F491968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1229 | 640 | 1012 | 366 |
Family's Representative Sequence
| Representative Sequence | 3300020070|Ga0206356_10862082|Ga0206356_108620822 |
| Length | 360 |
| Sequence | METTAPLILLAAGGTGGHLFPAEALGVELIKRGLRVRLVTDDRALKYSGLFSKDMIDVVASETARGRNPLQLAYAIFTLATGTLSAFGLMRRLKPAAVVGFGGYPTLPPLIAARIAGIPGVIHDANAVLGRANRFLARHVTAIATSLPCVLDRDPTLSAKATTVGTPRRPAIYTAPETNGPFRLLVVGGSQGARVMSDIVPGAIERLEPALWSRLILTQQVREEDMIRVRAVYDRLKIQAELAPFFTDLPARLASNHLVVSRSGAGTIAELAAIGRPSILVPLPGAIDQDQFANAGVLSEVDGALRIPQAEFTSDRLASEISALAAEPQRLAAMAAAARSAGRLDAAERLADLVVKTAGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 39 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 40 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 41 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 42 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 43 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 44 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 45 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 46 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 47 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 48 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 49 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 50 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 51 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 52 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 53 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 54 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 55 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 56 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 57 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 58 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 59 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 60 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 61 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 62 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 63 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 64 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 65 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 66 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 67 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 68 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 69 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 70 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 71 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 72 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 73 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 74 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 75 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 76 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 77 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 78 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 79 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 80 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 81 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 82 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 83 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 84 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 85 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 86 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 87 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 88 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 89 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 90 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 91 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 92 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 93 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 94 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 95 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 96 | 2904699407 | |||
| 97 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 98 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 99 | 2906610324 | |||
| 100 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 101 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 102 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 103 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 104 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 105 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 106 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 107 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 108 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 109 | 2922368715 | |||
| 110 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 111 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 112 | 2922425934 | |||
| 113 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 114 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 115 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 116 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 117 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 118 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 119 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 120 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 121 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 122 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 123 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 124 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 125 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 126 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 127 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 128 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 129 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 130 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 131 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 132 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 133 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 134 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 135 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 136 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 137 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 138 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 139 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 140 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 141 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 142 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 143 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 144 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 145 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 146 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 147 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 148 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 149 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 150 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 151 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 152 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 153 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 154 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 155 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 156 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 157 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 158 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 159 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 160 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 161 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 162 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 163 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 164 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 165 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 166 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 167 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 168 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 169 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 170 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 171 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 172 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 173 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 174 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 175 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 176 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 177 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 178 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 179 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 180 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 181 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 182 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 183 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 184 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 185 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 186 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 187 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 188 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 189 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 190 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 192 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 194 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 196 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 212 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 213 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 216 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 218 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 222 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 223 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 224 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 225 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 226 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 227 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 228 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 229 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 230 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 231 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 232 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 233 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 234 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 235 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 236 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 237 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 238 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 240 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 241 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 242 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 243 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 244 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 245 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 246 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 247 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 249 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 250 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 251 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 252 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 253 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 254 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 256 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 257 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 258 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 259 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 260 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 271 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 281 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 282 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 283 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 284 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 285 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 286 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 287 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 292 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 293 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 295 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 347 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 348 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 349 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 350 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 354 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 355 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 356 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 357 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 358 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 359 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 360 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 361 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 362 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 363 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 364 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 365 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 366 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 367 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 368 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 369 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 370 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 371 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 372 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 373 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 374 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 375 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 376 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 377 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 378 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 379 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 380 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 381 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 382 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 383 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 384 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 385 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 386 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 387 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 388 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 389 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 390 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 391 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 392 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 393 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 394 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 395 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 396 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 397 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 398 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 399 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 400 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 401 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 402 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 403 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 404 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 405 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 406 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 407 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 408 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 409 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 410 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 411 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 412 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 413 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 414 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 415 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 416 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 417 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 418 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 492 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 494 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 495 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 496 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 497 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 498 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 499 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 500 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 501 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 502 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 503 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 504 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 505 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 506 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 507 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 508 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 509 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 510 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 511 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 512 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 513 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 514 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 