F491968

General Info

Members Datasets Scaffolds Average Seq Length
1229 640 1012 366

Family's Representative Sequence

Representative Sequence 3300020070|Ga0206356_10862082|Ga0206356_108620822
Length 360
Sequence METTAPLILLAAGGTGGHLFPAEALGVELIKRGLRVRLVTDDRALKYSGLFSKDMIDVVASETARGRNPLQLAYAIFTLATGTLSAFGLMRRLKPAAVVGFGGYPTLPPLIAARIAGIPGVIHDANAVLGRANRFLARHVTAIATSLPCVLDRDPTLSAKATTVGTPRRPAIYTAPETNGPFRLLVVGGSQGARVMSDIVPGAIERLEPALWSRLILTQQVREEDMIRVRAVYDRLKIQAELAPFFTDLPARLASNHLVVSRSGAGTIAELAAIGRPSILVPLPGAIDQDQFANAGVLSEVDGALRIPQAEFTSDRLASEISALAAEPQRLAAMAAAARSAGRLDAAERLADLVVKTAGI

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
39 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
40 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
41 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
42 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
45 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
53 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
54 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
55 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
56 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
57 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
58 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
59 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
65 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
66 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
67 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
68 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
69 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
70 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
71 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
72 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
73 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
74 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
75 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
76 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
77 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
78 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
79 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
80 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
81 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
82 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
83 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
84 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
85 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
86 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
87 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
88 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
89 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
90 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
91 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
92 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
93 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
94 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
95 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
96 2904699407
97 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
98 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
99 2906610324
100 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
101 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
102 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
103 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
104 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
105 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
106 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
107 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
108 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
109 2922368715
110 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
111 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
112 2922425934
113 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
114 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
115 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
116 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
117 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
118 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
119 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
120 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
121 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
122 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
123 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
124 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
125 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
126 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
127 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
128 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
129 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
130 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
131 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
132 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
133 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
134 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
135 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
136 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
137 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
138 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
139 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
140 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
141 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
142 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
143 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
144 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
145 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
146 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
147 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
148 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
149 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
150 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
151 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
152 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
153 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
154 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
155 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
156 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
157 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
158 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
159 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
160 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
161 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
162 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
163 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
164 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
165 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
166 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
167 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
168 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
169 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
170 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
171 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
172 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
173 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
174 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
175 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
176 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
177 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
178 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
179 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
180 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
181 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
182 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
183 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
184 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
185 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
186 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
187 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
188 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
189 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
192 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
193 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
194 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
195 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
196 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
197 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
198 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
199 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
200 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
201 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
202 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
203 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
204 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
205 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
206 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
207 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
208 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
209 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
210 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
211 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
212 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
213 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
214 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
215 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
216 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
217 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
218 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
219 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
223 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
224 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
225 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
226 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
227 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
228 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
229 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
230 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
231 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
232 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
233 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
234 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
235 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
236 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
237 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
238 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
239 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
240 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
241 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
242 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
243 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
244 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
245 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
246 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
247 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
248 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
249 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
250 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
251 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
252 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
253 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
254 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
255 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
256 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
257 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
258 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
259 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
260 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
261 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
262 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
263 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
264 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
265 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
266 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
267 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
268 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
269 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
270 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
271 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
272 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
273 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
274 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
275 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
276 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
277 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
278 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
279 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
280 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
282 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
283 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
284 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
285 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
286 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
287 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
290 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
292 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
294 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
347 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
348 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
349 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
350 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
354 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
355 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
356 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
357 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
358 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
359 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
360 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
361 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
362 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
363 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
364 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
365 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
366 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
367 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
368 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
369 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
370 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
371 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
372 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
373 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
374 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
375 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
376 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
377 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
378 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
379 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
380 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
381 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
382 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
383 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
384 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
385 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
386 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
387 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
388 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
389 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
390 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
391 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
392 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
393 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
394 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
395 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
396 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
397 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
398 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
399 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
400 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
401 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
402 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
403 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
404 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
405 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
406 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
407 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
408 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
409 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
410 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
411 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
412 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
413 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
414 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
415 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
416 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
417 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
418 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
419 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
420 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
421 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
422 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
423 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
424 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
425 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
426 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
427 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
428 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
429 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
430 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
431 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
432 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
433 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
434 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
435 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
436 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
437 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
438 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
439 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
440 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
443 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
444 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
445 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
446 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
447 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
448 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
449 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
450 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
451 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
452 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
453 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
454 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
455 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
456 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
457 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
458 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
459 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
460 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
461 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
462 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
463 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
464 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
465 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
466 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
467 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
468 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
469 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
470 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
471 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
472 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
473 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
474 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
475 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
476 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
477 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
478 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
479 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
480 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
481 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
482 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
483 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
484 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
