491 Ga0495584_0000460 Ga0495584_0000460_12109_13239 373
906 3300046491 Ga0495584_0022193 Ga0495584_0022193_15_1145 373
907 3300046491 Ga0495584_0022301 Ga0495584_0022301_1663_2793 373
908 3300046491 Ga0495584_0036884 Ga0495584_0036884_748_1878 373
909 3300046492 Ga0495585_0000004 Ga0495585_0000004_311400_312530 373
910 3300046492 Ga0495585_0000814 Ga0495585_0000814_15967_17097 373
911 3300046492 Ga0495585_0000863 Ga0495585_0000863_3463_4593 373
912 3300046492 Ga0495585_0008368 Ga0495585_0008368_965_2095 373
913 3300046492 Ga0495585_0014155 Ga0495585_0014155_2200_3330 373
914 3300046492 Ga0495585_0037637 Ga0495585_0037637_277_1407 373
915 3300046492 Ga0495585_0089551 Ga0495585_0089551_19_1149 373
916 3300046500 Ga0495596_0000633 Ga0495596_0000633_18344_19474 373
917 3300046500 Ga0495596_0009225 Ga0495596_0009225_854_1984 373
918 3300046500 Ga0495596_0011133 Ga0495596_0011133_2473_3603 373
919 3300046500 Ga0495596_0030977 Ga0495596_0030977_996_2126 373
920 3300046501 Ga0495607_0003451 Ga0495607_0003451_8934_10064 373
921 3300046501 Ga0495607_0010718 Ga0495607_0010718_4357_5487 373
922 3300046506 Ga0495583_0000430 Ga0495583_0000430_13532_14662 373
923 3300046506 Ga0495583_0001408 Ga0495583_0001408_19122_20252 373
924 3300046506 Ga0495583_0010073 Ga0495583_0010073_323_1453 373
925 3300046506 Ga0495583_0049103 Ga0495583_0049103_537_1667 373
926 3300046506 Ga0495583_0062359 Ga0495583_0062359_438_1568 373
927 3300046507 Ga0495606_0028347 Ga0495606_0028347_2361_3491 373
928 3300046512 Ga0495610_0000506 Ga0495610_0000506_4044_5174 373
929 3300046513 Ga0495616_0002294 Ga0495616_0002294_9966_11096 373
930 3300046513 Ga0495616_0004089 Ga0495616_0004089_8046_9176 373
931 3300046515 Ga0495620_0022583 Ga0495620_0022583_708_1838 373
932 3300046518 Ga0495631_0000556 Ga0495631_0000556_14119_15249 373
933 3300046518 Ga0495631_0008026 Ga0495631_0008026_3666_4796 373
934 3300046518 Ga0495631_0012942 Ga0495631_0012942_1595_2725 373
935 3300046518 Ga0495631_0030852 Ga0495631_0030852_780_1910 373
936 3300046518 Ga0495631_0037447 Ga0495631_0037447_597_1727 373
937 3300046518 Ga0495631_0063583 Ga0495631_0063583_251_1381 373
938 3300046519 Ga0495632_0011980 Ga0495632_0011980_1646_2776 373
939 3300046519 Ga0495632_0089230 Ga0495632_0089230_123_1253 373
940 3300046520 Ga0495637_0000006 Ga0495637_0000006_207324_208454 373
941 3300046520 Ga0495637_0013100 Ga0495637_0013100_1985_3115 373
942 3300046522 Ga0495643_0004024 Ga0495643_0004024_6008_7138 373
943 3300046522 Ga0495643_0037000 Ga0495643_0037000_1533_2663 373
944 3300046523 Ga0495644_0007508 Ga0495644_0007508_2024_3154 373
945 3300046523 Ga0495644_0010273 Ga0495644_0010273_344_1474 373
946 3300046523 Ga0495644_0018694 Ga0495644_0018694_1141_2271 373
947 3300046523 Ga0495644_0037979 Ga0495644_0037979_507_1637 373