515 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 516 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 517 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 537 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 545 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 546 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 547 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 548 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 549 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 550 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 556 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 559 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 562 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 563 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 564 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 565 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 566 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 567 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 568 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 569 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 570 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 571 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 572 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 573 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 574 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 575 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 576 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 577 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 578 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 579 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 580 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 581 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 582 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 583 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 584 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 585 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 586 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 587 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 588 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 589 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 590 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 591 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 592 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 593 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 594 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 595 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 596 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 597 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 598 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 599 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 600 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 601 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 602 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 603 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 605 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 607 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 608 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 609 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 610 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 611 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 612 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 613 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 614 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 615 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 616 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 617 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 618 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 619 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 620 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 621 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 622 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 623 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 624 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 625 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 626 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 627 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 628 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 629 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 630 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 631 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 632 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 633 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 634 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 635 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 636 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 637 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 638 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 639 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 640 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.52 |
| Metatranscriptomes | 0.16 |
| Isolates | 17.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.85 |
| Nodule | 14.48 |
| Rhizoplane | 5.21 |
| Rhizosphere | 59.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000068 | 3300003203 | Bacteria | 47530 |
| 2 | JGI25406J46586_10000392 | 3300003203 | Bacteria | 20055 |
| 3 | JGI25406J46586_10003218 | 3300003203 | Bacteria | 7680 |
| 4 | JGI25153J46596_10004141 | 3300003215 | Bacteria | 7882 |
| 5 | JGI25153J46596_10004246 | 3300003215 | Bacteria | 7754 |
| 6 | JGI25153J46596_10008945 | 3300003215 | Bacteria | 4723 |
| 7 | JGI25153J46596_10009956 | 3300003215 | Bacteria | 4347 |
| 8 | JGI25160J50197_1001885 | 3300003354 | Bacteria | 10064 |
| 9 | JGI25160J50197_1003307 | 3300003354 | Bacteria | 7256 |
| 10 | JGI25160J50197_1008344 | 3300003354 | Bacteria | 3953 |
| 11 | Ga0055531_10005281 | 3300003794 | Bacteria | 7578 |
| 12 | Ga0055543_1007542 | 3300004625 | Bacteria | 2500 |
| 13 | Ga0065165_1004626 | 3300005262 | Bacteria | 8358 |
| 14 | Ga0065165_1004931 | 3300005262 | Bacteria | 7867 |
| 15 | Ga0065165_1016843 | 3300005262 | Bacteria | 2717 |
| 16 | Ga0070683_100008367 | 3300005329 | Bacteria | 8784 |
| 17 | Ga0070683_100080340 | 3300005329 | Bacteria | 3052 |
| 18 | Ga0070670_100209197 | 3300005331 | Bacteria | 1696 |
| 19 | Ga0068869_100087262 | 3300005334 | Bacteria | 2340 |
| 20 | Ga0068869_100179707 | 3300005334 | Bacteria | 1658 |
| 21 | Ga0068869_100217902 | 3300005334 | Bacteria | 1511 |
| 22 | Ga0070666_10043956 | 3300005335 | Bacteria | 2992 |
| 23 | Ga0070680_100027612 | 3300005336 | Bacteria | 4545 |
| 24 | Ga0070680_100089896 | 3300005336 | Bacteria | 2541 |
| 25 | Ga0070682_100172374 | 3300005337 | Bacteria | 1505 |
| 26 | Ga0068868_100132236 | 3300005338 | Bacteria | 2042 |
| 27 | Ga0068868_100267873 | 3300005338 | Bacteria | 1442 |
| 28 | Ga0070660_100002003 | 3300005339 | Bacteria | 14053 |
| 29 | Ga0070661_100062206 | 3300005344 | Bacteria | 2741 |
| 30 | Ga0070668_100103950 | 3300005347 | Bacteria | 2253 |
| 31 | Ga0070669_100121573 | 3300005353 | Bacteria | 1993 |
| 32 | Ga0070671_100026137 | 3300005355 | Bacteria | 4795 |
| 33 | Ga0070674_100192865 | 3300005356 | Bacteria | 1568 |
| 34 | Ga0070659_100200993 | 3300005366 | Bacteria | 1640 |
| 35 | Ga0070709_10001417 | 3300005434 | Bacteria | 12994 |
| 36 | Ga0070709_10010289 | 3300005434 | Bacteria | 5172 |
| 37 | Ga0070709_10032218 | 3300005434 | Bacteria | 3159 |
| 38 | Ga0070709_10168899 | 3300005434 | Bacteria | 1527 |
| 39 | Ga0070714_100000678 | 3300005435 | Bacteria | 24075 |
| 40 | Ga0070714_100018262 | 3300005435 | Bacteria | 5694 |
| 41 | Ga0070714_100033934 | 3300005435 | Bacteria | 4272 |
| 42 | Ga0070714_100107626 | 3300005435 | Bacteria | 2464 |
| 43 | Ga0070714_100113747 | 3300005435 | Bacteria | 2400 |
| 44 | Ga0070713_100004076 | 3300005436 | Bacteria | 9730 |
| 45 | Ga0070713_100020815 | 3300005436 | Bacteria | 5036 |
| 46 | Ga0070713_100194184 | 3300005436 | Bacteria | 1831 |
| 47 | Ga0070713_100277773 | 3300005436 | Bacteria | 1536 |
| 48 | Ga0070710_10000633 | 3300005437 | Bacteria | 16752 |
| 49 | Ga0070710_10001070 | 3300005437 | Bacteria | 12969 |
| 50 | Ga0070710_10019478 | 3300005437 | Bacteria | 3507 |
| 51 | Ga0070710_10114774 | 3300005437 | Bacteria | 1622 |
| 52 | Ga0070711_100001478 | 3300005439 | Bacteria | 12909 |
| 53 | Ga0070711_100001837 | 3300005439 | Bacteria | 11834 |
| 54 | Ga0070711_100002216 | 3300005439 | Bacteria | 11029 |
| 55 | Ga0070711_100056360 | 3300005439 | Bacteria | 2717 |
| 56 | Ga0070708_100041592 | 3300005445 | Bacteria | 4030 |
| 57 | Ga0070663_100078956 | 3300005455 | Bacteria | 2413 |
| 58 | Ga0070663_100088728 | 3300005455 | Bacteria | 2287 |
| 59 | Ga0070663_100231032 | 3300005455 | Bacteria | 1456 |
| 60 | Ga0070662_100015684 | 3300005457 | Bacteria | 5080 |
| 61 | Ga0070662_100076417 | 3300005457 | Bacteria | 2482 |
| 62 | Ga0070681_10026780 | 3300005458 | Bacteria | 5797 |
| 63 | Ga0070681_10043509 | 3300005458 | Bacteria | 4499 |
| 64 | Ga0070681_10084030 | 3300005458 | Bacteria | 3136 |
| 65 | Ga0070681_10168938 | 3300005458 | Bacteria | 2109 |
| 66 | Ga0070681_10200047 | 3300005458 | Bacteria | 1916 |
| 67 | Ga0068867_100091974 | 3300005459 | Bacteria | 2303 |
| 68 | Ga0070707_100084934 | 3300005468 | Bacteria | 3059 |
| 69 | Ga0070699_100418958 | 3300005518 | Bacteria | 1212 |
| 70 | Ga0070679_100084687 | 3300005530 | Bacteria | 3158 |
| 71 | Ga0070679_100165930 | 3300005530 | Bacteria | 2182 |
| 72 | Ga0070679_100169165 | 3300005530 | Bacteria | 2158 |
| 73 | Ga0070679_100172326 | 3300005530 | Bacteria | 2137 |
| 74 | Ga0070684_100005206 | 3300005535 | Bacteria | 9945 |
| 75 | Ga0070684_100006273 | 3300005535 | Bacteria | 9183 |
| 76 | Ga0070684_100014119 | 3300005535 | Bacteria | 6458 |
| 77 | Ga0068853_100008362 | 3300005539 | Bacteria | 8309 |
| 78 | Ga0068853_100010311 | 3300005539 | Bacteria | 7556 |
| 79 | Ga0068853_100028252 | 3300005539 | Bacteria | 4716 |
| 80 | Ga0070672_100064626 | 3300005543 | Bacteria | 2891 |
| 81 | Ga0070672_100183381 | 3300005543 | Bacteria | 1745 |
| 82 | Ga0070693_100151182 | 3300005547 | Bacteria | 1470 |
| 83 | Ga0070665_100047437 | 3300005548 | Bacteria | 4311 |
| 84 | Ga0070665_100149380 | 3300005548 | Bacteria | 2340 |
| 85 | Ga0070665_100161240 | 3300005548 | Bacteria | 2245 |
| 86 | Ga0070665_100212428 | 3300005548 | Bacteria | 1935 |
| 87 | Ga0068855_100030914 | 3300005563 | Bacteria | 6399 |
| 88 | Ga0068857_100213706 | 3300005577 | Bacteria | 1760 |
| 89 | Ga0068854_100036841 | 3300005578 | Bacteria | 3430 |
| 90 | Ga0068854_100051460 | 3300005578 | Bacteria | 2951 |
| 91 | Ga0068854_100124665 | 3300005578 | Bacteria | 1960 |
| 92 | Ga0068856_100000091 | 3300005614 | Bacteria | 85048 |
| 93 | Ga0068856_100011262 | 3300005614 | Bacteria | 8680 |
| 94 | Ga0068856_100056546 | 3300005614 | Bacteria | 3871 |
| 95 | Ga0068856_100134819 | 3300005614 | Bacteria | 2474 |
| 96 | Ga0068856_100204413 | 3300005614 | Bacteria | 1989 |
| 97 | Ga0068852_100056055 | 3300005616 | Bacteria | 3404 |
| 98 | Ga0068852_100162382 | 3300005616 | Bacteria | 2087 |
| 99 | Ga0068852_100205706 | 3300005616 | Bacteria | 1865 |
| 100 | Ga0068859_100217615 | 3300005617 | Bacteria | 1997 |
| 101 | Ga0068864_100110233 | 3300005618 | Bacteria | 2451 |
| 102 | Ga0068866_10007748 | 3300005718 | Bacteria | 4505 |
| 103 | Ga0068861_100054122 | 3300005719 | Bacteria | 3056 |
| 104 | Ga0068851_10001608 | 3300005834 | Bacteria | 9920 |
| 105 | Ga0068851_10035213 | 3300005834 | Bacteria | 2501 |
| 106 | Ga0068863_100111545 | 3300005841 | Bacteria | 2605 |
| 107 | Ga0068858_100021103 | 3300005842 | Bacteria | 6084 |
| 108 | Ga0068858_100171542 | 3300005842 | Bacteria | 2045 |
| 109 | Ga0068860_100000254 | 3300005843 | Bacteria | 79465 |
| 110 | Ga0068862_100052468 | 3300005844 | Bacteria | 3489 |
| 111 | Ga0068862_100231871 | 3300005844 | Bacteria | 1675 |
| 112 | Ga0081455_10004793 | 3300005937 | Bacteria | 15034 |
| 113 | Ga0081455_10026261 | 3300005937 | Bacteria | 5362 |
| 114 | Ga0081455_10042135 | 3300005937 | Bacteria | 4008 |
| 115 | Ga0081540_1001143 | 3300005983 | Bacteria | 23424 |
| 116 | Ga0081540_1003272 | 3300005983 | Bacteria | 12881 |
| 117 | Ga0081540_1005484 | 3300005983 | Bacteria | 9466 |
| 118 | Ga0081540_1009836 | 3300005983 | Bacteria | 6542 |
| 119 | Ga0081540_1012663 | 3300005983 | Bacteria | 5533 |
| 120 | Ga0081540_1013469 | 3300005983 | Bacteria | 5311 |
| 121 | Ga0081540_1030172 | 3300005983 | Bacteria | 3008 |
| 122 | Ga0081539_10000191 | 3300005985 | Bacteria | 142387 |
| 123 | Ga0081539_10000321 | 3300005985 | Bacteria | 106887 |
| 124 | Ga0070717_10005443 | 3300006028 | Bacteria | 9293 |
| 125 | Ga0070717_10029235 | 3300006028 | Bacteria | 4419 |
| 126 | Ga0075365_10008079 | 3300006038 | Bacteria | 5942 |
| 127 | Ga0075365_10026332 | 3300006038 | Bacteria | 3691 |
| 128 | Ga0075365_10086379 | 3300006038 | Bacteria | 2132 |
| 129 | Ga0075368_10023834 | 3300006042 | Bacteria | 2341 |
| 130 | Ga0075364_10027354 | 3300006051 | Bacteria | 3642 |
| 131 | Ga0070715_10000078 | 3300006163 | Bacteria | 27243 |
| 132 | Ga0070716_100017445 | 3300006173 | Bacteria | 3722 |
| 133 | Ga0070716_100046221 | 3300006173 | Bacteria | 2448 |
| 134 | Ga0070716_100064152 | 3300006173 | Bacteria | 2135 |
| 135 | Ga0070716_100075084 | 3300006173 | Bacteria | 1999 |
| 136 | Ga0070716_100097833 | 3300006173 | Bacteria | 1792 |
| 137 | Ga0070716_100106129 | 3300006173 | Bacteria | 1732 |
| 138 | Ga0070712_100011086 | 3300006175 | Bacteria | 5706 |
| 139 | Ga0070712_100040056 | 3300006175 | Bacteria | 3210 |
| 140 | Ga0070712_100063527 | 3300006175 | Bacteria | 2615 |
| 141 | Ga0070712_100110148 | 3300006175 | Bacteria | 2053 |
| 142 | Ga0075367_10036274 | 3300006178 | Bacteria | 2858 |
| 143 | Ga0075367_10115214 | 3300006178 | Bacteria | 1652 |
| 144 | Ga0075366_10012258 | 3300006195 | Bacteria | 4859 |
| 145 | Ga0075366_10121287 | 3300006195 | Bacteria | 1576 |
| 146 | Ga0097621_100091612 | 3300006237 | Bacteria | 2545 |
| 147 | Ga0075370_10037250 | 3300006353 | Bacteria | 2734 |
| 148 | Ga0075370_10038133 | 3300006353 | Bacteria | 2704 |
| 149 | Ga0068871_100083324 | 3300006358 | Bacteria | 2652 |
| 150 | Ga0075428_100089794 | 3300006844 | Bacteria | 3351 |
| 151 | Ga0075433_10029509 | 3300006852 | Bacteria | 4674 |
| 152 | Ga0075434_100081100 | 3300006871 | Bacteria | 3241 |
| 153 | Ga0075434_100304415 | 3300006871 | Bacteria | 1614 |
| 154 | Ga0075436_100049564 | 3300006914 | Bacteria | 2898 |
| 155 | Ga0075436_100210447 | 3300006914 | Bacteria | 1378 |
| 156 | Ga0097620_100217615 | 3300006931 | Bacteria | 1997 |
| 157 | Ga0099825_1018997 | 3300006941 | Bacteria | 5214 |
| 158 | Ga0099824_1023697 | 3300006942 | Bacteria | 3746 |
| 159 | Ga0099822_1000022 | 3300006943 | Bacteria | 64942 |
| 160 | Ga0099823_1027652 | 3300006944 | Bacteria | 4931 |
| 161 | Ga0075435_100164113 | 3300007076 | Bacteria | 1872 |
| 162 | Ga0105240_10017201 | 3300009093 | Bacteria | 9755 |
| 163 | Ga0105240_10022325 | 3300009093 | Bacteria | 8392 |
| 164 | Ga0105240_10068093 | 3300009093 | Bacteria | 4410 |
| 165 | Ga0105240_10086587 | 3300009093 | Bacteria | 3837 |
| 166 | Ga0105240_10189377 | 3300009093 | Bacteria | 2420 |
| 167 | Ga0105240_10210308 | 3300009093 | Bacteria | 2274 |
| 168 | Ga0105240_10393406 | 3300009093 | Bacteria | 1563 |
| 169 | Ga0111539_10119503 | 3300009094 | Bacteria | 3088 |
| 170 | Ga0105245_10071520 | 3300009098 | Bacteria | 3150 |
| 171 | Ga0105245_10117886 | 3300009098 | Bacteria | 2477 |
| 172 | Ga0105245_10237372 | 3300009098 | Bacteria | 1766 |
| 173 | Ga0105245_10268214 | 3300009098 | Bacteria | 1664 |
| 174 | Ga0105247_10019830 | 3300009101 | Bacteria | 4039 |
| 175 | Ga0105243_10272915 | 3300009148 | Bacteria | 1519 |
| 176 | Ga0105241_10014950 | 3300009174 | Bacteria | 5682 |
| 177 | Ga0105241_10029800 | 3300009174 | Bacteria | 4074 |
| 178 | Ga0105241_10296841 | 3300009174 | Bacteria | 1385 |
| 179 | Ga0105248_10150640 | 3300009177 | Bacteria | 2624 |
| 180 | Ga0105248_10187065 | 3300009177 | Bacteria | 2334 |
| 181 | Ga0105237_10015378 | 3300009545 | Bacteria | 7967 |
| 182 | Ga0105237_10018494 | 3300009545 | Bacteria | 7212 |
| 183 | Ga0105237_10024176 | 3300009545 | Bacteria | 6216 |
| 184 | Ga0105237_10028922 | 3300009545 | Bacteria | 5640 |
| 185 | Ga0105237_10095800 | 3300009545 | Bacteria | 2957 |
| 186 | Ga0105237_10138023 | 3300009545 | Bacteria | 2432 |
| 187 | Ga0105237_10146881 | 3300009545 | Bacteria | 2353 |
| 188 | Ga0105237_10286821 | 3300009545 | Bacteria | 1649 |
| 189 | Ga0105238_10008134 | 3300009551 | Bacteria | 10489 |
| 190 | Ga0105238_10057140 | 3300009551 | Bacteria | 3913 |
| 191 | Ga0105238_10142835 | 3300009551 | Bacteria | 2370 |
| 192 | Ga0105238_10396014 | 3300009551 | Bacteria | 1374 |
| 193 | Ga0105249_10077171 | 3300009553 | Bacteria | 3089 |
| 194 | Ga0105249_10275370 | 3300009553 | Bacteria | 1678 |
| 195 | Ga0099796_10014701 | 3300010159 | Bacteria | 2269 |
| 196 | Ga0099796_10023589 | 3300010159 | Bacteria | 1923 |
| 197 | Ga0105239_10053854 | 3300010375 | Bacteria | 4412 |
| 198 | Ga0105239_10111365 | 3300010375 | Bacteria | 3034 |
| 199 | Ga0105239_10127689 | 3300010375 | Bacteria | 2827 |
| 200 | Ga0105239_10373523 | 3300010375 | Bacteria | 1611 |
| 201 | Ga0105246_10028278 | 3300011119 | Bacteria | 3682 |
| 202 | Ga0157370_10044331 | 3300013104 | Bacteria | 4276 |
| 203 | Ga0157370_10254099 | 3300013104 | Bacteria | 1625 |
| 204 | Ga0157369_10016060 | 3300013105 | Bacteria | 8422 |