485 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
486 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
487 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
488 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
489 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
490 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
491 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
492 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
493 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
494 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
495 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
496 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
497 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
498 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
499 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
500 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
501 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
502 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
503 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
504 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
505 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
506 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
507 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
508 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
509 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
510 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
511 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
512 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
513 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
514 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
515 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
516 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
517 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
532 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
535 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
536 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
537 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
538 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
539 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
540 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
541 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
542 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
543 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
546 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
547 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
548 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
549 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
550 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
551 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
552 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
553 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
554 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
555 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
556 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
557 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
558 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
559 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
560 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
561 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
562 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
563 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
564 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
565 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
566 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
567 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
568 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
569 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
570 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
571 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
572 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
573 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
574 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
575 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
576 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
577 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
578 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
579 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
580 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
581 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
582 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
583 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
584 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
585 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
586 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
587 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
588 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
589 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
590 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
591 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
592 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
593 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
594 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
595 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
596 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
597 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
598 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
599 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
600 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
601 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
602 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
603 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
604 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
605 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
606 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
607 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
608 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
609 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
610 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
611 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
612 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
613 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
614 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
615 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
616 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
617 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
618 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
619 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
620 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
621 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
622 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
623 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
624 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
625 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
626 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
627 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
628 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
629 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
630 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
631 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
632 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
633 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
634 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
635 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
636 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
637 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
638 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
639 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
640 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.52
Metatranscriptomes 0.16
Isolates 17.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 14.48
Rhizoplane 5.21
Rhizosphere 59.64
Stem 0
Stem Tuber 0
Unclassified 10.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000068 3300003203 Bacteria 47530
2 JGI25406J46586_10000392 3300003203 Bacteria 20055
3 JGI25406J46586_10003218 3300003203 Bacteria 7680
4 JGI25153J46596_10004141 3300003215 Bacteria 7882
5 JGI25153J46596_10004246 3300003215 Bacteria 7754
6 JGI25153J46596_10008945 3300003215 Bacteria 4723
7 JGI25153J46596_10009956 3300003215 Bacteria 4347
8 JGI25160J50197_1001885 3300003354 Bacteria 10064
9 JGI25160J50197_1003307 3300003354 Bacteria 7256
10 JGI25160J50197_1008344 3300003354 Bacteria 3953
11 Ga0055531_10005281 3300003794 Bacteria 7578
12 Ga0055543_1007542 3300004625 Bacteria 2500
13 Ga0065165_1004626 3300005262 Bacteria 8358
14 Ga0065165_1004931 3300005262 Bacteria 7867
15 Ga0065165_1016843 3300005262 Bacteria 2717
16 Ga0070683_100008367 3300005329 Bacteria 8784
17 Ga0070683_100080340 3300005329 Bacteria 3052
18 Ga0070670_100209197 3300005331 Bacteria 1696
19 Ga0068869_100087262 3300005334 Bacteria 2340
20 Ga0068869_100179707 3300005334 Bacteria 1658
21 Ga0068869_100217902 3300005334 Bacteria 1511
22 Ga0070666_10043956 3300005335 Bacteria 2992
23 Ga0070680_100027612 3300005336 Bacteria 4545
24 Ga0070680_100089896 3300005336 Bacteria 2541
25 Ga0070682_100172374 3300005337 Bacteria 1505
26 Ga0068868_100132236 3300005338 Bacteria 2042
27 Ga0068868_100267873 3300005338 Bacteria 1442
28 Ga0070660_100002003 3300005339 Bacteria 14053
29 Ga0070661_100062206 3300005344 Bacteria 2741
30 Ga0070668_100103950 3300005347 Bacteria 2253
31 Ga0070669_100121573 3300005353 Bacteria 1993
32 Ga0070671_100026137 3300005355 Bacteria 4795
33 Ga0070674_100192865 3300005356 Bacteria 1568
34 Ga0070659_100200993 3300005366 Bacteria 1640
35 Ga0070709_10001417 3300005434 Bacteria 12994
36 Ga0070709_10010289 3300005434 Bacteria 5172
37 Ga0070709_10032218 3300005434 Bacteria 3159
38 Ga0070709_10168899 3300005434 Bacteria 1527
39 Ga0070714_100000678 3300005435 Bacteria 24075
40 Ga0070714_100018262 3300005435 Bacteria 5694
41 Ga0070714_100033934 3300005435 Bacteria 4272
42 Ga0070714_100107626 3300005435 Bacteria 2464
43 Ga0070714_100113747 3300005435 Bacteria 2400
44 Ga0070713_100004076 3300005436 Bacteria 9730
45 Ga0070713_100020815 3300005436 Bacteria 5036
46 Ga0070713_100194184 3300005436 Bacteria 1831
47 Ga0070713_100277773 3300005436 Bacteria 1536
48 Ga0070710_10000633 3300005437 Bacteria 16752
49 Ga0070710_10001070 3300005437 Bacteria 12969
50 Ga0070710_10019478 3300005437 Bacteria 3507
51 Ga0070710_10114774 3300005437 Bacteria 1622
52 Ga0070711_100001478 3300005439 Bacteria 12909
53 Ga0070711_100001837 3300005439 Bacteria 11834
54 Ga0070711_100002216 3300005439 Bacteria 11029
55 Ga0070711_100056360 3300005439 Bacteria 2717
56 Ga0070708_100041592 3300005445 Bacteria 4030
57 Ga0070663_100078956 3300005455 Bacteria 2413
58 Ga0070663_100088728 3300005455 Bacteria 2287
59 Ga0070663_100231032 3300005455 Bacteria 1456
60 Ga0070662_100015684 3300005457 Bacteria 5080
61 Ga0070662_100076417 3300005457 Bacteria 2482
62 Ga0070681_10026780 3300005458 Bacteria 5797
63 Ga0070681_10043509 3300005458 Bacteria 4499
64 Ga0070681_10084030 3300005458 Bacteria 3136
65 Ga0070681_10168938 3300005458 Bacteria 2109
66 Ga0070681_10200047 3300005458 Bacteria 1916
67 Ga0068867_100091974 3300005459 Bacteria 2303
68 Ga0070707_100084934 3300005468 Bacteria 3059
69 Ga0070699_100418958 3300005518 Bacteria 1212
70 Ga0070679_100084687 3300005530 Bacteria 3158
71 Ga0070679_100165930 3300005530 Bacteria 2182
72 Ga0070679_100169165 3300005530 Bacteria 2158
73 Ga0070679_100172326 3300005530 Bacteria 2137
74 Ga0070684_100005206 3300005535 Bacteria 9945
75 Ga0070684_100006273 3300005535 Bacteria 9183
76 Ga0070684_100014119 3300005535 Bacteria 6458
77 Ga0068853_100008362 3300005539 Bacteria 8309
78 Ga0068853_100010311 3300005539 Bacteria 7556
79 Ga0068853_100028252 3300005539 Bacteria 4716
80 Ga0070672_100064626 3300005543 Bacteria 2891
81 Ga0070672_100183381 3300005543 Bacteria 1745
82 Ga0070693_100151182 3300005547 Bacteria 1470
83 Ga0070665_100047437 3300005548 Bacteria 4311
84 Ga0070665_100149380 3300005548 Bacteria 2340
85 Ga0070665_100161240 3300005548 Bacteria 2245
86 Ga0070665_100212428 3300005548 Bacteria 1935
87 Ga0068855_100030914 3300005563 Bacteria 6399
88 Ga0068857_100213706 3300005577 Bacteria 1760
89 Ga0068854_100036841 3300005578 Bacteria 3430
90 Ga0068854_100051460 3300005578 Bacteria 2951
91 Ga0068854_100124665 3300005578 Bacteria 1960
92 Ga0068856_100000091 3300005614 Bacteria 85048
93 Ga0068856_100011262 3300005614 Bacteria 8680
94 Ga0068856_100056546 3300005614 Bacteria 3871
95 Ga0068856_100134819 3300005614 Bacteria 2474
96 Ga0068856_100204413 3300005614 Bacteria 1989
97 Ga0068852_100056055 3300005616 Bacteria 3404
98 Ga0068852_100162382 3300005616 Bacteria 2087
99 Ga0068852_100205706 3300005616 Bacteria 1865
100 Ga0068859_100217615 3300005617 Bacteria 1997
101 Ga0068864_100110233 3300005618 Bacteria 2451
102 Ga0068866_10007748 3300005718 Bacteria 4505
103 Ga0068861_100054122 3300005719 Bacteria 3056
104 Ga0068851_10001608 3300005834 Bacteria 9920
105 Ga0068851_10035213 3300005834 Bacteria 2501
106 Ga0068863_100111545 3300005841 Bacteria 2605
107 Ga0068858_100021103 3300005842 Bacteria 6084
108 Ga0068858_100171542 3300005842 Bacteria 2045
109 Ga0068860_100000254 3300005843 Bacteria 79465
110 Ga0068862_100052468 3300005844 Bacteria 3489
111 Ga0068862_100231871 3300005844 Bacteria 1675
112 Ga0081455_10004793 3300005937 Bacteria 15034
113 Ga0081455_10026261 3300005937 Bacteria 5362
114 Ga0081455_10042135 3300005937 Bacteria 4008
115 Ga0081540_1001143 3300005983 Bacteria 23424
116 Ga0081540_1003272 3300005983 Bacteria 12881
117 Ga0081540_1005484 3300005983 Bacteria 9466
118 Ga0081540_1009836 3300005983 Bacteria 6542
119 Ga0081540_1012663 3300005983 Bacteria 5533
120 Ga0081540_1013469 3300005983 Bacteria 5311
121 Ga0081540_1030172 3300005983 Bacteria 3008
122 Ga0081539_10000191 3300005985 Bacteria 142387
123 Ga0081539_10000321 3300005985 Bacteria 106887
124 Ga0070717_10005443 3300006028 Bacteria 9293
125 Ga0070717_10029235 3300006028 Bacteria 4419
126 Ga0075365_10008079 3300006038 Bacteria 5942
127 Ga0075365_10026332 3300006038 Bacteria 3691
128 Ga0075365_10086379 3300006038 Bacteria 2132
129 Ga0075368_10023834 3300006042 Bacteria 2341
130 Ga0075364_10027354 3300006051 Bacteria 3642
131 Ga0070715_10000078 3300006163 Bacteria 27243
132 Ga0070716_100017445 3300006173 Bacteria 3722
133 Ga0070716_100046221 3300006173 Bacteria 2448
134 Ga0070716_100064152 3300006173 Bacteria 2135
135 Ga0070716_100075084 3300006173 Bacteria 1999
136 Ga0070716_100097833 3300006173 Bacteria 1792
137 Ga0070716_100106129 3300006173 Bacteria 1732
138 Ga0070712_100011086 3300006175 Bacteria 5706
139 Ga0070712_100040056 3300006175 Bacteria 3210
140 Ga0070712_100063527 3300006175 Bacteria 2615
141 Ga0070712_100110148 3300006175 Bacteria 2053
142 Ga0075367_10036274 3300006178 Bacteria 2858
143 Ga0075367_10115214 3300006178 Bacteria 1652
144 Ga0075366_10012258 3300006195 Bacteria 4859
145 Ga0075366_10121287 3300006195 Bacteria 1576
146 Ga0097621_100091612 3300006237 Bacteria 2545
147 Ga0075370_10037250 3300006353 Bacteria 2734
148 Ga0075370_10038133 3300006353 Bacteria 2704
149 Ga0068871_100083324 3300006358 Bacteria 2652
150 Ga0075428_100089794 3300006844 Bacteria 3351
151 Ga0075433_10029509 3300006852 Bacteria 4674
152 Ga0075434_100081100 3300006871 Bacteria 3241
153 Ga0075434_100304415 3300006871 Bacteria 1614
154 Ga0075436_100049564 3300006914 Bacteria 2898
155 Ga0075436_100210447 3300006914 Bacteria 1378
156 Ga0097620_100217615 3300006931 Bacteria 1997
157 Ga0099825_1018997 3300006941 Bacteria 5214
158 Ga0099824_1023697 3300006942 Bacteria 3746
159 Ga0099822_1000022 3300006943 Bacteria 64942
160 Ga0099823_1027652 3300006944 Bacteria 4931
161 Ga0075435_100164113 3300007076 Bacteria 1872
162 Ga0105240_10017201 3300009093 Bacteria 9755
163 Ga0105240_10022325 3300009093 Bacteria 8392
164 Ga0105240_10068093 3300009093 Bacteria 4410
165 Ga0105240_10086587 3300009093 Bacteria 3837
166 Ga0105240_10189377 3300009093 Bacteria 2420
167 Ga0105240_10210308 3300009093 Bacteria 2274
168 Ga0105240_10393406 3300009093 Bacteria 1563
169 Ga0111539_10119503 3300009094 Bacteria 3088
170 Ga0105245_10071520 3300009098 Bacteria 3150
171 Ga0105245_10117886 3300009098 Bacteria 2477
172 Ga0105245_10237372 3300009098 Bacteria 1766
173 Ga0105245_10268214 3300009098 Bacteria 1664
174 Ga0105247_10019830 3300009101 Bacteria 4039
175 Ga0105243_10272915 3300009148 Bacteria 1519
176 Ga0105241_10014950 3300009174 Bacteria 5682
177 Ga0105241_10029800 3300009174 Bacteria 4074
178 Ga0105241_10296841 3300009174 Bacteria 1385
179 Ga0105248_10150640 3300009177 Bacteria 2624
180 Ga0105248_10187065 3300009177 Bacteria 2334
181 Ga0105237_10015378 3300009545 Bacteria 7967
182 Ga0105237_10018494 3300009545 Bacteria 7212
183 Ga0105237_10024176 3300009545 Bacteria 6216
184 Ga0105237_10028922 3300009545 Bacteria 5640
185 Ga0105237_10095800 3300009545 Bacteria 2957
186 Ga0105237_10138023 3300009545 Bacteria 2432
187 Ga0105237_10146881 3300009545 Bacteria 2353
188 Ga0105237_10286821 3300009545 Bacteria 1649
189 Ga0105238_10008134 3300009551 Bacteria 10489
190 Ga0105238_10057140 3300009551 Bacteria 3913
191 Ga0105238_10142835 3300009551 Bacteria 2370
192 Ga0105238_10396014 3300009551 Bacteria 1374
193 Ga0105249_10077171 3300009553 Bacteria 3089
194 Ga0105249_10275370 3300009553 Bacteria 1678
195 Ga0099796_10014701 3300010159 Bacteria 2269
196 Ga0099796_10023589 3300010159 Bacteria 1923
197 Ga0105239_10053854 3300010375 Bacteria 4412
198 Ga0105239_10111365 3300010375 Bacteria 3034
199 Ga0105239_10127689 3300010375 Bacteria 2827
200 Ga0105239_10373523 3300010375 Bacteria 1611
201 Ga0105246_10028278 3300011119 Bacteria 3682
202 Ga0157370_10044331 3300013104 Bacteria 4276
203 Ga0157370_10254099 3300013104 Bacteria 1625
204 Ga0157369_10016060 3300013105 Bacteria 8422
205 Ga0157369_10198242 3300013105 Bacteria 2107
206 Ga0157374_10092378 3300013296 Bacteria 2887
207 Ga0157375_10052552 3300013308 Bacteria 4006
208 Ga0163163_10087824 3300014325 Bacteria 3120
209 Ga0163163_10156308 3300014325 Bacteria 2325
210 Ga0163163_10409709 3300014325 Bacteria 1414
211 Ga0157376_10113676 3300014969 Bacteria 2387
212 Ga0163161_10108692 3300017792 Bacteria 2071
213 Ga0163161_10265622 3300017792 Bacteria 1341
214 Ga0206356_10862082 3300020070 Bacteria 1760
215 Ga0206356_11262758 3300020070 Bacteria 1697
216 Ga0214544_1000001 3300021320 Bacteria 783667
217 Ga0214542_1000005 3300021321 Bacteria 389646
218 Ga0214542_1024229 3300021321 Bacteria 3439
219 Ga0214545_1000003 3300021324 Bacteria 720274
220 Ga0214545_1023657 3300021324 Bacteria 3986
221 Ga0214543_1000002 3300021327 Bacteria 712733
222 Ga0214543_1026030 3300021327 Bacteria 3240
223 Ga0213876_10028489 3300021384 Bacteria 2945
224 Ga0213876_10066492 3300021384 Bacteria 1903
225 Ga0213876_10101694 3300021384 Bacteria 1524
226 Ga0213871_10002263 3300021441 Bacteria 3509
227 Ga0209677_101595 3300025253 Bacteria 9567
228 Ga0209677_108387 3300025253 Bacteria 2012
229 Ga0209148_1000424 3300025254 Bacteria 47087
230 Ga0209233_1004610 3300025261 Bacteria 4661
231 Ga0209233_1006596 3300025261 Bacteria 3730
232 Ga0209455_1009596 3300025272 Bacteria 2528
233 Ga0209455_1012617 3300025272 Bacteria 2010
234 Ga0209673_1037039 3300025273 Bacteria 1438
235 Ga0209564_1000485 3300025295 Bacteria 66032
236 Ga0209564_1006799 3300025295 Bacteria 6048
237 Ga0209758_1000141 3300025297 Bacteria 172481
238 Ga0209758_1002420 3300025297 Bacteria 19114
239 Ga0209758_1005684 3300025297 Bacteria 9427
240 Ga0209758_1006453 3300025297 Bacteria 8414
241 Ga0209758_1031926 3300025297 Bacteria 2149
242 Ga0209758_1032768 3300025297 Bacteria 2102
243 Ga0209758_1059854 3300025297 Bacteria 1264
244 Ga0209256_1010818 3300025299 Bacteria 3754
245 Ga0207426_1000425 3300025302 Bacteria 69088
246 Ga0207426_1003443 3300025302 Bacteria 8598
247 Ga0207426_1004449 3300025302 Bacteria 6833
248 Ga0209257_1000426 3300025304 Bacteria 81095
249 Ga0207656_10008209 3300025321 Bacteria 3831
250 Ga0207656_10016277 3300025321 Bacteria 2893
251 Ga0207692_10001055 3300025898 Bacteria 10067
252 Ga0207692_10005603 3300025898 Bacteria 5039
253 Ga0207692_10034148 3300025898 Bacteria 2461
254 Ga0207692_10083406 3300025898 Bacteria 1715
255 Ga0207642_10006639 3300025899 Bacteria 3859
256 Ga0207680_10141396 3300025903 Bacteria 1596
257 Ga0207685_10002878 3300025905 Bacteria 4057
258 Ga0207699_10000390 3300025906 Bacteria 22928
259 Ga0207699_10012034 3300025906 Bacteria 4390
260 Ga0207699_10030568 3300025906 Bacteria 3015
261 Ga0207699_10202813 3300025906 Bacteria 1345
262 Ga0207645_10145994 3300025907 Bacteria 1542
263 Ga0207684_10339723 3300025910 Bacteria 1293
264 Ga0207654_10000323 3300025911 Bacteria 28628
265 Ga0207654_10067997 3300025911 Bacteria 2107
266 Ga0207707_10000178 3300025912 Bacteria 66057
267 Ga0207707_10030844 3300025912 Bacteria 4690
268 Ga0207707_10069420 3300025912 Bacteria 3071
269 Ga0207707_10082388 3300025912 Bacteria 2809
270 Ga0207695_10000062 3300025913 Bacteria 351979
271 Ga0207695_10000497 3300025913 Bacteria 83894
272 Ga0207695_10088253 3300025913 Bacteria 3122
273 Ga0207671_10004982 3300025914 Bacteria 12436
274 Ga0207671_10154721 3300025914 Bacteria 1773
275 Ga0207671_10188296 3300025914 Bacteria 1608
276 Ga0207693_10003503 3300025915 Bacteria 13399
277 Ga0207693_10018008 3300025915 Bacteria 5629
278 Ga0207693_10027789 3300025915 Bacteria 4471