948 3300046524 Ga0495648_0000802 Ga0495648_0000802_3645_4775 373
949 3300046524 Ga0495648_0003099 Ga0495648_0003099_4341_5471 373
950 3300046524 Ga0495648_0014398 Ga0495648_0014398_969_2099 373
951 3300046524 Ga0495648_0047136 Ga0495648_0047136_1089_2219 373
952 3300046524 Ga0495648_0092890 Ga0495648_0092890_153_1283 373
953 3300046525 Ga0495663_0003544 Ga0495663_0003544_1932_3062 373
954 3300046526 Ga0495666_0015604 Ga0495666_0015604_578_1708 373
955 3300046528 Ga0495642_0000813 Ga0495642_0000813_9689_10819 373
956 3300046528 Ga0495642_0004410 Ga0495642_0004410_3901_5031 373
957 3300046528 Ga0495642_0005459 Ga0495642_0005459_2391_3521 373
958 3300046528 Ga0495642_0006627 Ga0495642_0006627_1447_2577 373
959 3300046528 Ga0495642_0046984 Ga0495642_0046984_529_1659 373
960 3300046530 Ga0495654_0005270 Ga0495654_0005270_4288_5418 373
961 3300046531 Ga0495665_0007081 Ga0495665_0007081_3790_4920 373
962 3300046535 Ga0495586_0039934 Ga0495586_0039934_22_1152 373
963 3300046538 Ga0495609_0005063 Ga0495609_0005063_2488_3618 373
964 3300046538 Ga0495609_0007366 Ga0495609_0007366_3189_4319 373
965 3300046557 Ga0495622_0016534 Ga0495622_0016534_861_1991 373
966 3300046557 Ga0495622_0016605 Ga0495622_0016605_336_1466 373
967 3300046558 Ga0495633_0001152 Ga0495633_0001152_1209_2339 373
968 3300046558 Ga0495633_0002045 Ga0495633_0002045_9994_11124 373
969 3300046615 Ga0495656_0003042 Ga0495656_0003042_2183_3313 373
970 3300046616 Ga0495668_0002567 Ga0495668_0002567_9375_10505 373
971 3300046616 Ga0495668_0008369 Ga0495668_0008369_2608_3738 373
972 3300046616 Ga0495668_0030115 Ga0495668_0030115_883_2013 373
973 3300046616 Ga0495668_0055641 Ga0495668_0055641_832_1962 373
974 3300046642 Ga0495634_0036626 Ga0495634_0036626_821_1951 373
975 3300046648 Ga0495611_0000476 Ga0495611_0000476_21593_22723 373
976 3300046648 Ga0495611_0004540 Ga0495611_0004540_2482_3612 373
977 3300046648 Ga0495611_0005280 Ga0495611_0005280_264_1394 373
978 3300046648 Ga0495611_0022450 Ga0495611_0022450_1174_2304 373
979 3300046648 Ga0495611_0040260 Ga0495611_0040260_359_1489 373
980 3300046660 Ga0495625_0022401 Ga0495625_0022401_3695_4825 373
981 3300046660 Ga0495625_0034649 Ga0495625_0034649_2133_3263 373
982 3300046660 Ga0495625_0166865 Ga0495625_0166865_185_1315 373
983 3300046663 Ga0495635_0022968 Ga0495635_0022968_2578_3708 373
984 3300046665 Ga0495661_0014949 Ga0495661_0014949_2145_3275 373
985 3300046665 Ga0495661_0025238 Ga0495661_0025238_1476_2606 373
986 3300046665 Ga0495661_0037776 Ga0495661_0037776_1740_2870 373
987 3300046665 Ga0495661_0115723 Ga0495661_0115723_22_1152 373
988 3300046679 Ga0495623_0024796 Ga0495623_0024796_1919_3049 373
989 3300046680 Ga0495646_0041268 Ga0495646_0041268_759_1889 373
990 3300046681 Ga0495647_0015333 Ga0495647_0015333_1340_2461 373