| 205 | Ga0157369_10198242 | 3300013105 | Bacteria | 2107 |
| 206 | Ga0157374_10092378 | 3300013296 | Bacteria | 2887 |
| 207 | Ga0157375_10052552 | 3300013308 | Bacteria | 4006 |
| 208 | Ga0163163_10087824 | 3300014325 | Bacteria | 3120 |
| 209 | Ga0163163_10156308 | 3300014325 | Bacteria | 2325 |
| 210 | Ga0163163_10409709 | 3300014325 | Bacteria | 1414 |
| 211 | Ga0157376_10113676 | 3300014969 | Bacteria | 2387 |
| 212 | Ga0163161_10108692 | 3300017792 | Bacteria | 2071 |
| 213 | Ga0163161_10265622 | 3300017792 | Bacteria | 1341 |
| 214 | Ga0206356_10862082 | 3300020070 | Bacteria | 1760 |
| 215 | Ga0206356_11262758 | 3300020070 | Bacteria | 1697 |
| 216 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 217 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 218 | Ga0214542_1024229 | 3300021321 | Bacteria | 3439 |
| 219 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 220 | Ga0214545_1023657 | 3300021324 | Bacteria | 3986 |
| 221 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 222 | Ga0214543_1026030 | 3300021327 | Bacteria | 3240 |
| 223 | Ga0213876_10028489 | 3300021384 | Bacteria | 2945 |
| 224 | Ga0213876_10066492 | 3300021384 | Bacteria | 1903 |
| 225 | Ga0213876_10101694 | 3300021384 | Bacteria | 1524 |
| 226 | Ga0213871_10002263 | 3300021441 | Bacteria | 3509 |
| 227 | Ga0209677_101595 | 3300025253 | Bacteria | 9567 |
| 228 | Ga0209677_108387 | 3300025253 | Bacteria | 2012 |
| 229 | Ga0209148_1000424 | 3300025254 | Bacteria | 47087 |
| 230 | Ga0209233_1004610 | 3300025261 | Bacteria | 4661 |
| 231 | Ga0209233_1006596 | 3300025261 | Bacteria | 3730 |
| 232 | Ga0209455_1009596 | 3300025272 | Bacteria | 2528 |
| 233 | Ga0209455_1012617 | 3300025272 | Bacteria | 2010 |
| 234 | Ga0209673_1037039 | 3300025273 | Bacteria | 1438 |
| 235 | Ga0209564_1000485 | 3300025295 | Bacteria | 66032 |
| 236 | Ga0209564_1006799 | 3300025295 | Bacteria | 6048 |
| 237 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 238 | Ga0209758_1002420 | 3300025297 | Bacteria | 19114 |
| 239 | Ga0209758_1005684 | 3300025297 | Bacteria | 9427 |
| 240 | Ga0209758_1006453 | 3300025297 | Bacteria | 8414 |
| 241 | Ga0209758_1031926 | 3300025297 | Bacteria | 2149 |
| 242 | Ga0209758_1032768 | 3300025297 | Bacteria | 2102 |
| 243 | Ga0209758_1059854 | 3300025297 | Bacteria | 1264 |
| 244 | Ga0209256_1010818 | 3300025299 | Bacteria | 3754 |
| 245 | Ga0207426_1000425 | 3300025302 | Bacteria | 69088 |
| 246 | Ga0207426_1003443 | 3300025302 | Bacteria | 8598 |
| 247 | Ga0207426_1004449 | 3300025302 | Bacteria | 6833 |
| 248 | Ga0209257_1000426 | 3300025304 | Bacteria | 81095 |
| 249 | Ga0207656_10008209 | 3300025321 | Bacteria | 3831 |
| 250 | Ga0207656_10016277 | 3300025321 | Bacteria | 2893 |
| 251 | Ga0207692_10001055 | 3300025898 | Bacteria | 10067 |
| 252 | Ga0207692_10005603 | 3300025898 | Bacteria | 5039 |
| 253 | Ga0207692_10034148 | 3300025898 | Bacteria | 2461 |
| 254 | Ga0207692_10083406 | 3300025898 | Bacteria | 1715 |
| 255 | Ga0207642_10006639 | 3300025899 | Bacteria | 3859 |
| 256 | Ga0207680_10141396 | 3300025903 | Bacteria | 1596 |
| 257 | Ga0207685_10002878 | 3300025905 | Bacteria | 4057 |
| 258 | Ga0207699_10000390 | 3300025906 | Bacteria | 22928 |
| 259 | Ga0207699_10012034 | 3300025906 | Bacteria | 4390 |
| 260 | Ga0207699_10030568 | 3300025906 | Bacteria | 3015 |
| 261 | Ga0207699_10202813 | 3300025906 | Bacteria | 1345 |
| 262 | Ga0207645_10145994 | 3300025907 | Bacteria | 1542 |
| 263 | Ga0207684_10339723 | 3300025910 | Bacteria | 1293 |
| 264 | Ga0207654_10000323 | 3300025911 | Bacteria | 28628 |
| 265 | Ga0207654_10067997 | 3300025911 | Bacteria | 2107 |
| 266 | Ga0207707_10000178 | 3300025912 | Bacteria | 66057 |
| 267 | Ga0207707_10030844 | 3300025912 | Bacteria | 4690 |
| 268 | Ga0207707_10069420 | 3300025912 | Bacteria | 3071 |
| 269 | Ga0207707_10082388 | 3300025912 | Bacteria | 2809 |
| 270 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 271 | Ga0207695_10000497 | 3300025913 | Bacteria | 83894 |
| 272 | Ga0207695_10088253 | 3300025913 | Bacteria | 3122 |
| 273 | Ga0207671_10004982 | 3300025914 | Bacteria | 12436 |
| 274 | Ga0207671_10154721 | 3300025914 | Bacteria | 1773 |
| 275 | Ga0207671_10188296 | 3300025914 | Bacteria | 1608 |
| 276 | Ga0207693_10003503 | 3300025915 | Bacteria | 13399 |
| 277 | Ga0207693_10018008 | 3300025915 | Bacteria | 5629 |
| 278 | Ga0207693_10027789 | 3300025915 | Bacteria | 4471 |
| 279 | Ga0207693_10051082 | 3300025915 | Bacteria | 3246 |
| 280 | Ga0207693_10083737 | 3300025915 | Bacteria | 2499 |
| 281 | Ga0207693_10109173 | 3300025915 | Bacteria | 2170 |
| 282 | Ga0207663_10001979 | 3300025916 | Bacteria | 9717 |
| 283 | Ga0207663_10006434 | 3300025916 | Bacteria | 6008 |
| 284 | Ga0207663_10015611 | 3300025916 | Bacteria | 4194 |
| 285 | Ga0207663_10043697 | 3300025916 | Bacteria | 2746 |
| 286 | Ga0207660_10014180 | 3300025917 | Bacteria | 5233 |
| 287 | Ga0207660_10179692 | 3300025917 | Bacteria | 1643 |
| 288 | Ga0207657_10002910 | 3300025919 | Bacteria | 18383 |
| 289 | Ga0207657_10029030 | 3300025919 | Bacteria | 5040 |
| 290 | Ga0207657_10076639 | 3300025919 | Bacteria | 2820 |
| 291 | Ga0207657_10186508 | 3300025919 | Bacteria | 1675 |
| 292 | Ga0207652_10057241 | 3300025921 | Bacteria | 3357 |
| 293 | Ga0207652_10099805 | 3300025921 | Bacteria | 2562 |
| 294 | Ga0207646_10095799 | 3300025922 | Bacteria | 2659 |
| 295 | Ga0207681_10253291 | 3300025923 | Bacteria | 1375 |
| 296 | Ga0207694_10000212 | 3300025924 | Bacteria | 56506 |
| 297 | Ga0207694_10020078 | 3300025924 | Bacteria | 5053 |
| 298 | Ga0207694_10078059 | 3300025924 | Bacteria | 2595 |
| 299 | Ga0207694_10143146 | 3300025924 | Bacteria | 1923 |
| 300 | Ga0207659_10054790 | 3300025926 | Bacteria | 2849 |
| 301 | Ga0207700_10001341 | 3300025928 | Bacteria | 13962 |
| 302 | Ga0207700_10038868 | 3300025928 | Bacteria | 3458 |
| 303 | Ga0207700_10073685 | 3300025928 | Bacteria | 2638 |
| 304 | Ga0207700_10292772 | 3300025928 | Bacteria | 1404 |
| 305 | Ga0207664_10033246 | 3300025929 | Bacteria | 3961 |
| 306 | Ga0207664_10036057 | 3300025929 | Bacteria | 3821 |
| 307 | Ga0207664_10038518 | 3300025929 | Bacteria | 3708 |
| 308 | Ga0207664_10075472 | 3300025929 | Bacteria | 2726 |
| 309 | Ga0207664_10140288 | 3300025929 | Bacteria | 2044 |
| 310 | Ga0207644_10151431 | 3300025931 | Bacteria | 1795 |
| 311 | Ga0207644_10254249 | 3300025931 | Bacteria | 1403 |
| 312 | Ga0207706_10023317 | 3300025933 | Bacteria | 5559 |
| 313 | Ga0207706_10087663 | 3300025933 | Bacteria | 2737 |
| 314 | Ga0207706_10133439 | 3300025933 | Bacteria | 2184 |
| 315 | Ga0207709_10013744 | 3300025935 | Bacteria | 4467 |
| 316 | Ga0207669_10050072 | 3300025937 | Bacteria | 2494 |
| 317 | Ga0207704_10052956 | 3300025938 | Bacteria | 2463 |
| 318 | Ga0207704_10133699 | 3300025938 | Bacteria | 1723 |
| 319 | Ga0207665_10000361 | 3300025939 | Bacteria | 31561 |
| 320 | Ga0207665_10005543 | 3300025939 | Bacteria | 8419 |
| 321 | Ga0207665_10096560 | 3300025939 | Bacteria | 2056 |
| 322 | Ga0207665_10097429 | 3300025939 | Bacteria | 2047 |
| 323 | Ga0207691_10154226 | 3300025940 | Bacteria | 2018 |
| 324 | Ga0207711_10040725 | 3300025941 | Bacteria | 3953 |
| 325 | Ga0207689_10140785 | 3300025942 | Bacteria | 1987 |
| 326 | Ga0207661_10004270 | 3300025944 | Bacteria | 10004 |
| 327 | Ga0207661_10040922 | 3300025944 | Bacteria | 3646 |
| 328 | Ga0207667_10007538 | 3300025949 | Bacteria | 13058 |
| 329 | Ga0207667_10020042 | 3300025949 | Bacteria | 7447 |
| 330 | Ga0207667_10020500 | 3300025949 | Bacteria | 7349 |
| 331 | Ga0207667_10096966 | 3300025949 | Bacteria | 3043 |
| 332 | Ga0207667_10183322 | 3300025949 | Bacteria | 2149 |
| 333 | Ga0207667_10339810 | 3300025949 | Bacteria | 1532 |
| 334 | Ga0207712_10070275 | 3300025961 | Bacteria | 2515 |
| 335 | Ga0207712_10124876 | 3300025961 | Bacteria | 1953 |
| 336 | Ga0207668_10080761 | 3300025972 | Bacteria | 2356 |
| 337 | Ga0207668_10274169 | 3300025972 | Bacteria | 1380 |
| 338 | Ga0207640_10054473 | 3300025981 | Bacteria | 2615 |
| 339 | Ga0207677_10240867 | 3300026023 | Bacteria | 1463 |
| 340 | Ga0207703_10190870 | 3300026035 | Bacteria | 1814 |
| 341 | Ga0207703_10242709 | 3300026035 | Bacteria | 1620 |
| 342 | Ga0207639_10002809 | 3300026041 | Bacteria | 11682 |
| 343 | Ga0207639_10009638 | 3300026041 | Bacteria | 6672 |
| 344 | Ga0207639_10142632 | 3300026041 | Bacteria | 1997 |
| 345 | Ga0207639_10190810 | 3300026041 | Bacteria | 1750 |
| 346 | Ga0207639_10350805 | 3300026041 | Bacteria | 1318 |
| 347 | Ga0207678_10087674 | 3300026067 | Bacteria | 2660 |
| 348 | Ga0207678_10092146 | 3300026067 | Bacteria | 2590 |
| 349 | Ga0207678_10096270 | 3300026067 | Bacteria | 2529 |
| 350 | Ga0207678_10142099 | 3300026067 | Bacteria | 2049 |
| 351 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 352 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 353 | Ga0207702_10080857 | 3300026078 | Bacteria | 2820 |
| 354 | Ga0207702_10183373 | 3300026078 | Bacteria | 1929 |
| 355 | Ga0207702_10302247 | 3300026078 | Bacteria | 1519 |
| 356 | Ga0207641_10119826 | 3300026088 | Bacteria | 2346 |
| 357 | Ga0207648_10013629 | 3300026089 | Bacteria | 7547 |
| 358 | Ga0207676_10045662 | 3300026095 | Bacteria | 3386 |
| 359 | Ga0207676_10212523 | 3300026095 | Bacteria | 1717 |
| 360 | Ga0207676_10305386 | 3300026095 | Bacteria | 1454 |
| 361 | Ga0207674_10004756 | 3300026116 | Bacteria | 16280 |
| 362 | Ga0207674_10026464 | 3300026116 | Bacteria | 6159 |
| 363 | Ga0207674_10186131 | 3300026116 | Bacteria | 2027 |
| 364 | Ga0207674_10445603 | 3300026116 | Bacteria | 1251 |
| 365 | Ga0207675_100058237 | 3300026118 | Bacteria | 3606 |
| 366 | Ga0207683_10096466 | 3300026121 | Bacteria | 2636 |
| 367 | Ga0207698_10021924 | 3300026142 | Bacteria | 4427 |
| 368 | Ga0207698_10313711 | 3300026142 | Bacteria | 1465 |
| 369 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 370 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 371 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 372 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 373 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 374 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 375 | Ga0209489_100295 | 3300027361 | Bacteria | 87273 |
| 376 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 377 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 378 | Ga0268266_10006027 | 3300028379 | Bacteria | 11179 |
| 379 | Ga0268266_10031060 | 3300028379 | Bacteria | 4536 |
| 380 | Ga0268266_10118886 | 3300028379 | Bacteria | 2350 |
| 381 | Ga0268266_10142144 | 3300028379 | Bacteria | 2154 |
| 382 | Ga0268266_10170332 | 3300028379 | Bacteria | 1976 |
| 383 | Ga0268265_10010132 | 3300028380 | Bacteria | 6365 |
| 384 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 385 | Ga0265337_1016134 | 3300028556 | Bacteria | 2424 |
| 386 | Ga0265323_10007415 | 3300028653 | Bacteria | 4559 |
| 387 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 388 | Ga0307515_10279100 | 3300028794 | Bacteria | 1380 |
| 389 | Ga0265338_10000328 | 3300028800 | Bacteria | 86546 |
| 390 | Ga0265324_10018488 | 3300029957 | Bacteria | 2519 |
| 391 | Ga0307511_10123048 | 3300030521 | Bacteria | 1595 |
| 392 | Ga0265330_10032732 | 3300031235 | Bacteria | 2328 |
| 393 | Ga0265330_10043222 | 3300031235 | Bacteria | 1994 |
| 394 | Ga0265330_10054608 | 3300031235 | Bacteria | 1746 |
| 395 | Ga0265332_10011026 | 3300031238 | Bacteria | 4016 |
| 396 | Ga0265332_10033057 | 3300031238 | Bacteria | 2252 |
| 397 | Ga0265325_10005212 | 3300031241 | Bacteria | 8068 |
| 398 | Ga0265325_10011412 | 3300031241 | Bacteria | 5106 |
| 399 | Ga0265329_10060793 | 3300031242 | Bacteria | 1197 |
| 400 | Ga0265340_10002779 | 3300031247 | Bacteria | 9978 |
| 401 | Ga0265340_10068419 | 3300031247 | Bacteria | 1686 |
| 402 | Ga0265340_10074215 | 3300031247 | Bacteria | 1609 |
| 403 | Ga0265339_10017239 | 3300031249 | Bacteria | 4281 |
| 404 | Ga0265339_10063209 | 3300031249 | Bacteria | 1989 |
| 405 | Ga0265331_10014674 | 3300031250 | Bacteria | 4163 |
| 406 | Ga0265331_10018816 | 3300031250 | Bacteria | 3572 |
| 407 | Ga0265331_10059130 | 3300031250 | Bacteria | 1813 |
| 408 | Ga0265316_10136317 | 3300031344 | Bacteria | 1846 |
| 409 | Ga0307509_10014739 | 3300031507 | Bacteria | 9167 |
| 410 | Ga0307509_10127238 | 3300031507 | Bacteria | 2511 |
| 411 | Ga0307509_10183857 | 3300031507 | Bacteria | 1951 |
| 412 | Ga0265313_10031838 | 3300031595 | Bacteria | 2700 |
| 413 | Ga0265313_10111789 | 3300031595 | Bacteria | 1200 |
| 414 | Ga0307508_10000034 | 3300031616 | Bacteria | 160115 |
| 415 | Ga0265314_10069718 | 3300031711 | Bacteria | 2358 |
| 416 | Ga0265342_10006824 | 3300031712 | Bacteria | 8440 |
| 417 | Ga0265342_10009227 | 3300031712 | Bacteria | 6978 |
| 418 | Ga0307516_10012343 | 3300031730 | Bacteria | 9215 |
| 419 | Ga0307516_10019297 | 3300031730 | Bacteria | 7063 |
| 420 | Ga0307516_10035813 | 3300031730 | Bacteria | 4975 |
| 421 | Ga0307516_10054377 | 3300031730 | Bacteria | 3912 |
| 422 | Ga0307516_10118891 | 3300031730 | Bacteria | 2436 |
| 423 | Ga0307412_10163491 | 3300031911 | Bacteria | 1657 |
| 424 | Ga0307510_10004348 | 3300033180 | Bacteria | 16677 |
| 425 | Ga0307510_10036621 | 3300033180 | Bacteria | 5458 |
| 426 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 427 | Ga0373926_0069513 | 3300035083 | Bacteria | 1292 |
| 428 | Ga0373934_0018964 | 3300035086 | Bacteria | 2636 |
| 429 | Ga0373923_0002407 | 3300035111 | Bacteria | 5748 |
| 430 | Ga0373923_0069761 | 3300035111 | Bacteria | 1507 |
| 431 | Ga0373936_0006093 | 3300035113 | Bacteria | 4543 |
| 432 | Ga0373936_0069904 | 3300035113 | Bacteria | 1445 |
| 433 | Ga0373945_0008267 | 3300035116 | Bacteria | 3385 |
| 434 | Ga0373956_0054801 | 3300035119 | Bacteria | 1797 |
| 435 | Ga0373956_0097869 | 3300035119 | Bacteria | 1358 |
| 436 | Ga0373957_0001068 | 3300035120 | Bacteria | 7227 |
| 437 | Ga0373957_0022511 | 3300035120 | Bacteria | 2246 |
| 438 | Ga0373943_0006580 | 3300035170 | Bacteria | 5212 |
| 439 | Ga0373943_0007994 | 3300035170 | Bacteria | 4747 |
| 440 | Ga0373946_0007122 | 3300035171 | Bacteria | 4084 |
| 441 | Ga0373946_0029419 | 3300035171 | Bacteria | 2186 |
| 442 | Ga0373955_0000880 | 3300035172 | Bacteria | 12889 |
| 443 | Ga0373955_0032414 | 3300035172 | Bacteria | 2742 |
| 444 | Ga0373942_0030249 | 3300035207 | Bacteria | 1426 |
| 445 | Ga0373924_0002398 | 3300035410 | Bacteria | 6306 |
| 446 | Ga0373924_0006697 | 3300035410 | Bacteria | 4137 |
| 447 | Ga0373924_0017618 | 3300035410 | Bacteria | 2742 |
| 448 | Ga0373931_0094054 | 3300035691 | Bacteria | 1675 |
| 449 | Ga0373935_0000259 | 3300035692 | Bacteria | 26229 |
| 450 | Ga0373935_0074169 | 3300035692 | Bacteria | 2199 |
| 451 | Ga0373927_0002379 | 3300035695 | Bacteria | 13707 |
| 452 | Ga0373927_0004958 | 3300035695 | Bacteria | 9228 |
| 453 | Ga0373927_0118562 | 3300035695 | Bacteria | 1727 |
| 454 | Ga0373933_0001150 | 3300035724 | Bacteria | 15688 |
| 455 | Ga0373933_0002191 | 3300035724 | Bacteria | 11169 |
| 456 | Ga0373933_0028214 | 3300035724 | Bacteria | 3236 |
| 457 | Ga0373933_0146828 | 3300035724 | Bacteria | 1492 |
| 458 | Ga0373947_0000217 | 3300035725 | Bacteria | 32254 |
| 459 | Ga0373947_0010938 | 3300035725 | Bacteria | 5211 |
| 460 | Ga0373947_0012207 | 3300035725 | Bacteria | 4919 |
| 461 | Ga0373947_0013046 | 3300035725 | Bacteria | 4764 |
| 462 | Ga0373947_0097834 | 3300035725 | Bacteria | 1840 |
| 463 | Ga0373947_0183242 | 3300035725 | Bacteria | 1364 |
| 464 | Ga0373937_0006578 | 3300036401 | Bacteria | 10035 |
| 465 | Ga0373937_0012724 | 3300036401 | Bacteria | 7406 |
| 466 | Ga0373937_0022213 | 3300036401 | Bacteria | 5702 |
| 467 | Ga0373925_0004501 | 3300037068 | Bacteria | 10530 |
| 468 | Ga0373925_0026107 | 3300037068 | Bacteria | 4272 |
| 469 | Ga0373925_0041268 | 3300037068 | Bacteria | 3420 |
| 470 | Ga0373925_0057981 | 3300037068 | Bacteria | 2902 |
| 471 | Ga0373925_0072762 | 3300037068 | Bacteria | 2601 |
| 472 | Ga0373925_0095574 | 3300037068 | Bacteria | 2276 |
| 473 | Ga0395900_0001924 | 3300037418 | Bacteria | 23564 |
| 474 | Ga0395900_0323270 | 3300037418 | Bacteria | 1522 |
| 475 | Ga0395898_0013875 | 3300037466 | Bacteria | 8282 |
| 476 | Ga0395898_0020243 | 3300037466 | Bacteria | 6760 |
| 477 | Ga0395898_0059500 | 3300037466 | Bacteria | 3716 |
| 478 | Ga0395898_0212975 | 3300037466 | Bacteria | 1843 |
| 479 | Ga0395905_0091606 | 3300037471 | Bacteria | 2850 |
| 480 | Ga0395905_0092596 | 3300037471 | Bacteria | 2835 |
| 481 | Ga0436364_0578778 | 3300037853 | Bacteria | 5418 |
| 482 | Ga0395901_0015985 | 3300038443 | Bacteria | 7647 |
| 483 | Ga0395901_0268461 | 3300038443 | Bacteria | 1775 |
| 484 | Ga0395901_0411236 | 3300038443 | Bacteria | 1389 |
| 485 | Ga0436365_0425471 | 3300039437 | Bacteria | 2620 |
| 486 | Ga0436365_0698518 | 3300039437 | Bacteria | 1563 |
| 487 | Ga0436365_1129324 | 3300039437 | Bacteria | 1958 |
| 488 | Ga0436360_0973324 | 3300039438 | Bacteria | 3801 |
| 489 | Ga0436361_1121961 | 3300039447 | Bacteria | 4323 |
| 490 | Ga0436361_1213962 | 3300039447 | Bacteria | 1309 |
| 491 | Ga0436363_0248819 | 3300039450 | Bacteria | 3382 |
| 492 | Ga0436363_1154387 | 3300039450 | Bacteria | 1372 |
| 493 | Ga0436362_0646134 | 3300039453 | Bacteria | 7178 |
| 494 | Ga0436362_0766994 | 3300039453 | Bacteria | 1153 |
| 495 | Ga0439465_0023650 | 3300041413 | Bacteria | 1934 |
| 496 | Ga0466972_0000520 | 3300044658 | Bacteria | 19029 |
| 497 | Ga0466972_0004454 | 3300044658 | Bacteria | 7005 |
| 498 | Ga0466965_0085586 | 3300044683 | Bacteria | 1598 |
| 499 | Ga0466966_0035979 | 3300044684 | Bacteria | 3198 |
| 500 | Ga0466966_0047681 | 3300044684 | Bacteria | 2731 |