279 Ga0207693_10051082 3300025915 Bacteria 3246
280 Ga0207693_10083737 3300025915 Bacteria 2499
281 Ga0207693_10109173 3300025915 Bacteria 2170
282 Ga0207663_10001979 3300025916 Bacteria 9717
283 Ga0207663_10006434 3300025916 Bacteria 6008
284 Ga0207663_10015611 3300025916 Bacteria 4194
285 Ga0207663_10043697 3300025916 Bacteria 2746
286 Ga0207660_10014180 3300025917 Bacteria 5233
287 Ga0207660_10179692 3300025917 Bacteria 1643
288 Ga0207657_10002910 3300025919 Bacteria 18383
289 Ga0207657_10029030 3300025919 Bacteria 5040
290 Ga0207657_10076639 3300025919 Bacteria 2820
291 Ga0207657_10186508 3300025919 Bacteria 1675
292 Ga0207652_10057241 3300025921 Bacteria 3357
293 Ga0207652_10099805 3300025921 Bacteria 2562
294 Ga0207646_10095799 3300025922 Bacteria 2659
295 Ga0207681_10253291 3300025923 Bacteria 1375
296 Ga0207694_10000212 3300025924 Bacteria 56506
297 Ga0207694_10020078 3300025924 Bacteria 5053
298 Ga0207694_10078059 3300025924 Bacteria 2595
299 Ga0207694_10143146 3300025924 Bacteria 1923
300 Ga0207659_10054790 3300025926 Bacteria 2849
301 Ga0207700_10001341 3300025928 Bacteria 13962
302 Ga0207700_10038868 3300025928 Bacteria 3458
303 Ga0207700_10073685 3300025928 Bacteria 2638
304 Ga0207700_10292772 3300025928 Bacteria 1404
305 Ga0207664_10033246 3300025929 Bacteria 3961
306 Ga0207664_10036057 3300025929 Bacteria 3821
307 Ga0207664_10038518 3300025929 Bacteria 3708
308 Ga0207664_10075472 3300025929 Bacteria 2726
309 Ga0207664_10140288 3300025929 Bacteria 2044
310 Ga0207644_10151431 3300025931 Bacteria 1795
311 Ga0207644_10254249 3300025931 Bacteria 1403
312 Ga0207706_10023317 3300025933 Bacteria 5559
313 Ga0207706_10087663 3300025933 Bacteria 2737
314 Ga0207706_10133439 3300025933 Bacteria 2184
315 Ga0207709_10013744 3300025935 Bacteria 4467
316 Ga0207669_10050072 3300025937 Bacteria 2494
317 Ga0207704_10052956 3300025938 Bacteria 2463
318 Ga0207704_10133699 3300025938 Bacteria 1723
319 Ga0207665_10000361 3300025939 Bacteria 31561
320 Ga0207665_10005543 3300025939 Bacteria 8419
321 Ga0207665_10096560 3300025939 Bacteria 2056
322 Ga0207665_10097429 3300025939 Bacteria 2047
323 Ga0207691_10154226 3300025940 Bacteria 2018
324 Ga0207711_10040725 3300025941 Bacteria 3953
325 Ga0207689_10140785 3300025942 Bacteria 1987
326 Ga0207661_10004270 3300025944 Bacteria 10004
327 Ga0207661_10040922 3300025944 Bacteria 3646
328 Ga0207667_10007538 3300025949 Bacteria 13058
329 Ga0207667_10020042 3300025949 Bacteria 7447
330 Ga0207667_10020500 3300025949 Bacteria 7349
331 Ga0207667_10096966 3300025949 Bacteria 3043
332 Ga0207667_10183322 3300025949 Bacteria 2149
333 Ga0207667_10339810 3300025949 Bacteria 1532
334 Ga0207712_10070275 3300025961 Bacteria 2515
335 Ga0207712_10124876 3300025961 Bacteria 1953
336 Ga0207668_10080761 3300025972 Bacteria 2356
337 Ga0207668_10274169 3300025972 Bacteria 1380
338 Ga0207640_10054473 3300025981 Bacteria 2615
339 Ga0207677_10240867 3300026023 Bacteria 1463
340 Ga0207703_10190870 3300026035 Bacteria 1814
341 Ga0207703_10242709 3300026035 Bacteria 1620
342 Ga0207639_10002809 3300026041 Bacteria 11682
343 Ga0207639_10009638 3300026041 Bacteria 6672
344 Ga0207639_10142632 3300026041 Bacteria 1997
345 Ga0207639_10190810 3300026041 Bacteria 1750
346 Ga0207639_10350805 3300026041 Bacteria 1318
347 Ga0207678_10087674 3300026067 Bacteria 2660
348 Ga0207678_10092146 3300026067 Bacteria 2590
349 Ga0207678_10096270 3300026067 Bacteria 2529
350 Ga0207678_10142099 3300026067 Bacteria 2049
351 Ga0207702_10000003 3300026078 Bacteria 434196
352 Ga0207702_10000041 3300026078 Bacteria 150754
353 Ga0207702_10080857 3300026078 Bacteria 2820
354 Ga0207702_10183373 3300026078 Bacteria 1929
355 Ga0207702_10302247 3300026078 Bacteria 1519
356 Ga0207641_10119826 3300026088 Bacteria 2346
357 Ga0207648_10013629 3300026089 Bacteria 7547
358 Ga0207676_10045662 3300026095 Bacteria 3386
359 Ga0207676_10212523 3300026095 Bacteria 1717
360 Ga0207676_10305386 3300026095 Bacteria 1454
361 Ga0207674_10004756 3300026116 Bacteria 16280
362 Ga0207674_10026464 3300026116 Bacteria 6159
363 Ga0207674_10186131 3300026116 Bacteria 2027
364 Ga0207674_10445603 3300026116 Bacteria 1251
365 Ga0207675_100058237 3300026118 Bacteria 3606
366 Ga0207683_10096466 3300026121 Bacteria 2636
367 Ga0207698_10021924 3300026142 Bacteria 4427
368 Ga0207698_10313711 3300026142 Bacteria 1465
369 Ga0209389_1000004 3300027296 Bacteria 263759
370 Ga0209389_1000023 3300027296 Bacteria 150730
371 Ga0209589_1000006 3300027357 Bacteria 436292
372 Ga0209589_1000010 3300027357 Bacteria 237657
373 Ga0209489_100007 3300027361 Bacteria 436292
374 Ga0209489_100011 3300027361 Bacteria 244710
375 Ga0209489_100295 3300027361 Bacteria 87273
376 Ga0209700_100008 3300027363 Bacteria 436292
377 Ga0209700_100013 3300027363 Bacteria 341906
378 Ga0268266_10006027 3300028379 Bacteria 11179
379 Ga0268266_10031060 3300028379 Bacteria 4536
380 Ga0268266_10118886 3300028379 Bacteria 2350
381 Ga0268266_10142144 3300028379 Bacteria 2154
382 Ga0268266_10170332 3300028379 Bacteria 1976
383 Ga0268265_10010132 3300028380 Bacteria 6365
384 Ga0268264_10000093 3300028381 Bacteria 232057
385 Ga0265337_1016134 3300028556 Bacteria 2424
386 Ga0265323_10007415 3300028653 Bacteria 4559
387 Ga0307517_10000085 3300028786 Bacteria 131200
388 Ga0307515_10279100 3300028794 Bacteria 1380
389 Ga0265338_10000328 3300028800 Bacteria 86546
390 Ga0265324_10018488 3300029957 Bacteria 2519
391 Ga0307511_10123048 3300030521 Bacteria 1595
392 Ga0265330_10032732 3300031235 Bacteria 2328
393 Ga0265330_10043222 3300031235 Bacteria 1994
394 Ga0265330_10054608 3300031235 Bacteria 1746
395 Ga0265332_10011026 3300031238 Bacteria 4016
396 Ga0265332_10033057 3300031238 Bacteria 2252
397 Ga0265325_10005212 3300031241 Bacteria 8068
398 Ga0265325_10011412 3300031241 Bacteria 5106
399 Ga0265329_10060793 3300031242 Bacteria 1197
400 Ga0265340_10002779 3300031247 Bacteria 9978
401 Ga0265340_10068419 3300031247 Bacteria 1686
402 Ga0265340_10074215 3300031247 Bacteria 1609
403 Ga0265339_10017239 3300031249 Bacteria 4281
404 Ga0265339_10063209 3300031249 Bacteria 1989
405 Ga0265331_10014674 3300031250 Bacteria 4163
406 Ga0265331_10018816 3300031250 Bacteria 3572
407 Ga0265331_10059130 3300031250 Bacteria 1813
408 Ga0265316_10136317 3300031344 Bacteria 1846
409 Ga0307509_10014739 3300031507 Bacteria 9167
410 Ga0307509_10127238 3300031507 Bacteria 2511
411 Ga0307509_10183857 3300031507 Bacteria 1951
412 Ga0265313_10031838 3300031595 Bacteria 2700
413 Ga0265313_10111789 3300031595 Bacteria 1200
414 Ga0307508_10000034 3300031616 Bacteria 160115
415 Ga0265314_10069718 3300031711 Bacteria 2358
416 Ga0265342_10006824 3300031712 Bacteria 8440
417 Ga0265342_10009227 3300031712 Bacteria 6978
418 Ga0307516_10012343 3300031730 Bacteria 9215
419 Ga0307516_10019297 3300031730 Bacteria 7063
420 Ga0307516_10035813 3300031730 Bacteria 4975
421 Ga0307516_10054377 3300031730 Bacteria 3912
422 Ga0307516_10118891 3300031730 Bacteria 2436
423 Ga0307412_10163491 3300031911 Bacteria 1657
424 Ga0307510_10004348 3300033180 Bacteria 16677
425 Ga0307510_10036621 3300033180 Bacteria 5458
426 Ga0315911_1000010 3300033442 Bacteria 322197
427 Ga0373926_0069513 3300035083 Bacteria 1292
428 Ga0373934_0018964 3300035086 Bacteria 2636
429 Ga0373923_0002407 3300035111 Bacteria 5748
430 Ga0373923_0069761 3300035111 Bacteria 1507
431 Ga0373936_0006093 3300035113 Bacteria 4543
432 Ga0373936_0069904 3300035113 Bacteria 1445
433 Ga0373945_0008267 3300035116 Bacteria 3385
434 Ga0373956_0054801 3300035119 Bacteria 1797
435 Ga0373956_0097869 3300035119 Bacteria 1358
436 Ga0373957_0001068 3300035120 Bacteria 7227
437 Ga0373957_0022511 3300035120 Bacteria 2246
438 Ga0373943_0006580 3300035170 Bacteria 5212
439 Ga0373943_0007994 3300035170 Bacteria 4747
440 Ga0373946_0007122 3300035171 Bacteria 4084
441 Ga0373946_0029419 3300035171 Bacteria 2186
442 Ga0373955_0000880 3300035172 Bacteria 12889
443 Ga0373955_0032414 3300035172 Bacteria 2742
444 Ga0373942_0030249 3300035207 Bacteria 1426
445 Ga0373924_0002398 3300035410 Bacteria 6306
446 Ga0373924_0006697 3300035410 Bacteria 4137
447 Ga0373924_0017618 3300035410 Bacteria 2742
448 Ga0373931_0094054 3300035691 Bacteria 1675
449 Ga0373935_0000259 3300035692 Bacteria 26229
450 Ga0373935_0074169 3300035692 Bacteria 2199
451 Ga0373927_0002379 3300035695 Bacteria 13707
452 Ga0373927_0004958 3300035695 Bacteria 9228
453 Ga0373927_0118562 3300035695 Bacteria 1727
454 Ga0373933_0001150 3300035724 Bacteria 15688
455 Ga0373933_0002191 3300035724 Bacteria 11169
456 Ga0373933_0028214 3300035724 Bacteria 3236
457 Ga0373933_0146828 3300035724 Bacteria 1492
458 Ga0373947_0000217 3300035725 Bacteria 32254
459 Ga0373947_0010938 3300035725 Bacteria 5211
460 Ga0373947_0012207 3300035725 Bacteria 4919
461 Ga0373947_0013046 3300035725 Bacteria 4764
462 Ga0373947_0097834 3300035725 Bacteria 1840
463 Ga0373947_0183242 3300035725 Bacteria 1364
464 Ga0373937_0006578 3300036401 Bacteria 10035
465 Ga0373937_0012724 3300036401 Bacteria 7406
466 Ga0373937_0022213 3300036401 Bacteria 5702
467 Ga0373925_0004501 3300037068 Bacteria 10530
468 Ga0373925_0026107 3300037068 Bacteria 4272
469 Ga0373925_0041268 3300037068 Bacteria 3420
470 Ga0373925_0057981 3300037068 Bacteria 2902
471 Ga0373925_0072762 3300037068 Bacteria 2601
472 Ga0373925_0095574 3300037068 Bacteria 2276
473 Ga0395900_0001924 3300037418 Bacteria 23564
474 Ga0395900_0323270 3300037418 Bacteria 1522
475 Ga0395898_0013875 3300037466 Bacteria 8282
476 Ga0395898_0020243 3300037466 Bacteria 6760
477 Ga0395898_0059500 3300037466 Bacteria 3716
478 Ga0395898_0212975 3300037466 Bacteria 1843
479 Ga0395905_0091606 3300037471 Bacteria 2850
480 Ga0395905_0092596 3300037471 Bacteria 2835
481 Ga0436364_0578778 3300037853 Bacteria 5418
482 Ga0395901_0015985 3300038443 Bacteria 7647
483 Ga0395901_0268461 3300038443 Bacteria 1775
484 Ga0395901_0411236 3300038443 Bacteria 1389
485 Ga0436365_0425471 3300039437 Bacteria 2620
486 Ga0436365_0698518 3300039437 Bacteria 1563
487 Ga0436365_1129324 3300039437 Bacteria 1958
488 Ga0436360_0973324 3300039438 Bacteria 3801
489 Ga0436361_1121961 3300039447 Bacteria 4323
490 Ga0436361_1213962 3300039447 Bacteria 1309
491 Ga0436363_0248819 3300039450 Bacteria 3382
492 Ga0436363_1154387 3300039450 Bacteria 1372
493 Ga0436362_0646134 3300039453 Bacteria 7178
494 Ga0436362_0766994 3300039453 Bacteria 1153
495 Ga0439465_0023650 3300041413 Bacteria 1934
496 Ga0466972_0000520 3300044658 Bacteria 19029
497 Ga0466972_0004454 3300044658 Bacteria 7005
498 Ga0466965_0085586 3300044683 Bacteria 1598
499 Ga0466966_0035979 3300044684 Bacteria 3198
500 Ga0466966_0047681 3300044684 Bacteria 2731
501 Ga0466961_0000149 3300044693 Bacteria 47561
502 Ga0466961_0070374 3300044693 Bacteria 2221
503 Ga0466963_0073746 3300044694 Bacteria 2301
504 Ga0466964_0088337 3300044706 Bacteria 1344
505 Ga0466968_0029898 3300044735 Bacteria 2255
506 Ga0466957_0017500 3300044842 Bacteria 4199
507 Ga0466960_0080589 3300044901 Bacteria 1639
508 Ga0466959_0004087 3300045049 Bacteria 9713
509 Ga0466959_0115308 3300045049 Bacteria 1914
510 Ga0466959_0156110 3300045049 Bacteria 1606
511 Ga0466967_0034405 3300045976 Bacteria 4301
512 Ga0466967_0040762 3300045976 Bacteria 3999
513 Ga0466967_0073074 3300045976 Bacteria 3076
514 Ga0495592_0008207 3300046454 Bacteria 7841
515 Ga0495592_0020912 3300046454 Bacteria 4978
516 Ga0495592_0029636 3300046454 Bacteria 4143
517 Ga0495592_0037847 3300046454 Bacteria 3630
518 Ga0495592_0114531 3300046454 Bacteria 1904
519 Ga0495603_0000352 3300046455 Bacteria 24722
520 Ga0495603_0014404 3300046455 Bacteria 4784
521 Ga0495603_0036212 3300046455 Bacteria 2962
522 Ga0495603_0079416 3300046455 Bacteria 1923
523 Ga0495590_0039148 3300046457 Bacteria 1654
524 Ga0495629_0003719 3300046459 Bacteria 11498
525 Ga0495629_0051707 3300046459 Bacteria 2875
526 Ga0495629_0108425 3300046459 Bacteria 1937
527 Ga0495638_0009309 3300046460 Bacteria 6904
528 Ga0495638_0014656 3300046460 Bacteria 5289
529 Ga0495638_0089820 3300046460 Bacteria 1852
530 Ga0495641_0006337 3300046461 Bacteria 7689
531 Ga0495641_0044210 3300046461 Bacteria 2056
532 Ga0495651_0003972 3300046462 Bacteria 11306
533 Ga0495651_0008150 3300046462 Bacteria 8034
534 Ga0495651_0009605 3300046462 Bacteria 7433
535 Ga0495651_0028771 3300046462 Bacteria 4331
536 Ga0495653_0012753 3300046463 Bacteria 6862
537 Ga0495653_0025837 3300046463 Bacteria 4712
538 Ga0495653_0039637 3300046463 Bacteria 3689
539 Ga0495653_0083742 3300046463 Bacteria 2351
540 Ga0495650_0024728 3300046471 Bacteria 2832
541 Ga0495580_0018652 3300046472 Bacteria 5163
542 Ga0495580_0059795 3300046472 Bacteria 2678
543 Ga0495580_0116513 3300046472 Bacteria 1855
544 Ga0495582_0000245 3300046473 Bacteria 30263
545 Ga0495582_0035658 3300046473 Bacteria 2736
546 Ga0495639_0020850 3300046475 Bacteria 2865
547 Ga0495662_0000872 3300046476 Bacteria 14723
548 Ga0495662_0075317 3300046476 Bacteria 1638
549 Ga0495664_0004666 3300046477 Bacteria 7494
550 Ga0495664_0020886 3300046477 Bacteria 3780
551 Ga0495664_0027890 3300046477 Bacteria 3294
552 Ga0495664_0036188 3300046477 Bacteria 2909
553 Ga0495664_0070105 3300046477 Bacteria 2093
554 Ga0495594_0001300 3300046499 Bacteria 13017
555 Ga0495594_0038102 3300046499 Bacteria 2624
556 Ga0495606_0015892 3300046507 Bacteria 5775
557 Ga0495606_0022638 3300046507 Bacteria 4571
558 Ga0495606_0160731 3300046507 Bacteria 1311
559 Ga0495608_0041347 3300046511 Bacteria 3085
560 Ga0495616_0032875 3300046513 Bacteria 2707
561 Ga0495618_0009256 3300046514 Bacteria 5944
562 Ga0495618_0017563 3300046514 Bacteria 4389
563 Ga0495618_0039877 3300046514 Bacteria 2953
564 Ga0495620_0046480 3300046515 Bacteria 1874
565 Ga0495628_0005097 3300046516 Bacteria 11546
566 Ga0495628_0040062 3300046516 Bacteria 3745
567 Ga0495630_0009422 3300046517 Bacteria 7019
568 Ga0495630_0051936 3300046517 Bacteria 3069
569 Ga0495630_0236611 3300046517 Bacteria 1395
570 Ga0495632_0074302 3300046519 Bacteria 1628
571 Ga0495643_0060904 3300046522 Bacteria 2002
572 Ga0495644_0006757 3300046523 Bacteria 4442
573 Ga0495648_0001680 3300046524 Bacteria 21407
574 Ga0495648_0019543 3300046524 Bacteria 4760
575 Ga0495648_0058195 3300046524 Bacteria 2312
576 Ga0495666_0003461 3300046526 Bacteria 7971
577 Ga0495652_0061223 3300046529 Bacteria 3178
578 Ga0495652_0087350 3300046529 Bacteria 2558
579 Ga0495652_0112503 3300046529 Bacteria 2187
580 Ga0495652_0156871 3300046529 Bacteria 1771
581 Ga0495652_0279926 3300046529 Bacteria 1222
582 Ga0495665_0000361 3300046531 Bacteria 22971
583 Ga0495665_0168695 3300046531 Bacteria 1140
584 Ga0495640_0003002 3300046533 Bacteria 13580
585 Ga0495640_0017400 3300046533 Bacteria 5359
586 Ga0495640_0022271 3300046533 Bacteria 4634
587 Ga0495640_0034231 3300046533 Bacteria 3604
588 Ga0495587_0017008 3300046536 Bacteria 4521
589 Ga0495621_0048207 3300046539 Bacteria 1516
590 Ga0495645_0001286 3300046543 Bacteria 17104
591 Ga0495645_0020761 3300046543 Bacteria 4744
592 Ga0495645_0023607 3300046543 Bacteria 4455
593 Ga0495645_0083631 3300046543 Bacteria 2287
594 Ga0495645_0203809 3300046543 Bacteria 1340
595 Ga0495622_0006317 3300046557 Bacteria 5501
596 Ga0495622_0079611 3300046557 Bacteria 1508
597 Ga0495633_0063543 3300046558 Bacteria 1727
598 Ga0495667_0012248 3300046559 Bacteria 5812
599 Ga0495667_0033462 3300046559 Bacteria 3440
600 Ga0495667_0126311 3300046559 Bacteria 1650
601 Ga0495656_0004410 3300046615 Bacteria 4818
602 Ga0495668_0091477 3300046616 Bacteria 1667
603 Ga0495634_0000249 3300046642 Bacteria 50835
604 Ga0495634_0012218 3300046642 Bacteria 6225
605 Ga0495634_0022747 3300046642 Bacteria 4415
606 Ga0495634_0068360 3300046642 Bacteria 2347
607 Ga0495634_0109805 3300046642 Bacteria 1774
608 Ga0495625_0036379 3300046660 Bacteria 3619
609 Ga0495635_0000239 3300046663 Bacteria 34889
610 Ga0495635_0003846 3300046663 Bacteria 10429
611 Ga0495635_0014377 3300046663 Bacteria 5536
612 Ga0495635_0081350 3300046663 Bacteria 2216
613 Ga0495635_0095584 3300046663 Bacteria 2031
614 Ga0495661_0012048 3300046665 Bacteria 5851
615 Ga0495588_0069307 3300046674 Bacteria 1833
616 Ga0495657_0003492 3300046675 Bacteria 12822
617 Ga0495657_0006927 3300046675 Bacteria 8808
618 Ga0495657_0026654 3300046675 Bacteria 4090
619 Ga0495599_0001556 3300046678 Bacteria 13209
620 Ga0495599_0008411 3300046678 Bacteria 6272
621 Ga0495599_0016849 3300046678 Bacteria 4539
622 Ga0495623_0002296 3300046679 Bacteria 12741
623 Ga0495623_0009107 3300046679 Bacteria 6440
624 Ga0495623_0010478 3300046679 Bacteria 6000
625 Ga0495646_0001918 3300046680 Bacteria 12509
626 Ga0495646_0005453 3300046680 Bacteria 8043
627 Ga0495646_0011250 3300046680 Bacteria 5683
628 Ga0495646_0102031 3300046680 Bacteria 1644
629 Ga0495647_0003088 3300046681 Bacteria 5318
630 Ga0495647_0022746 3300046681 Bacteria 2267
631 Ga0495647_0030086 3300046681 Bacteria 2013
632 Ga0495658_0001058 3300046683 Bacteria 14532
633 Ga0495658_0019298 3300046683 Bacteria 3556
634 Ga0495658_0102410 3300046683 Bacteria 1711
635 Ga0495669_0052607 3300046684 Bacteria 1830
636 Ga0495613_0000929 3300046689 Bacteria 22466
637 Ga0495613_0067749 3300046689 Bacteria 2605
638 Ga0495613_0255689 3300046689 Bacteria 1221
639 Ga0495624_0000538 3300046690 Bacteria 29656
640 Ga0495624_0184045 3300046690 Bacteria 1272
641 Ga0495670_0017939 3300046691 Bacteria 3486
642 Ga0495671_0055254 3300046692 Bacteria 1967
643 Ga0495671_0102419 3300046692 Bacteria 1399
644 Ga0495649_0085341 3300046694 Bacteria 1685
645 Ga0495589_0069305 3300046794 Bacteria 1725
646 Ga0495600_0002229 3300046809 Bacteria 11033
647 Ga0495600_0029557 3300046809 Bacteria 3548
648 Ga0495581_0001238 3300047315 Bacteria 14050
649 Ga0495581_0057166 3300047315 Bacteria 2252
650 Ga0495604_0005469 3300047317 Bacteria 10075
651 Ga0495604_0074523 3300047317 Bacteria 2557
652 Ga0495604_0134829 3300047317 Bacteria 1770
653 Ga0495604_0204143 3300047317 Bacteria 1369
654 Ga0495674_0001854 3300047319 Bacteria 20818
655 Ga0495674_0020768 3300047319 Bacteria 6080
656 Ga0495674_0021792 3300047319 Bacteria 5921
657 Ga0495674_0113269 3300047319 Bacteria 2297
658 Ga0495672_0036441 3300047320 Bacteria 3020
659 Ga0495672_0062942 3300047320 Bacteria 2131
660 Ga0495676_0027183 3300047321 Bacteria 4911
661 Ga0495680_0021114 3300047322 Bacteria 5456
662 Ga0495680_0024023 3300047322 Bacteria 5062
663 Ga0495680_0131314 3300047322 Bacteria 1840
664 Ga0495687_043987 3300047443 Bacteria 1943
665 Ga0495675_0062117 3300047444 Bacteria 2365
666 Ga0495677_0080575 3300047445 Bacteria 1220
667 Ga0495673_0010245 3300047469 Bacteria 5114
668 Ga0495681_0039134 3300047470 Bacteria 2318
669 Ga0495684_0000893 3300047471 Bacteria 24119
670 Ga0495684_0003057 3300047471 Bacteria 13153
671 Ga0495593_0000034 3300047673 Bacteria 57993
672 Ga0495593_0005088 3300047673 Bacteria 7774
673 Ga0495593_0030123 3300047673 Bacteria 2971
674 Ga0495602_0025294 3300048088 Bacteria 5747
675 Ga0495602_0045096 3300048088 Bacteria 3992
676 Ga0495614_0012106 3300048089 Bacteria 3788
677 Ga0495615_0022350 3300048090 Bacteria 1438
678 Ga0496100_0024419 3300048903 Bacteria 3687
679 Ga0496100_0035051 3300048903 Bacteria 3154
680 Ga0496100_0221778 3300048903 Bacteria 1388
681 Ga0496101_0005889 3300048904 Bacteria 7849
682 Ga0496101_0022103 3300048904 Bacteria 4376
683 Ga0496101_0075060 3300048904 Bacteria 2488
684 Ga0496101_0086002 3300048904 Bacteria 2331
685 Ga0496102_0041716 3300048905 Bacteria 4157
686 Ga0496102_0085515 3300048905 Bacteria 2912
687 Ga0496102_0129517 3300048905 Bacteria 2360
688 Ga0496102_0169801 3300048905 Bacteria 2053
689 Ga0496103_0148981 3300048906 Bacteria 1498
690 Ga0496104_0044141 3300048907 Bacteria 4188
691 Ga0496104_0078027 3300048907 Bacteria 3156
692 Ga0496104_0085182 3300048907 Bacteria 3016
693 Ga0496104_0176933 3300048907 Bacteria 2044
694 Ga0496104_0198086 3300048907 Bacteria 1920
695 Ga0496105_0017518 3300048908 Bacteria 5746
696 Ga0496105_0082763 3300048908 Bacteria 2651
697 Ga0496105_0085675 3300048908 Bacteria 2603
698 Ga0496106_0000649 3300048909 Bacteria 24884
699 Ga0496106_0001165 3300048909 Bacteria 19535
700 Ga0496106_0082778 3300048909 Bacteria 2467
701 Ga0496106_0281869 3300048909 Bacteria 1331
702 Ga0496106_0377205 3300048909 Bacteria 1140
703 Ga0496107_0025520 3300048910 Bacteria 4185
704 Ga0496107_0028181 3300048910 Bacteria 3990
705 Ga0496107_0043555 3300048910 Bacteria 3225
706 Ga0496107_0048989 3300048910 Bacteria 3044
707 Ga0496107_0202412 3300048910 Bacteria 1476
708 Ga0496108_0000744 3300048911 Bacteria 25343
709 Ga0496108_0247857 3300048911 Bacteria 1549
710 Ga0496109_0001766 3300048912 Bacteria 17962
711 Ga0496109_0048359 3300048912 Bacteria 3870
712 Ga0496109_0303289 3300048912 Bacteria 1506
713 Ga0496109_0309442 3300048912 Bacteria 1490
714 Ga0496109_0356227 3300048912 Bacteria 1382
715 Ga0496110_0006833 3300048913 Bacteria 9070
716 Ga0496110_0018692 3300048913 Bacteria 5814
717 Ga0496110_0056020 3300048913 Bacteria 3469
718 Ga0496110_0085668 3300048913 Bacteria 2812
719 Ga0496110_0112391 3300048913 Bacteria 2449
720 Ga0496110_0114120 3300048913 Bacteria 2431
721 Ga0496110_0161215 3300048913 Bacteria 2033
722 Ga0496111_0031499 3300048914 Bacteria 3778
723 Ga0496111_0121446 3300048914 Bacteria 1929
724 Ga0496111_0184210 3300048914 Bacteria 1552
725 Ga0496112_0000008 3300048915 Bacteria 310323
726 Ga0496112_0050851 3300048915 Bacteria 4064
727 Ga0496112_0157994 3300048915 Bacteria 2234
728 Ga0496112_0181663 3300048915 Bacteria 2067
729 Ga0496112_0226149 3300048915 Bacteria 1826
730 Ga0496114_0089217 3300048917 Bacteria 2616
731 Ga0496114_0098129 3300048917 Bacteria 2497
732 Ga0496114_0174356 3300048917 Bacteria 1876