991 3300046684 Ga0495669_0010848 Ga0495669_0010848_1085_2215 373
992 3300046684 Ga0495669_0026673 Ga0495669_0026673_396_1526 373
993 3300046689 Ga0495613_0017802 Ga0495613_0017802_3827_4957 373
994 3300046690 Ga0495624_0005465 Ga0495624_0005465_7159_8289 373
995 3300046691 Ga0495670_0000604 Ga0495670_0000604_9211_10341 373
996 3300046692 Ga0495671_0000132 Ga0495671_0000132_61949_63079 373
997 3300046692 Ga0495671_0018445 Ga0495671_0018445_1334_2464 373
998 3300046692 Ga0495671_0020725 Ga0495671_0020725_526_1656 373
999 3300046694 Ga0495649_0001317 Ga0495649_0001317_10544_11674 373
1000 3300046694 Ga0495649_0016046 Ga0495649_0016046_827_1957 373
1001 3300046794 Ga0495589_0002400 Ga0495589_0002400_7273_8403 373
1002 3300046794 Ga0495589_0002441 Ga0495589_0002441_2252_3382 373
1003 3300046794 Ga0495589_0096429 Ga0495589_0096429_170_1300 373
1004 3300046810 Ga0495660_0010570 Ga0495660_0010570_2512_3642 373
1005 3300046810 Ga0495660_0022679 Ga0495660_0022679_2327_3457 373
1006 3300046810 Ga0495660_0023686 Ga0495660_0023686_2208_3338 373
1007 3300047315 Ga0495581_0093981 Ga0495581_0093981_588_1718 373
1008 3300047317 Ga0495604_0005257 Ga0495604_0005257_4886_6016 373
1009 3300047317 Ga0495604_0037992 Ga0495604_0037992_1919_3049 373
1010 3300047317 Ga0495604_0072199 Ga0495604_0072199_1304_2434 373
1011 3300047319 Ga0495674_0024972 Ga0495674_0024972_705_1835 373
1012 3300047320 Ga0495672_0000086 Ga0495672_0000086_121251_122381 373
1013 3300047320 Ga0495672_0026319 Ga0495672_0026319_1883_3013 373
1014 3300047321 Ga0495676_0009421 Ga0495676_0009421_863_1993 373
1015 3300047322 Ga0495680_0034256 Ga0495680_0034256_829_1959 373
1016 3300047323 Ga0495683_0000080 Ga0495683_0000080_63143_64273 373
1017 3300047323 Ga0495683_0000576 Ga0495683_0000576_17960_19090 373
1018 3300047323 Ga0495683_0012554 Ga0495683_0012554_3227_4357 373
1019 3300047443 Ga0495687_000154 Ga0495687_000154_78793_79923 373
1020 3300047445 Ga0495677_0001947 Ga0495677_0001947_2951_4081 373
1021 3300047445 Ga0495677_0003246 Ga0495677_0003246_3087_4217 373
1022 3300047445 Ga0495677_0006506 Ga0495677_0006506_3177_4307 373
1023 3300047447 Ga0495685_001153 Ga0495685_001153_4898_6028 373
1024 3300047469 Ga0495673_0011984 Ga0495673_0011984_864_1994 373
1025 3300047470 Ga0495681_0016636 Ga0495681_0016636_1525_2655 373
1026 3300047470 Ga0495681_0056618 Ga0495681_0056618_371_1501 373
1027 3300047472 Ga0495686_0000987 Ga0495686_0000987_9640_10770 373
1028 3300047472 Ga0495686_0031754 Ga0495686_0031754_532_1662 373
1029 3300047472 Ga0495686_0102380 Ga0495686_0102380_429_1559 373
1030 3300047673 Ga0495593_0001403 Ga0495593_0001403_2692_3822 373
1031 3300047673 Ga0495593_0007353 Ga0495593_0007353_3437_4567 373
1032 3300048088 Ga0495602_0044457 Ga0495602_0044457_1488_2618 373
1033 3300048091 Ga0495626_0005034 Ga0495626_0005034_3722_4852 373