| 501 | Ga0466961_0000149 | 3300044693 | Bacteria | 47561 |
| 502 | Ga0466961_0070374 | 3300044693 | Bacteria | 2221 |
| 503 | Ga0466963_0073746 | 3300044694 | Bacteria | 2301 |
| 504 | Ga0466964_0088337 | 3300044706 | Bacteria | 1344 |
| 505 | Ga0466968_0029898 | 3300044735 | Bacteria | 2255 |
| 506 | Ga0466957_0017500 | 3300044842 | Bacteria | 4199 |
| 507 | Ga0466960_0080589 | 3300044901 | Bacteria | 1639 |
| 508 | Ga0466959_0004087 | 3300045049 | Bacteria | 9713 |
| 509 | Ga0466959_0115308 | 3300045049 | Bacteria | 1914 |
| 510 | Ga0466959_0156110 | 3300045049 | Bacteria | 1606 |
| 511 | Ga0466967_0034405 | 3300045976 | Bacteria | 4301 |
| 512 | Ga0466967_0040762 | 3300045976 | Bacteria | 3999 |
| 513 | Ga0466967_0073074 | 3300045976 | Bacteria | 3076 |
| 514 | Ga0495592_0008207 | 3300046454 | Bacteria | 7841 |
| 515 | Ga0495592_0020912 | 3300046454 | Bacteria | 4978 |
| 516 | Ga0495592_0029636 | 3300046454 | Bacteria | 4143 |
| 517 | Ga0495592_0037847 | 3300046454 | Bacteria | 3630 |
| 518 | Ga0495592_0114531 | 3300046454 | Bacteria | 1904 |
| 519 | Ga0495603_0000352 | 3300046455 | Bacteria | 24722 |
| 520 | Ga0495603_0014404 | 3300046455 | Bacteria | 4784 |
| 521 | Ga0495603_0036212 | 3300046455 | Bacteria | 2962 |
| 522 | Ga0495603_0079416 | 3300046455 | Bacteria | 1923 |
| 523 | Ga0495590_0039148 | 3300046457 | Bacteria | 1654 |
| 524 | Ga0495629_0003719 | 3300046459 | Bacteria | 11498 |
| 525 | Ga0495629_0051707 | 3300046459 | Bacteria | 2875 |
| 526 | Ga0495629_0108425 | 3300046459 | Bacteria | 1937 |
| 527 | Ga0495638_0009309 | 3300046460 | Bacteria | 6904 |
| 528 | Ga0495638_0014656 | 3300046460 | Bacteria | 5289 |
| 529 | Ga0495638_0089820 | 3300046460 | Bacteria | 1852 |
| 530 | Ga0495641_0006337 | 3300046461 | Bacteria | 7689 |
| 531 | Ga0495641_0044210 | 3300046461 | Bacteria | 2056 |
| 532 | Ga0495651_0003972 | 3300046462 | Bacteria | 11306 |
| 533 | Ga0495651_0008150 | 3300046462 | Bacteria | 8034 |
| 534 | Ga0495651_0009605 | 3300046462 | Bacteria | 7433 |
| 535 | Ga0495651_0028771 | 3300046462 | Bacteria | 4331 |
| 536 | Ga0495653_0012753 | 3300046463 | Bacteria | 6862 |
| 537 | Ga0495653_0025837 | 3300046463 | Bacteria | 4712 |
| 538 | Ga0495653_0039637 | 3300046463 | Bacteria | 3689 |
| 539 | Ga0495653_0083742 | 3300046463 | Bacteria | 2351 |
| 540 | Ga0495650_0024728 | 3300046471 | Bacteria | 2832 |
| 541 | Ga0495580_0018652 | 3300046472 | Bacteria | 5163 |
| 542 | Ga0495580_0059795 | 3300046472 | Bacteria | 2678 |
| 543 | Ga0495580_0116513 | 3300046472 | Bacteria | 1855 |
| 544 | Ga0495582_0000245 | 3300046473 | Bacteria | 30263 |
| 545 | Ga0495582_0035658 | 3300046473 | Bacteria | 2736 |
| 546 | Ga0495639_0020850 | 3300046475 | Bacteria | 2865 |
| 547 | Ga0495662_0000872 | 3300046476 | Bacteria | 14723 |
| 548 | Ga0495662_0075317 | 3300046476 | Bacteria | 1638 |
| 549 | Ga0495664_0004666 | 3300046477 | Bacteria | 7494 |
| 550 | Ga0495664_0020886 | 3300046477 | Bacteria | 3780 |
| 551 | Ga0495664_0027890 | 3300046477 | Bacteria | 3294 |
| 552 | Ga0495664_0036188 | 3300046477 | Bacteria | 2909 |
| 553 | Ga0495664_0070105 | 3300046477 | Bacteria | 2093 |
| 554 | Ga0495594_0001300 | 3300046499 | Bacteria | 13017 |
| 555 | Ga0495594_0038102 | 3300046499 | Bacteria | 2624 |
| 556 | Ga0495606_0015892 | 3300046507 | Bacteria | 5775 |
| 557 | Ga0495606_0022638 | 3300046507 | Bacteria | 4571 |
| 558 | Ga0495606_0160731 | 3300046507 | Bacteria | 1311 |
| 559 | Ga0495608_0041347 | 3300046511 | Bacteria | 3085 |
| 560 | Ga0495616_0032875 | 3300046513 | Bacteria | 2707 |
| 561 | Ga0495618_0009256 | 3300046514 | Bacteria | 5944 |
| 562 | Ga0495618_0017563 | 3300046514 | Bacteria | 4389 |
| 563 | Ga0495618_0039877 | 3300046514 | Bacteria | 2953 |
| 564 | Ga0495620_0046480 | 3300046515 | Bacteria | 1874 |
| 565 | Ga0495628_0005097 | 3300046516 | Bacteria | 11546 |
| 566 | Ga0495628_0040062 | 3300046516 | Bacteria | 3745 |
| 567 | Ga0495630_0009422 | 3300046517 | Bacteria | 7019 |
| 568 | Ga0495630_0051936 | 3300046517 | Bacteria | 3069 |
| 569 | Ga0495630_0236611 | 3300046517 | Bacteria | 1395 |
| 570 | Ga0495632_0074302 | 3300046519 | Bacteria | 1628 |
| 571 | Ga0495643_0060904 | 3300046522 | Bacteria | 2002 |
| 572 | Ga0495644_0006757 | 3300046523 | Bacteria | 4442 |
| 573 | Ga0495648_0001680 | 3300046524 | Bacteria | 21407 |
| 574 | Ga0495648_0019543 | 3300046524 | Bacteria | 4760 |
| 575 | Ga0495648_0058195 | 3300046524 | Bacteria | 2312 |
| 576 | Ga0495666_0003461 | 3300046526 | Bacteria | 7971 |
| 577 | Ga0495652_0061223 | 3300046529 | Bacteria | 3178 |
| 578 | Ga0495652_0087350 | 3300046529 | Bacteria | 2558 |
| 579 | Ga0495652_0112503 | 3300046529 | Bacteria | 2187 |
| 580 | Ga0495652_0156871 | 3300046529 | Bacteria | 1771 |
| 581 | Ga0495652_0279926 | 3300046529 | Bacteria | 1222 |
| 582 | Ga0495665_0000361 | 3300046531 | Bacteria | 22971 |
| 583 | Ga0495665_0168695 | 3300046531 | Bacteria | 1140 |
| 584 | Ga0495640_0003002 | 3300046533 | Bacteria | 13580 |
| 585 | Ga0495640_0017400 | 3300046533 | Bacteria | 5359 |
| 586 | Ga0495640_0022271 | 3300046533 | Bacteria | 4634 |
| 587 | Ga0495640_0034231 | 3300046533 | Bacteria | 3604 |
| 588 | Ga0495587_0017008 | 3300046536 | Bacteria | 4521 |
| 589 | Ga0495621_0048207 | 3300046539 | Bacteria | 1516 |
| 590 | Ga0495645_0001286 | 3300046543 | Bacteria | 17104 |
| 591 | Ga0495645_0020761 | 3300046543 | Bacteria | 4744 |
| 592 | Ga0495645_0023607 | 3300046543 | Bacteria | 4455 |
| 593 | Ga0495645_0083631 | 3300046543 | Bacteria | 2287 |
| 594 | Ga0495645_0203809 | 3300046543 | Bacteria | 1340 |
| 595 | Ga0495622_0006317 | 3300046557 | Bacteria | 5501 |
| 596 | Ga0495622_0079611 | 3300046557 | Bacteria | 1508 |
| 597 | Ga0495633_0063543 | 3300046558 | Bacteria | 1727 |
| 598 | Ga0495667_0012248 | 3300046559 | Bacteria | 5812 |
| 599 | Ga0495667_0033462 | 3300046559 | Bacteria | 3440 |
| 600 | Ga0495667_0126311 | 3300046559 | Bacteria | 1650 |
| 601 | Ga0495656_0004410 | 3300046615 | Bacteria | 4818 |
| 602 | Ga0495668_0091477 | 3300046616 | Bacteria | 1667 |
| 603 | Ga0495634_0000249 | 3300046642 | Bacteria | 50835 |
| 604 | Ga0495634_0012218 | 3300046642 | Bacteria | 6225 |
| 605 | Ga0495634_0022747 | 3300046642 | Bacteria | 4415 |
| 606 | Ga0495634_0068360 | 3300046642 | Bacteria | 2347 |
| 607 | Ga0495634_0109805 | 3300046642 | Bacteria | 1774 |
| 608 | Ga0495625_0036379 | 3300046660 | Bacteria | 3619 |
| 609 | Ga0495635_0000239 | 3300046663 | Bacteria | 34889 |
| 610 | Ga0495635_0003846 | 3300046663 | Bacteria | 10429 |
| 611 | Ga0495635_0014377 | 3300046663 | Bacteria | 5536 |
| 612 | Ga0495635_0081350 | 3300046663 | Bacteria | 2216 |
| 613 | Ga0495635_0095584 | 3300046663 | Bacteria | 2031 |
| 614 | Ga0495661_0012048 | 3300046665 | Bacteria | 5851 |
| 615 | Ga0495588_0069307 | 3300046674 | Bacteria | 1833 |
| 616 | Ga0495657_0003492 | 3300046675 | Bacteria | 12822 |
| 617 | Ga0495657_0006927 | 3300046675 | Bacteria | 8808 |
| 618 | Ga0495657_0026654 | 3300046675 | Bacteria | 4090 |
| 619 | Ga0495599_0001556 | 3300046678 | Bacteria | 13209 |
| 620 | Ga0495599_0008411 | 3300046678 | Bacteria | 6272 |
| 621 | Ga0495599_0016849 | 3300046678 | Bacteria | 4539 |
| 622 | Ga0495623_0002296 | 3300046679 | Bacteria | 12741 |
| 623 | Ga0495623_0009107 | 3300046679 | Bacteria | 6440 |
| 624 | Ga0495623_0010478 | 3300046679 | Bacteria | 6000 |
| 625 | Ga0495646_0001918 | 3300046680 | Bacteria | 12509 |
| 626 | Ga0495646_0005453 | 3300046680 | Bacteria | 8043 |
| 627 | Ga0495646_0011250 | 3300046680 | Bacteria | 5683 |
| 628 | Ga0495646_0102031 | 3300046680 | Bacteria | 1644 |
| 629 | Ga0495647_0003088 | 3300046681 | Bacteria | 5318 |
| 630 | Ga0495647_0022746 | 3300046681 | Bacteria | 2267 |
| 631 | Ga0495647_0030086 | 3300046681 | Bacteria | 2013 |
| 632 | Ga0495658_0001058 | 3300046683 | Bacteria | 14532 |
| 633 | Ga0495658_0019298 | 3300046683 | Bacteria | 3556 |
| 634 | Ga0495658_0102410 | 3300046683 | Bacteria | 1711 |
| 635 | Ga0495669_0052607 | 3300046684 | Bacteria | 1830 |
| 636 | Ga0495613_0000929 | 3300046689 | Bacteria | 22466 |
| 637 | Ga0495613_0067749 | 3300046689 | Bacteria | 2605 |
| 638 | Ga0495613_0255689 | 3300046689 | Bacteria | 1221 |
| 639 | Ga0495624_0000538 | 3300046690 | Bacteria | 29656 |
| 640 | Ga0495624_0184045 | 3300046690 | Bacteria | 1272 |
| 641 | Ga0495670_0017939 | 3300046691 | Bacteria | 3486 |
| 642 | Ga0495671_0055254 | 3300046692 | Bacteria | 1967 |
| 643 | Ga0495671_0102419 | 3300046692 | Bacteria | 1399 |
| 644 | Ga0495649_0085341 | 3300046694 | Bacteria | 1685 |
| 645 | Ga0495589_0069305 | 3300046794 | Bacteria | 1725 |
| 646 | Ga0495600_0002229 | 3300046809 | Bacteria | 11033 |
| 647 | Ga0495600_0029557 | 3300046809 | Bacteria | 3548 |
| 648 | Ga0495581_0001238 | 3300047315 | Bacteria | 14050 |
| 649 | Ga0495581_0057166 | 3300047315 | Bacteria | 2252 |
| 650 | Ga0495604_0005469 | 3300047317 | Bacteria | 10075 |
| 651 | Ga0495604_0074523 | 3300047317 | Bacteria | 2557 |
| 652 | Ga0495604_0134829 | 3300047317 | Bacteria | 1770 |
| 653 | Ga0495604_0204143 | 3300047317 | Bacteria | 1369 |
| 654 | Ga0495674_0001854 | 3300047319 | Bacteria | 20818 |
| 655 | Ga0495674_0020768 | 3300047319 | Bacteria | 6080 |
| 656 | Ga0495674_0021792 | 3300047319 | Bacteria | 5921 |
| 657 | Ga0495674_0113269 | 3300047319 | Bacteria | 2297 |
| 658 | Ga0495672_0036441 | 3300047320 | Bacteria | 3020 |
| 659 | Ga0495672_0062942 | 3300047320 | Bacteria | 2131 |
| 660 | Ga0495676_0027183 | 3300047321 | Bacteria | 4911 |
| 661 | Ga0495680_0021114 | 3300047322 | Bacteria | 5456 |
| 662 | Ga0495680_0024023 | 3300047322 | Bacteria | 5062 |
| 663 | Ga0495680_0131314 | 3300047322 | Bacteria | 1840 |
| 664 | Ga0495687_043987 | 3300047443 | Bacteria | 1943 |
| 665 | Ga0495675_0062117 | 3300047444 | Bacteria | 2365 |
| 666 | Ga0495677_0080575 | 3300047445 | Bacteria | 1220 |
| 667 | Ga0495673_0010245 | 3300047469 | Bacteria | 5114 |
| 668 | Ga0495681_0039134 | 3300047470 | Bacteria | 2318 |
| 669 | Ga0495684_0000893 | 3300047471 | Bacteria | 24119 |
| 670 | Ga0495684_0003057 | 3300047471 | Bacteria | 13153 |
| 671 | Ga0495593_0000034 | 3300047673 | Bacteria | 57993 |
| 672 | Ga0495593_0005088 | 3300047673 | Bacteria | 7774 |
| 673 | Ga0495593_0030123 | 3300047673 | Bacteria | 2971 |
| 674 | Ga0495602_0025294 | 3300048088 | Bacteria | 5747 |
| 675 | Ga0495602_0045096 | 3300048088 | Bacteria | 3992 |
| 676 | Ga0495614_0012106 | 3300048089 | Bacteria | 3788 |
| 677 | Ga0495615_0022350 | 3300048090 | Bacteria | 1438 |
| 678 | Ga0496100_0024419 | 3300048903 | Bacteria | 3687 |
| 679 | Ga0496100_0035051 | 3300048903 | Bacteria | 3154 |
| 680 | Ga0496100_0221778 | 3300048903 | Bacteria | 1388 |
| 681 | Ga0496101_0005889 | 3300048904 | Bacteria | 7849 |
| 682 | Ga0496101_0022103 | 3300048904 | Bacteria | 4376 |
| 683 | Ga0496101_0075060 | 3300048904 | Bacteria | 2488 |
| 684 | Ga0496101_0086002 | 3300048904 | Bacteria | 2331 |
| 685 | Ga0496102_0041716 | 3300048905 | Bacteria | 4157 |
| 686 | Ga0496102_0085515 | 3300048905 | Bacteria | 2912 |
| 687 | Ga0496102_0129517 | 3300048905 | Bacteria | 2360 |
| 688 | Ga0496102_0169801 | 3300048905 | Bacteria | 2053 |
| 689 | Ga0496103_0148981 | 3300048906 | Bacteria | 1498 |
| 690 | Ga0496104_0044141 | 3300048907 | Bacteria | 4188 |
| 691 | Ga0496104_0078027 | 3300048907 | Bacteria | 3156 |
| 692 | Ga0496104_0085182 | 3300048907 | Bacteria | 3016 |
| 693 | Ga0496104_0176933 | 3300048907 | Bacteria | 2044 |
| 694 | Ga0496104_0198086 | 3300048907 | Bacteria | 1920 |
| 695 | Ga0496105_0017518 | 3300048908 | Bacteria | 5746 |
| 696 | Ga0496105_0082763 | 3300048908 | Bacteria | 2651 |
| 697 | Ga0496105_0085675 | 3300048908 | Bacteria | 2603 |
| 698 | Ga0496106_0000649 | 3300048909 | Bacteria | 24884 |
| 699 | Ga0496106_0001165 | 3300048909 | Bacteria | 19535 |
| 700 | Ga0496106_0082778 | 3300048909 | Bacteria | 2467 |
| 701 | Ga0496106_0281869 | 3300048909 | Bacteria | 1331 |
| 702 | Ga0496106_0377205 | 3300048909 | Bacteria | 1140 |
| 703 | Ga0496107_0025520 | 3300048910 | Bacteria | 4185 |
| 704 | Ga0496107_0028181 | 3300048910 | Bacteria | 3990 |
| 705 | Ga0496107_0043555 | 3300048910 | Bacteria | 3225 |
| 706 | Ga0496107_0048989 | 3300048910 | Bacteria | 3044 |
| 707 | Ga0496107_0202412 | 3300048910 | Bacteria | 1476 |
| 708 | Ga0496108_0000744 | 3300048911 | Bacteria | 25343 |
| 709 | Ga0496108_0247857 | 3300048911 | Bacteria | 1549 |
| 710 | Ga0496109_0001766 | 3300048912 | Bacteria | 17962 |
| 711 | Ga0496109_0048359 | 3300048912 | Bacteria | 3870 |
| 712 | Ga0496109_0303289 | 3300048912 | Bacteria | 1506 |
| 713 | Ga0496109_0309442 | 3300048912 | Bacteria | 1490 |
| 714 | Ga0496109_0356227 | 3300048912 | Bacteria | 1382 |
| 715 | Ga0496110_0006833 | 3300048913 | Bacteria | 9070 |
| 716 | Ga0496110_0018692 | 3300048913 | Bacteria | 5814 |
| 717 | Ga0496110_0056020 | 3300048913 | Bacteria | 3469 |
| 718 | Ga0496110_0085668 | 3300048913 | Bacteria | 2812 |
| 719 | Ga0496110_0112391 | 3300048913 | Bacteria | 2449 |
| 720 | Ga0496110_0114120 | 3300048913 | Bacteria | 2431 |
| 721 | Ga0496110_0161215 | 3300048913 | Bacteria | 2033 |
| 722 | Ga0496111_0031499 | 3300048914 | Bacteria | 3778 |
| 723 | Ga0496111_0121446 | 3300048914 | Bacteria | 1929 |
| 724 | Ga0496111_0184210 | 3300048914 | Bacteria | 1552 |
| 725 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 726 | Ga0496112_0050851 | 3300048915 | Bacteria | 4064 |
| 727 | Ga0496112_0157994 | 3300048915 | Bacteria | 2234 |
| 728 | Ga0496112_0181663 | 3300048915 | Bacteria | 2067 |
| 729 | Ga0496112_0226149 | 3300048915 | Bacteria | 1826 |
| 730 | Ga0496114_0089217 | 3300048917 | Bacteria | 2616 |
| 731 | Ga0496114_0098129 | 3300048917 | Bacteria | 2497 |
| 732 | Ga0496114_0174356 | 3300048917 | Bacteria | 1876 |
| 733 | Ga0496114_0259154 | 3300048917 | Bacteria | 1531 |
| 734 | Ga0496115_0007272 | 3300048918 | Bacteria | 8144 |
| 735 | Ga0496115_0015832 | 3300048918 | Bacteria | 5728 |
| 736 | Ga0496115_0073171 | 3300048918 | Bacteria | 2781 |
| 737 | Ga0496115_0096862 | 3300048918 | Bacteria | 2416 |
| 738 | Ga0496115_0117402 | 3300048918 | Bacteria | 2188 |
| 739 | Ga0496115_0140716 | 3300048918 | Bacteria | 1991 |
| 740 | Ga0496116_0007242 | 3300048919 | Bacteria | 9890 |
| 741 | Ga0496117_0021643 | 3300048920 | Bacteria | 5193 |
| 742 | Ga0496117_0153317 | 3300048920 | Bacteria | 1360 |
| 743 | Ga0496118_0013219 | 3300048921 | Bacteria | 7828 |
| 744 | Ga0496118_0051899 | 3300048921 | Bacteria | 3133 |
| 745 | Ga0496118_0071624 | 3300048921 | Bacteria | 2494 |
| 746 | Ga0496119_0053236 | 3300048922 | Bacteria | 2474 |
| 747 | Ga0496119_0068363 | 3300048922 | Bacteria | 2092 |
| 748 | Ga0496119_0068812 | 3300048922 | Bacteria | 2083 |
| 749 | Ga0496119_0076546 | 3300048922 | Bacteria | 1941 |
| 750 | Ga0496120_0103874 | 3300048923 | Bacteria | 1496 |
| 751 | Ga0496121_0000476 | 3300048924 | Bacteria | 78015 |
| 752 | Ga0496121_0001497 | 3300048924 | Bacteria | 39336 |
| 753 | Ga0496121_0001742 | 3300048924 | Bacteria | 35564 |
| 754 | Ga0496121_0003089 | 3300048924 | Bacteria | 24095 |
| 755 | Ga0496121_0015642 | 3300048924 | Bacteria | 7916 |
| 756 | Ga0496121_0017380 | 3300048924 | Bacteria | 7352 |
| 757 | Ga0496121_0025084 | 3300048924 | Bacteria | 5674 |
| 758 | Ga0496121_0036908 | 3300048924 | Bacteria | 4348 |
| 759 | Ga0496121_0038697 | 3300048924 | Bacteria | 4216 |
| 760 | Ga0496121_0049287 | 3300048924 | Bacteria | 3572 |
| 761 | Ga0496121_0053890 | 3300048924 | Bacteria | 3366 |
| 762 | Ga0496121_0082348 | 3300048924 | Bacteria | 2544 |
| 763 | Ga0496121_0083650 | 3300048924 | Bacteria | 2519 |
| 764 | Ga0496121_0099916 | 3300048924 | Bacteria | 2241 |
| 765 | Ga0496122_0055284 | 3300048925 | Bacteria | 2971 |
| 766 | Ga0496122_0060464 | 3300048925 | Bacteria | 2790 |
| 767 | Ga0496122_0089939 | 3300048925 | Bacteria | 2097 |
| 768 | Ga0496123_0090680 | 3300048926 | Bacteria | 1816 |
| 769 | Ga0496123_0096202 | 3300048926 | Bacteria | 1739 |
| 770 | Ga0496124_0001128 | 3300048927 | Bacteria | 42017 |
| 771 | Ga0496124_0090921 | 3300048927 | Bacteria | 2488 |
| 772 | Ga0496124_0153432 | 3300048927 | Bacteria | 1804 |
| 773 | Ga0496124_0165776 | 3300048927 | Bacteria | 1717 |
| 774 | Ga0496124_0173653 | 3300048927 | Bacteria | 1666 |
| 775 | Ga0496125_0000154 | 3300048928 | Bacteria | 152240 |
| 776 | Ga0496125_0015007 | 3300048928 | Bacteria | 7523 |
| 777 | Ga0496125_0044841 | 3300048928 | Bacteria | 3731 |
| 778 | Ga0496125_0153920 | 3300048928 | Bacteria | 1574 |
| 779 | Ga0496126_0002744 | 3300048929 | Bacteria | 23267 |
| 780 | Ga0496126_0006113 | 3300048929 | Bacteria | 13500 |
| 781 | Ga0496126_0009402 | 3300048929 | Bacteria | 10385 |
| 782 | Ga0496126_0015910 | 3300048929 | Bacteria | 7552 |
| 783 | Ga0496126_0020832 | 3300048929 | Bacteria | 6418 |
| 784 | Ga0496126_0032430 | 3300048929 | Bacteria | 4920 |
| 785 | Ga0496126_0053931 | 3300048929 | Bacteria | 3645 |
| 786 | Ga0496126_0079933 | 3300048929 | Bacteria | 2893 |
| 787 | Ga0496126_0089718 | 3300048929 | Bacteria | 2705 |
| 788 | Ga0496126_0094162 | 3300048929 | Bacteria | 2629 |
| 789 | Ga0496126_0188462 | 3300048929 | Bacteria | 1748 |
| 790 | Ga0496126_0191581 | 3300048929 | Bacteria | 1731 |
| 791 | Ga0496126_0202508 | 3300048929 | Bacteria | 1675 |
| 792 | Ga0496126_0319939 | 3300048929 | Bacteria | 1275 |
| 793 | Ga0501031_0012949 | 3300049568 | Bacteria | 5445 |
| 794 | Ga0501031_0064009 | 3300049568 | Bacteria | 2395 |
| 795 | Ga0501032_0003534 | 3300049569 | Bacteria | 11926 |
| 796 | Ga0501032_0012670 | 3300049569 | Bacteria | 6012 |
| 797 | Ga0501032_0020626 | 3300049569 | Bacteria | 4587 |
| 798 | Ga0501032_0082398 | 3300049569 | Bacteria | 2140 |
| 799 | Ga0501032_0119010 | 3300049569 | Bacteria | 1746 |