733 Ga0496114_0259154 3300048917 Bacteria 1531
734 Ga0496115_0007272 3300048918 Bacteria 8144
735 Ga0496115_0015832 3300048918 Bacteria 5728
736 Ga0496115_0073171 3300048918 Bacteria 2781
737 Ga0496115_0096862 3300048918 Bacteria 2416
738 Ga0496115_0117402 3300048918 Bacteria 2188
739 Ga0496115_0140716 3300048918 Bacteria 1991
740 Ga0496116_0007242 3300048919 Bacteria 9890
741 Ga0496117_0021643 3300048920 Bacteria 5193
742 Ga0496117_0153317 3300048920 Bacteria 1360
743 Ga0496118_0013219 3300048921 Bacteria 7828
744 Ga0496118_0051899 3300048921 Bacteria 3133
745 Ga0496118_0071624 3300048921 Bacteria 2494
746 Ga0496119_0053236 3300048922 Bacteria 2474
747 Ga0496119_0068363 3300048922 Bacteria 2092
748 Ga0496119_0068812 3300048922 Bacteria 2083
749 Ga0496119_0076546 3300048922 Bacteria 1941
750 Ga0496120_0103874 3300048923 Bacteria 1496
751 Ga0496121_0000476 3300048924 Bacteria 78015
752 Ga0496121_0001497 3300048924 Bacteria 39336
753 Ga0496121_0001742 3300048924 Bacteria 35564
754 Ga0496121_0003089 3300048924 Bacteria 24095
755 Ga0496121_0015642 3300048924 Bacteria 7916
756 Ga0496121_0017380 3300048924 Bacteria 7352
757 Ga0496121_0025084 3300048924 Bacteria 5674
758 Ga0496121_0036908 3300048924 Bacteria 4348
759 Ga0496121_0038697 3300048924 Bacteria 4216
760 Ga0496121_0049287 3300048924 Bacteria 3572
761 Ga0496121_0053890 3300048924 Bacteria 3366
762 Ga0496121_0082348 3300048924 Bacteria 2544
763 Ga0496121_0083650 3300048924 Bacteria 2519
764 Ga0496121_0099916 3300048924 Bacteria 2241
765 Ga0496122_0055284 3300048925 Bacteria 2971
766 Ga0496122_0060464 3300048925 Bacteria 2790
767 Ga0496122_0089939 3300048925 Bacteria 2097
768 Ga0496123_0090680 3300048926 Bacteria 1816
769 Ga0496123_0096202 3300048926 Bacteria 1739
770 Ga0496124_0001128 3300048927 Bacteria 42017
771 Ga0496124_0090921 3300048927 Bacteria 2488
772 Ga0496124_0153432 3300048927 Bacteria 1804
773 Ga0496124_0165776 3300048927 Bacteria 1717
774 Ga0496124_0173653 3300048927 Bacteria 1666
775 Ga0496125_0000154 3300048928 Bacteria 152240
776 Ga0496125_0015007 3300048928 Bacteria 7523
777 Ga0496125_0044841 3300048928 Bacteria 3731
778 Ga0496125_0153920 3300048928 Bacteria 1574
779 Ga0496126_0002744 3300048929 Bacteria 23267
780 Ga0496126_0006113 3300048929 Bacteria 13500
781 Ga0496126_0009402 3300048929 Bacteria 10385
782 Ga0496126_0015910 3300048929 Bacteria 7552
783 Ga0496126_0020832 3300048929 Bacteria 6418
784 Ga0496126_0032430 3300048929 Bacteria 4920
785 Ga0496126_0053931 3300048929 Bacteria 3645
786 Ga0496126_0079933 3300048929 Bacteria 2893
787 Ga0496126_0089718 3300048929 Bacteria 2705
788 Ga0496126_0094162 3300048929 Bacteria 2629
789 Ga0496126_0188462 3300048929 Bacteria 1748
790 Ga0496126_0191581 3300048929 Bacteria 1731
791 Ga0496126_0202508 3300048929 Bacteria 1675
792 Ga0496126_0319939 3300048929 Bacteria 1275
793 Ga0501031_0012949 3300049568 Bacteria 5445
794 Ga0501031_0064009 3300049568 Bacteria 2395
795 Ga0501032_0003534 3300049569 Bacteria 11926
796 Ga0501032_0012670 3300049569 Bacteria 6012
797 Ga0501032_0020626 3300049569 Bacteria 4587
798 Ga0501032_0082398 3300049569 Bacteria 2140
799 Ga0501032_0119010 3300049569 Bacteria 1746
800 Ga0501032_0208172 3300049569 Bacteria 1275
801 Ga0501033_0000249 3300049570 Bacteria 52045
802 Ga0501033_0000951 3300049570 Bacteria 26299
803 Ga0501033_0229418 3300049570 Bacteria 1319
804 Ga0501034_0000197 3300049571 Bacteria 114088
805 Ga0501034_0001938 3300049571 Bacteria 26206
806 Ga0501034_0136806 3300049571 Bacteria 2431
807 Ga0501034_0183501 3300049571 Bacteria 2056
808 Ga0501034_0286773 3300049571 Bacteria 1585
809 Ga0501034_0290404 3300049571 Bacteria 1573
810 Ga0501034_0348538 3300049571 Bacteria 1409
811 Ga0501036_0004433 3300049572 Bacteria 11343
812 Ga0501036_0026547 3300049572 Bacteria 4889
813 Ga0501036_0050620 3300049572 Bacteria 3517
814 Ga0501036_0095024 3300049572 Bacteria 2519
815 Ga0501037_0000112 3300049573 Bacteria 75698
816 Ga0501037_0067387 3300049573 Bacteria 2607
817 Ga0501037_0101975 3300049573 Bacteria 2070
818 Ga0501037_0130451 3300049573 Bacteria 1802
819 Ga0501038_0000160 3300049574 Bacteria 57443
820 Ga0501038_0002206 3300049574 Bacteria 18110
821 Ga0501038_0036532 3300049574 Bacteria 4311
822 Ga0501038_0038091 3300049574 Bacteria 4211
823 Ga0501038_0082118 3300049574 Bacteria 2714
824 Ga0501038_0145474 3300049574 Bacteria 1935
825 Ga0501038_0168699 3300049574 Bacteria 1773
826 Ga0501038_0233536 3300049574 Bacteria 1462
827 Ga0501038_0341018 3300049574 Bacteria 1168
828 Ga0501039_0000472 3300049575 Bacteria 29218
829 Ga0501039_0001057 3300049575 Bacteria 20191
830 Ga0501039_0017068 3300049575 Bacteria 5566
831 Ga0501039_0142515 3300049575 Bacteria 1882
832 Ga0501042_0015592 3300049578 Bacteria 5205
833 Ga0501042_0071253 3300049578 Bacteria 2486
834 Ga0501043_0000278 3300049579 Bacteria 46214
835 Ga0501043_0008635 3300049579 Bacteria 8029
836 Ga0501043_0022578 3300049579 Bacteria 4933
837 Ga0501043_0073668 3300049579 Bacteria 2682
838 Ga0501043_0096156 3300049579 Bacteria 2328
839 Ga0501043_0150931 3300049579 Bacteria 1818
840 Ga0501043_0215853 3300049579 Bacteria 1485
841 Ga0501046_0000937 3300049580 Bacteria 28581
842 Ga0501046_0008812 3300049580 Bacteria 8763
843 Ga0501046_0012556 3300049580 Bacteria 7204
844 Ga0501046_0021462 3300049580 Bacteria 5328
845 Ga0501046_0065853 3300049580 Bacteria 2825
846 Ga0501047_0000275 3300049581 Bacteria 59536
847 Ga0501047_0009938 3300049581 Bacteria 8998
848 Ga0501047_0073429 3300049581 Bacteria 3293
849 Ga0501047_0089000 3300049581 Bacteria 2964
850 Ga0501047_0122575 3300049581 Bacteria 2480
851 Ga0501047_0217062 3300049581 Bacteria 1769
852 Ga0501047_0336852 3300049581 Bacteria 1347
853 Ga0501048_0001248 3300049582 Bacteria 19253
854 Ga0501048_0011414 3300049582 Bacteria 6626
855 Ga0501048_0022723 3300049582 Bacteria 4584
856 Ga0501048_0036570 3300049582 Bacteria 3529
857 Ga0501067_0000258 3300049583 Bacteria 28937
858 Ga0501067_0013462 3300049583 Bacteria 4533
859 Ga0501067_0084036 3300049583 Bacteria 1766
860 Ga0501067_0092887 3300049583 Bacteria 1675
861 Ga0501068_0004146 3300049584 Bacteria 7852
862 Ga0501068_0015819 3300049584 Bacteria 4341
863 Ga0501068_0026245 3300049584 Bacteria 3431
864 Ga0501068_0064658 3300049584 Bacteria 2226
865 Ga0501068_0140272 3300049584 Bacteria 1515
866 Ga0501069_0013808 3300049585 Bacteria 4310
867 Ga0501069_0043425 3300049585 Bacteria 2488
868 Ga0501069_0115876 3300049585 Bacteria 1528
869 Ga0501070_0002548 3300049586 Bacteria 15964
870 Ga0501070_0006200 3300049586 Bacteria 10187
871 Ga0501070_0020554 3300049586 Bacteria 5537
872 Ga0501070_0063929 3300049586 Bacteria 3048
873 Ga0501070_0068502 3300049586 Bacteria 2937
874 Ga0501070_0085330 3300049586 Bacteria 2614
875 Ga0501070_0090347 3300049586 Bacteria 2535
876 Ga0501070_0314854 3300049586 Bacteria 1273
877 Ga0501071_0196477 3300049587 Bacteria 1514
878 Ga0501072_0003198 3300049588 Bacteria 12304
879 Ga0501073_0000103 3300049589 Bacteria 53962
880 Ga0501073_0038356 3300049589 Bacteria 3398
881 Ga0501073_0096064 3300049589 Bacteria 2058
882 Ga0501074_0000456 3300049590 Bacteria 24566
883 Ga0501074_0067246 3300049590 Bacteria 2577
884 Ga0501074_0085067 3300049590 Bacteria 2266
885 Ga0501076_0063997 3300049592 Bacteria 2931
886 Ga0501077_0104803 3300049593 Bacteria 1792
887 Ga0501079_0000451 3300049741 Bacteria 26871
888 Ga0501079_0010445 3300049741 Bacteria 7058
889 Ga0501080_0000082 3300049742 Bacteria 63972
890 Ga0501080_0002998 3300049742 Bacteria 14886
891 Ga0501080_0016338 3300049742 Bacteria 6854
892 Ga0501080_0071776 3300049742 Bacteria 3220
893 Ga0501080_0082435 3300049742 Bacteria 2987
894 Ga0501080_0349960 3300049742 Bacteria 1334
895 Ga0501080_0389057 3300049742 Bacteria 1255
896 Ga0501083_0009193 3300049744 Bacteria 6980
897 Ga0501083_0058731 3300049744 Bacteria 2573
898 Ga0501035_0000766 3300049822 Bacteria 34513
899 Ga0501035_0011386 3300049822 Bacteria 8244
900 Ga0501035_0018251 3300049822 Bacteria 6463
901 Ga0501035_0045134 3300049822 Bacteria 3965
902 Ga0501035_0078488 3300049822 Bacteria 2916
903 Ga0501035_0123726 3300049822 Bacteria 2259
904 Ga0501035_0124942 3300049822 Bacteria 2246
905 Ga0501035_0144301 3300049822 Bacteria 2068
906 Ga0501035_0159477 3300049822 Bacteria 1953
907 Ga0501044_0000418 3300049823 Bacteria 52554
908 Ga0501044_0024381 3300049823 Bacteria 6423
909 Ga0501044_0034063 3300049823 Bacteria 5345
910 Ga0501044_0078546 3300049823 Bacteria 3344
911 Ga0501044_0196236 3300049823 Bacteria 1978
912 Ga0501044_0218611 3300049823 Bacteria 1856
913 Ga0501044_0231316 3300049823 Bacteria 1796
914 Ga0501044_0238631 3300049823 Bacteria 1762
915 Ga0501044_0272344 3300049823 Bacteria 1628
916 Ga0501044_0325483 3300049823 Bacteria 1461
917 Ga0501044_0332956 3300049823 Bacteria 1440
918 Ga0501045_0038807 3300049824 Bacteria 3464
919 Ga0501045_0077486 3300049824 Bacteria 2450
920 nmdc:mga0yw44_1397_c1 3300050492 Bacteria 9573
921 nmdc:mga0yw44_17247_c1 3300050492 Bacteria 3925
922 nmdc:mga0yw44_94319_c1 3300050492 Bacteria 1897
923 nmdc:mga0k408_127339_c1 3300050493 Bacteria 1511
924 nmdc:mga06z11_31082_c1 3300050494 Bacteria 2591
925 nmdc:mga07m45_95447_c1 3300050496 Bacteria 1706
926 nmdc:mga08y16_196743_c1 3300050511 Bacteria 2089
927 nmdc:mga0n895_80110_c1 3300050512 Bacteria 3253
928 nmdc:mga0n895_82170_c1 3300050512 Bacteria 3211
929 nmdc:mga0rr50_152607_c1 3300050513 Bacteria 1868
930 nmdc:mga08x19_192730_c1 3300050514 Bacteria 1395
931 nmdc:mga08x19_24160_c1 3300050514 Bacteria 3773
932 nmdc:mga0a205_311035_c1 3300050515 Bacteria 1447
933 nmdc:mga0a205_3227_c1 3300050515 Bacteria 11031
934 nmdc:mga0sz30_22811_c2 3300050516 Bacteria 1867
935 Ga0495601_0009529 3300053077 Bacteria 5749
936 Ga0495601_0037183 3300053077 Bacteria 3043
937 Ga0495601_0083052 3300053077 Bacteria 2057
938 Ga0495601_0220392 3300053077 Bacteria 1239
939 Ga0495612_0046196 3300053078 Bacteria 1783
940 Ga0500635_0026172 3300053080 Bacteria 1844
941 Ga0495619_0077914 3300053085 Bacteria 2227
942 Ga0500578_0176816 3300053086 Bacteria 1317
943 Ga0500643_000267 3300053087 Bacteria 46005
944 Ga0500643_018509 3300053087 Bacteria 2310
945 Ga0500581_085026 3300053089 Bacteria 1574
946 Ga0500647_0017157 3300053091 Bacteria 3334
947 Ga0500583_0086589 3300053092 Bacteria 1520
948 Ga0500651_0000861 3300053093 Bacteria 14855
949 Ga0500566_0000157 3300053094 Bacteria 34534
950 Ga0500566_0000925 3300053094 Bacteria 16797
951 Ga0500566_0001146 3300053094 Bacteria 15389
952 Ga0500640_038114 3300053095 Bacteria 2111
953 Ga0500641_0058981 3300053096 Bacteria 1595
954 Ga0500650_0001493 3300053098 Bacteria 7107
955 Ga0500554_000718 3300053102 Bacteria 6703
956 Ga0500554_003128 3300053102 Bacteria 3348
957 Ga0500555_002718 3300053103 Bacteria 5083
958 Ga0500556_0000413 3300053104 Bacteria 31142
959 Ga0500557_000041 3300053105 Bacteria 64885
960 Ga0500569_001799 3300053109 Bacteria 4110
961 Ga0500572_001865 3300053111 Bacteria 5335
962 Ga0500592_004170 3300053116 Bacteria 2306
963 Ga0500594_0030081 3300053118 Bacteria 1424
964 Ga0500595_003818 3300053119 Bacteria 6928
965 Ga0500595_006228 3300053119 Bacteria 5095
966 Ga0500608_004754 3300053122 Bacteria 5296
967 Ga0500608_030350 3300053122 Bacteria 2562
968 Ga0500614_001219 3300053123 Bacteria 6263
969 Ga0500626_057934 3300053128 Bacteria 1736
970 Ga0500642_0000005 3300053130 Bacteria 422725
971 Ga0500642_0000140 3300053130 Bacteria 32282
972 Ga0500652_000531 3300053131 Bacteria 13423
973 Ga0500658_0011515 3300053134 Bacteria 3259
974 Ga0500658_0013696 3300053134 Bacteria 2999
975 Ga0500658_0044143 3300053134 Bacteria 1797
976 Ga0500658_0081505 3300053134 Bacteria 1385
977 Ga0500559_0003580 3300053136 Bacteria 7596
978 Ga0500559_0004212 3300053136 Bacteria 6885
979 Ga0500559_0018273 3300053136 Bacteria 2962
980 Ga0500568_0002109 3300053139 Bacteria 12007
981 Ga0500568_0011586 3300053139 Bacteria 4082
982 Ga0500568_0028346 3300053139 Bacteria 2335
983 Ga0500577_0000693 3300053142 Bacteria 8639
984 Ga0500603_000277 3300053150 Bacteria 13486
985 Ga0500603_001226 3300053150 Bacteria 5959
986 Ga0500604_0003539 3300053151 Bacteria 4205
987 Ga0500616_0000166 3300053153 Bacteria 110141
988 Ga0500616_0000180 3300053153 Bacteria 106053
989 Ga0500616_0028432 3300053153 Bacteria 3081
990 Ga0500622_0011079 3300053156 Bacteria 4922
991 Ga0500622_0029561 3300053156 Bacteria 2881
992 Ga0500624_002833 3300053157 Bacteria 2302
993 Ga0500630_014168 3300053159 Bacteria 3925
994 Ga0500634_0031081 3300053161 Bacteria 2911
995 Ga0500638_001014 3300053162 Bacteria 8145
996 Ga0500638_057858 3300053162 Bacteria 1866
997 Ga0500639_000014 3300053163 Bacteria 122926
998 Ga0500639_033548 3300053163 Bacteria 2713
999 Ga0500636_0001916 3300053177 Bacteria 11425
1000 Ga0500636_0011628 3300053177 Bacteria 5151
1001 Ga0500636_0028779 3300053177 Bacteria 3281
1002 Ga0500637_0000121 3300053178 Bacteria 28204
1003 Ga0500637_0002840 3300053178 Bacteria 7802
1004 Ga0500637_0103898 3300053178 Bacteria 1648
1005 Ga0500625_003212 3300053729 Bacteria 6395
1006 Ga0500609_004134 3300053731 Bacteria 2019
1007 Ga0500596_000810 3300053735 Bacteria 6182
1008 Ga0500601_000076 3300053737 Bacteria 20083
1009 Ga0501084_0003972 3300054114 Bacteria 12046
1010 Ga0501084_0222438 3300054114 Bacteria 1593
1011 Ga0500661_000452 3300055283 Bacteria 7586
1012 Ga0501082_0011183 3300060353 Bacteria 7713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2824635225 2824641055 337
2 iso_pu_bacteria 8019555841 8019559553 337
3 3300049569 Ga0501032_0208172 Ga0501032_0208172_14_1030 338
4 3300049574 Ga0501038_0233536 Ga0501038_0233536_14_1030 338
5 3300049579 Ga0501043_0215853 Ga0501043_0215853_14_1030 338
6 3300049581 Ga0501047_0217062 Ga0501047_0217062_14_1030 338
7 3300049585 Ga0501069_0115876 Ga0501069_0115876_13_1029 338
8 3300053086 Ga0500578_0176816 Ga0500578_0176816_275_1291 338
9 iso_pu_bacteria 2824732956 2824740138 339
10 3300053130 Ga0500642_0000140 Ga0500642_0000140_26551_27651 342
11 3300046539 Ga0495621_0048207 Ga0495621_0048207_247_1344 344
12 3300046455 Ga0495603_0079416 Ga0495603_0079416_563_1663 345
13 iso_pu_bacteria 2849076700 2849081530 345
14 3300006942 Ga0099824_1023697 Ga0099824_10236972 346
15 3300027296 Ga0209389_1000023 Ga0209389_100002310 346
16 3300027357 Ga0209589_1000010 Ga0209589_1000010149 346
17 3300027361 Ga0209489_100011 Ga0209489_10001187 346
18 3300047470 Ga0495681_0039134 Ga0495681_0039134_59_1162 346
19 3300009093 Ga0105240_10086587 Ga0105240_100865871 347
20 3300013104 Ga0157370_10254099 Ga0157370_102540991 347
21 3300025913 Ga0207695_10088253 Ga0207695_100882532 347
22 3300037466 Ga0395898_0013875 Ga0395898_0013875_5686_6786 347
23 3300038443 Ga0395901_0015985 Ga0395901_0015985_1826_2926 347
24 3300047320 Ga0495672_0036441 Ga0495672_0036441_890_1996 347
25 3300048913 Ga0496110_0161215 Ga0496110_0161215_804_1904 347
26 3300049822 Ga0501035_0144301 Ga0501035_0144301_973_2043 349
27 3300005434 Ga0070709_10010289 Ga0070709_100102892 350
28 3300005435 Ga0070714_100033934 Ga0070714_1000339343 350
29 3300005436 Ga0070713_100194184 Ga0070713_1001941842 350
30 3300005437 Ga0070710_10114774 Ga0070710_101147742 350
31 3300005614 Ga0068856_100011262 Ga0068856_1000112622 350
32 3300005616 Ga0068852_100162382 Ga0068852_1001623822 350
33 3300006173 Ga0070716_100097833 Ga0070716_1000978332 350
34 3300025253 Ga0209677_108387 Ga0209677_1083872 350
35 3300025919 Ga0207657_10186508 Ga0207657_101865082 350
36 3300026078 Ga0207702_10080857 Ga0207702_100808572 350
37 3300026142 Ga0207698_10313711 Ga0207698_103137112 350
38 3300048915 Ga0496112_0157994 Ga0496112_0157994_137_1237 350
39 3300048924 Ga0496121_0038697 Ga0496121_0038697_1699_2799 350
40 3300009148 Ga0105243_10272915 Ga0105243_102729152 351
41 3300025898 Ga0207692_10083406 Ga0207692_100834062 351
42 3300025906 Ga0207699_10030568 Ga0207699_100305682 351
43 3300025915 Ga0207693_10109173 Ga0207693_101091732 351
44 3300025929 Ga0207664_10140288 Ga0207664_101402882 351
45 3300030521 Ga0307511_10123048 Ga0307511_101230482 351
46 3300048929 Ga0496126_0188462 Ga0496126_0188462_452_1552 351
47 3300005435 Ga0070714_100113747 Ga0070714_1001137473 352
48 3300005535 Ga0070684_100006273 Ga0070684_1000062731 352
49 3300025944 Ga0207661_10004270 Ga0207661_100042702 352
50 3300031507 Ga0307509_10014739 Ga0307509_100147392 352
51 3300031730 Ga0307516_10012343 Ga0307516_100123436 352
52 3300046507 Ga0495606_0160731 Ga0495606_0160731_43_1146 352
53 3300005347 Ga0070668_100103950 Ga0070668_1001039502 353
54 3300005455 Ga0070663_100078956 Ga0070663_1000789562 353
55 3300025919 Ga0207657_10029030 Ga0207657_100290302 353
56 3300025949 Ga0207667_10096966 Ga0207667_100969662 353
57 3300026067 Ga0207678_10096270 Ga0207678_100962702 353
58 3300046477 Ga0495664_0070105 Ga0495664_0070105_176_1276 353
59 3300046684 Ga0495669_0052607 Ga0495669_0052607_147_1247 353
60 3300047445 Ga0495677_0080575 Ga0495677_0080575_58_1158 353
61 3300048903 Ga0496100_0035051 Ga0496100_0035051_1346_2446 353
62 3300048908 Ga0496105_0085675 Ga0496105_0085675_1216_2316 353
63 3300048909 Ga0496106_0082778 Ga0496106_0082778_889_1989 353
64 3300048910 Ga0496107_0048989 Ga0496107_0048989_313_1413 353
65 3300048912 Ga0496109_0303289 Ga0496109_0303289_217_1317 353
66 3300048915 Ga0496112_0226149 Ga0496112_0226149_230_1330 353
67 3300048917 Ga0496114_0089217 Ga0496114_0089217_912_2012 353
68 3300048918 Ga0496115_0073171 Ga0496115_0073171_802_1902 353
69 3300048924 Ga0496121_0015642 Ga0496121_0015642_2250_3350 353
70 3300025928 Ga0207700_10292772 Ga0207700_102927722 354
71 3300044684 Ga0466966_0047681 Ga0466966_0047681_1332_2486 354
72 3300045049 Ga0466959_0115308 Ga0466959_0115308_335_1489 354
73 3300049583 Ga0501067_0092887 Ga0501067_0092887_38_1138 354
74 3300010375 Ga0105239_10111365 Ga0105239_101113652 355
75 3300048909 Ga0496106_0377205 Ga0496106_0377205_20_1123 355
76 3300048924 Ga0496121_0036908 Ga0496121_0036908_1206_2306 355
77 3300009551 Ga0105238_10396014 Ga0105238_103960141 356
78 3300048927 Ga0496124_0090921 Ga0496124_0090921_51_1154 356
79 3300048918 Ga0496115_0096862 Ga0496115_0096862_839_1939 357
80 3300053091 Ga0500647_0017157 Ga0500647_0017157_1228_2328 357
81 3300053094 Ga0500566_0000925 Ga0500566_0000925_1637_2737 357
82 3300053095 Ga0500640_038114 Ga0500640_038114_793_1893 357
83 3300053111 Ga0500572_001865 Ga0500572_001865_1663_2763 357
84 3300053122 Ga0500608_030350 Ga0500608_030350_553_1653 357
85 3300053123 Ga0500614_001219 Ga0500614_001219_4741_5841 357
86 3300053136 Ga0500559_0004212 Ga0500559_0004212_3082_4182 357
87 3300053150 Ga0500603_001226 Ga0500603_001226_3152_4252 357
88 3300053159 Ga0500630_014168 Ga0500630_014168_2299_3399 357
89 3300053162 Ga0500638_057858 Ga0500638_057858_85_1185 357
90 3300053163 Ga0500639_000014 Ga0500639_000014_1669_2769 357
91 iso_pu_bacteria 2824600985 2824607730 357
92 iso_pu_bacteria 2824609381 2824617132 357
93 iso_pu_bacteria 2844315083 2844316914 357
94 iso_pu_bacteria 2888378607 2888381524 357
95 iso_pu_bacteria 2903727486 2903733964 357
96 iso_pu_bacteria 2906602504 2906604580 357
97 3300046533 Ga0495640_0034231 Ga0495640_0034231_2513_3589 358
98 3300005530 Ga0070679_100172326 Ga0070679_1001723262 359
99 3300005539 Ga0068853_100028252 Ga0068853_1000282521 359
100 3300005578 Ga0068854_100051460 Ga0068854_1000514602 359
101 3300005614 Ga0068856_100056546 Ga0068856_1000565464 359
102 3300005616 Ga0068852_100205706 Ga0068852_1002057061 359
103 3300009093 Ga0105240_10068093 Ga0105240_100680932 359
104 3300009093 Ga0105240_10210308 Ga0105240_102103082 359
105 3300009545 Ga0105237_10146881 Ga0105237_101468812 359
106 3300020070 Ga0206356_10862082 Ga0206356_108620822 359
107 3300025921 Ga0207652_10057241 Ga0207652_100572412 359
108 3300025949 Ga0207667_10183322 Ga0207667_101833222 359
109 3300026041 Ga0207639_10190810 Ga0207639_101908102 359
110 3300026078 Ga0207702_10302247 Ga0207702_103022472 359
111 3300026116 Ga0207674_10026464 Ga0207674_100264646 359
112 3300028786 Ga0307517_10000085 Ga0307517_10000085113 359
113 3300046692 Ga0495671_0102419 Ga0495671_0102419_304_1383 359
114 3300048924 Ga0496121_0083650 Ga0496121_0083650_216_1295 359
115 3300049570 Ga0501033_0229418 Ga0501033_0229418_34_1137 359
116 3300005937 Ga0081455_10026261 Ga0081455_100262613 360
117 3300031235 Ga0265330_10054608 Ga0265330_100546082 360
118 3300035724 Ga0373933_0028214 Ga0373933_0028214_1464_2654 360
119 3300048924 Ga0496121_0082348 Ga0496121_0082348_150_1250 360
120 3300049571 Ga0501034_0286773 Ga0501034_0286773_40_1140 360
121 3300049574 Ga0501038_0082118 Ga0501038_0082118_623_1723 360
122 3300049581 Ga0501047_0073429 Ga0501047_0073429_1198_2298 360
123 3300049586 Ga0501070_0063929 Ga0501070_0063929_1264_2364 360
124 3300049822 Ga0501035_0123726 Ga0501035_0123726_208_1308 360
125 iso_pu_bacteria 8019629233 8019637044 360
126 3300006028 Ga0070717_10005443 Ga0070717_100054433 361
127 3300025297 Ga0209758_1031926 Ga0209758_10319262 361
128 3300031235 Ga0265330_10032732 Ga0265330_100327322 361
129 3300031247 Ga0265340_10002779 Ga0265340_100027795 361
130 3300039453 Ga0436362_0766994 Ga0436362_0766994_53_1138 361
131 3300053080 Ga0500635_0026172 Ga0500635_0026172_11_1105 361
132 iso_pu_bacteria 2507262055 2507511012 362
133 iso_pu_bacteria 2508501042 2508696939 362
134 iso_pu_bacteria 2508501128 2509148875 362
135 iso_pu_bacteria 2511231028 2511395187 362
136 iso_pu_bacteria 2513237092 2513623486 362
137 iso_pu_bacteria 2513237094 2513637468 362
138 iso_pu_bacteria 2513237095 2513649682 362
139 iso_pu_bacteria 2513237096 2513655026 362
140 iso_pu_bacteria 2513237098 2513677796 362
141 iso_pu_bacteria 2513237101 2513697433 362
142 iso_pu_bacteria 2513237104 2513716918 362
143 iso_pu_bacteria 2513237137 2513861042 362