1034 3300048091 Ga0495626_0012887 Ga0495626_0012887_2380_3510 373
1035 3300048091 Ga0495626_0048408 Ga0495626_0048408_409_1539 373
1036 3300048911 Ga0496108_0150383 Ga0496108_0150383_36_1166 373
1037 3300048913 Ga0496110_0025312 Ga0496110_0025312_76_1206 373
1038 3300048918 Ga0496115_0013062 Ga0496115_0013062_2007_3137 373
1039 3300048924 Ga0496121_0165506 Ga0496121_0165506_123_1250 373
1040 3300049459 Ga0495678_000064 Ga0495678_000064_132859_133989 373
1041 3300049515 Ga0501292_002034 Ga0501292_002034_237_1367 373
1042 3300049520 Ga0501297_004592 Ga0501297_004592_193_1323 373
1043 3300049759 Ga0501262_000761 Ga0501262_000761_2532_3662 373
1044 3300049762 Ga0501265_002219 Ga0501265_002219_673_1803 373
1045 iso_pu_bacteria 2596583598 2597032403 373
1046 iso_pu_bacteria 2599185178 2599448314 373
1047 iso_pu_bacteria 2885266251 2885269397 373
1048 iso_pu_bacteria 2900577576 2900578933 373
1049 iso_pu_bacteria 2928058823 2928060566 373
1050 3300044684 Ga0466966_0010101 Ga0466966_0010101_2426_3562 374
1051 3300045051 Ga0451576_0231898 Ga0451576_0231898_385_1524 374
1052 3300046474 Ga0495605_0082788 Ga0495605_0082788_328_1464 374
1053 3300046506 Ga0495583_0003837 Ga0495583_0003837_5569_6705 374
1054 3300046507 Ga0495606_0027799 Ga0495606_0027799_1066_2199 374
1055 3300046513 Ga0495616_0001339 Ga0495616_0001339_13513_14649 374
1056 3300046520 Ga0495637_0009761 Ga0495637_0009761_2213_3349 374
1057 3300046522 Ga0495643_0000192 Ga0495643_0000192_92995_94131 374
1058 3300046542 Ga0495597_0000587 Ga0495597_0000587_21141_22271 374
1059 3300046691 Ga0495670_0030634 Ga0495670_0030634_224_1360 374
1060 3300047320 Ga0495672_0003913 Ga0495672_0003913_916_2061 374
1061 3300048091 Ga0495626_0014308 Ga0495626_0014308_2251_3387 374
1062 3300048905 Ga0496102_0000253 Ga0496102_0000253_58378_59523 374
1063 3300006028 Ga0070717_10013109 Ga0070717_100131095 375
1064 3300046453 Ga0495627_015484 Ga0495627_015484_1080_2225 375
1065 3300046455 Ga0495603_0043618 Ga0495603_0043618_149_1294 375
1066 3300046473 Ga0495582_0004982 Ga0495582_0004982_693_1838 375
1067 3300046474 Ga0495605_0009309 Ga0495605_0009309_1413_2558 375
1068 3300046474 Ga0495605_0012019 Ga0495605_0012019_787_1932 375
1069 3300046474 Ga0495605_0042078 Ga0495605_0042078_1117_2262 375
1070 3300046491 Ga0495584_0003929 Ga0495584_0003929_1351_2496 375
1071 3300046491 Ga0495584_0006863 Ga0495584_0006863_4054_5199 375
1072 3300046491 Ga0495584_0023259 Ga0495584_0023259_897_2042 375
1073 3300046492 Ga0495585_0006024 Ga0495585_0006024_2726_3871 375
1074 3300046492 Ga0495585_0008688 Ga0495585_0008688_4095_5240 375
1075 3300046499 Ga0495594_0010723 Ga0495594_0010723_2263_3408 375
1076 3300046499 Ga0495594_0018124 Ga0495594_0018124_929_2074 375
1077 3300046500 Ga0495596_0004150 Ga0495596_0004150_1820_2965 375