| 800 | Ga0501032_0208172 | 3300049569 | Bacteria | 1275 |
| 801 | Ga0501033_0000249 | 3300049570 | Bacteria | 52045 |
| 802 | Ga0501033_0000951 | 3300049570 | Bacteria | 26299 |
| 803 | Ga0501033_0229418 | 3300049570 | Bacteria | 1319 |
| 804 | Ga0501034_0000197 | 3300049571 | Bacteria | 114088 |
| 805 | Ga0501034_0001938 | 3300049571 | Bacteria | 26206 |
| 806 | Ga0501034_0136806 | 3300049571 | Bacteria | 2431 |
| 807 | Ga0501034_0183501 | 3300049571 | Bacteria | 2056 |
| 808 | Ga0501034_0286773 | 3300049571 | Bacteria | 1585 |
| 809 | Ga0501034_0290404 | 3300049571 | Bacteria | 1573 |
| 810 | Ga0501034_0348538 | 3300049571 | Bacteria | 1409 |
| 811 | Ga0501036_0004433 | 3300049572 | Bacteria | 11343 |
| 812 | Ga0501036_0026547 | 3300049572 | Bacteria | 4889 |
| 813 | Ga0501036_0050620 | 3300049572 | Bacteria | 3517 |
| 814 | Ga0501036_0095024 | 3300049572 | Bacteria | 2519 |
| 815 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 816 | Ga0501037_0067387 | 3300049573 | Bacteria | 2607 |
| 817 | Ga0501037_0101975 | 3300049573 | Bacteria | 2070 |
| 818 | Ga0501037_0130451 | 3300049573 | Bacteria | 1802 |
| 819 | Ga0501038_0000160 | 3300049574 | Bacteria | 57443 |
| 820 | Ga0501038_0002206 | 3300049574 | Bacteria | 18110 |
| 821 | Ga0501038_0036532 | 3300049574 | Bacteria | 4311 |
| 822 | Ga0501038_0038091 | 3300049574 | Bacteria | 4211 |
| 823 | Ga0501038_0082118 | 3300049574 | Bacteria | 2714 |
| 824 | Ga0501038_0145474 | 3300049574 | Bacteria | 1935 |
| 825 | Ga0501038_0168699 | 3300049574 | Bacteria | 1773 |
| 826 | Ga0501038_0233536 | 3300049574 | Bacteria | 1462 |
| 827 | Ga0501038_0341018 | 3300049574 | Bacteria | 1168 |
| 828 | Ga0501039_0000472 | 3300049575 | Bacteria | 29218 |
| 829 | Ga0501039_0001057 | 3300049575 | Bacteria | 20191 |
| 830 | Ga0501039_0017068 | 3300049575 | Bacteria | 5566 |
| 831 | Ga0501039_0142515 | 3300049575 | Bacteria | 1882 |
| 832 | Ga0501042_0015592 | 3300049578 | Bacteria | 5205 |
| 833 | Ga0501042_0071253 | 3300049578 | Bacteria | 2486 |
| 834 | Ga0501043_0000278 | 3300049579 | Bacteria | 46214 |
| 835 | Ga0501043_0008635 | 3300049579 | Bacteria | 8029 |
| 836 | Ga0501043_0022578 | 3300049579 | Bacteria | 4933 |
| 837 | Ga0501043_0073668 | 3300049579 | Bacteria | 2682 |
| 838 | Ga0501043_0096156 | 3300049579 | Bacteria | 2328 |
| 839 | Ga0501043_0150931 | 3300049579 | Bacteria | 1818 |
| 840 | Ga0501043_0215853 | 3300049579 | Bacteria | 1485 |
| 841 | Ga0501046_0000937 | 3300049580 | Bacteria | 28581 |
| 842 | Ga0501046_0008812 | 3300049580 | Bacteria | 8763 |
| 843 | Ga0501046_0012556 | 3300049580 | Bacteria | 7204 |
| 844 | Ga0501046_0021462 | 3300049580 | Bacteria | 5328 |
| 845 | Ga0501046_0065853 | 3300049580 | Bacteria | 2825 |
| 846 | Ga0501047_0000275 | 3300049581 | Bacteria | 59536 |
| 847 | Ga0501047_0009938 | 3300049581 | Bacteria | 8998 |
| 848 | Ga0501047_0073429 | 3300049581 | Bacteria | 3293 |
| 849 | Ga0501047_0089000 | 3300049581 | Bacteria | 2964 |
| 850 | Ga0501047_0122575 | 3300049581 | Bacteria | 2480 |
| 851 | Ga0501047_0217062 | 3300049581 | Bacteria | 1769 |
| 852 | Ga0501047_0336852 | 3300049581 | Bacteria | 1347 |
| 853 | Ga0501048_0001248 | 3300049582 | Bacteria | 19253 |
| 854 | Ga0501048_0011414 | 3300049582 | Bacteria | 6626 |
| 855 | Ga0501048_0022723 | 3300049582 | Bacteria | 4584 |
| 856 | Ga0501048_0036570 | 3300049582 | Bacteria | 3529 |
| 857 | Ga0501067_0000258 | 3300049583 | Bacteria | 28937 |
| 858 | Ga0501067_0013462 | 3300049583 | Bacteria | 4533 |
| 859 | Ga0501067_0084036 | 3300049583 | Bacteria | 1766 |
| 860 | Ga0501067_0092887 | 3300049583 | Bacteria | 1675 |
| 861 | Ga0501068_0004146 | 3300049584 | Bacteria | 7852 |
| 862 | Ga0501068_0015819 | 3300049584 | Bacteria | 4341 |
| 863 | Ga0501068_0026245 | 3300049584 | Bacteria | 3431 |
| 864 | Ga0501068_0064658 | 3300049584 | Bacteria | 2226 |
| 865 | Ga0501068_0140272 | 3300049584 | Bacteria | 1515 |
| 866 | Ga0501069_0013808 | 3300049585 | Bacteria | 4310 |
| 867 | Ga0501069_0043425 | 3300049585 | Bacteria | 2488 |
| 868 | Ga0501069_0115876 | 3300049585 | Bacteria | 1528 |
| 869 | Ga0501070_0002548 | 3300049586 | Bacteria | 15964 |
| 870 | Ga0501070_0006200 | 3300049586 | Bacteria | 10187 |
| 871 | Ga0501070_0020554 | 3300049586 | Bacteria | 5537 |
| 872 | Ga0501070_0063929 | 3300049586 | Bacteria | 3048 |
| 873 | Ga0501070_0068502 | 3300049586 | Bacteria | 2937 |
| 874 | Ga0501070_0085330 | 3300049586 | Bacteria | 2614 |
| 875 | Ga0501070_0090347 | 3300049586 | Bacteria | 2535 |
| 876 | Ga0501070_0314854 | 3300049586 | Bacteria | 1273 |
| 877 | Ga0501071_0196477 | 3300049587 | Bacteria | 1514 |
| 878 | Ga0501072_0003198 | 3300049588 | Bacteria | 12304 |
| 879 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 880 | Ga0501073_0038356 | 3300049589 | Bacteria | 3398 |
| 881 | Ga0501073_0096064 | 3300049589 | Bacteria | 2058 |
| 882 | Ga0501074_0000456 | 3300049590 | Bacteria | 24566 |
| 883 | Ga0501074_0067246 | 3300049590 | Bacteria | 2577 |
| 884 | Ga0501074_0085067 | 3300049590 | Bacteria | 2266 |
| 885 | Ga0501076_0063997 | 3300049592 | Bacteria | 2931 |
| 886 | Ga0501077_0104803 | 3300049593 | Bacteria | 1792 |
| 887 | Ga0501079_0000451 | 3300049741 | Bacteria | 26871 |
| 888 | Ga0501079_0010445 | 3300049741 | Bacteria | 7058 |
| 889 | Ga0501080_0000082 | 3300049742 | Bacteria | 63972 |
| 890 | Ga0501080_0002998 | 3300049742 | Bacteria | 14886 |
| 891 | Ga0501080_0016338 | 3300049742 | Bacteria | 6854 |
| 892 | Ga0501080_0071776 | 3300049742 | Bacteria | 3220 |
| 893 | Ga0501080_0082435 | 3300049742 | Bacteria | 2987 |
| 894 | Ga0501080_0349960 | 3300049742 | Bacteria | 1334 |
| 895 | Ga0501080_0389057 | 3300049742 | Bacteria | 1255 |
| 896 | Ga0501083_0009193 | 3300049744 | Bacteria | 6980 |
| 897 | Ga0501083_0058731 | 3300049744 | Bacteria | 2573 |
| 898 | Ga0501035_0000766 | 3300049822 | Bacteria | 34513 |
| 899 | Ga0501035_0011386 | 3300049822 | Bacteria | 8244 |
| 900 | Ga0501035_0018251 | 3300049822 | Bacteria | 6463 |
| 901 | Ga0501035_0045134 | 3300049822 | Bacteria | 3965 |
| 902 | Ga0501035_0078488 | 3300049822 | Bacteria | 2916 |
| 903 | Ga0501035_0123726 | 3300049822 | Bacteria | 2259 |
| 904 | Ga0501035_0124942 | 3300049822 | Bacteria | 2246 |
| 905 | Ga0501035_0144301 | 3300049822 | Bacteria | 2068 |
| 906 | Ga0501035_0159477 | 3300049822 | Bacteria | 1953 |
| 907 | Ga0501044_0000418 | 3300049823 | Bacteria | 52554 |
| 908 | Ga0501044_0024381 | 3300049823 | Bacteria | 6423 |
| 909 | Ga0501044_0034063 | 3300049823 | Bacteria | 5345 |
| 910 | Ga0501044_0078546 | 3300049823 | Bacteria | 3344 |
| 911 | Ga0501044_0196236 | 3300049823 | Bacteria | 1978 |
| 912 | Ga0501044_0218611 | 3300049823 | Bacteria | 1856 |
| 913 | Ga0501044_0231316 | 3300049823 | Bacteria | 1796 |
| 914 | Ga0501044_0238631 | 3300049823 | Bacteria | 1762 |
| 915 | Ga0501044_0272344 | 3300049823 | Bacteria | 1628 |
| 916 | Ga0501044_0325483 | 3300049823 | Bacteria | 1461 |
| 917 | Ga0501044_0332956 | 3300049823 | Bacteria | 1440 |
| 918 | Ga0501045_0038807 | 3300049824 | Bacteria | 3464 |
| 919 | Ga0501045_0077486 | 3300049824 | Bacteria | 2450 |
| 920 | nmdc:mga0yw44_1397_c1 | 3300050492 | Bacteria | 9573 |
| 921 | nmdc:mga0yw44_17247_c1 | 3300050492 | Bacteria | 3925 |
| 922 | nmdc:mga0yw44_94319_c1 | 3300050492 | Bacteria | 1897 |
| 923 | nmdc:mga0k408_127339_c1 | 3300050493 | Bacteria | 1511 |
| 924 | nmdc:mga06z11_31082_c1 | 3300050494 | Bacteria | 2591 |
| 925 | nmdc:mga07m45_95447_c1 | 3300050496 | Bacteria | 1706 |
| 926 | nmdc:mga08y16_196743_c1 | 3300050511 | Bacteria | 2089 |
| 927 | nmdc:mga0n895_80110_c1 | 3300050512 | Bacteria | 3253 |
| 928 | nmdc:mga0n895_82170_c1 | 3300050512 | Bacteria | 3211 |
| 929 | nmdc:mga0rr50_152607_c1 | 3300050513 | Bacteria | 1868 |
| 930 | nmdc:mga08x19_192730_c1 | 3300050514 | Bacteria | 1395 |
| 931 | nmdc:mga08x19_24160_c1 | 3300050514 | Bacteria | 3773 |
| 932 | nmdc:mga0a205_311035_c1 | 3300050515 | Bacteria | 1447 |
| 933 | nmdc:mga0a205_3227_c1 | 3300050515 | Bacteria | 11031 |
| 934 | nmdc:mga0sz30_22811_c2 | 3300050516 | Bacteria | 1867 |
| 935 | Ga0495601_0009529 | 3300053077 | Bacteria | 5749 |
| 936 | Ga0495601_0037183 | 3300053077 | Bacteria | 3043 |
| 937 | Ga0495601_0083052 | 3300053077 | Bacteria | 2057 |
| 938 | Ga0495601_0220392 | 3300053077 | Bacteria | 1239 |
| 939 | Ga0495612_0046196 | 3300053078 | Bacteria | 1783 |
| 940 | Ga0500635_0026172 | 3300053080 | Bacteria | 1844 |
| 941 | Ga0495619_0077914 | 3300053085 | Bacteria | 2227 |
| 942 | Ga0500578_0176816 | 3300053086 | Bacteria | 1317 |
| 943 | Ga0500643_000267 | 3300053087 | Bacteria | 46005 |
| 944 | Ga0500643_018509 | 3300053087 | Bacteria | 2310 |
| 945 | Ga0500581_085026 | 3300053089 | Bacteria | 1574 |
| 946 | Ga0500647_0017157 | 3300053091 | Bacteria | 3334 |
| 947 | Ga0500583_0086589 | 3300053092 | Bacteria | 1520 |
| 948 | Ga0500651_0000861 | 3300053093 | Bacteria | 14855 |
| 949 | Ga0500566_0000157 | 3300053094 | Bacteria | 34534 |
| 950 | Ga0500566_0000925 | 3300053094 | Bacteria | 16797 |
| 951 | Ga0500566_0001146 | 3300053094 | Bacteria | 15389 |
| 952 | Ga0500640_038114 | 3300053095 | Bacteria | 2111 |
| 953 | Ga0500641_0058981 | 3300053096 | Bacteria | 1595 |
| 954 | Ga0500650_0001493 | 3300053098 | Bacteria | 7107 |
| 955 | Ga0500554_000718 | 3300053102 | Bacteria | 6703 |
| 956 | Ga0500554_003128 | 3300053102 | Bacteria | 3348 |
| 957 | Ga0500555_002718 | 3300053103 | Bacteria | 5083 |
| 958 | Ga0500556_0000413 | 3300053104 | Bacteria | 31142 |
| 959 | Ga0500557_000041 | 3300053105 | Bacteria | 64885 |
| 960 | Ga0500569_001799 | 3300053109 | Bacteria | 4110 |
| 961 | Ga0500572_001865 | 3300053111 | Bacteria | 5335 |
| 962 | Ga0500592_004170 | 3300053116 | Bacteria | 2306 |
| 963 | Ga0500594_0030081 | 3300053118 | Bacteria | 1424 |
| 964 | Ga0500595_003818 | 3300053119 | Bacteria | 6928 |
| 965 | Ga0500595_006228 | 3300053119 | Bacteria | 5095 |
| 966 | Ga0500608_004754 | 3300053122 | Bacteria | 5296 |
| 967 | Ga0500608_030350 | 3300053122 | Bacteria | 2562 |
| 968 | Ga0500614_001219 | 3300053123 | Bacteria | 6263 |
| 969 | Ga0500626_057934 | 3300053128 | Bacteria | 1736 |
| 970 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 971 | Ga0500642_0000140 | 3300053130 | Bacteria | 32282 |
| 972 | Ga0500652_000531 | 3300053131 | Bacteria | 13423 |
| 973 | Ga0500658_0011515 | 3300053134 | Bacteria | 3259 |
| 974 | Ga0500658_0013696 | 3300053134 | Bacteria | 2999 |
| 975 | Ga0500658_0044143 | 3300053134 | Bacteria | 1797 |
| 976 | Ga0500658_0081505 | 3300053134 | Bacteria | 1385 |
| 977 | Ga0500559_0003580 | 3300053136 | Bacteria | 7596 |
| 978 | Ga0500559_0004212 | 3300053136 | Bacteria | 6885 |
| 979 | Ga0500559_0018273 | 3300053136 | Bacteria | 2962 |
| 980 | Ga0500568_0002109 | 3300053139 | Bacteria | 12007 |
| 981 | Ga0500568_0011586 | 3300053139 | Bacteria | 4082 |
| 982 | Ga0500568_0028346 | 3300053139 | Bacteria | 2335 |
| 983 | Ga0500577_0000693 | 3300053142 | Bacteria | 8639 |
| 984 | Ga0500603_000277 | 3300053150 | Bacteria | 13486 |
| 985 | Ga0500603_001226 | 3300053150 | Bacteria | 5959 |
| 986 | Ga0500604_0003539 | 3300053151 | Bacteria | 4205 |
| 987 | Ga0500616_0000166 | 3300053153 | Bacteria | 110141 |
| 988 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 989 | Ga0500616_0028432 | 3300053153 | Bacteria | 3081 |
| 990 | Ga0500622_0011079 | 3300053156 | Bacteria | 4922 |
| 991 | Ga0500622_0029561 | 3300053156 | Bacteria | 2881 |
| 992 | Ga0500624_002833 | 3300053157 | Bacteria | 2302 |
| 993 | Ga0500630_014168 | 3300053159 | Bacteria | 3925 |
| 994 | Ga0500634_0031081 | 3300053161 | Bacteria | 2911 |
| 995 | Ga0500638_001014 | 3300053162 | Bacteria | 8145 |
| 996 | Ga0500638_057858 | 3300053162 | Bacteria | 1866 |
| 997 | Ga0500639_000014 | 3300053163 | Bacteria | 122926 |
| 998 | Ga0500639_033548 | 3300053163 | Bacteria | 2713 |
| 999 | Ga0500636_0001916 | 3300053177 | Bacteria | 11425 |
| 1000 | Ga0500636_0011628 | 3300053177 | Bacteria | 5151 |
| 1001 | Ga0500636_0028779 | 3300053177 | Bacteria | 3281 |
| 1002 | Ga0500637_0000121 | 3300053178 | Bacteria | 28204 |
| 1003 | Ga0500637_0002840 | 3300053178 | Bacteria | 7802 |
| 1004 | Ga0500637_0103898 | 3300053178 | Bacteria | 1648 |
| 1005 | Ga0500625_003212 | 3300053729 | Bacteria | 6395 |
| 1006 | Ga0500609_004134 | 3300053731 | Bacteria | 2019 |
| 1007 | Ga0500596_000810 | 3300053735 | Bacteria | 6182 |
| 1008 | Ga0500601_000076 | 3300053737 | Bacteria | 20083 |
| 1009 | Ga0501084_0003972 | 3300054114 | Bacteria | 12046 |
| 1010 | Ga0501084_0222438 | 3300054114 | Bacteria | 1593 |
| 1011 | Ga0500661_000452 | 3300055283 | Bacteria | 7586 |
| 1012 | Ga0501082_0011183 | 3300060353 | Bacteria | 7713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2824635225 | 2824641055 | 337 |
| 2 | iso_pu_bacteria | 8019555841 | 8019559553 | 337 |
| 3 | 3300049569 | Ga0501032_0208172 | Ga0501032_0208172_14_1030 | 338 |
| 4 | 3300049574 | Ga0501038_0233536 | Ga0501038_0233536_14_1030 | 338 |
| 5 | 3300049579 | Ga0501043_0215853 | Ga0501043_0215853_14_1030 | 338 |
| 6 | 3300049581 | Ga0501047_0217062 | Ga0501047_0217062_14_1030 | 338 |
| 7 | 3300049585 | Ga0501069_0115876 | Ga0501069_0115876_13_1029 | 338 |
| 8 | 3300053086 | Ga0500578_0176816 | Ga0500578_0176816_275_1291 | 338 |
| 9 | iso_pu_bacteria | 2824732956 | 2824740138 | 339 |
| 10 | 3300053130 | Ga0500642_0000140 | Ga0500642_0000140_26551_27651 | 342 |
| 11 | 3300046539 | Ga0495621_0048207 | Ga0495621_0048207_247_1344 | 344 |
| 12 | 3300046455 | Ga0495603_0079416 | Ga0495603_0079416_563_1663 | 345 |
| 13 | iso_pu_bacteria | 2849076700 | 2849081530 | 345 |
| 14 | 3300006942 | Ga0099824_1023697 | Ga0099824_10236972 | 346 |
| 15 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002310 | 346 |
| 16 | 3300027357 | Ga0209589_1000010 | Ga0209589_1000010149 | 346 |
| 17 | 3300027361 | Ga0209489_100011 | Ga0209489_10001187 | 346 |
| 18 | 3300047470 | Ga0495681_0039134 | Ga0495681_0039134_59_1162 | 346 |
| 19 | 3300009093 | Ga0105240_10086587 | Ga0105240_100865871 | 347 |
| 20 | 3300013104 | Ga0157370_10254099 | Ga0157370_102540991 | 347 |
| 21 | 3300025913 | Ga0207695_10088253 | Ga0207695_100882532 | 347 |
| 22 | 3300037466 | Ga0395898_0013875 | Ga0395898_0013875_5686_6786 | 347 |
| 23 | 3300038443 | Ga0395901_0015985 | Ga0395901_0015985_1826_2926 | 347 |
| 24 | 3300047320 | Ga0495672_0036441 | Ga0495672_0036441_890_1996 | 347 |
| 25 | 3300048913 | Ga0496110_0161215 | Ga0496110_0161215_804_1904 | 347 |
| 26 | 3300049822 | Ga0501035_0144301 | Ga0501035_0144301_973_2043 | 349 |
| 27 | 3300005434 | Ga0070709_10010289 | Ga0070709_100102892 | 350 |
| 28 | 3300005435 | Ga0070714_100033934 | Ga0070714_1000339343 | 350 |
| 29 | 3300005436 | Ga0070713_100194184 | Ga0070713_1001941842 | 350 |
| 30 | 3300005437 | Ga0070710_10114774 | Ga0070710_101147742 | 350 |
| 31 | 3300005614 | Ga0068856_100011262 | Ga0068856_1000112622 | 350 |
| 32 | 3300005616 | Ga0068852_100162382 | Ga0068852_1001623822 | 350 |
| 33 | 3300006173 | Ga0070716_100097833 | Ga0070716_1000978332 | 350 |
| 34 | 3300025253 | Ga0209677_108387 | Ga0209677_1083872 | 350 |
| 35 | 3300025919 | Ga0207657_10186508 | Ga0207657_101865082 | 350 |
| 36 | 3300026078 | Ga0207702_10080857 | Ga0207702_100808572 | 350 |
| 37 | 3300026142 | Ga0207698_10313711 | Ga0207698_103137112 | 350 |
| 38 | 3300048915 | Ga0496112_0157994 | Ga0496112_0157994_137_1237 | 350 |
| 39 | 3300048924 | Ga0496121_0038697 | Ga0496121_0038697_1699_2799 | 350 |
| 40 | 3300009148 | Ga0105243_10272915 | Ga0105243_102729152 | 351 |
| 41 | 3300025898 | Ga0207692_10083406 | Ga0207692_100834062 | 351 |
| 42 | 3300025906 | Ga0207699_10030568 | Ga0207699_100305682 | 351 |
| 43 | 3300025915 | Ga0207693_10109173 | Ga0207693_101091732 | 351 |
| 44 | 3300025929 | Ga0207664_10140288 | Ga0207664_101402882 | 351 |
| 45 | 3300030521 | Ga0307511_10123048 | Ga0307511_101230482 | 351 |
| 46 | 3300048929 | Ga0496126_0188462 | Ga0496126_0188462_452_1552 | 351 |
| 47 | 3300005435 | Ga0070714_100113747 | Ga0070714_1001137473 | 352 |
| 48 | 3300005535 | Ga0070684_100006273 | Ga0070684_1000062731 | 352 |
| 49 | 3300025944 | Ga0207661_10004270 | Ga0207661_100042702 | 352 |
| 50 | 3300031507 | Ga0307509_10014739 | Ga0307509_100147392 | 352 |
| 51 | 3300031730 | Ga0307516_10012343 | Ga0307516_100123436 | 352 |
| 52 | 3300046507 | Ga0495606_0160731 | Ga0495606_0160731_43_1146 | 352 |
| 53 | 3300005347 | Ga0070668_100103950 | Ga0070668_1001039502 | 353 |
| 54 | 3300005455 | Ga0070663_100078956 | Ga0070663_1000789562 | 353 |
| 55 | 3300025919 | Ga0207657_10029030 | Ga0207657_100290302 | 353 |
| 56 | 3300025949 | Ga0207667_10096966 | Ga0207667_100969662 | 353 |
| 57 | 3300026067 | Ga0207678_10096270 | Ga0207678_100962702 | 353 |
| 58 | 3300046477 | Ga0495664_0070105 | Ga0495664_0070105_176_1276 | 353 |
| 59 | 3300046684 | Ga0495669_0052607 | Ga0495669_0052607_147_1247 | 353 |
| 60 | 3300047445 | Ga0495677_0080575 | Ga0495677_0080575_58_1158 | 353 |
| 61 | 3300048903 | Ga0496100_0035051 | Ga0496100_0035051_1346_2446 | 353 |
| 62 | 3300048908 | Ga0496105_0085675 | Ga0496105_0085675_1216_2316 | 353 |
| 63 | 3300048909 | Ga0496106_0082778 | Ga0496106_0082778_889_1989 | 353 |
| 64 | 3300048910 | Ga0496107_0048989 | Ga0496107_0048989_313_1413 | 353 |
| 65 | 3300048912 | Ga0496109_0303289 | Ga0496109_0303289_217_1317 | 353 |
| 66 | 3300048915 | Ga0496112_0226149 | Ga0496112_0226149_230_1330 | 353 |
| 67 | 3300048917 | Ga0496114_0089217 | Ga0496114_0089217_912_2012 | 353 |
| 68 | 3300048918 | Ga0496115_0073171 | Ga0496115_0073171_802_1902 | 353 |
| 69 | 3300048924 | Ga0496121_0015642 | Ga0496121_0015642_2250_3350 | 353 |
| 70 | 3300025928 | Ga0207700_10292772 | Ga0207700_102927722 | 354 |