144 iso_pu_bacteria 2513237139 2513874652 362
145 iso_pu_bacteria 2513237145 2513915951 362
146 iso_pu_bacteria 2513237161 2514010632 362
147 iso_pu_bacteria 2515154112 2515625436 362
148 iso_pu_bacteria 2517093001 2517100591 362
149 iso_pu_bacteria 2517572143 2517894744 362
150 iso_pu_bacteria 2524023205 2524438185 362
151 iso_pu_bacteria 2524023210 2524464075 362
152 iso_pu_bacteria 2524023228 2524534493 362
153 iso_pu_bacteria 2528768022 2528849820 362
154 iso_pu_bacteria 2602042107 2603862615 362
155 iso_pu_bacteria 2617270735 2617350776 362
156 iso_pu_bacteria 2617270741 2617373145 362
157 iso_pu_bacteria 2667528175 2671119158 362
158 iso_pu_bacteria 2721755755 2723843076 362
159 iso_pu_bacteria 2728368998 2728747600 362
160 iso_pu_bacteria 2791355196 2793064664 362
161 iso_pu_bacteria 2791355197 2793071219 362
162 iso_pu_bacteria 2791355199 2793079517 362
163 iso_pu_bacteria 2802429603 2805916649 362
164 iso_pu_bacteria 2816332527 2818238153 362
165 iso_pu_bacteria 2824653114 2824658711 362
166 iso_pu_bacteria 2824661429 2824668266 362
167 iso_pu_bacteria 2824671348 2824676178 362
168 iso_pu_bacteria 2824679649 2824682885 362
169 iso_pu_bacteria 2824687955 2824692364 362
170 iso_pu_bacteria 2824746037 2824751540 362
171 iso_pu_bacteria 2824753945 2824761224 362
172 iso_pu_bacteria 2824763712 2824771851 362
173 iso_pu_bacteria 2824773399 2824780542 362
174 iso_pu_bacteria 2838122688 2838127896 362
175 iso_pu_bacteria 2841941048 2841943189 362
176 iso_pu_bacteria 2841949485 2841954080 362
177 iso_pu_bacteria 2841957949 2841960218 362
178 iso_pu_bacteria 2841966195 2841968170 362
179 iso_pu_bacteria 2841974524 2841976620 362
180 iso_pu_bacteria 2841983080 2841987993 362
181 iso_pu_bacteria 2842038055 2842042704 362
182 iso_pu_bacteria 2842045827 2842050747 362
183 iso_pu_bacteria 2847930680 2847938563 362
184 iso_pu_bacteria 2847939898 2847944237 362
185 iso_pu_bacteria 2857509624 2857512189 362
186 iso_pu_bacteria 2857524615 2857529962 362
187 iso_pu_bacteria 2874590934 2874597749 362
188 iso_pu_bacteria 2874604998 2874612593 362
189 iso_pu_bacteria 2874612657 2874617697 362
190 iso_pu_bacteria 2874620515 2874623435 362
191 iso_pu_bacteria 2874628541 2874630655 362
192 iso_pu_bacteria 2874645413 2874651278 362
193 iso_pu_bacteria 2876761206 2876762402 362
194 iso_pu_bacteria 2876771140 2876776349 362
195 iso_pu_bacteria 2876818435 2876820917 362
196 iso_pu_bacteria 2879074833 2879081788 362
197 iso_pu_bacteria 2879083081 2879086192 362
198 iso_pu_bacteria 2879099564 2879101348 362
199 iso_pu_bacteria 2879110137 2879118034 362
200 iso_pu_bacteria 2879127579 2879130503 362
201 iso_pu_bacteria 2879142872 2879146389 362
202 iso_pu_bacteria 2881364244 2881370681 362
203 iso_pu_bacteria 2885366525 2885366933 362
204 iso_pu_bacteria 2885374607 2885378766 362
205 iso_pu_bacteria 2885383462 2885384490 362
206 iso_pu_bacteria 2888388044 2888389115 362
207 iso_pu_bacteria 2888419890 2888421927 362
208 iso_pu_bacteria 2889033259 2889033623 362
209 iso_pu_bacteria 2893066018 2893069395 362
210 iso_pu_bacteria 2903748898 2903751426 362
211 iso_pu_bacteria 2903768456 2903773626 362
212 iso_pu_bacteria 2904666416 2904667334 362
213 iso_pu_bacteria 2904699407 2904705791 362
214 iso_pu_bacteria 2904711408 2904719228 362
215 iso_pu_bacteria 2906610324 2906611464 362
216 iso_pu_bacteria 2906626472 2906635179 362
217 iso_pu_bacteria 2906635258 2906641699 362
218 iso_pu_bacteria 2906643746 2906651200 362
219 iso_pu_bacteria 2906660503 2906660801 362
220 iso_pu_bacteria 2908739725 2908745056 362
221 iso_pu_bacteria 2908756301 2908757176 362
222 iso_pu_bacteria 2908775508 2908781600 362
223 iso_pu_bacteria 2919073203 2919077185 362
224 iso_pu_bacteria 2922361189 2922366991 362
225 iso_pu_bacteria 2922368715 2922371192 362
226 iso_pu_bacteria 2922386360 2922390227 362
227 iso_pu_bacteria 2922393267 2922393564 362
228 iso_pu_bacteria 2922425934 2922427893 362
229 iso_pu_bacteria 2929615660 2929619576 362
230 iso_pu_bacteria 2929624759 2929627954 362
231 iso_pu_bacteria 2932784394 2932785906 362
232 iso_pu_bacteria 2932794094 2932798314 362
233 iso_pu_bacteria 2932801729 2932804110 362
234 iso_pu_bacteria 2932809354 2932817276 362
235 iso_pu_bacteria 2932818245 2932826873 362
236 iso_pu_bacteria 2932828146 2932830950 362
237 iso_pu_bacteria 2933577622 2933581496 362
238 iso_pu_bacteria 2935608549 2935612751 362
239 iso_pu_bacteria 2935616580 2935621015 362
240 iso_pu_bacteria 2935630451 2935632179 362
241 iso_pu_bacteria 2935638405 2935640091 362
242 iso_pu_bacteria 2935648319 2935656721 362
243 iso_pu_bacteria 2935656913 2935665540 362
244 iso_pu_bacteria 2935665750 2935667070 362
245 iso_pu_bacteria 2935684952 2935690202 362
246 iso_pu_bacteria 2935694250 2935699712 362
247 iso_pu_bacteria 2935703347 2935704826 362
248 iso_pu_bacteria 2935713505 2935718101 362
249 iso_pu_bacteria 2935722832 2935726749 362
250 iso_pu_bacteria 2935732158 2935735518 362
251 iso_pu_bacteria 2935741537 2935745211 362
252 iso_pu_bacteria 2935750917 2935755213 362
253 iso_pu_bacteria 2935760218 2935762269 362
254 iso_pu_bacteria 2935769743 2935773657 362
255 iso_pu_bacteria 2935777560 2935780212 362
256 iso_pu_bacteria 2935785616 2935788438 362
257 iso_pu_bacteria 2935793552 2935796594 362
258 iso_pu_bacteria 2935801545 2935803772 362
259 iso_pu_bacteria 2935810662 2935811687 362
260 iso_pu_bacteria 2935819856 2935824240 362
261 iso_pu_bacteria 2935827899 2935829574 362
262 iso_pu_bacteria 2935837841 2935843092 362
263 iso_pu_bacteria 2935847175 2935852613 362
264 iso_pu_bacteria 2935855204 2935858822 362
265 iso_pu_bacteria 2935864058 2935866780 362
266 iso_pu_bacteria 2935873716 2935876911 362
267 iso_pu_bacteria 2935883170 2935884084 362
268 iso_pu_bacteria 2935908558 2935912241 362
269 iso_pu_bacteria 2935916978 2935924085 362
270 iso_pu_bacteria 2935926038 2935929270 362
271 iso_pu_bacteria 2935934488 2935935901 362
272 iso_pu_bacteria 2935942939 2935950409 362
273 iso_pu_bacteria 2935951376 2935957433 362
274 iso_pu_bacteria 2935959822 2935962044 362
275 iso_pu_bacteria 2935967501 2935968464 362
276 iso_pu_bacteria 2935975950 2935976653 362
277 iso_pu_bacteria 2935984226 2935990723 362
278 iso_pu_bacteria 2935992306 2935993452 362
279 iso_pu_bacteria 2936002035 2936004347 362
280 iso_pu_bacteria 2936011229 2936019584 362
281 iso_pu_bacteria 2936019824 2936028200 362
282 iso_pu_bacteria 2936028420 2936037073 362
283 iso_pu_bacteria 2936037263 2936038269 362
284 iso_pu_bacteria 2936046547 2936055057 362
285 iso_pu_bacteria 2936055302 2936058607 362
286 iso_pu_bacteria 2940556831 2940561506 362
287 iso_pu_bacteria 2941507105 2941508127 362
288 iso_pu_bacteria 2941515067 2941515368 362
289 iso_pu_bacteria 2941523033 2941524057 362
290 iso_pu_bacteria 2941531003 2941533696 362
291 iso_pu_bacteria 2941538514 2941544316 362
292 iso_pu_bacteria 3005474847 3005477604 362
293 iso_pu_bacteria 3005483717 3005486183 362
294 iso_pu_bacteria 3005506211 3005507124 362
295 iso_pu_bacteria 3005587118 3005588498 362
296 iso_pu_bacteria 3005594810 3005596548 362
297 iso_pu_bacteria 3005710791 3005712616 362
298 iso_pu_bacteria 3005718088 3005719677 362
299 iso_pu_bacteria 8006926726 8006930905 362
300 iso_pu_bacteria 8006933436 8006933615 362
301 iso_pu_bacteria 8006964411 8006966527 362
302 iso_pu_bacteria 8006973647 8006983288 362
303 iso_pu_bacteria 8006994254 8006997837 362
304 iso_pu_bacteria 8016511872 8016516435 362
305 iso_pu_bacteria 8016522445 8016523835 362
306 iso_pu_bacteria 8016539877 8016541636 362
307 iso_pu_bacteria 8016548790 8016551632 362
308 iso_pu_bacteria 8016557553 8016560018 362
309 iso_pu_bacteria 8016566248 8016567022 362
310 iso_pu_bacteria 8016583857 8016589131 362
311 iso_pu_bacteria 8016595262 8016597943 362
312 iso_pu_bacteria 8016613128 8016620665 362
313 iso_pu_bacteria 8016622563 8016629333 362
314 iso_pu_bacteria 8016630954 8016633848 362
315 iso_pu_bacteria 8017057580 8017060102 362
316 iso_pu_bacteria 8019530166 8019537050 362
317 iso_pu_bacteria 8019538911 8019542490 362
318 iso_pu_bacteria 8019547302 8019548265 362
319 iso_pu_bacteria 8019565922 8019569655 362
320 iso_pu_bacteria 8019576017 8019579612 362
321 iso_pu_bacteria 8019597564 8019604018 362
322 iso_pu_bacteria 8019648815 8019650025 362
323 iso_pu_bacteria 8019678201 8019681658 362
324 iso_pu_bacteria 8019687851 8019694113 362
325 iso_pu_bacteria 8055742211 8055749166 362
326 iso_pu_bacteria 8056673599 8056674871 362
327 iso_pu_bacteria 8056681323 8056682382 362
328 iso_pu_bacteria 8056689827 8056695171 362
329 iso_pu_bacteria 8056967851 8056969721 362
330 3300049569 Ga0501032_0119010 Ga0501032_0119010_102_1202 363
331 3300049571 Ga0501034_0000197 Ga0501034_0000197_54694_55794 363
332 3300049573 Ga0501037_0101975 Ga0501037_0101975_785_1885 363
333 3300049574 Ga0501038_0038091 Ga0501038_0038091_871_1971 363
334 3300049585 Ga0501069_0043425 Ga0501069_0043425_362_1462 363
335 3300049586 Ga0501070_0090347 Ga0501070_0090347_856_1956 363
336 3300049586 Ga0501070_0314854 Ga0501070_0314854_124_1224 363
337 3300049742 Ga0501080_0389057 Ga0501080_0389057_106_1206 363
338 3300049823 Ga0501044_0231316 Ga0501044_0231316_60_1160 363
339 3300049823 Ga0501044_0238631 Ga0501044_0238631_62_1162 363
340 3300049823 Ga0501044_0332956 Ga0501044_0332956_227_1327 363
341 iso_pu_bacteria 2513237141 2513892085 363
342 iso_pu_bacteria 2824626560 2824633057 363
343 iso_pu_bacteria 2824644064 2824648775 363
344 iso_pu_bacteria 2881665667 2881672684 363
345 iso_pu_bacteria 8006984368 8006989355 363
346 3300031247 Ga0265340_10068419 Ga0265340_100684192 364
347 3300031595 Ga0265313_10031838 Ga0265313_100318382 364
348 3300005334 Ga0068869_100087262 Ga0068869_1000872621 365
349 3300005334 Ga0068869_100217902 Ga0068869_1002179021 365
350 3300005337 Ga0070682_100172374 Ga0070682_1001723742 365
351 3300005366 Ga0070659_100200993 Ga0070659_1002009931 365
352 3300005434 Ga0070709_10032218 Ga0070709_100322181 365
353 3300005435 Ga0070714_100000678 Ga0070714_1000006789 365
354 3300005437 Ga0070710_10001070 Ga0070710_100010701 365
355 3300005439 Ga0070711_100001837 Ga0070711_1000018377 365
356 3300005457 Ga0070662_100076417 Ga0070662_1000764172 365
357 3300005614 Ga0068856_100134819 Ga0068856_1001348192 365
358 3300005842 Ga0068858_100021103 Ga0068858_1000211033 365
359 3300005844 Ga0068862_100231871 Ga0068862_1002318712 365
360 3300005937 Ga0081455_10004793 Ga0081455_1000479312 365
361 3300005983 Ga0081540_1012663 Ga0081540_10126631 365
362 3300006028 Ga0070717_10029235 Ga0070717_100292352 365
363 3300006042 Ga0075368_10023834 Ga0075368_100238342 365
364 3300006163 Ga0070715_10000078 Ga0070715_1000007814 365
365 3300006173 Ga0070716_100046221 Ga0070716_1000462211 365
366 3300006195 Ga0075366_10012258 Ga0075366_100122583 365
367 3300006353 Ga0075370_10037250 Ga0075370_100372502 365
368 3300006358 Ga0068871_100083324 Ga0068871_1000833242 365
369 3300007076 Ga0075435_100164113 Ga0075435_1001641132 365
370 3300009098 Ga0105245_10237372 Ga0105245_102373722 365
371 3300009177 Ga0105248_10150640 Ga0105248_101506402 365
372 3300009545 Ga0105237_10024176 Ga0105237_100241764 365
373 3300009553 Ga0105249_10275370 Ga0105249_102753702 365
374 3300014325 Ga0163163_10087824 Ga0163163_100878243 365
375 3300025898 Ga0207692_10001055 Ga0207692_100010556 365
376 3300025905 Ga0207685_10002878 Ga0207685_100028782 365
377 3300025906 Ga0207699_10012034 Ga0207699_100120343 365
378 3300025906 Ga0207699_10202813 Ga0207699_102028132 365
379 3300025911 Ga0207654_10067997 Ga0207654_100679972 365
380 3300025915 Ga0207693_10003503 Ga0207693_100035039 365
381 3300025916 Ga0207663_10001979 Ga0207663_100019792 365
382 3300025923 Ga0207681_10253291 Ga0207681_102532911 365
383 3300025924 Ga0207694_10143146 Ga0207694_101431462 365
384 3300025929 Ga0207664_10038518 Ga0207664_100385183 365
385 3300025933 Ga0207706_10087663 Ga0207706_100876632 365
386 3300025939 Ga0207665_10000361 Ga0207665_1000036111 365
387 3300025941 Ga0207711_10040725 Ga0207711_100407252 365
388 3300025949 Ga0207667_10339810 Ga0207667_103398102 365
389 3300025961 Ga0207712_10124876 Ga0207712_101248762 365
390 3300026023 Ga0207677_10240867 Ga0207677_102408671 365
391 3300026035 Ga0207703_10190870 Ga0207703_101908702 365
392 3300026041 Ga0207639_10350805 Ga0207639_103508051 365
393 3300026067 Ga0207678_10092146 Ga0207678_100921462 365
394 3300026095 Ga0207676_10045662 Ga0207676_100456622 365
395 3300026116 Ga0207674_10186131 Ga0207674_101861312 365
396 3300028379 Ga0268266_10006027 Ga0268266_100060275 365
397 3300031730 Ga0307516_10035813 Ga0307516_100358132 365
398 3300037068 Ga0373925_0072762 Ga0373925_0072762_954_2051 365
399 3300041413 Ga0439465_0023650 Ga0439465_0023650_187_1284 365
400 3300046557 Ga0495622_0079611 Ga0495622_0079611_353_1453 365
401 3300048912 Ga0496109_0356227 Ga0496109_0356227_220_1317 365
402 3300048913 Ga0496110_0114120 Ga0496110_0114120_658_1755 365
403 3300049586 Ga0501070_0085330 Ga0501070_0085330_183_1286 365
404 3300049742 Ga0501080_0349960 Ga0501080_0349960_56_1159 365
405 3300050493 nmdc:mga0k408_127339_c1 nmdc:mga0k408_127339_c1_250_1347 365
406 3300050496 nmdc:mga07m45_95447_c1 nmdc:mga07m45_95447_c1_446_1543 365
407 3300050512 nmdc:mga0n895_82170_c1 nmdc:mga0n895_82170_c1_1398_2495 365
408 3300050513 nmdc:mga0rr50_152607_c1 nmdc:mga0rr50_152607_c1_436_1533 365
409 3300053177 Ga0500636_0028779 Ga0500636_0028779_51_1148 365
410 3300003203 JGI25406J46586_10000068 JGI25406J46586_1000006832 366
411 3300003203 JGI25406J46586_10000392 JGI25406J46586_100003922 366
412 3300003203 JGI25406J46586_10003218 JGI25406J46586_100032182 366
413 3300003215 JGI25153J46596_10004141 JGI25153J46596_100041414 366
414 3300003215 JGI25153J46596_10004246 JGI25153J46596_100042464 366
415 3300003215 JGI25153J46596_10008945 JGI25153J46596_100089452 366
416 3300003215 JGI25153J46596_10009956 JGI25153J46596_100099562 366
417 3300003354 JGI25160J50197_1001885 JGI25160J50197_10018852 366
418 3300003354 JGI25160J50197_1003307 JGI25160J50197_10033074 366
419 3300003354 JGI25160J50197_1008344 JGI25160J50197_10083442 366
420 3300003794 Ga0055531_10005281 Ga0055531_100052816 366
421 3300004625 Ga0055543_1007542 Ga0055543_10075422 366
422 3300005262 Ga0065165_1004626 Ga0065165_10046266 366
423 3300005262 Ga0065165_1004931 Ga0065165_10049312 366
424 3300005262 Ga0065165_1016843 Ga0065165_10168432 366
425 3300005329 Ga0070683_100008367 Ga0070683_1000083677 366
426 3300005329 Ga0070683_100080340 Ga0070683_1000803404 366
427 3300005331 Ga0070670_100209197 Ga0070670_1002091972 366
428 3300005334 Ga0068869_100179707 Ga0068869_1001797071 366
429 3300005335 Ga0070666_10043956 Ga0070666_100439562 366
430 3300005336 Ga0070680_100027612 Ga0070680_1000276122 366
431 3300005336 Ga0070680_100089896 Ga0070680_1000898962 366
432 3300005338 Ga0068868_100132236 Ga0068868_1001322362 366
433 3300005338 Ga0068868_100267873 Ga0068868_1002678731 366
434 3300005339 Ga0070660_100002003 Ga0070660_10000200310 366
435 3300005344 Ga0070661_100062206 Ga0070661_1000622062 366
436 3300005353 Ga0070669_100121573 Ga0070669_1001215732 366
437 3300005355 Ga0070671_100026137 Ga0070671_1000261375 366
438 3300005356 Ga0070674_100192865 Ga0070674_1001928651 366
439 3300005434 Ga0070709_10001417 Ga0070709_100014178 366
440 3300005434 Ga0070709_10168899 Ga0070709_101688991 366
441 3300005435 Ga0070714_100018262 Ga0070714_1000182622 366
442 3300005435 Ga0070714_100107626 Ga0070714_1001076261 366
443 3300005436 Ga0070713_100004076 Ga0070713_1000040767 366
444 3300005436 Ga0070713_100020815 Ga0070713_1000208152 366
445 3300005436 Ga0070713_100277773 Ga0070713_1002777731 366
446 3300005437 Ga0070710_10000633 Ga0070710_1000063310 366
447 3300005437 Ga0070710_10019478 Ga0070710_100194783 366
448 3300005439 Ga0070711_100001478 Ga0070711_1000014781 366
449 3300005439 Ga0070711_100002216 Ga0070711_1000022161 366
450 3300005439 Ga0070711_100056360 Ga0070711_1000563602 366
451 3300005445 Ga0070708_100041592 Ga0070708_1000415922 366
452 3300005455 Ga0070663_100088728 Ga0070663_1000887282 366
453 3300005455 Ga0070663_100231032 Ga0070663_1002310322 366
454 3300005457 Ga0070662_100015684 Ga0070662_1000156843 366
455 3300005458 Ga0070681_10026780 Ga0070681_100267805 366
456 3300005458 Ga0070681_10043509 Ga0070681_100435094 366
457 3300005458 Ga0070681_10084030 Ga0070681_100840301 366
458 3300005458 Ga0070681_10168938 Ga0070681_101689382 366
459 3300005458 Ga0070681_10200047 Ga0070681_102000472 366
460 3300005459 Ga0068867_100091974 Ga0068867_1000919742 366
461 3300005468 Ga0070707_100084934 Ga0070707_1000849342 366
462 3300005518 Ga0070699_100418958 Ga0070699_1004189581 366
463 3300005530 Ga0070679_100084687 Ga0070679_1000846872 366
464 3300005530 Ga0070679_100165930 Ga0070679_1001659302 366
465 3300005530 Ga0070679_100169165 Ga0070679_1001691652 366
466 3300005535 Ga0070684_100005206 Ga0070684_1000052067 366
467 3300005535 Ga0070684_100014119 Ga0070684_1000141193 366
468 3300005539 Ga0068853_100008362 Ga0068853_1000083621 366
469 3300005539 Ga0068853_100010311 Ga0068853_1000103113 366
470 3300005543 Ga0070672_100064626 Ga0070672_1000646262 366
471 3300005543 Ga0070672_100183381 Ga0070672_1001833812 366
472 3300005547 Ga0070693_100151182 Ga0070693_1001511821 366
473 3300005548 Ga0070665_100047437 Ga0070665_1000474372 366
474 3300005548 Ga0070665_100149380 Ga0070665_1001493802 366
475 3300005548 Ga0070665_100161240 Ga0070665_1001612402 366
476 3300005548 Ga0070665_100212428 Ga0070665_1002124282 366
477 3300005563 Ga0068855_100030914 Ga0068855_1000309143 366
478 3300005577 Ga0068857_100213706 Ga0068857_1002137062 366
479 3300005578 Ga0068854_100036841 Ga0068854_1000368413 366
480 3300005578 Ga0068854_100124665 Ga0068854_1001246652 366
481 3300005614 Ga0068856_100000091 Ga0068856_10000009162 366
482 3300005614 Ga0068856_100204413 Ga0068856_1002044132 366
483 3300005616 Ga0068852_100056055 Ga0068852_1000560554 366
484 3300005617 Ga0068859_100217615 Ga0068859_1002176152 366
485 3300005618 Ga0068864_100110233 Ga0068864_1001102332 366
486 3300005718 Ga0068866_10007748 Ga0068866_100077482 366
487 3300005719 Ga0068861_100054122 Ga0068861_1000541223 366
488 3300005834 Ga0068851_10001608 Ga0068851_100016088 366
489 3300005834 Ga0068851_10035213 Ga0068851_100352132 366
490 3300005841 Ga0068863_100111545 Ga0068863_1001115452 366
491 3300005842 Ga0068858_100171542 Ga0068858_1001715422 366
492 3300005843 Ga0068860_100000254 Ga0068860_10000025442 366
493 3300005844 Ga0068862_100052468 Ga0068862_1000524683 366
494 3300005937 Ga0081455_10042135 Ga0081455_100421354 366
495 3300005983 Ga0081540_1001143 Ga0081540_100114311 366
496 3300005983 Ga0081540_1003272 Ga0081540_10032726 366
497 3300005983 Ga0081540_1005484 Ga0081540_10054847 366
498 3300005983 Ga0081540_1009836 Ga0081540_10098366 366
499 3300005983 Ga0081540_1013469 Ga0081540_10134696 366
500 3300005983 Ga0081540_1030172 Ga0081540_10301722 366
501 3300005985 Ga0081539_10000191 Ga0081539_10000191143 366
502 3300005985 Ga0081539_10000321 Ga0081539_1000032185 366
503 3300006038 Ga0075365_10008079 Ga0075365_100080792 366
504 3300006038 Ga0075365_10026332 Ga0075365_100263322 366
505 3300006038 Ga0075365_10086379 Ga0075365_100863792 366
506 3300006051 Ga0075364_10027354 Ga0075364_100273542 366
507 3300006173 Ga0070716_100017445 Ga0070716_1000174452 366
508 3300006173 Ga0070716_100064152 Ga0070716_1000641522 366
509 3300006173 Ga0070716_100075084 Ga0070716_1000750842 366
510 3300006173 Ga0070716_100106129 Ga0070716_1001061292 366
511 3300006175 Ga0070712_100011086 Ga0070712_1000110864 366
512 3300006175 Ga0070712_100040056 Ga0070712_1000400563 366
513 3300006175 Ga0070712_100063527 Ga0070712_1000635272 366
514 3300006175 Ga0070712_100110148 Ga0070712_1001101482 366
515 3300006178 Ga0075367_10036274 Ga0075367_100362742 366
516 3300006178 Ga0075367_10115214 Ga0075367_101152142 366
517 3300006195 Ga0075366_10121287 Ga0075366_101212872 366
518 3300006237 Ga0097621_100091612 Ga0097621_1000916122 366
519 3300006353 Ga0075370_10038133 Ga0075370_100381332 366
520 3300006844 Ga0075428_100089794 Ga0075428_1000897943 366
521 3300006852 Ga0075433_10029509 Ga0075433_100295094 366
522 3300006871 Ga0075434_100081100 Ga0075434_1000811002 366
523 3300006871 Ga0075434_100304415 Ga0075434_1003044152 366
524 3300006914 Ga0075436_100049564 Ga0075436_1000495642 366
525 3300006914 Ga0075436_100210447 Ga0075436_1002104471 366
526 3300006931 Ga0097620_100217615 Ga0097620_1002176152 366
527 3300006941 Ga0099825_1018997 Ga0099825_10189972 366
528 3300006943 Ga0099822_1000022 Ga0099822_10000229 366
529 3300006944 Ga0099823_1027652 Ga0099823_10276523 366
530 3300009093 Ga0105240_10017201 Ga0105240_100172017 366
531 3300009093 Ga0105240_10022325 Ga0105240_100223252 366
532 3300009093 Ga0105240_10189377 Ga0105240_101893772 366
533 3300009093 Ga0105240_10393406 Ga0105240_103934062 366
534 3300009094 Ga0111539_10119503 Ga0111539_101195032 366
535 3300009098 Ga0105245_10071520 Ga0105245_100715202 366
536 3300009098 Ga0105245_10117886 Ga0105245_101178862 366
537 3300009098 Ga0105245_10268214 Ga0105245_102682142 366
538 3300009101 Ga0105247_10019830 Ga0105247_100198302 366
539 3300009174 Ga0105241_10014950 Ga0105241_100149505 366
540 3300009174 Ga0105241_10029800 Ga0105241_100298003 366
541 3300009174 Ga0105241_10296841 Ga0105241_102968411 366
542 3300009177 Ga0105248_10187065 Ga0105248_101870652 366
543 3300009545 Ga0105237_10015378 Ga0105237_100153786 366
544 3300009545 Ga0105237_10018494 Ga0105237_100184946 366
545 3300009545 Ga0105237_10028922 Ga0105237_100289224 366
546 3300009545 Ga0105237_10095800 Ga0105237_100958002 366
547 3300009545 Ga0105237_10138023 Ga0105237_101380232 366