1078 3300046500 Ga0495596_0006018 Ga0495596_0006018_2329_3474 375
1079 3300046500 Ga0495596_0008424 Ga0495596_0008424_2052_3197 375
1080 3300046501 Ga0495607_0032512 Ga0495607_0032512_1472_2617 375
1081 3300046501 Ga0495607_0043436 Ga0495607_0043436_820_1965 375
1082 3300046506 Ga0495583_0000241 Ga0495583_0000241_11866_13011 375
1083 3300046506 Ga0495583_0001716 Ga0495583_0001716_2469_3614 375
1084 3300046506 Ga0495583_0022997 Ga0495583_0022997_964_2109 375
1085 3300046506 Ga0495583_0028050 Ga0495583_0028050_552_1697 375
1086 3300046506 Ga0495583_0076467 Ga0495583_0076467_234_1379 375
1087 3300046512 Ga0495610_0024568 Ga0495610_0024568_1089_2234 375
1088 3300046513 Ga0495616_0000218 Ga0495616_0000218_3757_4902 375
1089 3300046513 Ga0495616_0006247 Ga0495616_0006247_4272_5417 375
1090 3300046513 Ga0495616_0006363 Ga0495616_0006363_1056_2201 375
1091 3300046513 Ga0495616_0013987 Ga0495616_0013987_813_1958 375
1092 3300046518 Ga0495631_0002191 Ga0495631_0002191_3608_4753 375
1093 3300046518 Ga0495631_0005244 Ga0495631_0005244_2798_3943 375
1094 3300046518 Ga0495631_0006335 Ga0495631_0006335_1221_2366 375
1095 3300046518 Ga0495631_0037413 Ga0495631_0037413_802_1947 375
1096 3300046519 Ga0495632_0000040 Ga0495632_0000040_29252_30397 375
1097 3300046519 Ga0495632_0000114 Ga0495632_0000114_4233_5378 375
1098 3300046519 Ga0495632_0002437 Ga0495632_0002437_4206_5351 375
1099 3300046519 Ga0495632_0008625 Ga0495632_0008625_1219_2364 375
1100 3300046519 Ga0495632_0012370 Ga0495632_0012370_2717_3862 375
1101 3300046522 Ga0495643_0002723 Ga0495643_0002723_10463_11608 375
1102 3300046522 Ga0495643_0017628 Ga0495643_0017628_139_1284 375
1103 3300046523 Ga0495644_0001463 Ga0495644_0001463_7835_8980 375
1104 3300046528 Ga0495642_0001190 Ga0495642_0001190_2070_3215 375
1105 3300046528 Ga0495642_0002344 Ga0495642_0002344_4564_5709 375
1106 3300046528 Ga0495642_0006314 Ga0495642_0006314_335_1480 375
1107 3300046530 Ga0495654_0013309 Ga0495654_0013309_2177_3322 375
1108 3300046542 Ga0495597_0007925 Ga0495597_0007925_1074_2219 375
1109 3300046542 Ga0495597_0011861 Ga0495597_0011861_1381_2526 375
1110 3300046557 Ga0495622_0045703 Ga0495622_0045703_630_1775 375
1111 3300046558 Ga0495633_0006201 Ga0495633_0006201_4370_5515 375
1112 3300046616 Ga0495668_0001608 Ga0495668_0001608_8045_9187 375
1113 3300046616 Ga0495668_0032574 Ga0495668_0032574_1013_2158 375
1114 3300046616 Ga0495668_0062633 Ga0495668_0062633_84_1229 375
1115 3300046616 Ga0495668_0144427 Ga0495668_0144427_122_1267 375
1116 3300046660 Ga0495625_0059374 Ga0495625_0059374_515_1660 375
1117 3300046665 Ga0495661_0006009 Ga0495661_0006009_2798_3943 375
1118 3300046665 Ga0495661_0015784 Ga0495661_0015784_1694_2839 375
1119 3300046674 Ga0495588_0005552 Ga0495588_0005552_2346_3491 375