| 71 | 3300044684 | Ga0466966_0047681 | Ga0466966_0047681_1332_2486 | 354 |
| 72 | 3300045049 | Ga0466959_0115308 | Ga0466959_0115308_335_1489 | 354 |
| 73 | 3300049583 | Ga0501067_0092887 | Ga0501067_0092887_38_1138 | 354 |
| 74 | 3300010375 | Ga0105239_10111365 | Ga0105239_101113652 | 355 |
| 75 | 3300048909 | Ga0496106_0377205 | Ga0496106_0377205_20_1123 | 355 |
| 76 | 3300048924 | Ga0496121_0036908 | Ga0496121_0036908_1206_2306 | 355 |
| 77 | 3300009551 | Ga0105238_10396014 | Ga0105238_103960141 | 356 |
| 78 | 3300048927 | Ga0496124_0090921 | Ga0496124_0090921_51_1154 | 356 |
| 79 | 3300048918 | Ga0496115_0096862 | Ga0496115_0096862_839_1939 | 357 |
| 80 | 3300053091 | Ga0500647_0017157 | Ga0500647_0017157_1228_2328 | 357 |
| 81 | 3300053094 | Ga0500566_0000925 | Ga0500566_0000925_1637_2737 | 357 |
| 82 | 3300053095 | Ga0500640_038114 | Ga0500640_038114_793_1893 | 357 |
| 83 | 3300053111 | Ga0500572_001865 | Ga0500572_001865_1663_2763 | 357 |
| 84 | 3300053122 | Ga0500608_030350 | Ga0500608_030350_553_1653 | 357 |
| 85 | 3300053123 | Ga0500614_001219 | Ga0500614_001219_4741_5841 | 357 |
| 86 | 3300053136 | Ga0500559_0004212 | Ga0500559_0004212_3082_4182 | 357 |
| 87 | 3300053150 | Ga0500603_001226 | Ga0500603_001226_3152_4252 | 357 |
| 88 | 3300053159 | Ga0500630_014168 | Ga0500630_014168_2299_3399 | 357 |
| 89 | 3300053162 | Ga0500638_057858 | Ga0500638_057858_85_1185 | 357 |
| 90 | 3300053163 | Ga0500639_000014 | Ga0500639_000014_1669_2769 | 357 |
| 91 | iso_pu_bacteria | 2824600985 | 2824607730 | 357 |
| 92 | iso_pu_bacteria | 2824609381 | 2824617132 | 357 |
| 93 | iso_pu_bacteria | 2844315083 | 2844316914 | 357 |
| 94 | iso_pu_bacteria | 2888378607 | 2888381524 | 357 |
| 95 | iso_pu_bacteria | 2903727486 | 2903733964 | 357 |
| 96 | iso_pu_bacteria | 2906602504 | 2906604580 | 357 |
| 97 | 3300046533 | Ga0495640_0034231 | Ga0495640_0034231_2513_3589 | 358 |
| 98 | 3300005530 | Ga0070679_100172326 | Ga0070679_1001723262 | 359 |
| 99 | 3300005539 | Ga0068853_100028252 | Ga0068853_1000282521 | 359 |
| 100 | 3300005578 | Ga0068854_100051460 | Ga0068854_1000514602 | 359 |
| 101 | 3300005614 | Ga0068856_100056546 | Ga0068856_1000565464 | 359 |
| 102 | 3300005616 | Ga0068852_100205706 | Ga0068852_1002057061 | 359 |
| 103 | 3300009093 | Ga0105240_10068093 | Ga0105240_100680932 | 359 |
| 104 | 3300009093 | Ga0105240_10210308 | Ga0105240_102103082 | 359 |
| 105 | 3300009545 | Ga0105237_10146881 | Ga0105237_101468812 | 359 |
| 106 | 3300020070 | Ga0206356_10862082 | Ga0206356_108620822 | 359 |
| 107 | 3300025921 | Ga0207652_10057241 | Ga0207652_100572412 | 359 |
| 108 | 3300025949 | Ga0207667_10183322 | Ga0207667_101833222 | 359 |
| 109 | 3300026041 | Ga0207639_10190810 | Ga0207639_101908102 | 359 |
| 110 | 3300026078 | Ga0207702_10302247 | Ga0207702_103022472 | 359 |
| 111 | 3300026116 | Ga0207674_10026464 | Ga0207674_100264646 | 359 |
| 112 | 3300028786 | Ga0307517_10000085 | Ga0307517_10000085113 | 359 |
| 113 | 3300046692 | Ga0495671_0102419 | Ga0495671_0102419_304_1383 | 359 |
| 114 | 3300048924 | Ga0496121_0083650 | Ga0496121_0083650_216_1295 | 359 |
| 115 | 3300049570 | Ga0501033_0229418 | Ga0501033_0229418_34_1137 | 359 |
| 116 | 3300005937 | Ga0081455_10026261 | Ga0081455_100262613 | 360 |
| 117 | 3300031235 | Ga0265330_10054608 | Ga0265330_100546082 | 360 |
| 118 | 3300035724 | Ga0373933_0028214 | Ga0373933_0028214_1464_2654 | 360 |
| 119 | 3300048924 | Ga0496121_0082348 | Ga0496121_0082348_150_1250 | 360 |
| 120 | 3300049571 | Ga0501034_0286773 | Ga0501034_0286773_40_1140 | 360 |
| 121 | 3300049574 | Ga0501038_0082118 | Ga0501038_0082118_623_1723 | 360 |
| 122 | 3300049581 | Ga0501047_0073429 | Ga0501047_0073429_1198_2298 | 360 |
| 123 | 3300049586 | Ga0501070_0063929 | Ga0501070_0063929_1264_2364 | 360 |
| 124 | 3300049822 | Ga0501035_0123726 | Ga0501035_0123726_208_1308 | 360 |
| 125 | iso_pu_bacteria | 8019629233 | 8019637044 | 360 |
| 126 | 3300006028 | Ga0070717_10005443 | Ga0070717_100054433 | 361 |
| 127 | 3300025297 | Ga0209758_1031926 | Ga0209758_10319262 | 361 |
| 128 | 3300031235 | Ga0265330_10032732 | Ga0265330_100327322 | 361 |
| 129 | 3300031247 | Ga0265340_10002779 | Ga0265340_100027795 | 361 |
| 130 | 3300039453 | Ga0436362_0766994 | Ga0436362_0766994_53_1138 | 361 |
| 131 | 3300053080 | Ga0500635_0026172 | Ga0500635_0026172_11_1105 | 361 |
| 132 | iso_pu_bacteria | 2507262055 | 2507511012 | 362 |
| 133 | iso_pu_bacteria | 2508501042 | 2508696939 | 362 |
| 134 | iso_pu_bacteria | 2508501128 | 2509148875 | 362 |
| 135 | iso_pu_bacteria | 2511231028 | 2511395187 | 362 |
| 136 | iso_pu_bacteria | 2513237092 | 2513623486 | 362 |
| 137 | iso_pu_bacteria | 2513237094 | 2513637468 | 362 |
| 138 | iso_pu_bacteria | 2513237095 | 2513649682 | 362 |
| 139 | iso_pu_bacteria | 2513237096 | 2513655026 | 362 |
| 140 | iso_pu_bacteria | 2513237098 | 2513677796 | 362 |
| 141 | iso_pu_bacteria | 2513237101 | 2513697433 | 362 |
| 142 | iso_pu_bacteria | 2513237104 | 2513716918 | 362 |
| 143 | iso_pu_bacteria | 2513237137 | 2513861042 | 362 |
| 144 | iso_pu_bacteria | 2513237139 | 2513874652 | 362 |
| 145 | iso_pu_bacteria | 2513237145 | 2513915951 | 362 |
| 146 | iso_pu_bacteria | 2513237161 | 2514010632 | 362 |
| 147 | iso_pu_bacteria | 2515154112 | 2515625436 | 362 |
| 148 | iso_pu_bacteria | 2517093001 | 2517100591 | 362 |
| 149 | iso_pu_bacteria | 2517572143 | 2517894744 | 362 |
| 150 | iso_pu_bacteria | 2524023205 | 2524438185 | 362 |
| 151 | iso_pu_bacteria | 2524023210 | 2524464075 | 362 |
| 152 | iso_pu_bacteria | 2524023228 | 2524534493 | 362 |
| 153 | iso_pu_bacteria | 2528768022 | 2528849820 | 362 |
| 154 | iso_pu_bacteria | 2602042107 | 2603862615 | 362 |
| 155 | iso_pu_bacteria | 2617270735 | 2617350776 | 362 |
| 156 | iso_pu_bacteria | 2617270741 | 2617373145 | 362 |
| 157 | iso_pu_bacteria | 2667528175 | 2671119158 | 362 |
| 158 | iso_pu_bacteria | 2721755755 | 2723843076 | 362 |
| 159 | iso_pu_bacteria | 2728368998 | 2728747600 | 362 |
| 160 | iso_pu_bacteria | 2791355196 | 2793064664 | 362 |
| 161 | iso_pu_bacteria | 2791355197 | 2793071219 | 362 |
| 162 | iso_pu_bacteria | 2791355199 | 2793079517 | 362 |
| 163 | iso_pu_bacteria | 2802429603 | 2805916649 | 362 |
| 164 | iso_pu_bacteria | 2816332527 | 2818238153 | 362 |
| 165 | iso_pu_bacteria | 2824653114 | 2824658711 | 362 |
| 166 | iso_pu_bacteria | 2824661429 | 2824668266 | 362 |
| 167 | iso_pu_bacteria | 2824671348 | 2824676178 | 362 |
| 168 | iso_pu_bacteria | 2824679649 | 2824682885 | 362 |
| 169 | iso_pu_bacteria | 2824687955 | 2824692364 | 362 |
| 170 | iso_pu_bacteria | 2824746037 | 2824751540 | 362 |
| 171 | iso_pu_bacteria | 2824753945 | 2824761224 | 362 |
| 172 | iso_pu_bacteria | 2824763712 | 2824771851 | 362 |
| 173 | iso_pu_bacteria | 2824773399 | 2824780542 | 362 |
| 174 | iso_pu_bacteria | 2838122688 | 2838127896 | 362 |
| 175 | iso_pu_bacteria | 2841941048 | 2841943189 | 362 |
| 176 | iso_pu_bacteria | 2841949485 | 2841954080 | 362 |
| 177 | iso_pu_bacteria | 2841957949 | 2841960218 | 362 |
| 178 | iso_pu_bacteria | 2841966195 | 2841968170 | 362 |
| 179 | iso_pu_bacteria | 2841974524 | 2841976620 | 362 |
| 180 | iso_pu_bacteria | 2841983080 | 2841987993 | 362 |
| 181 | iso_pu_bacteria | 2842038055 | 2842042704 | 362 |
| 182 | iso_pu_bacteria | 2842045827 | 2842050747 | 362 |
| 183 | iso_pu_bacteria | 2847930680 | 2847938563 | 362 |
| 184 | iso_pu_bacteria | 2847939898 | 2847944237 | 362 |
| 185 | iso_pu_bacteria | 2857509624 | 2857512189 | 362 |
| 186 | iso_pu_bacteria | 2857524615 | 2857529962 | 362 |
| 187 | iso_pu_bacteria | 2874590934 | 2874597749 | 362 |
| 188 | iso_pu_bacteria | 2874604998 | 2874612593 | 362 |
| 189 | iso_pu_bacteria | 2874612657 | 2874617697 | 362 |
| 190 | iso_pu_bacteria | 2874620515 | 2874623435 | 362 |
| 191 | iso_pu_bacteria | 2874628541 | 2874630655 | 362 |
| 192 | iso_pu_bacteria | 2874645413 | 2874651278 | 362 |
| 193 | iso_pu_bacteria | 2876761206 | 2876762402 | 362 |
| 194 | iso_pu_bacteria | 2876771140 | 2876776349 | 362 |
| 195 | iso_pu_bacteria | 2876818435 | 2876820917 | 362 |
| 196 | iso_pu_bacteria | 2879074833 | 2879081788 | 362 |
| 197 | iso_pu_bacteria | 2879083081 | 2879086192 | 362 |
| 198 | iso_pu_bacteria | 2879099564 | 2879101348 | 362 |
| 199 | iso_pu_bacteria | 2879110137 | 2879118034 | 362 |
| 200 | iso_pu_bacteria | 2879127579 | 2879130503 | 362 |
| 201 | iso_pu_bacteria | 2879142872 | 2879146389 | 362 |
| 202 | iso_pu_bacteria | 2881364244 | 2881370681 | 362 |
| 203 | iso_pu_bacteria | 2885366525 | 2885366933 | 362 |
| 204 | iso_pu_bacteria | 2885374607 | 2885378766 | 362 |
| 205 | iso_pu_bacteria | 2885383462 | 2885384490 | 362 |
| 206 | iso_pu_bacteria | 2888388044 | 2888389115 | 362 |
| 207 | iso_pu_bacteria | 2888419890 | 2888421927 | 362 |
| 208 | iso_pu_bacteria | 2889033259 | 2889033623 | 362 |
| 209 | iso_pu_bacteria | 2893066018 | 2893069395 | 362 |
| 210 | iso_pu_bacteria | 2903748898 | 2903751426 | 362 |
| 211 | iso_pu_bacteria | 2903768456 | 2903773626 | 362 |
| 212 | iso_pu_bacteria | 2904666416 | 2904667334 | 362 |
| 213 | iso_pu_bacteria | 2904699407 | 2904705791 | 362 |
| 214 | iso_pu_bacteria | 2904711408 | 2904719228 | 362 |
| 215 | iso_pu_bacteria | 2906610324 | 2906611464 | 362 |
| 216 | iso_pu_bacteria | 2906626472 | 2906635179 | 362 |
| 217 | iso_pu_bacteria | 2906635258 | 2906641699 | 362 |
| 218 | iso_pu_bacteria | 2906643746 | 2906651200 | 362 |
| 219 | iso_pu_bacteria | 2906660503 | 2906660801 | 362 |
| 220 | iso_pu_bacteria | 2908739725 | 2908745056 | 362 |
| 221 | iso_pu_bacteria | 2908756301 | 2908757176 | 362 |
| 222 | iso_pu_bacteria | 2908775508 | 2908781600 | 362 |
| 223 | iso_pu_bacteria | 2919073203 | 2919077185 | 362 |
| 224 | iso_pu_bacteria | 2922361189 | 2922366991 | 362 |
| 225 | iso_pu_bacteria | 2922368715 | 2922371192 | 362 |
| 226 | iso_pu_bacteria | 2922386360 | 2922390227 | 362 |
| 227 | iso_pu_bacteria | 2922393267 | 2922393564 | 362 |
| 228 | iso_pu_bacteria | 2922425934 | 2922427893 | 362 |
| 229 | iso_pu_bacteria | 2929615660 | 2929619576 | 362 |
| 230 | iso_pu_bacteria | 2929624759 | 2929627954 | 362 |
| 231 | iso_pu_bacteria | 2932784394 | 2932785906 | 362 |
| 232 | iso_pu_bacteria | 2932794094 | 2932798314 | 362 |
| 233 | iso_pu_bacteria | 2932801729 | 2932804110 | 362 |
| 234 | iso_pu_bacteria | 2932809354 | 2932817276 | 362 |
| 235 | iso_pu_bacteria | 2932818245 | 2932826873 | 362 |
| 236 | iso_pu_bacteria | 2932828146 | 2932830950 | 362 |
| 237 | iso_pu_bacteria | 2933577622 | 2933581496 | 362 |
| 238 | iso_pu_bacteria | 2935608549 | 2935612751 | 362 |
| 239 | iso_pu_bacteria | 2935616580 | 2935621015 | 362 |
| 240 | iso_pu_bacteria | 2935630451 | 2935632179 | 362 |
| 241 | iso_pu_bacteria | 2935638405 | 2935640091 | 362 |
| 242 | iso_pu_bacteria | 2935648319 | 2935656721 | 362 |
| 243 | iso_pu_bacteria | 2935656913 | 2935665540 | 362 |
| 244 | iso_pu_bacteria | 2935665750 | 2935667070 | 362 |
| 245 | iso_pu_bacteria | 2935684952 | 2935690202 | 362 |
| 246 | iso_pu_bacteria | 2935694250 | 2935699712 | 362 |
| 247 | iso_pu_bacteria | 2935703347 | 2935704826 | 362 |
| 248 | iso_pu_bacteria | 2935713505 | 2935718101 | 362 |
| 249 | iso_pu_bacteria | 2935722832 | 2935726749 | 362 |
| 250 | iso_pu_bacteria | 2935732158 | 2935735518 | 362 |
| 251 | iso_pu_bacteria | 2935741537 | 2935745211 | 362 |
| 252 | iso_pu_bacteria | 2935750917 | 2935755213 | 362 |
| 253 | iso_pu_bacteria | 2935760218 | 2935762269 | 362 |
| 254 | iso_pu_bacteria | 2935769743 | 2935773657 | 362 |
| 255 | iso_pu_bacteria | 2935777560 | 2935780212 | 362 |
| 256 | iso_pu_bacteria | 2935785616 | 2935788438 | 362 |
| 257 | iso_pu_bacteria | 2935793552 | 2935796594 | 362 |
| 258 | iso_pu_bacteria | 2935801545 | 2935803772 | 362 |
| 259 | iso_pu_bacteria | 2935810662 | 2935811687 | 362 |
| 260 | iso_pu_bacteria | 2935819856 | 2935824240 | 362 |
| 261 | iso_pu_bacteria | 2935827899 | 2935829574 | 362 |
| 262 | iso_pu_bacteria | 2935837841 | 2935843092 | 362 |
| 263 | iso_pu_bacteria | 2935847175 | 2935852613 | 362 |
| 264 | iso_pu_bacteria | 2935855204 | 2935858822 | 362 |
| 265 | iso_pu_bacteria | 2935864058 | 2935866780 | 362 |
| 266 | iso_pu_bacteria | 2935873716 | 2935876911 | 362 |
| 267 | iso_pu_bacteria | 2935883170 | 2935884084 | 362 |
| 268 | iso_pu_bacteria | 2935908558 | 2935912241 | 362 |
| 269 | iso_pu_bacteria | 2935916978 | 2935924085 | 362 |
| 270 | iso_pu_bacteria | 2935926038 | 2935929270 | 362 |
| 271 | iso_pu_bacteria | 2935934488 | 2935935901 | 362 |
| 272 | iso_pu_bacteria | 2935942939 | 2935950409 | 362 |
| 273 | iso_pu_bacteria | 2935951376 | 2935957433 | 362 |
| 274 | iso_pu_bacteria | 2935959822 | 2935962044 | 362 |
| 275 | iso_pu_bacteria | 2935967501 | 2935968464 | 362 |
| 276 | iso_pu_bacteria | 2935975950 | 2935976653 | 362 |
| 277 | iso_pu_bacteria | 2935984226 | 2935990723 | 362 |
| 278 | iso_pu_bacteria | 2935992306 | 2935993452 | 362 |
| 279 | iso_pu_bacteria | 2936002035 | 2936004347 | 362 |
| 280 | iso_pu_bacteria | 2936011229 | 2936019584 | 362 |
| 281 | iso_pu_bacteria | 2936019824 | 2936028200 | 362 |
| 282 | iso_pu_bacteria | 2936028420 | 2936037073 | 362 |
| 283 | iso_pu_bacteria | 2936037263 | 2936038269 | 362 |
| 284 | iso_pu_bacteria | 2936046547 | 2936055057 | 362 |
| 285 | iso_pu_bacteria | 2936055302 | 2936058607 | 362 |
| 286 | iso_pu_bacteria | 2940556831 | 2940561506 | 362 |
| 287 | iso_pu_bacteria | 2941507105 | 2941508127 | 362 |
| 288 | iso_pu_bacteria | 2941515067 | 2941515368 | 362 |
| 289 | iso_pu_bacteria | 2941523033 | 2941524057 | 362 |
| 290 | iso_pu_bacteria | 2941531003 | 2941533696 | 362 |
| 291 | iso_pu_bacteria | 2941538514 | 2941544316 | 362 |
| 292 | iso_pu_bacteria | 3005474847 | 3005477604 | 362 |
| 293 | iso_pu_bacteria | 3005483717 | 3005486183 | 362 |
| 294 | iso_pu_bacteria | 3005506211 | 3005507124 | 362 |
| 295 | iso_pu_bacteria | 3005587118 | 3005588498 | 362 |
| 296 | iso_pu_bacteria | 3005594810 | 3005596548 | 362 |
| 297 | iso_pu_bacteria | 3005710791 | 3005712616 | 362 |
| 298 | iso_pu_bacteria | 3005718088 | 3005719677 | 362 |
| 299 | iso_pu_bacteria | 8006926726 | 8006930905 | 362 |
| 300 | iso_pu_bacteria | 8006933436 | 8006933615 | 362 |
| 301 | iso_pu_bacteria | 8006964411 | 8006966527 | 362 |
| 302 | iso_pu_bacteria | 8006973647 | 8006983288 | 362 |
| 303 | iso_pu_bacteria | 8006994254 | 8006997837 | 362 |
| 304 | iso_pu_bacteria | 8016511872 | 8016516435 | 362 |
| 305 | iso_pu_bacteria | 8016522445 | 8016523835 | 362 |
| 306 | iso_pu_bacteria | 8016539877 | 8016541636 | 362 |
| 307 | iso_pu_bacteria | 8016548790 | 8016551632 | 362 |
| 308 | iso_pu_bacteria | 8016557553 | 8016560018 | 362 |
| 309 | iso_pu_bacteria | 8016566248 | 8016567022 | 362 |
| 310 | iso_pu_bacteria | 8016583857 | 8016589131 | 362 |
| 311 | iso_pu_bacteria | 8016595262 | 8016597943 | 362 |
| 312 | iso_pu_bacteria | 8016613128 | 8016620665 | 362 |
| 313 | iso_pu_bacteria | 8016622563 | 8016629333 | 362 |
| 314 | iso_pu_bacteria | 8016630954 | 8016633848 | 362 |
| 315 | iso_pu_bacteria | 8017057580 | 8017060102 | 362 |
| 316 | iso_pu_bacteria | 8019530166 | 8019537050 | 362 |
| 317 | iso_pu_bacteria | 8019538911 | 8019542490 | 362 |
| 318 | iso_pu_bacteria | 8019547302 | 8019548265 | 362 |
| 319 | iso_pu_bacteria | 8019565922 | 8019569655 | 362 |
| 320 | iso_pu_bacteria | 8019576017 | 8019579612 | 362 |
| 321 | iso_pu_bacteria | 8019597564 | 8019604018 | 362 |
| 322 | iso_pu_bacteria | 8019648815 | 8019650025 | 362 |
| 323 | iso_pu_bacteria | 8019678201 | 8019681658 | 362 |
| 324 | iso_pu_bacteria | 8019687851 | 8019694113 | 362 |
| 325 | iso_pu_bacteria | 8055742211 | 8055749166 | 362 |
| 326 | iso_pu_bacteria | 8056673599 | 8056674871 | 362 |
| 327 | iso_pu_bacteria | 8056681323 | 8056682382 | 362 |
| 328 | iso_pu_bacteria | 8056689827 | 8056695171 | 362 |
| 329 | iso_pu_bacteria | 8056967851 | 8056969721 | 362 |
| 330 | 3300049569 | Ga0501032_0119010 | Ga0501032_0119010_102_1202 | 363 |
| 331 | 3300049571 | Ga0501034_0000197 | Ga0501034_0000197_54694_55794 | 363 |
| 332 | 3300049573 | Ga0501037_0101975 | Ga0501037_0101975_785_1885 | 363 |
| 333 | 3300049574 | Ga0501038_0038091 | Ga0501038_0038091_871_1971 | 363 |
| 334 | 3300049585 | Ga0501069_0043425 | Ga0501069_0043425_362_1462 | 363 |
| 335 | 3300049586 | Ga0501070_0090347 | Ga0501070_0090347_856_1956 | 363 |
| 336 | 3300049586 | Ga0501070_0314854 | Ga0501070_0314854_124_1224 | 363 |
| 337 | 3300049742 | Ga0501080_0389057 | Ga0501080_0389057_106_1206 | 363 |
| 338 | 3300049823 | Ga0501044_0231316 | Ga0501044_0231316_60_1160 | 363 |
| 339 | 3300049823 | Ga0501044_0238631 | Ga0501044_0238631_62_1162 | 363 |
| 340 | 3300049823 | Ga0501044_0332956 | Ga0501044_0332956_227_1327 | 363 |
| 341 | iso_pu_bacteria | 2513237141 | 2513892085 | 363 |
| 342 | iso_pu_bacteria | 2824626560 | 2824633057 | 363 |
| 343 | iso_pu_bacteria | 2824644064 | 2824648775 | 363 |
| 344 | iso_pu_bacteria | 2881665667 | 2881672684 | 363 |
| 345 | iso_pu_bacteria | 8006984368 | 8006989355 | 363 |
| 346 | 3300031247 | Ga0265340_10068419 | Ga0265340_100684192 | 364 |
| 347 | 3300031595 | Ga0265313_10031838 | Ga0265313_100318382 | 364 |
| 348 | 3300005334 | Ga0068869_100087262 | Ga0068869_1000872621 | 365 |
| 349 | 3300005334 | Ga0068869_100217902 | Ga0068869_1002179021 | 365 |
| 350 | 3300005337 | Ga0070682_100172374 | Ga0070682_1001723742 | 365 |
| 351 | 3300005366 | Ga0070659_100200993 | Ga0070659_1002009931 | 365 |
| 352 | 3300005434 | Ga0070709_10032218 | Ga0070709_100322181 | 365 |
| 353 | 3300005435 | Ga0070714_100000678 | Ga0070714_1000006789 | 365 |
| 354 | 3300005437 | Ga0070710_10001070 | Ga0070710_100010701 | 365 |
| 355 | 3300005439 | Ga0070711_100001837 | Ga0070711_1000018377 | 365 |