548 3300009545 Ga0105237_10286821 Ga0105237_102868212 366
549 3300009551 Ga0105238_10008134 Ga0105238_100081342 366
550 3300009551 Ga0105238_10057140 Ga0105238_100571403 366
551 3300009551 Ga0105238_10142835 Ga0105238_101428352 366
552 3300009553 Ga0105249_10077171 Ga0105249_100771713 366
553 3300010159 Ga0099796_10014701 Ga0099796_100147012 366
554 3300010159 Ga0099796_10023589 Ga0099796_100235892 366
555 3300010375 Ga0105239_10053854 Ga0105239_100538542 366
556 3300010375 Ga0105239_10127689 Ga0105239_101276892 366
557 3300010375 Ga0105239_10373523 Ga0105239_103735232 366
558 3300011119 Ga0105246_10028278 Ga0105246_100282782 366
559 3300013104 Ga0157370_10044331 Ga0157370_100443312 366
560 3300013105 Ga0157369_10016060 Ga0157369_100160606 366
561 3300013105 Ga0157369_10198242 Ga0157369_101982422 366
562 3300013296 Ga0157374_10092378 Ga0157374_100923782 366
563 3300013308 Ga0157375_10052552 Ga0157375_100525523 366
564 3300014325 Ga0163163_10156308 Ga0163163_101563082 366
565 3300014325 Ga0163163_10409709 Ga0163163_104097091 366
566 3300014969 Ga0157376_10113676 Ga0157376_101136762 366
567 3300017792 Ga0163161_10108692 Ga0163161_101086922 366
568 3300017792 Ga0163161_10265622 Ga0163161_102656221 366
569 3300020070 Ga0206356_11262758 Ga0206356_112627581 366
570 3300021320 Ga0214544_1000001 Ga0214544_1000001331 366
571 3300021321 Ga0214542_1000005 Ga0214542_1000005331 366
572 3300021321 Ga0214542_1024229 Ga0214542_10242293 366
573 3300021324 Ga0214545_1000003 Ga0214545_1000003433 366
574 3300021324 Ga0214545_1023657 Ga0214545_10236571 366
575 3300021327 Ga0214543_1000002 Ga0214543_1000002333 366
576 3300021327 Ga0214543_1026030 Ga0214543_10260301 366
577 3300021384 Ga0213876_10028489 Ga0213876_100284892 366
578 3300021384 Ga0213876_10066492 Ga0213876_100664922 366
579 3300021384 Ga0213876_10101694 Ga0213876_101016942 366
580 3300021441 Ga0213871_10002263 Ga0213871_100022632 366
581 3300025253 Ga0209677_101595 Ga0209677_1015957 366
582 3300025254 Ga0209148_1000424 Ga0209148_100042439 366
583 3300025261 Ga0209233_1004610 Ga0209233_10046104 366
584 3300025261 Ga0209233_1006596 Ga0209233_10065962 366
585 3300025272 Ga0209455_1009596 Ga0209455_10095962 366
586 3300025272 Ga0209455_1012617 Ga0209455_10126171 366
587 3300025273 Ga0209673_1037039 Ga0209673_10370392 366
588 3300025295 Ga0209564_1000485 Ga0209564_100048528 366
589 3300025295 Ga0209564_1006799 Ga0209564_10067994 366
590 3300025297 Ga0209758_1000141 Ga0209758_1000141156 366
591 3300025297 Ga0209758_1002420 Ga0209758_10024206 366
592 3300025297 Ga0209758_1005684 Ga0209758_10056844 366
593 3300025297 Ga0209758_1006453 Ga0209758_10064534 366
594 3300025297 Ga0209758_1032768 Ga0209758_10327682 366
595 3300025297 Ga0209758_1059854 Ga0209758_10598541 366
596 3300025299 Ga0209256_1010818 Ga0209256_10108182 366
597 3300025302 Ga0207426_1000425 Ga0207426_100042560 366
598 3300025302 Ga0207426_1003443 Ga0207426_10034435 366
599 3300025302 Ga0207426_1004449 Ga0207426_10044491 366
600 3300025304 Ga0209257_1000426 Ga0209257_100042634 366
601 3300025321 Ga0207656_10008209 Ga0207656_100082092 366
602 3300025321 Ga0207656_10016277 Ga0207656_100162772 366
603 3300025898 Ga0207692_10005603 Ga0207692_100056033 366
604 3300025898 Ga0207692_10034148 Ga0207692_100341482 366
605 3300025899 Ga0207642_10006639 Ga0207642_100066392 366
606 3300025903 Ga0207680_10141396 Ga0207680_101413962 366
607 3300025906 Ga0207699_10000390 Ga0207699_100003906 366
608 3300025907 Ga0207645_10145994 Ga0207645_101459941 366
609 3300025910 Ga0207684_10339723 Ga0207684_103397231 366
610 3300025911 Ga0207654_10000323 Ga0207654_1000032311 366
611 3300025912 Ga0207707_10000178 Ga0207707_1000017811 366
612 3300025912 Ga0207707_10030844 Ga0207707_100308443 366
613 3300025912 Ga0207707_10069420 Ga0207707_100694202 366
614 3300025912 Ga0207707_10082388 Ga0207707_100823882 366
615 3300025913 Ga0207695_10000062 Ga0207695_10000062274 366
616 3300025913 Ga0207695_10000497 Ga0207695_1000049713 366
617 3300025914 Ga0207671_10004982 Ga0207671_100049826 366
618 3300025914 Ga0207671_10154721 Ga0207671_101547212 366
619 3300025914 Ga0207671_10188296 Ga0207671_101882962 366
620 3300025915 Ga0207693_10018008 Ga0207693_100180083 366
621 3300025915 Ga0207693_10027789 Ga0207693_100277894 366
622 3300025915 Ga0207693_10051082 Ga0207693_100510822 366
623 3300025915 Ga0207693_10083737 Ga0207693_100837372 366
624 3300025916 Ga0207663_10006434 Ga0207663_100064341 366
625 3300025916 Ga0207663_10015611 Ga0207663_100156113 366
626 3300025916 Ga0207663_10043697 Ga0207663_100436972 366
627 3300025917 Ga0207660_10014180 Ga0207660_100141804 366
628 3300025917 Ga0207660_10179692 Ga0207660_101796922 366
629 3300025919 Ga0207657_10002910 Ga0207657_100029106 366
630 3300025919 Ga0207657_10076639 Ga0207657_100766392 366
631 3300025921 Ga0207652_10099805 Ga0207652_100998052 366
632 3300025922 Ga0207646_10095799 Ga0207646_100957992 366
633 3300025924 Ga0207694_10000212 Ga0207694_1000021241 366
634 3300025924 Ga0207694_10020078 Ga0207694_100200782 366
635 3300025924 Ga0207694_10078059 Ga0207694_100780592 366
636 3300025926 Ga0207659_10054790 Ga0207659_100547902 366
637 3300025928 Ga0207700_10001341 Ga0207700_100013412 366
638 3300025928 Ga0207700_10038868 Ga0207700_100388681 366
639 3300025928 Ga0207700_10073685 Ga0207700_100736851 366
640 3300025929 Ga0207664_10033246 Ga0207664_100332462 366
641 3300025929 Ga0207664_10036057 Ga0207664_100360572 366
642 3300025929 Ga0207664_10075472 Ga0207664_100754722 366
643 3300025931 Ga0207644_10151431 Ga0207644_101514312 366
644 3300025931 Ga0207644_10254249 Ga0207644_102542492 366
645 3300025933 Ga0207706_10023317 Ga0207706_100233172 366
646 3300025933 Ga0207706_10133439 Ga0207706_101334392 366
647 3300025935 Ga0207709_10013744 Ga0207709_100137443 366
648 3300025937 Ga0207669_10050072 Ga0207669_100500722 366
649 3300025938 Ga0207704_10052956 Ga0207704_100529562 366
650 3300025938 Ga0207704_10133699 Ga0207704_101336992 366
651 3300025939 Ga0207665_10005543 Ga0207665_100055432 366
652 3300025939 Ga0207665_10096560 Ga0207665_100965602 366
653 3300025939 Ga0207665_10097429 Ga0207665_100974292 366
654 3300025940 Ga0207691_10154226 Ga0207691_101542262 366
655 3300025942 Ga0207689_10140785 Ga0207689_101407852 366
656 3300025944 Ga0207661_10040922 Ga0207661_100409222 366
657 3300025949 Ga0207667_10007538 Ga0207667_100075388 366
658 3300025949 Ga0207667_10020042 Ga0207667_100200425 366
659 3300025949 Ga0207667_10020500 Ga0207667_100205003 366
660 3300025961 Ga0207712_10070275 Ga0207712_100702751 366
661 3300025972 Ga0207668_10080761 Ga0207668_100807612 366
662 3300025972 Ga0207668_10274169 Ga0207668_102741691 366
663 3300025981 Ga0207640_10054473 Ga0207640_100544733 366
664 3300026035 Ga0207703_10242709 Ga0207703_102427091 366
665 3300026041 Ga0207639_10002809 Ga0207639_100028095 366
666 3300026041 Ga0207639_10009638 Ga0207639_100096382 366
667 3300026041 Ga0207639_10142632 Ga0207639_101426322 366
668 3300026067 Ga0207678_10087674 Ga0207678_100876742 366
669 3300026067 Ga0207678_10142099 Ga0207678_101420992 366
670 3300026078 Ga0207702_10000003 Ga0207702_10000003388 366
671 3300026078 Ga0207702_10000041 Ga0207702_1000004175 366
672 3300026078 Ga0207702_10183373 Ga0207702_101833732 366
673 3300026088 Ga0207641_10119826 Ga0207641_101198262 366
674 3300026089 Ga0207648_10013629 Ga0207648_100136293 366
675 3300026095 Ga0207676_10212523 Ga0207676_102125232 366
676 3300026095 Ga0207676_10305386 Ga0207676_103053862 366
677 3300026116 Ga0207674_10004756 Ga0207674_100047568 366
678 3300026116 Ga0207674_10445603 Ga0207674_104456031 366
679 3300026118 Ga0207675_100058237 Ga0207675_1000582372 366
680 3300026121 Ga0207683_10096466 Ga0207683_100964662 366
681 3300026142 Ga0207698_10021924 Ga0207698_100219242 366
682 3300027296 Ga0209389_1000004 Ga0209389_10000043 366
683 3300027357 Ga0209589_1000006 Ga0209589_1000006373 366
684 3300027361 Ga0209489_100007 Ga0209489_100007373 366
685 3300027361 Ga0209489_100295 Ga0209489_1002952 366
686 3300027363 Ga0209700_100008 Ga0209700_100008373 366
687 3300027363 Ga0209700_100013 Ga0209700_10001390 366
688 3300028379 Ga0268266_10031060 Ga0268266_100310602 366
689 3300028379 Ga0268266_10118886 Ga0268266_101188862 366
690 3300028379 Ga0268266_10142144 Ga0268266_101421442 366
691 3300028379 Ga0268266_10170332 Ga0268266_101703322 366
692 3300028380 Ga0268265_10010132 Ga0268265_100101325 366
693 3300028381 Ga0268264_10000093 Ga0268264_10000093117 366
694 3300028556 Ga0265337_1016134 Ga0265337_10161342 366
695 3300028653 Ga0265323_10007415 Ga0265323_100074153 366
696 3300028794 Ga0307515_10279100 Ga0307515_102791001 366
697 3300028800 Ga0265338_10000328 Ga0265338_1000032822 366
698 3300029957 Ga0265324_10018488 Ga0265324_100184883 366
699 3300031235 Ga0265330_10043222 Ga0265330_100432222 366
700 3300031238 Ga0265332_10011026 Ga0265332_100110263 366
701 3300031238 Ga0265332_10033057 Ga0265332_100330572 366
702 3300031241 Ga0265325_10005212 Ga0265325_100052123 366
703 3300031241 Ga0265325_10011412 Ga0265325_100114123 366
704 3300031242 Ga0265329_10060793 Ga0265329_100607931 366
705 3300031247 Ga0265340_10074215 Ga0265340_100742152 366
706 3300031249 Ga0265339_10017239 Ga0265339_100172392 366
707 3300031249 Ga0265339_10063209 Ga0265339_100632092 366
708 3300031250 Ga0265331_10014674 Ga0265331_100146744 366
709 3300031250 Ga0265331_10018816 Ga0265331_100188162 366
710 3300031250 Ga0265331_10059130 Ga0265331_100591301 366
711 3300031344 Ga0265316_10136317 Ga0265316_101363172 366
712 3300031507 Ga0307509_10127238 Ga0307509_101272382 366
713 3300031507 Ga0307509_10183857 Ga0307509_101838572 366
714 3300031595 Ga0265313_10111789 Ga0265313_101117891 366
715 3300031616 Ga0307508_10000034 Ga0307508_10000034126 366
716 3300031711 Ga0265314_10069718 Ga0265314_100697182 366
717 3300031712 Ga0265342_10006824 Ga0265342_100068244 366
718 3300031712 Ga0265342_10009227 Ga0265342_100092273 366
719 3300031730 Ga0307516_10019297 Ga0307516_100192972 366
720 3300031730 Ga0307516_10054377 Ga0307516_100543772 366
721 3300031730 Ga0307516_10118891 Ga0307516_101188911 366
722 3300031911 Ga0307412_10163491 Ga0307412_101634912 366
723 3300033180 Ga0307510_10004348 Ga0307510_100043488 366
724 3300033180 Ga0307510_10036621 Ga0307510_100366214 366
725 3300033442 Ga0315911_1000010 Ga0315911_1000010163 366
726 3300035083 Ga0373926_0069513 Ga0373926_0069513_115_1215 366
727 3300035086 Ga0373934_0018964 Ga0373934_0018964_667_1767 366
728 3300035111 Ga0373923_0002407 Ga0373923_0002407_3947_5047 366
729 3300035111 Ga0373923_0069761 Ga0373923_0069761_308_1408 366
730 3300035113 Ga0373936_0006093 Ga0373936_0006093_2301_3401 366
731 3300035113 Ga0373936_0069904 Ga0373936_0069904_134_1234 366
732 3300035116 Ga0373945_0008267 Ga0373945_0008267_1246_2346 366
733 3300035119 Ga0373956_0054801 Ga0373956_0054801_632_1732 366
734 3300035119 Ga0373956_0097869 Ga0373956_0097869_85_1185 366
735 3300035120 Ga0373957_0001068 Ga0373957_0001068_3473_4573 366
736 3300035120 Ga0373957_0022511 Ga0373957_0022511_821_1921 366
737 3300035170 Ga0373943_0006580 Ga0373943_0006580_3940_5040 366
738 3300035170 Ga0373943_0007994 Ga0373943_0007994_2979_4079 366
739 3300035171 Ga0373946_0007122 Ga0373946_0007122_2444_3544 366
740 3300035171 Ga0373946_0029419 Ga0373946_0029419_68_1168 366
741 3300035172 Ga0373955_0000880 Ga0373955_0000880_9351_10451 366
742 3300035172 Ga0373955_0032414 Ga0373955_0032414_1368_2468 366
743 3300035207 Ga0373942_0030249 Ga0373942_0030249_23_1135 366
744 3300035410 Ga0373924_0002398 Ga0373924_0002398_2356_3456 366
745 3300035410 Ga0373924_0006697 Ga0373924_0006697_1917_3017 366
746 3300035410 Ga0373924_0017618 Ga0373924_0017618_1500_2600 366
747 3300035691 Ga0373931_0094054 Ga0373931_0094054_114_1214 366
748 3300035692 Ga0373935_0000259 Ga0373935_0000259_13724_14824 366
749 3300035692 Ga0373935_0074169 Ga0373935_0074169_824_1924 366
750 3300035695 Ga0373927_0002379 Ga0373927_0002379_6996_8108 366
751 3300035695 Ga0373927_0004958 Ga0373927_0004958_679_1779 366
752 3300035695 Ga0373927_0118562 Ga0373927_0118562_329_1438 366
753 3300035724 Ga0373933_0001150 Ga0373933_0001150_12726_13826 366
754 3300035724 Ga0373933_0002191 Ga0373933_0002191_2075_3175 366
755 3300035724 Ga0373933_0146828 Ga0373933_0146828_157_1257 366
756 3300035725 Ga0373947_0000217 Ga0373947_0000217_11690_12790 366
757 3300035725 Ga0373947_0010938 Ga0373947_0010938_2200_3312 366
758 3300035725 Ga0373947_0012207 Ga0373947_0012207_2292_3392 366
759 3300035725 Ga0373947_0013046 Ga0373947_0013046_1681_2781 366
760 3300035725 Ga0373947_0097834 Ga0373947_0097834_235_1335 366
761 3300035725 Ga0373947_0183242 Ga0373947_0183242_202_1311 366
762 3300036401 Ga0373937_0006578 Ga0373937_0006578_7021_8121 366
763 3300036401 Ga0373937_0012724 Ga0373937_0012724_5942_7042 366
764 3300036401 Ga0373937_0022213 Ga0373937_0022213_4400_5500 366
765 3300037068 Ga0373925_0004501 Ga0373925_0004501_3745_4845 366
766 3300037068 Ga0373925_0026107 Ga0373925_0026107_1756_2856 366
767 3300037068 Ga0373925_0041268 Ga0373925_0041268_1208_2314 366
768 3300037068 Ga0373925_0057981 Ga0373925_0057981_178_1290 366
769 3300037068 Ga0373925_0095574 Ga0373925_0095574_203_1303 366
770 3300037418 Ga0395900_0001924 Ga0395900_0001924_8878_9978 366
771 3300037418 Ga0395900_0323270 Ga0395900_0323270_103_1203 366
772 3300037466 Ga0395898_0020243 Ga0395898_0020243_3286_4386 366
773 3300037466 Ga0395898_0059500 Ga0395898_0059500_874_1974 366
774 3300037466 Ga0395898_0212975 Ga0395898_0212975_586_1686 366
775 3300037471 Ga0395905_0091606 Ga0395905_0091606_1425_2525 366
776 3300037471 Ga0395905_0092596 Ga0395905_0092596_1423_2523 366
777 3300037853 Ga0436364_0578778 Ga0436364_0578778_3392_4495 366
778 3300038443 Ga0395901_0268461 Ga0395901_0268461_73_1194 366
779 3300038443 Ga0395901_0411236 Ga0395901_0411236_181_1281 366
780 3300039437 Ga0436365_0425471 Ga0436365_0425471_1098_2234 366
781 3300039437 Ga0436365_0698518 Ga0436365_0698518_156_1259 366
782 3300039437 Ga0436365_1129324 Ga0436365_1129324_763_1863 366
783 3300039438 Ga0436360_0973324 Ga0436360_0973324_56_1159 366
784 3300039447 Ga0436361_1121961 Ga0436361_1121961_187_1290 366
785 3300039447 Ga0436361_1213962 Ga0436361_1213962_123_1226 366
786 3300039450 Ga0436363_0248819 Ga0436363_0248819_848_1954 366
787 3300039450 Ga0436363_1154387 Ga0436363_1154387_85_1221 366
788 3300039453 Ga0436362_0646134 Ga0436362_0646134_5225_6325 366
789 3300044658 Ga0466972_0000520 Ga0466972_0000520_6189_7289 366
790 3300044658 Ga0466972_0004454 Ga0466972_0004454_1557_2657 366
791 3300044683 Ga0466965_0085586 Ga0466965_0085586_446_1546 366
792 3300044684 Ga0466966_0035979 Ga0466966_0035979_1492_2592 366
793 3300044693 Ga0466961_0000149 Ga0466961_0000149_46415_47515 366
794 3300044693 Ga0466961_0070374 Ga0466961_0070374_358_1458 366
795 3300044694 Ga0466963_0073746 Ga0466963_0073746_951_2051 366
796 3300044706 Ga0466964_0088337 Ga0466964_0088337_67_1167 366
797 3300044735 Ga0466968_0029898 Ga0466968_0029898_590_1690 366
798 3300044842 Ga0466957_0017500 Ga0466957_0017500_1486_2586 366
799 3300044901 Ga0466960_0080589 Ga0466960_0080589_59_1159 366
800 3300045049 Ga0466959_0004087 Ga0466959_0004087_4153_5253 366
801 3300045049 Ga0466959_0156110 Ga0466959_0156110_282_1382 366
802 3300045976 Ga0466967_0034405 Ga0466967_0034405_656_1756 366
803 3300045976 Ga0466967_0040762 Ga0466967_0040762_1645_2745 366
804 3300045976 Ga0466967_0073074 Ga0466967_0073074_20_1123 366
805 3300046454 Ga0495592_0008207 Ga0495592_0008207_4469_5569 366
806 3300046454 Ga0495592_0020912 Ga0495592_0020912_633_1733 366
807 3300046454 Ga0495592_0029636 Ga0495592_0029636_334_1434 366
808 3300046454 Ga0495592_0037847 Ga0495592_0037847_180_1283 366
809 3300046454 Ga0495592_0114531 Ga0495592_0114531_96_1196 366
810 3300046455 Ga0495603_0000352 Ga0495603_0000352_10159_11259 366
811 3300046455 Ga0495603_0014404 Ga0495603_0014404_701_1813 366
812 3300046455 Ga0495603_0036212 Ga0495603_0036212_760_1860 366
813 3300046457 Ga0495590_0039148 Ga0495590_0039148_244_1350 366
814 3300046459 Ga0495629_0003719 Ga0495629_0003719_8991_10091 366
815 3300046459 Ga0495629_0051707 Ga0495629_0051707_1373_2473 366
816 3300046459 Ga0495629_0108425 Ga0495629_0108425_529_1629 366
817 3300046460 Ga0495638_0009309 Ga0495638_0009309_1204_2355 366
818 3300046460 Ga0495638_0014656 Ga0495638_0014656_1252_2352 366
819 3300046460 Ga0495638_0089820 Ga0495638_0089820_80_1180 366
820 3300046461 Ga0495641_0006337 Ga0495641_0006337_2541_3641 366
821 3300046461 Ga0495641_0044210 Ga0495641_0044210_612_1712 366
822 3300046462 Ga0495651_0003972 Ga0495651_0003972_3074_4177 366
823 3300046462 Ga0495651_0008150 Ga0495651_0008150_130_1230 366
824 3300046462 Ga0495651_0009605 Ga0495651_0009605_4075_5175 366
825 3300046462 Ga0495651_0028771 Ga0495651_0028771_1712_2812 366
826 3300046463 Ga0495653_0012753 Ga0495653_0012753_5611_6711 366
827 3300046463 Ga0495653_0025837 Ga0495653_0025837_323_1426 366
828 3300046463 Ga0495653_0039637 Ga0495653_0039637_1352_2452 366
829 3300046463 Ga0495653_0083742 Ga0495653_0083742_785_1885 366
830 3300046471 Ga0495650_0024728 Ga0495650_0024728_697_1800 366
831 3300046472 Ga0495580_0018652 Ga0495580_0018652_1107_2207 366
832 3300046472 Ga0495580_0059795 Ga0495580_0059795_1511_2623 366
833 3300046472 Ga0495580_0116513 Ga0495580_0116513_551_1651 366
834 3300046473 Ga0495582_0000245 Ga0495582_0000245_25832_26932 366
835 3300046473 Ga0495582_0035658 Ga0495582_0035658_348_1448 366
836 3300046475 Ga0495639_0020850 Ga0495639_0020850_1067_2167 366
837 3300046476 Ga0495662_0000872 Ga0495662_0000872_9868_10968 366
838 3300046476 Ga0495662_0075317 Ga0495662_0075317_254_1357 366
839 3300046477 Ga0495664_0004666 Ga0495664_0004666_3162_4262 366
840 3300046477 Ga0495664_0020886 Ga0495664_0020886_1180_2280 366
841 3300046477 Ga0495664_0027890 Ga0495664_0027890_1316_2416 366
842 3300046477 Ga0495664_0036188 Ga0495664_0036188_235_1335 366
843 3300046499 Ga0495594_0001300 Ga0495594_0001300_10648_11748 366
844 3300046499 Ga0495594_0038102 Ga0495594_0038102_556_1668 366
845 3300046507 Ga0495606_0015892 Ga0495606_0015892_1505_2605 366
846 3300046507 Ga0495606_0022638 Ga0495606_0022638_1003_2133 366
847 3300046511 Ga0495608_0041347 Ga0495608_0041347_201_1301 366
848 3300046513 Ga0495616_0032875 Ga0495616_0032875_125_1225 366
849 3300046514 Ga0495618_0009256 Ga0495618_0009256_2600_3700 366
850 3300046514 Ga0495618_0017563 Ga0495618_0017563_713_1813 366
851 3300046514 Ga0495618_0039877 Ga0495618_0039877_140_1240 366
852 3300046515 Ga0495620_0046480 Ga0495620_0046480_559_1662 366
853 3300046516 Ga0495628_0005097 Ga0495628_0005097_5465_6565 366
854 3300046516 Ga0495628_0040062 Ga0495628_0040062_947_2047 366
855 3300046517 Ga0495630_0009422 Ga0495630_0009422_4775_5875 366
856 3300046517 Ga0495630_0051936 Ga0495630_0051936_575_1675 366
857 3300046517 Ga0495630_0236611 Ga0495630_0236611_154_1254 366
858 3300046519 Ga0495632_0074302 Ga0495632_0074302_159_1262 366
859 3300046522 Ga0495643_0060904 Ga0495643_0060904_411_1511 366
860 3300046523 Ga0495644_0006757 Ga0495644_0006757_3057_4187 366
861 3300046524 Ga0495648_0001680 Ga0495648_0001680_10550_11650 366
862 3300046524 Ga0495648_0019543 Ga0495648_0019543_3087_4187 366
863 3300046524 Ga0495648_0058195 Ga0495648_0058195_576_1727 366
864 3300046526 Ga0495666_0003461 Ga0495666_0003461_6341_7441 366
865 3300046529 Ga0495652_0061223 Ga0495652_0061223_701_1804 366
866 3300046529 Ga0495652_0087350 Ga0495652_0087350_835_1986 366
867 3300046529 Ga0495652_0112503 Ga0495652_0112503_365_1465 366
868 3300046529 Ga0495652_0156871 Ga0495652_0156871_599_1699 366
869 3300046529 Ga0495652_0279926 Ga0495652_0279926_104_1204 366
870 3300046531 Ga0495665_0000361 Ga0495665_0000361_2829_3929 366
871 3300046531 Ga0495665_0168695 Ga0495665_0168695_12_1112 366
872 3300046533 Ga0495640_0003002 Ga0495640_0003002_2828_3928 366
873 3300046533 Ga0495640_0017400 Ga0495640_0017400_1605_2705 366
874 3300046533 Ga0495640_0022271 Ga0495640_0022271_1100_2200 366
875 3300046536 Ga0495587_0017008 Ga0495587_0017008_1642_2742 366
876 3300046543 Ga0495645_0001286 Ga0495645_0001286_483_1583 366
877 3300046543 Ga0495645_0020761 Ga0495645_0020761_3489_4592 366
878 3300046543 Ga0495645_0023607 Ga0495645_0023607_1298_2404 366
879 3300046543 Ga0495645_0083631 Ga0495645_0083631_965_2065 366
880 3300046543 Ga0495645_0203809 Ga0495645_0203809_54_1154 366
881 3300046557 Ga0495622_0006317 Ga0495622_0006317_3399_4499 366
882 3300046558 Ga0495633_0063543 Ga0495633_0063543_162_1292 366
883 3300046559 Ga0495667_0012248 Ga0495667_0012248_2742_3842 366
884 3300046559 Ga0495667_0033462 Ga0495667_0033462_1397_2497 366
885 3300046559 Ga0495667_0126311 Ga0495667_0126311_440_1540 366
886 3300046615 Ga0495656_0004410 Ga0495656_0004410_3288_4418 366
887 3300046616 Ga0495668_0091477 Ga0495668_0091477_356_1456 366
888 3300046642 Ga0495634_0000249 Ga0495634_0000249_9463_10563 366
889 3300046642 Ga0495634_0012218 Ga0495634_0012218_4012_5112 366
890 3300046642 Ga0495634_0022747 Ga0495634_0022747_3230_4330 366
891 3300046642 Ga0495634_0068360 Ga0495634_0068360_947_2047 366
892 3300046642 Ga0495634_0109805 Ga0495634_0109805_577_1680 366
893 3300046660 Ga0495625_0036379 Ga0495625_0036379_1150_2250 366
894 3300046663 Ga0495635_0000239 Ga0495635_0000239_7122_8222 366
895 3300046663 Ga0495635_0003846 Ga0495635_0003846_6561_7661 366
896 3300046663 Ga0495635_0014377 Ga0495635_0014377_2781_3881 366
897 3300046663 Ga0495635_0081350 Ga0495635_0081350_293_1393 366
898 3300046663 Ga0495635_0095584 Ga0495635_0095584_52_1155 366
899 3300046665 Ga0495661_0012048 Ga0495661_0012048_1374_2474 366
900 3300046674 Ga0495588_0069307 Ga0495588_0069307_155_1255 366