1120 3300046674 Ga0495588_0040498 Ga0495588_0040498_372_1517 375
1121 3300046674 Ga0495588_0053203 Ga0495588_0053203_757_1902 375
1122 3300046684 Ga0495669_0000098 Ga0495669_0000098_29280_30425 375
1123 3300046684 Ga0495669_0000122 Ga0495669_0000122_4016_5161 375
1124 3300046689 Ga0495613_0003579 Ga0495613_0003579_2280_3425 375
1125 3300046691 Ga0495670_0002986 Ga0495670_0002986_3459_4604 375
1126 3300046691 Ga0495670_0028216 Ga0495670_0028216_253_1398 375
1127 3300046691 Ga0495670_0070736 Ga0495670_0070736_378_1523 375
1128 3300046692 Ga0495671_0014662 Ga0495671_0014662_2721_3866 375
1129 3300046694 Ga0495649_0004408 Ga0495649_0004408_3578_4723 375
1130 3300046694 Ga0495649_0029298 Ga0495649_0029298_1621_2766 375
1131 3300046694 Ga0495649_0049349 Ga0495649_0049349_446_1591 375
1132 3300046794 Ga0495589_0001941 Ga0495589_0001941_4086_5228 375
1133 3300046794 Ga0495589_0022789 Ga0495589_0022789_392_1537 375
1134 3300046794 Ga0495589_0035130 Ga0495589_0035130_1232_2377 375
1135 3300046810 Ga0495660_0002463 Ga0495660_0002463_8327_9472 375
1136 3300046810 Ga0495660_0003124 Ga0495660_0003124_7899_9044 375
1137 3300047315 Ga0495581_0004715 Ga0495581_0004715_2059_3204 375
1138 3300047320 Ga0495672_0000556 Ga0495672_0000556_9739_10884 375
1139 3300047320 Ga0495672_0003253 Ga0495672_0003253_4197_5342 375
1140 3300047321 Ga0495676_0000035 Ga0495676_0000035_30800_31945 375
1141 3300047323 Ga0495683_0005543 Ga0495683_0005543_3461_4606 375
1142 3300047323 Ga0495683_0059501 Ga0495683_0059501_204_1349 375
1143 3300047443 Ga0495687_003354 Ga0495687_003354_6504_7649 375
1144 3300047445 Ga0495677_0002817 Ga0495677_0002817_1972_3117 375
1145 3300047445 Ga0495677_0006565 Ga0495677_0006565_2758_3903 375
1146 3300047445 Ga0495677_0044671 Ga0495677_0044671_144_1289 375
1147 3300047446 Ga0495679_005672 Ga0495679_005672_3333_4478 375
1148 3300047470 Ga0495681_0006038 Ga0495681_0006038_3098_4243 375
1149 3300047470 Ga0495681_0006668 Ga0495681_0006668_2141_3307 375
1150 3300047470 Ga0495681_0007470 Ga0495681_0007470_2242_3387 375
1151 3300047470 Ga0495681_0018349 Ga0495681_0018349_1986_3131 375
1152 3300048089 Ga0495614_0010341 Ga0495614_0010341_241_1386 375
1153 3300048091 Ga0495626_0007834 Ga0495626_0007834_3107_4252 375
1154 3300048091 Ga0495626_0008937 Ga0495626_0008937_1698_2843 375
1155 3300048091 Ga0495626_0014301 Ga0495626_0014301_926_2071 375
1156 3300048091 Ga0495626_0014620 Ga0495626_0014620_666_1811 375
1157 3300048091 Ga0495626_0017883 Ga0495626_0017883_376_1521 375
1158 3300049459 Ga0495678_002660 Ga0495678_002660_6540_7685 375
1159 3300049459 Ga0495678_018210 Ga0495678_018210_1707_2852 375
1160 3300049460 Ga0495682_0000726 Ga0495682_0000726_4214_5359 375
1161 3300048091 Ga0495626_0029228 Ga0495626_0029228_1431_2579 376
1162 3300048927 Ga0496124_0015326 Ga0496124_0015326_1603_2757 376