| 356 | 3300005457 | Ga0070662_100076417 | Ga0070662_1000764172 | 365 |
| 357 | 3300005614 | Ga0068856_100134819 | Ga0068856_1001348192 | 365 |
| 358 | 3300005842 | Ga0068858_100021103 | Ga0068858_1000211033 | 365 |
| 359 | 3300005844 | Ga0068862_100231871 | Ga0068862_1002318712 | 365 |
| 360 | 3300005937 | Ga0081455_10004793 | Ga0081455_1000479312 | 365 |
| 361 | 3300005983 | Ga0081540_1012663 | Ga0081540_10126631 | 365 |
| 362 | 3300006028 | Ga0070717_10029235 | Ga0070717_100292352 | 365 |
| 363 | 3300006042 | Ga0075368_10023834 | Ga0075368_100238342 | 365 |
| 364 | 3300006163 | Ga0070715_10000078 | Ga0070715_1000007814 | 365 |
| 365 | 3300006173 | Ga0070716_100046221 | Ga0070716_1000462211 | 365 |
| 366 | 3300006195 | Ga0075366_10012258 | Ga0075366_100122583 | 365 |
| 367 | 3300006353 | Ga0075370_10037250 | Ga0075370_100372502 | 365 |
| 368 | 3300006358 | Ga0068871_100083324 | Ga0068871_1000833242 | 365 |
| 369 | 3300007076 | Ga0075435_100164113 | Ga0075435_1001641132 | 365 |
| 370 | 3300009098 | Ga0105245_10237372 | Ga0105245_102373722 | 365 |
| 371 | 3300009177 | Ga0105248_10150640 | Ga0105248_101506402 | 365 |
| 372 | 3300009545 | Ga0105237_10024176 | Ga0105237_100241764 | 365 |
| 373 | 3300009553 | Ga0105249_10275370 | Ga0105249_102753702 | 365 |
| 374 | 3300014325 | Ga0163163_10087824 | Ga0163163_100878243 | 365 |
| 375 | 3300025898 | Ga0207692_10001055 | Ga0207692_100010556 | 365 |
| 376 | 3300025905 | Ga0207685_10002878 | Ga0207685_100028782 | 365 |
| 377 | 3300025906 | Ga0207699_10012034 | Ga0207699_100120343 | 365 |
| 378 | 3300025906 | Ga0207699_10202813 | Ga0207699_102028132 | 365 |
| 379 | 3300025911 | Ga0207654_10067997 | Ga0207654_100679972 | 365 |
| 380 | 3300025915 | Ga0207693_10003503 | Ga0207693_100035039 | 365 |
| 381 | 3300025916 | Ga0207663_10001979 | Ga0207663_100019792 | 365 |
| 382 | 3300025923 | Ga0207681_10253291 | Ga0207681_102532911 | 365 |
| 383 | 3300025924 | Ga0207694_10143146 | Ga0207694_101431462 | 365 |
| 384 | 3300025929 | Ga0207664_10038518 | Ga0207664_100385183 | 365 |
| 385 | 3300025933 | Ga0207706_10087663 | Ga0207706_100876632 | 365 |
| 386 | 3300025939 | Ga0207665_10000361 | Ga0207665_1000036111 | 365 |
| 387 | 3300025941 | Ga0207711_10040725 | Ga0207711_100407252 | 365 |
| 388 | 3300025949 | Ga0207667_10339810 | Ga0207667_103398102 | 365 |
| 389 | 3300025961 | Ga0207712_10124876 | Ga0207712_101248762 | 365 |
| 390 | 3300026023 | Ga0207677_10240867 | Ga0207677_102408671 | 365 |
| 391 | 3300026035 | Ga0207703_10190870 | Ga0207703_101908702 | 365 |
| 392 | 3300026041 | Ga0207639_10350805 | Ga0207639_103508051 | 365 |
| 393 | 3300026067 | Ga0207678_10092146 | Ga0207678_100921462 | 365 |
| 394 | 3300026095 | Ga0207676_10045662 | Ga0207676_100456622 | 365 |
| 395 | 3300026116 | Ga0207674_10186131 | Ga0207674_101861312 | 365 |
| 396 | 3300028379 | Ga0268266_10006027 | Ga0268266_100060275 | 365 |
| 397 | 3300031730 | Ga0307516_10035813 | Ga0307516_100358132 | 365 |
| 398 | 3300037068 | Ga0373925_0072762 | Ga0373925_0072762_954_2051 | 365 |
| 399 | 3300041413 | Ga0439465_0023650 | Ga0439465_0023650_187_1284 | 365 |
| 400 | 3300046557 | Ga0495622_0079611 | Ga0495622_0079611_353_1453 | 365 |
| 401 | 3300048912 | Ga0496109_0356227 | Ga0496109_0356227_220_1317 | 365 |
| 402 | 3300048913 | Ga0496110_0114120 | Ga0496110_0114120_658_1755 | 365 |
| 403 | 3300049586 | Ga0501070_0085330 | Ga0501070_0085330_183_1286 | 365 |
| 404 | 3300049742 | Ga0501080_0349960 | Ga0501080_0349960_56_1159 | 365 |
| 405 | 3300050493 | nmdc:mga0k408_127339_c1 | nmdc:mga0k408_127339_c1_250_1347 | 365 |
| 406 | 3300050496 | nmdc:mga07m45_95447_c1 | nmdc:mga07m45_95447_c1_446_1543 | 365 |
| 407 | 3300050512 | nmdc:mga0n895_82170_c1 | nmdc:mga0n895_82170_c1_1398_2495 | 365 |
| 408 | 3300050513 | nmdc:mga0rr50_152607_c1 | nmdc:mga0rr50_152607_c1_436_1533 | 365 |
| 409 | 3300053177 | Ga0500636_0028779 | Ga0500636_0028779_51_1148 | 365 |
| 410 | 3300003203 | JGI25406J46586_10000068 | JGI25406J46586_1000006832 | 366 |
| 411 | 3300003203 | JGI25406J46586_10000392 | JGI25406J46586_100003922 | 366 |
| 412 | 3300003203 | JGI25406J46586_10003218 | JGI25406J46586_100032182 | 366 |
| 413 | 3300003215 | JGI25153J46596_10004141 | JGI25153J46596_100041414 | 366 |
| 414 | 3300003215 | JGI25153J46596_10004246 | JGI25153J46596_100042464 | 366 |
| 415 | 3300003215 | JGI25153J46596_10008945 | JGI25153J46596_100089452 | 366 |
| 416 | 3300003215 | JGI25153J46596_10009956 | JGI25153J46596_100099562 | 366 |
| 417 | 3300003354 | JGI25160J50197_1001885 | JGI25160J50197_10018852 | 366 |
| 418 | 3300003354 | JGI25160J50197_1003307 | JGI25160J50197_10033074 | 366 |
| 419 | 3300003354 | JGI25160J50197_1008344 | JGI25160J50197_10083442 | 366 |
| 420 | 3300003794 | Ga0055531_10005281 | Ga0055531_100052816 | 366 |
| 421 | 3300004625 | Ga0055543_1007542 | Ga0055543_10075422 | 366 |
| 422 | 3300005262 | Ga0065165_1004626 | Ga0065165_10046266 | 366 |
| 423 | 3300005262 | Ga0065165_1004931 | Ga0065165_10049312 | 366 |
| 424 | 3300005262 | Ga0065165_1016843 | Ga0065165_10168432 | 366 |
| 425 | 3300005329 | Ga0070683_100008367 | Ga0070683_1000083677 | 366 |
| 426 | 3300005329 | Ga0070683_100080340 | Ga0070683_1000803404 | 366 |
| 427 | 3300005331 | Ga0070670_100209197 | Ga0070670_1002091972 | 366 |
| 428 | 3300005334 | Ga0068869_100179707 | Ga0068869_1001797071 | 366 |
| 429 | 3300005335 | Ga0070666_10043956 | Ga0070666_100439562 | 366 |
| 430 | 3300005336 | Ga0070680_100027612 | Ga0070680_1000276122 | 366 |
| 431 | 3300005336 | Ga0070680_100089896 | Ga0070680_1000898962 | 366 |
| 432 | 3300005338 | Ga0068868_100132236 | Ga0068868_1001322362 | 366 |
| 433 | 3300005338 | Ga0068868_100267873 | Ga0068868_1002678731 | 366 |
| 434 | 3300005339 | Ga0070660_100002003 | Ga0070660_10000200310 | 366 |
| 435 | 3300005344 | Ga0070661_100062206 | Ga0070661_1000622062 | 366 |
| 436 | 3300005353 | Ga0070669_100121573 | Ga0070669_1001215732 | 366 |
| 437 | 3300005355 | Ga0070671_100026137 | Ga0070671_1000261375 | 366 |
| 438 | 3300005356 | Ga0070674_100192865 | Ga0070674_1001928651 | 366 |
| 439 | 3300005434 | Ga0070709_10001417 | Ga0070709_100014178 | 366 |
| 440 | 3300005434 | Ga0070709_10168899 | Ga0070709_101688991 | 366 |
| 441 | 3300005435 | Ga0070714_100018262 | Ga0070714_1000182622 | 366 |
| 442 | 3300005435 | Ga0070714_100107626 | Ga0070714_1001076261 | 366 |
| 443 | 3300005436 | Ga0070713_100004076 | Ga0070713_1000040767 | 366 |
| 444 | 3300005436 | Ga0070713_100020815 | Ga0070713_1000208152 | 366 |
| 445 | 3300005436 | Ga0070713_100277773 | Ga0070713_1002777731 | 366 |
| 446 | 3300005437 | Ga0070710_10000633 | Ga0070710_1000063310 | 366 |
| 447 | 3300005437 | Ga0070710_10019478 | Ga0070710_100194783 | 366 |
| 448 | 3300005439 | Ga0070711_100001478 | Ga0070711_1000014781 | 366 |
| 449 | 3300005439 | Ga0070711_100002216 | Ga0070711_1000022161 | 366 |
| 450 | 3300005439 | Ga0070711_100056360 | Ga0070711_1000563602 | 366 |
| 451 | 3300005445 | Ga0070708_100041592 | Ga0070708_1000415922 | 366 |
| 452 | 3300005455 | Ga0070663_100088728 | Ga0070663_1000887282 | 366 |
| 453 | 3300005455 | Ga0070663_100231032 | Ga0070663_1002310322 | 366 |
| 454 | 3300005457 | Ga0070662_100015684 | Ga0070662_1000156843 | 366 |
| 455 | 3300005458 | Ga0070681_10026780 | Ga0070681_100267805 | 366 |
| 456 | 3300005458 | Ga0070681_10043509 | Ga0070681_100435094 | 366 |
| 457 | 3300005458 | Ga0070681_10084030 | Ga0070681_100840301 | 366 |
| 458 | 3300005458 | Ga0070681_10168938 | Ga0070681_101689382 | 366 |
| 459 | 3300005458 | Ga0070681_10200047 | Ga0070681_102000472 | 366 |
| 460 | 3300005459 | Ga0068867_100091974 | Ga0068867_1000919742 | 366 |
| 461 | 3300005468 | Ga0070707_100084934 | Ga0070707_1000849342 | 366 |
| 462 | 3300005518 | Ga0070699_100418958 | Ga0070699_1004189581 | 366 |
| 463 | 3300005530 | Ga0070679_100084687 | Ga0070679_1000846872 | 366 |
| 464 | 3300005530 | Ga0070679_100165930 | Ga0070679_1001659302 | 366 |
| 465 | 3300005530 | Ga0070679_100169165 | Ga0070679_1001691652 | 366 |
| 466 | 3300005535 | Ga0070684_100005206 | Ga0070684_1000052067 | 366 |
| 467 | 3300005535 | Ga0070684_100014119 | Ga0070684_1000141193 | 366 |
| 468 | 3300005539 | Ga0068853_100008362 | Ga0068853_1000083621 | 366 |
| 469 | 3300005539 | Ga0068853_100010311 | Ga0068853_1000103113 | 366 |
| 470 | 3300005543 | Ga0070672_100064626 | Ga0070672_1000646262 | 366 |
| 471 | 3300005543 | Ga0070672_100183381 | Ga0070672_1001833812 | 366 |
| 472 | 3300005547 | Ga0070693_100151182 | Ga0070693_1001511821 | 366 |
| 473 | 3300005548 | Ga0070665_100047437 | Ga0070665_1000474372 | 366 |
| 474 | 3300005548 | Ga0070665_100149380 | Ga0070665_1001493802 | 366 |
| 475 | 3300005548 | Ga0070665_100161240 | Ga0070665_1001612402 | 366 |
| 476 | 3300005548 | Ga0070665_100212428 | Ga0070665_1002124282 | 366 |
| 477 | 3300005563 | Ga0068855_100030914 | Ga0068855_1000309143 | 366 |
| 478 | 3300005577 | Ga0068857_100213706 | Ga0068857_1002137062 | 366 |
| 479 | 3300005578 | Ga0068854_100036841 | Ga0068854_1000368413 | 366 |
| 480 | 3300005578 | Ga0068854_100124665 | Ga0068854_1001246652 | 366 |
| 481 | 3300005614 | Ga0068856_100000091 | Ga0068856_10000009162 | 366 |
| 482 | 3300005614 | Ga0068856_100204413 | Ga0068856_1002044132 | 366 |
| 483 | 3300005616 | Ga0068852_100056055 | Ga0068852_1000560554 | 366 |
| 484 | 3300005617 | Ga0068859_100217615 | Ga0068859_1002176152 | 366 |
| 485 | 3300005618 | Ga0068864_100110233 | Ga0068864_1001102332 | 366 |
| 486 | 3300005718 | Ga0068866_10007748 | Ga0068866_100077482 | 366 |
| 487 | 3300005719 | Ga0068861_100054122 | Ga0068861_1000541223 | 366 |
| 488 | 3300005834 | Ga0068851_10001608 | Ga0068851_100016088 | 366 |
| 489 | 3300005834 | Ga0068851_10035213 | Ga0068851_100352132 | 366 |
| 490 | 3300005841 | Ga0068863_100111545 | Ga0068863_1001115452 | 366 |
| 491 | 3300005842 | Ga0068858_100171542 | Ga0068858_1001715422 | 366 |
| 492 | 3300005843 | Ga0068860_100000254 | Ga0068860_10000025442 | 366 |
| 493 | 3300005844 | Ga0068862_100052468 | Ga0068862_1000524683 | 366 |
| 494 | 3300005937 | Ga0081455_10042135 | Ga0081455_100421354 | 366 |
| 495 | 3300005983 | Ga0081540_1001143 | Ga0081540_100114311 | 366 |
| 496 | 3300005983 | Ga0081540_1003272 | Ga0081540_10032726 | 366 |
| 497 | 3300005983 | Ga0081540_1005484 | Ga0081540_10054847 | 366 |
| 498 | 3300005983 | Ga0081540_1009836 | Ga0081540_10098366 | 366 |
| 499 | 3300005983 | Ga0081540_1013469 | Ga0081540_10134696 | 366 |
| 500 | 3300005983 | Ga0081540_1030172 | Ga0081540_10301722 | 366 |
| 501 | 3300005985 | Ga0081539_10000191 | Ga0081539_10000191143 | 366 |
| 502 | 3300005985 | Ga0081539_10000321 | Ga0081539_1000032185 | 366 |
| 503 | 3300006038 | Ga0075365_10008079 | Ga0075365_100080792 | 366 |
| 504 | 3300006038 | Ga0075365_10026332 | Ga0075365_100263322 | 366 |
| 505 | 3300006038 | Ga0075365_10086379 | Ga0075365_100863792 | 366 |
| 506 | 3300006051 | Ga0075364_10027354 | Ga0075364_100273542 | 366 |
| 507 | 3300006173 | Ga0070716_100017445 | Ga0070716_1000174452 | 366 |
| 508 | 3300006173 | Ga0070716_100064152 | Ga0070716_1000641522 | 366 |
| 509 | 3300006173 | Ga0070716_100075084 | Ga0070716_1000750842 | 366 |
| 510 | 3300006173 | Ga0070716_100106129 | Ga0070716_1001061292 | 366 |
| 511 | 3300006175 | Ga0070712_100011086 | Ga0070712_1000110864 | 366 |
| 512 | 3300006175 | Ga0070712_100040056 | Ga0070712_1000400563 | 366 |
| 513 | 3300006175 | Ga0070712_100063527 | Ga0070712_1000635272 | 366 |
| 514 | 3300006175 | Ga0070712_100110148 | Ga0070712_1001101482 | 366 |
| 515 | 3300006178 | Ga0075367_10036274 | Ga0075367_100362742 | 366 |
| 516 | 3300006178 | Ga0075367_10115214 | Ga0075367_101152142 | 366 |
| 517 | 3300006195 | Ga0075366_10121287 | Ga0075366_101212872 | 366 |
| 518 | 3300006237 | Ga0097621_100091612 | Ga0097621_1000916122 | 366 |
| 519 | 3300006353 | Ga0075370_10038133 | Ga0075370_100381332 | 366 |
| 520 | 3300006844 | Ga0075428_100089794 | Ga0075428_1000897943 | 366 |
| 521 | 3300006852 | Ga0075433_10029509 | Ga0075433_100295094 | 366 |
| 522 | 3300006871 | Ga0075434_100081100 | Ga0075434_1000811002 | 366 |
| 523 | 3300006871 | Ga0075434_100304415 | Ga0075434_1003044152 | 366 |
| 524 | 3300006914 | Ga0075436_100049564 | Ga0075436_1000495642 | 366 |
| 525 | 3300006914 | Ga0075436_100210447 | Ga0075436_1002104471 | 366 |
| 526 | 3300006931 | Ga0097620_100217615 | Ga0097620_1002176152 | 366 |
| 527 | 3300006941 | Ga0099825_1018997 | Ga0099825_10189972 | 366 |
| 528 | 3300006943 | Ga0099822_1000022 | Ga0099822_10000229 | 366 |
| 529 | 3300006944 | Ga0099823_1027652 | Ga0099823_10276523 | 366 |
| 530 | 3300009093 | Ga0105240_10017201 | Ga0105240_100172017 | 366 |
| 531 | 3300009093 | Ga0105240_10022325 | Ga0105240_100223252 | 366 |
| 532 | 3300009093 | Ga0105240_10189377 | Ga0105240_101893772 | 366 |
| 533 | 3300009093 | Ga0105240_10393406 | Ga0105240_103934062 | 366 |
| 534 | 3300009094 | Ga0111539_10119503 | Ga0111539_101195032 | 366 |
| 535 | 3300009098 | Ga0105245_10071520 | Ga0105245_100715202 | 366 |
| 536 | 3300009098 | Ga0105245_10117886 | Ga0105245_101178862 | 366 |
| 537 | 3300009098 | Ga0105245_10268214 | Ga0105245_102682142 | 366 |
| 538 | 3300009101 | Ga0105247_10019830 | Ga0105247_100198302 | 366 |
| 539 | 3300009174 | Ga0105241_10014950 | Ga0105241_100149505 | 366 |
| 540 | 3300009174 | Ga0105241_10029800 | Ga0105241_100298003 | 366 |
| 541 | 3300009174 | Ga0105241_10296841 | Ga0105241_102968411 | 366 |
| 542 | 3300009177 | Ga0105248_10187065 | Ga0105248_101870652 | 366 |
| 543 | 3300009545 | Ga0105237_10015378 | Ga0105237_100153786 | 366 |
| 544 | 3300009545 | Ga0105237_10018494 | Ga0105237_100184946 | 366 |
| 545 | 3300009545 | Ga0105237_10028922 | Ga0105237_100289224 | 366 |
| 546 | 3300009545 | Ga0105237_10095800 | Ga0105237_100958002 | 366 |
| 547 | 3300009545 | Ga0105237_10138023 | Ga0105237_101380232 | 366 |
| 548 | 3300009545 | Ga0105237_10286821 | Ga0105237_102868212 | 366 |
| 549 | 3300009551 | Ga0105238_10008134 | Ga0105238_100081342 | 366 |
| 550 | 3300009551 | Ga0105238_10057140 | Ga0105238_100571403 | 366 |
| 551 | 3300009551 | Ga0105238_10142835 | Ga0105238_101428352 | 366 |
| 552 | 3300009553 | Ga0105249_10077171 | Ga0105249_100771713 | 366 |
| 553 | 3300010159 | Ga0099796_10014701 | Ga0099796_100147012 | 366 |
| 554 | 3300010159 | Ga0099796_10023589 | Ga0099796_100235892 | 366 |
| 555 | 3300010375 | Ga0105239_10053854 | Ga0105239_100538542 | 366 |
| 556 | 3300010375 | Ga0105239_10127689 | Ga0105239_101276892 | 366 |
| 557 | 3300010375 | Ga0105239_10373523 | Ga0105239_103735232 | 366 |
| 558 | 3300011119 | Ga0105246_10028278 | Ga0105246_100282782 | 366 |
| 559 | 3300013104 | Ga0157370_10044331 | Ga0157370_100443312 | 366 |
| 560 | 3300013105 | Ga0157369_10016060 | Ga0157369_100160606 | 366 |
| 561 | 3300013105 | Ga0157369_10198242 | Ga0157369_101982422 | 366 |
| 562 | 3300013296 | Ga0157374_10092378 | Ga0157374_100923782 | 366 |
| 563 | 3300013308 | Ga0157375_10052552 | Ga0157375_100525523 | 366 |
| 564 | 3300014325 | Ga0163163_10156308 | Ga0163163_101563082 | 366 |
| 565 | 3300014325 | Ga0163163_10409709 | Ga0163163_104097091 | 366 |
| 566 | 3300014969 | Ga0157376_10113676 | Ga0157376_101136762 | 366 |
| 567 | 3300017792 | Ga0163161_10108692 | Ga0163161_101086922 | 366 |
| 568 | 3300017792 | Ga0163161_10265622 | Ga0163161_102656221 | 366 |
| 569 | 3300020070 | Ga0206356_11262758 | Ga0206356_112627581 | 366 |
| 570 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001331 | 366 |
| 571 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005331 | 366 |
| 572 | 3300021321 | Ga0214542_1024229 | Ga0214542_10242293 | 366 |
| 573 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003433 | 366 |
| 574 | 3300021324 | Ga0214545_1023657 | Ga0214545_10236571 | 366 |
| 575 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002333 | 366 |
| 576 | 3300021327 | Ga0214543_1026030 | Ga0214543_10260301 | 366 |
| 577 | 3300021384 | Ga0213876_10028489 | Ga0213876_100284892 | 366 |
| 578 | 3300021384 | Ga0213876_10066492 | Ga0213876_100664922 | 366 |
| 579 | 3300021384 | Ga0213876_10101694 | Ga0213876_101016942 | 366 |
| 580 | 3300021441 | Ga0213871_10002263 | Ga0213871_100022632 | 366 |
| 581 | 3300025253 | Ga0209677_101595 | Ga0209677_1015957 | 366 |
| 582 | 3300025254 | Ga0209148_1000424 | Ga0209148_100042439 | 366 |
| 583 | 3300025261 | Ga0209233_1004610 | Ga0209233_10046104 | 366 |
| 584 | 3300025261 | Ga0209233_1006596 | Ga0209233_10065962 | 366 |
| 585 | 3300025272 | Ga0209455_1009596 | Ga0209455_10095962 | 366 |
| 586 | 3300025272 | Ga0209455_1012617 | Ga0209455_10126171 | 366 |
| 587 | 3300025273 | Ga0209673_1037039 | Ga0209673_10370392 | 366 |
| 588 | 3300025295 | Ga0209564_1000485 | Ga0209564_100048528 | 366 |
| 589 | 3300025295 | Ga0209564_1006799 | Ga0209564_10067994 | 366 |
| 590 | 3300025297 | Ga0209758_1000141 | Ga0209758_1000141156 | 366 |
| 591 | 3300025297 | Ga0209758_1002420 | Ga0209758_10024206 | 366 |
| 592 | 3300025297 | Ga0209758_1005684 | Ga0209758_10056844 | 366 |
| 593 | 3300025297 | Ga0209758_1006453 | Ga0209758_10064534 | 366 |
| 594 | 3300025297 | Ga0209758_1032768 | Ga0209758_10327682 | 366 |
| 595 | 3300025297 | Ga0209758_1059854 | Ga0209758_10598541 | 366 |
| 596 | 3300025299 | Ga0209256_1010818 | Ga0209256_10108182 | 366 |
| 597 | 3300025302 | Ga0207426_1000425 | Ga0207426_100042560 | 366 |
| 598 | 3300025302 | Ga0207426_1003443 | Ga0207426_10034435 | 366 |
| 599 | 3300025302 | Ga0207426_1004449 | Ga0207426_10044491 | 366 |
| 600 | 3300025304 | Ga0209257_1000426 | Ga0209257_100042634 | 366 |
| 601 | 3300025321 | Ga0207656_10008209 | Ga0207656_100082092 | 366 |
| 602 | 3300025321 | Ga0207656_10016277 | Ga0207656_100162772 | 366 |