901 3300046675 Ga0495657_0003492 Ga0495657_0003492_4689_5792 366
902 3300046675 Ga0495657_0006927 Ga0495657_0006927_2612_3712 366
903 3300046675 Ga0495657_0026654 Ga0495657_0026654_824_1924 366
904 3300046678 Ga0495599_0001556 Ga0495599_0001556_2850_3950 366
905 3300046678 Ga0495599_0008411 Ga0495599_0008411_2286_3386 366
906 3300046678 Ga0495599_0016849 Ga0495599_0016849_1361_2464 366
907 3300046679 Ga0495623_0002296 Ga0495623_0002296_5185_6288 366
908 3300046679 Ga0495623_0009107 Ga0495623_0009107_5211_6311 366
909 3300046679 Ga0495623_0010478 Ga0495623_0010478_2641_3741 366
910 3300046680 Ga0495646_0001918 Ga0495646_0001918_4977_6077 366
911 3300046680 Ga0495646_0005453 Ga0495646_0005453_4660_5760 366
912 3300046680 Ga0495646_0011250 Ga0495646_0011250_1399_2499 366
913 3300046680 Ga0495646_0102031 Ga0495646_0102031_523_1623 366
914 3300046681 Ga0495647_0003088 Ga0495647_0003088_2949_4049 366
915 3300046681 Ga0495647_0022746 Ga0495647_0022746_1042_2142 366
916 3300046681 Ga0495647_0030086 Ga0495647_0030086_798_1904 366
917 3300046683 Ga0495658_0001058 Ga0495658_0001058_8120_9220 366
918 3300046683 Ga0495658_0019298 Ga0495658_0019298_1543_2643 366
919 3300046683 Ga0495658_0102410 Ga0495658_0102410_301_1413 366
920 3300046689 Ga0495613_0000929 Ga0495613_0000929_13186_14286 366
921 3300046689 Ga0495613_0067749 Ga0495613_0067749_901_2001 366
922 3300046689 Ga0495613_0255689 Ga0495613_0255689_84_1187 366
923 3300046690 Ga0495624_0000538 Ga0495624_0000538_2017_3117 366
924 3300046690 Ga0495624_0184045 Ga0495624_0184045_68_1168 366
925 3300046691 Ga0495670_0017939 Ga0495670_0017939_1899_2999 366
926 3300046692 Ga0495671_0055254 Ga0495671_0055254_347_1450 366
927 3300046694 Ga0495649_0085341 Ga0495649_0085341_520_1623 366
928 3300046794 Ga0495589_0069305 Ga0495589_0069305_99_1202 366
929 3300046809 Ga0495600_0002229 Ga0495600_0002229_6065_7165 366
930 3300046809 Ga0495600_0029557 Ga0495600_0029557_2394_3497 366
931 3300047315 Ga0495581_0001238 Ga0495581_0001238_9828_10928 366
932 3300047315 Ga0495581_0057166 Ga0495581_0057166_939_2045 366
933 3300047317 Ga0495604_0005469 Ga0495604_0005469_4896_5999 366
934 3300047317 Ga0495604_0074523 Ga0495604_0074523_1385_2485 366
935 3300047317 Ga0495604_0134829 Ga0495604_0134829_114_1214 366
936 3300047317 Ga0495604_0204143 Ga0495604_0204143_62_1162 366
937 3300047319 Ga0495674_0001854 Ga0495674_0001854_9800_10900 366
938 3300047319 Ga0495674_0020768 Ga0495674_0020768_2914_4014 366
939 3300047319 Ga0495674_0021792 Ga0495674_0021792_1896_2996 366
940 3300047319 Ga0495674_0113269 Ga0495674_0113269_823_1923 366
941 3300047320 Ga0495672_0062942 Ga0495672_0062942_526_1638 366
942 3300047321 Ga0495676_0027183 Ga0495676_0027183_1371_2471 366
943 3300047322 Ga0495680_0021114 Ga0495680_0021114_2187_3287 366
944 3300047322 Ga0495680_0024023 Ga0495680_0024023_1174_2277 366
945 3300047322 Ga0495680_0131314 Ga0495680_0131314_256_1356 366
946 3300047443 Ga0495687_043987 Ga0495687_043987_25_1125 366
947 3300047444 Ga0495675_0062117 Ga0495675_0062117_966_2066 366
948 3300047469 Ga0495673_0010245 Ga0495673_0010245_1544_2644 366
949 3300047471 Ga0495684_0000893 Ga0495684_0000893_5488_6588 366
950 3300047471 Ga0495684_0003057 Ga0495684_0003057_10884_11984 366
951 3300047673 Ga0495593_0000034 Ga0495593_0000034_48283_49383 366
952 3300047673 Ga0495593_0005088 Ga0495593_0005088_803_1903 366
953 3300047673 Ga0495593_0030123 Ga0495593_0030123_1804_2904 366
954 3300048088 Ga0495602_0025294 Ga0495602_0025294_891_1994 366
955 3300048088 Ga0495602_0045096 Ga0495602_0045096_2805_3905 366
956 3300048089 Ga0495614_0012106 Ga0495614_0012106_2656_3756 366
957 3300048090 Ga0495615_0022350 Ga0495615_0022350_12_1112 366
958 3300048903 Ga0496100_0024419 Ga0496100_0024419_1201_2301 366
959 3300048903 Ga0496100_0221778 Ga0496100_0221778_39_1139 366
960 3300048904 Ga0496101_0005889 Ga0496101_0005889_4430_5530 366
961 3300048904 Ga0496101_0022103 Ga0496101_0022103_2406_3506 366
962 3300048904 Ga0496101_0075060 Ga0496101_0075060_67_1170 366
963 3300048904 Ga0496101_0086002 Ga0496101_0086002_402_1502 366
964 3300048905 Ga0496102_0041716 Ga0496102_0041716_2147_3247 366
965 3300048905 Ga0496102_0085515 Ga0496102_0085515_1332_2435 366
966 3300048905 Ga0496102_0129517 Ga0496102_0129517_1077_2177 366
967 3300048905 Ga0496102_0169801 Ga0496102_0169801_744_1844 366
968 3300048906 Ga0496103_0148981 Ga0496103_0148981_260_1360 366
969 3300048907 Ga0496104_0044141 Ga0496104_0044141_2014_3114 366
970 3300048907 Ga0496104_0078027 Ga0496104_0078027_1460_2560 366
971 3300048907 Ga0496104_0085182 Ga0496104_0085182_1724_2824 366
972 3300048907 Ga0496104_0176933 Ga0496104_0176933_32_1132 366
973 3300048907 Ga0496104_0198086 Ga0496104_0198086_245_1345 366
974 3300048908 Ga0496105_0017518 Ga0496105_0017518_1664_2764 366
975 3300048908 Ga0496105_0082763 Ga0496105_0082763_996_2102 366
976 3300048909 Ga0496106_0000649 Ga0496106_0000649_15416_16516 366
977 3300048909 Ga0496106_0001165 Ga0496106_0001165_15299_16399 366
978 3300048909 Ga0496106_0281869 Ga0496106_0281869_161_1261 366
979 3300048910 Ga0496107_0025520 Ga0496107_0025520_252_1352 366
980 3300048910 Ga0496107_0028181 Ga0496107_0028181_251_1351 366
981 3300048910 Ga0496107_0043555 Ga0496107_0043555_1114_2217 366
982 3300048910 Ga0496107_0202412 Ga0496107_0202412_306_1406 366
983 3300048911 Ga0496108_0000744 Ga0496108_0000744_23862_24962 366
984 3300048911 Ga0496108_0247857 Ga0496108_0247857_432_1532 366
985 3300048912 Ga0496109_0001766 Ga0496109_0001766_9012_10112 366
986 3300048912 Ga0496109_0048359 Ga0496109_0048359_628_1728 366
987 3300048912 Ga0496109_0309442 Ga0496109_0309442_141_1256 366
988 3300048913 Ga0496110_0006833 Ga0496110_0006833_6842_7942 366
989 3300048913 Ga0496110_0018692 Ga0496110_0018692_4608_5708 366
990 3300048913 Ga0496110_0056020 Ga0496110_0056020_1686_2789 366
991 3300048913 Ga0496110_0085668 Ga0496110_0085668_722_1822 366
992 3300048913 Ga0496110_0112391 Ga0496110_0112391_1156_2256 366
993 3300048914 Ga0496111_0031499 Ga0496111_0031499_140_1240 366
994 3300048914 Ga0496111_0121446 Ga0496111_0121446_198_1298 366
995 3300048914 Ga0496111_0184210 Ga0496111_0184210_238_1338 366
996 3300048915 Ga0496112_0000008 Ga0496112_0000008_7364_8464 366
997 3300048915 Ga0496112_0050851 Ga0496112_0050851_2371_3474 366
998 3300048915 Ga0496112_0181663 Ga0496112_0181663_224_1324 366
999 3300048917 Ga0496114_0098129 Ga0496114_0098129_1215_2315 366
1000 3300048917 Ga0496114_0174356 Ga0496114_0174356_13_1113 366
1001 3300048917 Ga0496114_0259154 Ga0496114_0259154_335_1435 366
1002 3300048918 Ga0496115_0007272 Ga0496115_0007272_6751_7851 366
1003 3300048918 Ga0496115_0015832 Ga0496115_0015832_2691_3791 366
1004 3300048918 Ga0496115_0117402 Ga0496115_0117402_74_1174 366
1005 3300048918 Ga0496115_0140716 Ga0496115_0140716_617_1723 366
1006 3300048919 Ga0496116_0007242 Ga0496116_0007242_5157_6257 366
1007 3300048920 Ga0496117_0021643 Ga0496117_0021643_2953_4053 366
1008 3300048920 Ga0496117_0153317 Ga0496117_0153317_219_1319 366
1009 3300048921 Ga0496118_0013219 Ga0496118_0013219_6688_7788 366
1010 3300048921 Ga0496118_0051899 Ga0496118_0051899_1373_2473 366
1011 3300048921 Ga0496118_0071624 Ga0496118_0071624_747_1847 366
1012 3300048922 Ga0496119_0053236 Ga0496119_0053236_352_1452 366
1013 3300048922 Ga0496119_0068363 Ga0496119_0068363_868_1968 366
1014 3300048922 Ga0496119_0068812 Ga0496119_0068812_293_1393 366
1015 3300048922 Ga0496119_0076546 Ga0496119_0076546_110_1213 366
1016 3300048923 Ga0496120_0103874 Ga0496120_0103874_329_1429 366
1017 3300048924 Ga0496121_0000476 Ga0496121_0000476_64765_65865 366
1018 3300048924 Ga0496121_0001497 Ga0496121_0001497_26858_27958 366
1019 3300048924 Ga0496121_0001742 Ga0496121_0001742_11168_12268 366
1020 3300048924 Ga0496121_0003089 Ga0496121_0003089_13530_14633 366
1021 3300048924 Ga0496121_0017380 Ga0496121_0017380_6082_7185 366
1022 3300048924 Ga0496121_0025084 Ga0496121_0025084_280_1380 366
1023 3300048924 Ga0496121_0049287 Ga0496121_0049287_617_1717 366
1024 3300048924 Ga0496121_0053890 Ga0496121_0053890_1376_2476 366
1025 3300048924 Ga0496121_0099916 Ga0496121_0099916_859_1959 366
1026 3300048925 Ga0496122_0055284 Ga0496122_0055284_706_1806 366
1027 3300048925 Ga0496122_0060464 Ga0496122_0060464_420_1535 366
1028 3300048925 Ga0496122_0089939 Ga0496122_0089939_545_1645 366
1029 3300048926 Ga0496123_0090680 Ga0496123_0090680_641_1741 366
1030 3300048926 Ga0496123_0096202 Ga0496123_0096202_23_1123 366
1031 3300048927 Ga0496124_0001128 Ga0496124_0001128_33871_34971 366
1032 3300048927 Ga0496124_0153432 Ga0496124_0153432_617_1720 366
1033 3300048927 Ga0496124_0165776 Ga0496124_0165776_141_1241 366
1034 3300048927 Ga0496124_0173653 Ga0496124_0173653_36_1136 366
1035 3300048928 Ga0496125_0000154 Ga0496125_0000154_45861_46976 366
1036 3300048928 Ga0496125_0015007 Ga0496125_0015007_2084_3184 366
1037 3300048928 Ga0496125_0044841 Ga0496125_0044841_718_1821 366
1038 3300048928 Ga0496125_0153920 Ga0496125_0153920_77_1177 366
1039 3300048929 Ga0496126_0002744 Ga0496126_0002744_17314_18414 366
1040 3300048929 Ga0496126_0006113 Ga0496126_0006113_1215_2315 366
1041 3300048929 Ga0496126_0009402 Ga0496126_0009402_4936_6036 366
1042 3300048929 Ga0496126_0015910 Ga0496126_0015910_1510_2610 366
1043 3300048929 Ga0496126_0020832 Ga0496126_0020832_737_1837 366
1044 3300048929 Ga0496126_0032430 Ga0496126_0032430_617_1717 366
1045 3300048929 Ga0496126_0053931 Ga0496126_0053931_1704_2807 366
1046 3300048929 Ga0496126_0079933 Ga0496126_0079933_944_2044 366
1047 3300048929 Ga0496126_0089718 Ga0496126_0089718_576_1676 366
1048 3300048929 Ga0496126_0094162 Ga0496126_0094162_1357_2457 366
1049 3300048929 Ga0496126_0191581 Ga0496126_0191581_511_1689 366
1050 3300048929 Ga0496126_0202508 Ga0496126_0202508_113_1213 366
1051 3300048929 Ga0496126_0319939 Ga0496126_0319939_18_1118 366
1052 3300049568 Ga0501031_0012949 Ga0501031_0012949_3760_4872 366
1053 3300049568 Ga0501031_0064009 Ga0501031_0064009_877_1989 366
1054 3300049569 Ga0501032_0003534 Ga0501032_0003534_6514_7626 366
1055 3300049569 Ga0501032_0012670 Ga0501032_0012670_508_1611 366
1056 3300049569 Ga0501032_0020626 Ga0501032_0020626_3060_4166 366
1057 3300049569 Ga0501032_0082398 Ga0501032_0082398_707_1858 366
1058 3300049570 Ga0501033_0000249 Ga0501033_0000249_28242_29354 366
1059 3300049570 Ga0501033_0000951 Ga0501033_0000951_22391_23503 366
1060 3300049571 Ga0501034_0001938 Ga0501034_0001938_8193_9305 366
1061 3300049571 Ga0501034_0136806 Ga0501034_0136806_157_1260 366
1062 3300049571 Ga0501034_0183501 Ga0501034_0183501_83_1186 366
1063 3300049571 Ga0501034_0290404 Ga0501034_0290404_252_1355 366
1064 3300049571 Ga0501034_0348538 Ga0501034_0348538_26_1186 366
1065 3300049572 Ga0501036_0004433 Ga0501036_0004433_8109_9221 366
1066 3300049572 Ga0501036_0026547 Ga0501036_0026547_34_1137 366
1067 3300049572 Ga0501036_0050620 Ga0501036_0050620_1148_2311 366
1068 3300049572 Ga0501036_0095024 Ga0501036_0095024_927_2087 366
1069 3300049573 Ga0501037_0000112 Ga0501037_0000112_29705_30817 366
1070 3300049573 Ga0501037_0067387 Ga0501037_0067387_1322_2425 366
1071 3300049573 Ga0501037_0130451 Ga0501037_0130451_283_1443 366
1072 3300049574 Ga0501038_0000160 Ga0501038_0000160_42932_44044 366
1073 3300049574 Ga0501038_0002206 Ga0501038_0002206_1853_3004 366
1074 3300049574 Ga0501038_0036532 Ga0501038_0036532_2652_3758 366
1075 3300049574 Ga0501038_0145474 Ga0501038_0145474_578_1741 366
1076 3300049574 Ga0501038_0168699 Ga0501038_0168699_96_1208 366
1077 3300049574 Ga0501038_0341018 Ga0501038_0341018_32_1138 366
1078 3300049575 Ga0501039_0000472 Ga0501039_0000472_27618_28721 366
1079 3300049575 Ga0501039_0001057 Ga0501039_0001057_298_1410 366
1080 3300049575 Ga0501039_0017068 Ga0501039_0017068_23_1135 366
1081 3300049575 Ga0501039_0142515 Ga0501039_0142515_709_1812 366
1082 3300049578 Ga0501042_0015592 Ga0501042_0015592_2404_3564 366
1083 3300049578 Ga0501042_0071253 Ga0501042_0071253_254_1366 366
1084 3300049579 Ga0501043_0000278 Ga0501043_0000278_26089_27201 366
1085 3300049579 Ga0501043_0008635 Ga0501043_0008635_1106_2257 366
1086 3300049579 Ga0501043_0022578 Ga0501043_0022578_391_1497 366
1087 3300049579 Ga0501043_0073668 Ga0501043_0073668_965_2128 366
1088 3300049579 Ga0501043_0096156 Ga0501043_0096156_855_1958 366
1089 3300049579 Ga0501043_0150931 Ga0501043_0150931_106_1218 366
1090 3300049580 Ga0501046_0000937 Ga0501046_0000937_1597_2709 366
1091 3300049580 Ga0501046_0008812 Ga0501046_0008812_3192_4298 366
1092 3300049580 Ga0501046_0012556 Ga0501046_0012556_3802_4905 366
1093 3300049580 Ga0501046_0021462 Ga0501046_0021462_115_1227 366
1094 3300049580 Ga0501046_0065853 Ga0501046_0065853_1574_2737 366
1095 3300049581 Ga0501047_0000275 Ga0501047_0000275_36699_37811 366
1096 3300049581 Ga0501047_0009938 Ga0501047_0009938_3189_4295 366
1097 3300049581 Ga0501047_0089000 Ga0501047_0089000_255_1406 366
1098 3300049581 Ga0501047_0122575 Ga0501047_0122575_740_1903 366
1099 3300049581 Ga0501047_0336852 Ga0501047_0336852_85_1185 366
1100 3300049582 Ga0501048_0001248 Ga0501048_0001248_4196_5308 366
1101 3300049582 Ga0501048_0011414 Ga0501048_0011414_2726_3829 366
1102 3300049582 Ga0501048_0022723 Ga0501048_0022723_2269_3429 366
1103 3300049582 Ga0501048_0036570 Ga0501048_0036570_2318_3424 366
1104 3300049583 Ga0501067_0000258 Ga0501067_0000258_13692_14804 366
1105 3300049583 Ga0501067_0013462 Ga0501067_0013462_2844_3947 366
1106 3300049583 Ga0501067_0084036 Ga0501067_0084036_250_1350 366
1107 3300049584 Ga0501068_0004146 Ga0501068_0004146_1819_2931 366
1108 3300049584 Ga0501068_0015819 Ga0501068_0015819_2830_3990 366
1109 3300049584 Ga0501068_0026245 Ga0501068_0026245_1562_2665 366
1110 3300049584 Ga0501068_0064658 Ga0501068_0064658_99_1262 366
1111 3300049584 Ga0501068_0140272 Ga0501068_0140272_169_1281 366
1112 3300049585 Ga0501069_0013808 Ga0501069_0013808_296_1408 366
1113 3300049586 Ga0501070_0002548 Ga0501070_0002548_4167_5279 366
1114 3300049586 Ga0501070_0006200 Ga0501070_0006200_3354_4517 366
1115 3300049586 Ga0501070_0020554 Ga0501070_0020554_2445_3548 366
1116 3300049586 Ga0501070_0068502 Ga0501070_0068502_1035_2195 366
1117 3300049587 Ga0501071_0196477 Ga0501071_0196477_199_1302 366
1118 3300049588 Ga0501072_0003198 Ga0501072_0003198_1333_2445 366
1119 3300049589 Ga0501073_0000103 Ga0501073_0000103_17113_18225 366
1120 3300049589 Ga0501073_0038356 Ga0501073_0038356_1493_2656 366
1121 3300049589 Ga0501073_0096064 Ga0501073_0096064_594_1697 366
1122 3300049590 Ga0501074_0000456 Ga0501074_0000456_19879_20991 366
1123 3300049590 Ga0501074_0067246 Ga0501074_0067246_737_1900 366
1124 3300049590 Ga0501074_0085067 Ga0501074_0085067_432_1592 366
1125 3300049592 Ga0501076_0063997 Ga0501076_0063997_497_1657 366
1126 3300049593 Ga0501077_0104803 Ga0501077_0104803_294_1454 366
1127 3300049741 Ga0501079_0000451 Ga0501079_0000451_11606_12718 366
1128 3300049741 Ga0501079_0010445 Ga0501079_0010445_2543_3706 366
1129 3300049742 Ga0501080_0000082 Ga0501080_0000082_3679_4782 366
1130 3300049742 Ga0501080_0002998 Ga0501080_0002998_7863_8975 366
1131 3300049742 Ga0501080_0016338 Ga0501080_0016338_3305_4408 366
1132 3300049742 Ga0501080_0071776 Ga0501080_0071776_1386_2546 366
1133 3300049742 Ga0501080_0082435 Ga0501080_0082435_1295_2458 366
1134 3300049744 Ga0501083_0009193 Ga0501083_0009193_4167_5279 366
1135 3300049744 Ga0501083_0058731 Ga0501083_0058731_965_2128 366
1136 3300049822 Ga0501035_0000766 Ga0501035_0000766_17113_18225 366
1137 3300049822 Ga0501035_0011386 Ga0501035_0011386_931_2037 366
1138 3300049822 Ga0501035_0018251 Ga0501035_0018251_2916_4019 366
1139 3300049822 Ga0501035_0045134 Ga0501035_0045134_1785_2897 366
1140 3300049822 Ga0501035_0078488 Ga0501035_0078488_199_1305 366
1141 3300049822 Ga0501035_0124942 Ga0501035_0124942_1035_2198 366
1142 3300049822 Ga0501035_0159477 Ga0501035_0159477_548_1708 366
1143 3300049823 Ga0501044_0000418 Ga0501044_0000418_43245_44357 366
1144 3300049823 Ga0501044_0024381 Ga0501044_0024381_283_1434 366
1145 3300049823 Ga0501044_0034063 Ga0501044_0034063_490_1593 366
1146 3300049823 Ga0501044_0078546 Ga0501044_0078546_883_1983 366
1147 3300049823 Ga0501044_0196236 Ga0501044_0196236_793_1953 366
1148 3300049823 Ga0501044_0218611 Ga0501044_0218611_645_1808 366
1149 3300049823 Ga0501044_0272344 Ga0501044_0272344_300_1412 366
1150 3300049823 Ga0501044_0325483 Ga0501044_0325483_282_1382 366
1151 3300049824 Ga0501045_0038807 Ga0501045_0038807_1321_2481 366
1152 3300049824 Ga0501045_0077486 Ga0501045_0077486_721_1833 366
1153 3300050492 nmdc:mga0yw44_1397_c1 nmdc:mga0yw44_1397_c1_3820_4923 366
1154 3300050492 nmdc:mga0yw44_17247_c1 nmdc:mga0yw44_17247_c1_478_1578 366
1155 3300050492 nmdc:mga0yw44_94319_c1 nmdc:mga0yw44_94319_c1_484_1584 366
1156 3300050494 nmdc:mga06z11_31082_c1 nmdc:mga06z11_31082_c1_641_1741 366
1157 3300050511 nmdc:mga08y16_196743_c1 nmdc:mga08y16_196743_c1_879_1982 366
1158 3300050512 nmdc:mga0n895_80110_c1 nmdc:mga0n895_80110_c1_1997_3103 366
1159 3300050514 nmdc:mga08x19_192730_c1 nmdc:mga08x19_192730_c1_128_1228 366
1160 3300050514 nmdc:mga08x19_24160_c1 nmdc:mga08x19_24160_c1_1602_2702 366
1161 3300050515 nmdc:mga0a205_311035_c1 nmdc:mga0a205_311035_c1_303_1406 366
1162 3300050515 nmdc:mga0a205_3227_c1 nmdc:mga0a205_3227_c1_9186_10292 366
1163 3300050516 nmdc:mga0sz30_22811_c2 nmdc:mga0sz30_22811_c2_391_1491 366
1164 3300053077 Ga0495601_0009529 Ga0495601_0009529_3566_4666 366
1165 3300053077 Ga0495601_0037183 Ga0495601_0037183_1425_2525 366
1166 3300053077 Ga0495601_0083052 Ga0495601_0083052_766_1866 366
1167 3300053077 Ga0495601_0220392 Ga0495601_0220392_41_1141 366
1168 3300053078 Ga0495612_0046196 Ga0495612_0046196_529_1635 366
1169 3300053085 Ga0495619_0077914 Ga0495619_0077914_574_1674 366
1170 3300053087 Ga0500643_000267 Ga0500643_000267_12579_13679 366
1171 3300053087 Ga0500643_018509 Ga0500643_018509_127_1227 366
1172 3300053089 Ga0500581_085026 Ga0500581_085026_164_1264 366
1173 3300053092 Ga0500583_0086589 Ga0500583_0086589_73_1173 366
1174 3300053093 Ga0500651_0000861 Ga0500651_0000861_11924_13027 366
1175 3300053094 Ga0500566_0000157 Ga0500566_0000157_7558_8658 366
1176 3300053094 Ga0500566_0001146 Ga0500566_0001146_6657_7757 366
1177 3300053096 Ga0500641_0058981 Ga0500641_0058981_174_1274 366
1178 3300053098 Ga0500650_0001493 Ga0500650_0001493_1241_2341 366
1179 3300053102 Ga0500554_000718 Ga0500554_000718_2176_3285 366
1180 3300053102 Ga0500554_003128 Ga0500554_003128_1780_2880 366
1181 3300053103 Ga0500555_002718 Ga0500555_002718_2493_3593 366
1182 3300053104 Ga0500556_0000413 Ga0500556_0000413_5063_6163 366
1183 3300053105 Ga0500557_000041 Ga0500557_000041_39908_41008 366
1184 3300053109 Ga0500569_001799 Ga0500569_001799_2373_3473 366
1185 3300053116 Ga0500592_004170 Ga0500592_004170_309_1409 366
1186 3300053118 Ga0500594_0030081 Ga0500594_0030081_97_1197 366
1187 3300053119 Ga0500595_003818 Ga0500595_003818_5145_6245 366
1188 3300053119 Ga0500595_006228 Ga0500595_006228_3331_4431 366
1189 3300053122 Ga0500608_004754 Ga0500608_004754_1837_2937 366
1190 3300053128 Ga0500626_057934 Ga0500626_057934_505_1605 366
1191 3300053130 Ga0500642_0000005 Ga0500642_0000005_25015_26115 366
1192 3300053131 Ga0500652_000531 Ga0500652_000531_7915_9015 366
1193 3300053134 Ga0500658_0011515 Ga0500658_0011515_486_1589 366
1194 3300053134 Ga0500658_0013696 Ga0500658_0013696_1677_2777 366
1195 3300053134 Ga0500658_0044143 Ga0500658_0044143_241_1341 366
1196 3300053134 Ga0500658_0081505 Ga0500658_0081505_11_1111 366
1197 3300053136 Ga0500559_0003580 Ga0500559_0003580_5960_7060 366
1198 3300053136 Ga0500559_0018273 Ga0500559_0018273_766_1869 366
1199 3300053139 Ga0500568_0002109 Ga0500568_0002109_9583_10683 366
1200 3300053139 Ga0500568_0011586 Ga0500568_0011586_2563_3666 366
1201 3300053139 Ga0500568_0028346 Ga0500568_0028346_700_1800 366
1202 3300053142 Ga0500577_0000693 Ga0500577_0000693_2698_3798 366
1203 3300053150 Ga0500603_000277 Ga0500603_000277_7460_8569 366
1204 3300053151 Ga0500604_0003539 Ga0500604_0003539_1666_2766 366
1205 3300053153 Ga0500616_0000166 Ga0500616_0000166_81387_82487 366
1206 3300053153 Ga0500616_0000180 Ga0500616_0000180_79916_81016 366
1207 3300053153 Ga0500616_0028432 Ga0500616_0028432_494_1645 366
1208 3300053156 Ga0500622_0011079 Ga0500622_0011079_2573_3673 366
1209 3300053156 Ga0500622_0029561 Ga0500622_0029561_1537_2688 366
1210 3300053157 Ga0500624_002833 Ga0500624_002833_630_1730 366
1211 3300053161 Ga0500634_0031081 Ga0500634_0031081_12_1112 366
1212 3300053162 Ga0500638_001014 Ga0500638_001014_1489_2589 366
1213 3300053163 Ga0500639_033548 Ga0500639_033548_94_1197 366
1214 3300053177 Ga0500636_0001916 Ga0500636_0001916_4452_5552 366
1215 3300053177 Ga0500636_0011628 Ga0500636_0011628_2092_3192 366
1216 3300053178 Ga0500637_0000121 Ga0500637_0000121_18687_19787 366
1217 3300053178 Ga0500637_0002840 Ga0500637_0002840_4673_5782 366
1218 3300053178 Ga0500637_0103898 Ga0500637_0103898_146_1246 366
1219 3300053729 Ga0500625_003212 Ga0500625_003212_2150_3250 366
1220 3300053731 Ga0500609_004134 Ga0500609_004134_68_1168 366
1221 3300053735 Ga0500596_000810 Ga0500596_000810_4738_5841 366
1222 3300053737 Ga0500601_000076 Ga0500601_000076_18875_19975 366
1223 3300054114 Ga0501084_0003972 Ga0501084_0003972_7042_8154 366
1224 3300054114 Ga0501084_0222438 Ga0501084_0222438_169_1272 366
1225 3300055283 Ga0500661_000452 Ga0500661_000452_6325_7425 366
1226 3300060353 Ga0501082_0011183 Ga0501082_0011183_2352_3464 366
1227 iso_pu_bacteria 2643221651 2644287346 366
1228 iso_pu_bacteria 2904690495 2904697727 366
1229 iso_pu_bacteria 8016603502 8016604083 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