1163 3300001915 JGI24741J21665_1001242 JGI24741J21665_10012423 377
1164 3300001979 JGI24740J21852_10001764 JGI24740J21852_100017644 377
1165 3300001979 JGI24740J21852_10004026 JGI24740J21852_100040263 377
1166 3300002705 JGI25156J39149_1005822 JGI25156J39149_10058222 377
1167 3300002738 JGI25154J39366_1002494 JGI25154J39366_10024942 377
1168 3300003752 Ga0055539_1000541 Ga0055539_10005413 377
1169 3300003758 Ga0055532_1000786 Ga0055532_10007863 377
1170 3300003759 Ga0055525_1001433 Ga0055525_10014333 377
1171 3300003761 Ga0055535_1001576 Ga0055535_10015763 377
1172 3300003762 Ga0055542_1001580 Ga0055542_10015804 377
1173 3300003763 Ga0055529_1001155 Ga0055529_10011553 377
1174 3300003841 Ga0055541_1001057 Ga0055541_10010573 377
1175 3300005337 Ga0070682_100061547 Ga0070682_1000615473 377
1176 3300005344 Ga0070661_100000892 Ga0070661_1000008924 377
1177 3300005366 Ga0070659_100002030 Ga0070659_1000020304 377
1178 3300005455 Ga0070663_100000463 Ga0070663_1000004634 377
1179 3300005564 Ga0070664_100002094 Ga0070664_1000020949 377
1180 3300005577 Ga0068857_100014572 Ga0068857_1000145724 377
1181 3300005578 Ga0068854_100000776 Ga0068854_10000077611 377
1182 3300005614 Ga0068856_100003674 Ga0068856_1000036745 377
1183 3300009093 Ga0105240_10338906 Ga0105240_103389062 377
1184 3300013100 Ga0157373_10005365 Ga0157373_100053654 377
1185 3300013102 Ga0157371_10001831 Ga0157371_1000183110 377
1186 3300013104 Ga0157370_10001175 Ga0157370_1000117523 377
1187 3300013105 Ga0157369_10009847 Ga0157369_100098473 377
1188 3300013307 Ga0157372_10002150 Ga0157372_100021509 377
1189 3300014497 Ga0182008_10023466 Ga0182008_100234663 377
1190 3300015261 Ga0182006_1001529 Ga0182006_10015295 377
1191 3300020069 Ga0197907_10873026 Ga0197907_108730262 377
1192 3300020070 Ga0206356_10848462 Ga0206356_108484624 377
1193 3300020077 Ga0206351_10868641 Ga0206351_108686413 377
1194 3300020610 Ga0154015_1236554 Ga0154015_12365544 377
1195 3300025224 Ga0209784_100006 Ga0209784_100006208 377
1196 3300025224 Ga0209784_100753 Ga0209784_1007534 377
1197 3300025224 Ga0209784_101546 Ga0209784_1015461 377
1198 3300025225 Ga0209566_100002 Ga0209566_100002208 377
1199 3300025226 Ga0209674_100010 Ga0209674_100010929 377
1200 3300025226 Ga0209674_100176 Ga0209674_10017654 377
1201 3300025226 Ga0209674_100320 Ga0209674_10032012 377
1202 3300025228 Ga0209672_100110 Ga0209672_10011047 377
1203 3300025229 Ga0209147_100018 Ga0209147_100018298 377
1204 3300025230 Ga0209563_100041 Ga0209563_100041264 377
1205 3300025242 Ga0209258_100028 Ga0209258_100028298 377
1206 3300025246 Ga0209646_1000043 Ga0209646_1000043320 377
1207 3300025250 Ga0209026_1003044 Ga0209026_10030442 377
1208 3300025253 Ga0209677_100007 Ga0209677_100007208 377
1209 3300025253 Ga0209677_103393 Ga0209677_1033935 377