183

350

0.97

PF03033

Glyco_transf_28

Glycosyltransferase family 28 N-terminal domain

8

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8981 6 363
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.8904 6 363
8dp7-assembly1.cif.gz_A structure of helicobacter pylori egtu bound to egt 0.8668 7 39
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8416 4 362
7d1i-assembly1.cif.gz_B-2 crystal structure of acinetobacter baumannii murg 0.8346 4 362
ID Description Score Start End Superfamily
af_Q2FYL5_1_178_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9013 5 169 3.40.50.2000
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8951 222 346 3.40.50.2000
3s2uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8789 167 348 3.40.50.2000
3s2uA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8763 6 166 3.40.50.2000
af_K7KRG7_37_209_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8761 6 171 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A436LCT7-F1-model_v4 deleted 0.9837 161 365
AF-A0A060BN88-F1-model_v4 Glyco_tran_28_C 0.98 176 307 GO:0050511
AF-A0A519JEV0-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9736 220 362 GO:0050511
AF-A0A435JI80-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 0.9714 183 365 GO:0050511
AF-A5EPK4-F1-model_v4 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) 0.9713 3 366 GO:0005886
GO:0005975
GO:0008360
GO:0009252
GO:0030259
GO:0050511
GO:0051301
GO:0051991
GO:0071555

Feature Viewer

pLDDT pTM Quality
89.48 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map