1210 3300025254 Ga0209148_1000151 Ga0209148_1000151123 377
1211 3300025256 Ga0209759_1001163 Ga0209759_10011634 377
1212 3300025256 Ga0209759_1001504 Ga0209759_10015045 377
1213 3300025256 Ga0209759_1001749 Ga0209759_10017494 377
1214 3300025256 Ga0209759_1026497 Ga0209759_10264971 377
1215 3300025272 Ga0209455_1000065 Ga0209455_1000065298 377
1216 3300025913 Ga0207695_10000872 Ga0207695_100008726 377
1217 3300025920 Ga0207649_10002344 Ga0207649_100023443 377
1218 3300025932 Ga0207690_10007640 Ga0207690_100076404 377
1219 3300025945 Ga0207679_10000012 Ga0207679_10000012304 377
1220 3300025981 Ga0207640_10000047 Ga0207640_100000479 377
1221 3300026067 Ga0207678_10001558 Ga0207678_100015589 377
1222 3300026078 Ga0207702_10001737 Ga0207702_100017379 377
1223 3300026116 Ga0207674_10020244 Ga0207674_100202443 377
1224 3300037418 Ga0395900_0013095 Ga0395900_0013095_5297_6430 377
1225 3300042876 Ga0451577_0033475 Ga0451577_0033475_392_1528 377
1226 3300044712 Ga0453684_0002276 Ga0453684_0002276_29853_30989 377
1227 3300044712 Ga0453684_0023287 Ga0453684_0023287_6803_7948 377
1228 3300045051 Ga0451576_0003152 Ga0451576_0003152_6091_7227 377
1229 3300059643 Ga0587072_001186 Ga0587072_001186_1108_2241 377
1230 3300061719 Ga0466962_0005173 Ga0466962_0005173_4990_6123 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04107

GCS2

Glutamate-cysteine ligase family 2(GCS2)

47

325

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.9639 6 369
1r8g-assembly1.cif.gz_B structure and function of ybdk 0.9618 3 369
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.956 6 369
1r8g-assembly1.cif.gz_B structure and function of ybdk 0.9539 3 369
1r8g-assembly1.cif.gz_A structure and function of ybdk 0.9473 3 369
ID Description Score Start End Superfamily
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9437 3 369 3.30.590.20
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9384 3 369 3.30.590.20
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9381 5 369 3.30.590.20
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9258 5 369 3.30.590.20
af_I6YCS6_35_480_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.7932 13 356 3.30.590.20
ID Description Score Start End GO Terms
AF-A0A1C6R0V2-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9894 1 373 GO:0004357
GO:0005524
GO:0042398
AF-A0A7L5Y800-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9878 2 373 GO:0004357
GO:0005524
GO:0016020
GO:0042398
AF-A0A520DV78-F1-model_v4 Glutamate--cysteine ligase 0.9876 195 369 GO:0004357
GO:0042398
AF-A0A4Q3PB65-F1-model_v4 deleted 0.9875 1 94
AF-A0A645A4B0-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) 0.9865 151 372 GO:0004357
GO:0042398

Feature Viewer

pLDDT pTM Quality
91.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map