| 603 | 3300025898 | Ga0207692_10005603 | Ga0207692_100056033 | 366 |
| 604 | 3300025898 | Ga0207692_10034148 | Ga0207692_100341482 | 366 |
| 605 | 3300025899 | Ga0207642_10006639 | Ga0207642_100066392 | 366 |
| 606 | 3300025903 | Ga0207680_10141396 | Ga0207680_101413962 | 366 |
| 607 | 3300025906 | Ga0207699_10000390 | Ga0207699_100003906 | 366 |
| 608 | 3300025907 | Ga0207645_10145994 | Ga0207645_101459941 | 366 |
| 609 | 3300025910 | Ga0207684_10339723 | Ga0207684_103397231 | 366 |
| 610 | 3300025911 | Ga0207654_10000323 | Ga0207654_1000032311 | 366 |
| 611 | 3300025912 | Ga0207707_10000178 | Ga0207707_1000017811 | 366 |
| 612 | 3300025912 | Ga0207707_10030844 | Ga0207707_100308443 | 366 |
| 613 | 3300025912 | Ga0207707_10069420 | Ga0207707_100694202 | 366 |
| 614 | 3300025912 | Ga0207707_10082388 | Ga0207707_100823882 | 366 |
| 615 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062274 | 366 |
| 616 | 3300025913 | Ga0207695_10000497 | Ga0207695_1000049713 | 366 |
| 617 | 3300025914 | Ga0207671_10004982 | Ga0207671_100049826 | 366 |
| 618 | 3300025914 | Ga0207671_10154721 | Ga0207671_101547212 | 366 |
| 619 | 3300025914 | Ga0207671_10188296 | Ga0207671_101882962 | 366 |
| 620 | 3300025915 | Ga0207693_10018008 | Ga0207693_100180083 | 366 |
| 621 | 3300025915 | Ga0207693_10027789 | Ga0207693_100277894 | 366 |
| 622 | 3300025915 | Ga0207693_10051082 | Ga0207693_100510822 | 366 |
| 623 | 3300025915 | Ga0207693_10083737 | Ga0207693_100837372 | 366 |
| 624 | 3300025916 | Ga0207663_10006434 | Ga0207663_100064341 | 366 |
| 625 | 3300025916 | Ga0207663_10015611 | Ga0207663_100156113 | 366 |
| 626 | 3300025916 | Ga0207663_10043697 | Ga0207663_100436972 | 366 |
| 627 | 3300025917 | Ga0207660_10014180 | Ga0207660_100141804 | 366 |
| 628 | 3300025917 | Ga0207660_10179692 | Ga0207660_101796922 | 366 |
| 629 | 3300025919 | Ga0207657_10002910 | Ga0207657_100029106 | 366 |
| 630 | 3300025919 | Ga0207657_10076639 | Ga0207657_100766392 | 366 |
| 631 | 3300025921 | Ga0207652_10099805 | Ga0207652_100998052 | 366 |
| 632 | 3300025922 | Ga0207646_10095799 | Ga0207646_100957992 | 366 |
| 633 | 3300025924 | Ga0207694_10000212 | Ga0207694_1000021241 | 366 |
| 634 | 3300025924 | Ga0207694_10020078 | Ga0207694_100200782 | 366 |
| 635 | 3300025924 | Ga0207694_10078059 | Ga0207694_100780592 | 366 |
| 636 | 3300025926 | Ga0207659_10054790 | Ga0207659_100547902 | 366 |
| 637 | 3300025928 | Ga0207700_10001341 | Ga0207700_100013412 | 366 |
| 638 | 3300025928 | Ga0207700_10038868 | Ga0207700_100388681 | 366 |
| 639 | 3300025928 | Ga0207700_10073685 | Ga0207700_100736851 | 366 |
| 640 | 3300025929 | Ga0207664_10033246 | Ga0207664_100332462 | 366 |
| 641 | 3300025929 | Ga0207664_10036057 | Ga0207664_100360572 | 366 |
| 642 | 3300025929 | Ga0207664_10075472 | Ga0207664_100754722 | 366 |
| 643 | 3300025931 | Ga0207644_10151431 | Ga0207644_101514312 | 366 |
| 644 | 3300025931 | Ga0207644_10254249 | Ga0207644_102542492 | 366 |
| 645 | 3300025933 | Ga0207706_10023317 | Ga0207706_100233172 | 366 |
| 646 | 3300025933 | Ga0207706_10133439 | Ga0207706_101334392 | 366 |
| 647 | 3300025935 | Ga0207709_10013744 | Ga0207709_100137443 | 366 |
| 648 | 3300025937 | Ga0207669_10050072 | Ga0207669_100500722 | 366 |
| 649 | 3300025938 | Ga0207704_10052956 | Ga0207704_100529562 | 366 |
| 650 | 3300025938 | Ga0207704_10133699 | Ga0207704_101336992 | 366 |
| 651 | 3300025939 | Ga0207665_10005543 | Ga0207665_100055432 | 366 |
| 652 | 3300025939 | Ga0207665_10096560 | Ga0207665_100965602 | 366 |
| 653 | 3300025939 | Ga0207665_10097429 | Ga0207665_100974292 | 366 |
| 654 | 3300025940 | Ga0207691_10154226 | Ga0207691_101542262 | 366 |
| 655 | 3300025942 | Ga0207689_10140785 | Ga0207689_101407852 | 366 |
| 656 | 3300025944 | Ga0207661_10040922 | Ga0207661_100409222 | 366 |
| 657 | 3300025949 | Ga0207667_10007538 | Ga0207667_100075388 | 366 |
| 658 | 3300025949 | Ga0207667_10020042 | Ga0207667_100200425 | 366 |
| 659 | 3300025949 | Ga0207667_10020500 | Ga0207667_100205003 | 366 |
| 660 | 3300025961 | Ga0207712_10070275 | Ga0207712_100702751 | 366 |
| 661 | 3300025972 | Ga0207668_10080761 | Ga0207668_100807612 | 366 |
| 662 | 3300025972 | Ga0207668_10274169 | Ga0207668_102741691 | 366 |
| 663 | 3300025981 | Ga0207640_10054473 | Ga0207640_100544733 | 366 |
| 664 | 3300026035 | Ga0207703_10242709 | Ga0207703_102427091 | 366 |
| 665 | 3300026041 | Ga0207639_10002809 | Ga0207639_100028095 | 366 |
| 666 | 3300026041 | Ga0207639_10009638 | Ga0207639_100096382 | 366 |
| 667 | 3300026041 | Ga0207639_10142632 | Ga0207639_101426322 | 366 |
| 668 | 3300026067 | Ga0207678_10087674 | Ga0207678_100876742 | 366 |
| 669 | 3300026067 | Ga0207678_10142099 | Ga0207678_101420992 | 366 |
| 670 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003388 | 366 |
| 671 | 3300026078 | Ga0207702_10000041 | Ga0207702_1000004175 | 366 |
| 672 | 3300026078 | Ga0207702_10183373 | Ga0207702_101833732 | 366 |
| 673 | 3300026088 | Ga0207641_10119826 | Ga0207641_101198262 | 366 |
| 674 | 3300026089 | Ga0207648_10013629 | Ga0207648_100136293 | 366 |
| 675 | 3300026095 | Ga0207676_10212523 | Ga0207676_102125232 | 366 |
| 676 | 3300026095 | Ga0207676_10305386 | Ga0207676_103053862 | 366 |
| 677 | 3300026116 | Ga0207674_10004756 | Ga0207674_100047568 | 366 |
| 678 | 3300026116 | Ga0207674_10445603 | Ga0207674_104456031 | 366 |
| 679 | 3300026118 | Ga0207675_100058237 | Ga0207675_1000582372 | 366 |
| 680 | 3300026121 | Ga0207683_10096466 | Ga0207683_100964662 | 366 |
| 681 | 3300026142 | Ga0207698_10021924 | Ga0207698_100219242 | 366 |
| 682 | 3300027296 | Ga0209389_1000004 | Ga0209389_10000043 | 366 |
| 683 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006373 | 366 |
| 684 | 3300027361 | Ga0209489_100007 | Ga0209489_100007373 | 366 |
| 685 | 3300027361 | Ga0209489_100295 | Ga0209489_1002952 | 366 |
| 686 | 3300027363 | Ga0209700_100008 | Ga0209700_100008373 | 366 |
| 687 | 3300027363 | Ga0209700_100013 | Ga0209700_10001390 | 366 |
| 688 | 3300028379 | Ga0268266_10031060 | Ga0268266_100310602 | 366 |
| 689 | 3300028379 | Ga0268266_10118886 | Ga0268266_101188862 | 366 |
| 690 | 3300028379 | Ga0268266_10142144 | Ga0268266_101421442 | 366 |
| 691 | 3300028379 | Ga0268266_10170332 | Ga0268266_101703322 | 366 |
| 692 | 3300028380 | Ga0268265_10010132 | Ga0268265_100101325 | 366 |
| 693 | 3300028381 | Ga0268264_10000093 | Ga0268264_10000093117 | 366 |
| 694 | 3300028556 | Ga0265337_1016134 | Ga0265337_10161342 | 366 |
| 695 | 3300028653 | Ga0265323_10007415 | Ga0265323_100074153 | 366 |
| 696 | 3300028794 | Ga0307515_10279100 | Ga0307515_102791001 | 366 |
| 697 | 3300028800 | Ga0265338_10000328 | Ga0265338_1000032822 | 366 |
| 698 | 3300029957 | Ga0265324_10018488 | Ga0265324_100184883 | 366 |
| 699 | 3300031235 | Ga0265330_10043222 | Ga0265330_100432222 | 366 |
| 700 | 3300031238 | Ga0265332_10011026 | Ga0265332_100110263 | 366 |
| 701 | 3300031238 | Ga0265332_10033057 | Ga0265332_100330572 | 366 |
| 702 | 3300031241 | Ga0265325_10005212 | Ga0265325_100052123 | 366 |
| 703 | 3300031241 | Ga0265325_10011412 | Ga0265325_100114123 | 366 |
| 704 | 3300031242 | Ga0265329_10060793 | Ga0265329_100607931 | 366 |
| 705 | 3300031247 | Ga0265340_10074215 | Ga0265340_100742152 | 366 |
| 706 | 3300031249 | Ga0265339_10017239 | Ga0265339_100172392 | 366 |
| 707 | 3300031249 | Ga0265339_10063209 | Ga0265339_100632092 | 366 |
| 708 | 3300031250 | Ga0265331_10014674 | Ga0265331_100146744 | 366 |
| 709 | 3300031250 | Ga0265331_10018816 | Ga0265331_100188162 | 366 |
| 710 | 3300031250 | Ga0265331_10059130 | Ga0265331_100591301 | 366 |
| 711 | 3300031344 | Ga0265316_10136317 | Ga0265316_101363172 | 366 |
| 712 | 3300031507 | Ga0307509_10127238 | Ga0307509_101272382 | 366 |
| 713 | 3300031507 | Ga0307509_10183857 | Ga0307509_101838572 | 366 |
| 714 | 3300031595 | Ga0265313_10111789 | Ga0265313_101117891 | 366 |
| 715 | 3300031616 | Ga0307508_10000034 | Ga0307508_10000034126 | 366 |
| 716 | 3300031711 | Ga0265314_10069718 | Ga0265314_100697182 | 366 |
| 717 | 3300031712 | Ga0265342_10006824 | Ga0265342_100068244 | 366 |
| 718 | 3300031712 | Ga0265342_10009227 | Ga0265342_100092273 | 366 |
| 719 | 3300031730 | Ga0307516_10019297 | Ga0307516_100192972 | 366 |
| 720 | 3300031730 | Ga0307516_10054377 | Ga0307516_100543772 | 366 |
| 721 | 3300031730 | Ga0307516_10118891 | Ga0307516_101188911 | 366 |
| 722 | 3300031911 | Ga0307412_10163491 | Ga0307412_101634912 | 366 |
| 723 | 3300033180 | Ga0307510_10004348 | Ga0307510_100043488 | 366 |
| 724 | 3300033180 | Ga0307510_10036621 | Ga0307510_100366214 | 366 |
| 725 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010163 | 366 |
| 726 | 3300035083 | Ga0373926_0069513 | Ga0373926_0069513_115_1215 | 366 |
| 727 | 3300035086 | Ga0373934_0018964 | Ga0373934_0018964_667_1767 | 366 |
| 728 | 3300035111 | Ga0373923_0002407 | Ga0373923_0002407_3947_5047 | 366 |
| 729 | 3300035111 | Ga0373923_0069761 | Ga0373923_0069761_308_1408 | 366 |
| 730 | 3300035113 | Ga0373936_0006093 | Ga0373936_0006093_2301_3401 | 366 |
| 731 | 3300035113 | Ga0373936_0069904 | Ga0373936_0069904_134_1234 | 366 |
| 732 | 3300035116 | Ga0373945_0008267 | Ga0373945_0008267_1246_2346 | 366 |
| 733 | 3300035119 | Ga0373956_0054801 | Ga0373956_0054801_632_1732 | 366 |
| 734 | 3300035119 | Ga0373956_0097869 | Ga0373956_0097869_85_1185 | 366 |
| 735 | 3300035120 | Ga0373957_0001068 | Ga0373957_0001068_3473_4573 | 366 |
| 736 | 3300035120 | Ga0373957_0022511 | Ga0373957_0022511_821_1921 | 366 |
| 737 | 3300035170 | Ga0373943_0006580 | Ga0373943_0006580_3940_5040 | 366 |
| 738 | 3300035170 | Ga0373943_0007994 | Ga0373943_0007994_2979_4079 | 366 |
| 739 | 3300035171 | Ga0373946_0007122 | Ga0373946_0007122_2444_3544 | 366 |
| 740 | 3300035171 | Ga0373946_0029419 | Ga0373946_0029419_68_1168 | 366 |
| 741 | 3300035172 | Ga0373955_0000880 | Ga0373955_0000880_9351_10451 | 366 |
| 742 | 3300035172 | Ga0373955_0032414 | Ga0373955_0032414_1368_2468 | 366 |
| 743 | 3300035207 | Ga0373942_0030249 | Ga0373942_0030249_23_1135 | 366 |
| 744 | 3300035410 | Ga0373924_0002398 | Ga0373924_0002398_2356_3456 | 366 |
| 745 | 3300035410 | Ga0373924_0006697 | Ga0373924_0006697_1917_3017 | 366 |
| 746 | 3300035410 | Ga0373924_0017618 | Ga0373924_0017618_1500_2600 | 366 |
| 747 | 3300035691 | Ga0373931_0094054 | Ga0373931_0094054_114_1214 | 366 |
| 748 | 3300035692 | Ga0373935_0000259 | Ga0373935_0000259_13724_14824 | 366 |
| 749 | 3300035692 | Ga0373935_0074169 | Ga0373935_0074169_824_1924 | 366 |
| 750 | 3300035695 | Ga0373927_0002379 | Ga0373927_0002379_6996_8108 | 366 |
| 751 | 3300035695 | Ga0373927_0004958 | Ga0373927_0004958_679_1779 | 366 |
| 752 | 3300035695 | Ga0373927_0118562 | Ga0373927_0118562_329_1438 | 366 |
| 753 | 3300035724 | Ga0373933_0001150 | Ga0373933_0001150_12726_13826 | 366 |
| 754 | 3300035724 | Ga0373933_0002191 | Ga0373933_0002191_2075_3175 | 366 |
| 755 | 3300035724 | Ga0373933_0146828 | Ga0373933_0146828_157_1257 | 366 |
| 756 | 3300035725 | Ga0373947_0000217 | Ga0373947_0000217_11690_12790 | 366 |
| 757 | 3300035725 | Ga0373947_0010938 | Ga0373947_0010938_2200_3312 | 366 |
| 758 | 3300035725 | Ga0373947_0012207 | Ga0373947_0012207_2292_3392 | 366 |
| 759 | 3300035725 | Ga0373947_0013046 | Ga0373947_0013046_1681_2781 | 366 |
| 760 | 3300035725 | Ga0373947_0097834 | Ga0373947_0097834_235_1335 | 366 |
| 761 | 3300035725 | Ga0373947_0183242 | Ga0373947_0183242_202_1311 | 366 |
| 762 | 3300036401 | Ga0373937_0006578 | Ga0373937_0006578_7021_8121 | 366 |
| 763 | 3300036401 | Ga0373937_0012724 | Ga0373937_0012724_5942_7042 | 366 |
| 764 | 3300036401 | Ga0373937_0022213 | Ga0373937_0022213_4400_5500 | 366 |
| 765 | 3300037068 | Ga0373925_0004501 | Ga0373925_0004501_3745_4845 | 366 |
| 766 | 3300037068 | Ga0373925_0026107 | Ga0373925_0026107_1756_2856 | 366 |
| 767 | 3300037068 | Ga0373925_0041268 | Ga0373925_0041268_1208_2314 | 366 |
| 768 | 3300037068 | Ga0373925_0057981 | Ga0373925_0057981_178_1290 | 366 |
| 769 | 3300037068 | Ga0373925_0095574 | Ga0373925_0095574_203_1303 | 366 |
| 770 | 3300037418 | Ga0395900_0001924 | Ga0395900_0001924_8878_9978 | 366 |
| 771 | 3300037418 | Ga0395900_0323270 | Ga0395900_0323270_103_1203 | 366 |
| 772 | 3300037466 | Ga0395898_0020243 | Ga0395898_0020243_3286_4386 | 366 |
| 773 | 3300037466 | Ga0395898_0059500 | Ga0395898_0059500_874_1974 | 366 |
| 774 | 3300037466 | Ga0395898_0212975 | Ga0395898_0212975_586_1686 | 366 |
| 775 | 3300037471 | Ga0395905_0091606 | Ga0395905_0091606_1425_2525 | 366 |
| 776 | 3300037471 | Ga0395905_0092596 | Ga0395905_0092596_1423_2523 | 366 |
| 777 | 3300037853 | Ga0436364_0578778 | Ga0436364_0578778_3392_4495 | 366 |
| 778 | 3300038443 | Ga0395901_0268461 | Ga0395901_0268461_73_1194 | 366 |
| 779 | 3300038443 | Ga0395901_0411236 | Ga0395901_0411236_181_1281 | 366 |
| 780 | 3300039437 | Ga0436365_0425471 | Ga0436365_0425471_1098_2234 | 366 |
| 781 | 3300039437 | Ga0436365_0698518 | Ga0436365_0698518_156_1259 | 366 |
| 782 | 3300039437 | Ga0436365_1129324 | Ga0436365_1129324_763_1863 | 366 |
| 783 | 3300039438 | Ga0436360_0973324 | Ga0436360_0973324_56_1159 | 366 |
| 784 | 3300039447 | Ga0436361_1121961 | Ga0436361_1121961_187_1290 | 366 |
| 785 | 3300039447 | Ga0436361_1213962 | Ga0436361_1213962_123_1226 | 366 |
| 786 | 3300039450 | Ga0436363_0248819 | Ga0436363_0248819_848_1954 | 366 |
| 787 | 3300039450 | Ga0436363_1154387 | Ga0436363_1154387_85_1221 | 366 |
| 788 | 3300039453 | Ga0436362_0646134 | Ga0436362_0646134_5225_6325 | 366 |
| 789 | 3300044658 | Ga0466972_0000520 | Ga0466972_0000520_6189_7289 | 366 |
| 790 | 3300044658 | Ga0466972_0004454 | Ga0466972_0004454_1557_2657 | 366 |
| 791 | 3300044683 | Ga0466965_0085586 | Ga0466965_0085586_446_1546 | 366 |
| 792 | 3300044684 | Ga0466966_0035979 | Ga0466966_0035979_1492_2592 | 366 |
| 793 | 3300044693 | Ga0466961_0000149 | Ga0466961_0000149_46415_47515 | 366 |
| 794 | 3300044693 | Ga0466961_0070374 | Ga0466961_0070374_358_1458 | 366 |
| 795 | 3300044694 | Ga0466963_0073746 | Ga0466963_0073746_951_2051 | 366 |
| 796 | 3300044706 | Ga0466964_0088337 | Ga0466964_0088337_67_1167 | 366 |
| 797 | 3300044735 | Ga0466968_0029898 | Ga0466968_0029898_590_1690 | 366 |
| 798 | 3300044842 | Ga0466957_0017500 | Ga0466957_0017500_1486_2586 | 366 |
| 799 | 3300044901 | Ga0466960_0080589 | Ga0466960_0080589_59_1159 | 366 |
| 800 | 3300045049 | Ga0466959_0004087 | Ga0466959_0004087_4153_5253 | 366 |
| 801 | 3300045049 | Ga0466959_0156110 | Ga0466959_0156110_282_1382 | 366 |
| 802 | 3300045976 | Ga0466967_0034405 | Ga0466967_0034405_656_1756 | 366 |
| 803 | 3300045976 | Ga0466967_0040762 | Ga0466967_0040762_1645_2745 | 366 |
| 804 | 3300045976 | Ga0466967_0073074 | Ga0466967_0073074_20_1123 | 366 |
| 805 | 3300046454 | Ga0495592_0008207 | Ga0495592_0008207_4469_5569 | 366 |
| 806 | 3300046454 | Ga0495592_0020912 | Ga0495592_0020912_633_1733 | 366 |
| 807 | 3300046454 | Ga0495592_0029636 | Ga0495592_0029636_334_1434 | 366 |
| 808 | 3300046454 | Ga0495592_0037847 | Ga0495592_0037847_180_1283 | 366 |
| 809 | 3300046454 | Ga0495592_0114531 | Ga0495592_0114531_96_1196 | 366 |
| 810 | 3300046455 | Ga0495603_0000352 | Ga0495603_0000352_10159_11259 | 366 |
| 811 | 3300046455 | Ga0495603_0014404 | Ga0495603_0014404_701_1813 | 366 |
| 812 | 3300046455 | Ga0495603_0036212 | Ga0495603_0036212_760_1860 | 366 |
| 813 | 3300046457 | Ga0495590_0039148 | Ga0495590_0039148_244_1350 | 366 |
| 814 | 3300046459 | Ga0495629_0003719 | Ga0495629_0003719_8991_10091 | 366 |
| 815 | 3300046459 | Ga0495629_0051707 | Ga0495629_0051707_1373_2473 | 366 |
| 816 | 3300046459 | Ga0495629_0108425 | Ga0495629_0108425_529_1629 | 366 |
| 817 | 3300046460 | Ga0495638_0009309 | Ga0495638_0009309_1204_2355 | 366 |
| 818 | 3300046460 | Ga0495638_0014656 | Ga0495638_0014656_1252_2352 | 366 |
| 819 | 3300046460 | Ga0495638_0089820 | Ga0495638_0089820_80_1180 | 366 |
| 820 | 3300046461 | Ga0495641_0006337 | Ga0495641_0006337_2541_3641 | 366 |
| 821 | 3300046461 | Ga0495641_0044210 | Ga0495641_0044210_612_1712 | 366 |
| 822 | 3300046462 | Ga0495651_0003972 | Ga0495651_0003972_3074_4177 | 366 |
| 823 | 3300046462 | Ga0495651_0008150 | Ga0495651_0008150_130_1230 | 366 |
| 824 | 3300046462 | Ga0495651_0009605 | Ga0495651_0009605_4075_5175 | 366 |
| 825 | 3300046462 | Ga0495651_0028771 | Ga0495651_0028771_1712_2812 | 366 |
| 826 | 3300046463 | Ga0495653_0012753 | Ga0495653_0012753_5611_6711 | 366 |
| 827 | 3300046463 | Ga0495653_0025837 | Ga0495653_0025837_323_1426 | 366 |
| 828 | 3300046463 | Ga0495653_0039637 | Ga0495653_0039637_1352_2452 | 366 |
| 829 | 3300046463 | Ga0495653_0083742 | Ga0495653_0083742_785_1885 | 366 |
| 830 | 3300046471 | Ga0495650_0024728 | Ga0495650_0024728_697_1800 | 366 |
| 831 | 3300046472 | Ga0495580_0018652 | Ga0495580_0018652_1107_2207 | 366 |
| 832 | 3300046472 | Ga0495580_0059795 | Ga0495580_0059795_1511_2623 | 366 |
| 833 | 3300046472 | Ga0495580_0116513 | Ga0495580_0116513_551_1651 | 366 |
| 834 | 3300046473 | Ga0495582_0000245 | Ga0495582_0000245_25832_26932 | 366 |
| 835 | 3300046473 | Ga0495582_0035658 | Ga0495582_0035658_348_1448 | 366 |
| 836 | 3300046475 | Ga0495639_0020850 | Ga0495639_0020850_1067_2167 | 366 |
| 837 | 3300046476 | Ga0495662_0000872 | Ga0495662_0000872_9868_10968 | 366 |
| 838 | 3300046476 | Ga0495662_0075317 | Ga0495662_0075317_254_1357 | 366 |
| 839 | 3300046477 | Ga0495664_0004666 | Ga0495664_0004666_3162_4262 | 366 |
| 840 | 3300046477 | Ga0495664_0020886 | Ga0495664_0020886_1180_2280 | 366 |
| 841 | 3300046477 | Ga0495664_0027890 | Ga0495664_0027890_1316_2416 | 366 |
| 842 | 3300046477 | Ga0495664_0036188 | Ga0495664_0036188_235_1335 | 366 |
| 843 | 3300046499 | Ga0495594_0001300 | Ga0495594_0001300_10648_11748 | 366 |
| 844 | 3300046499 | Ga0495594_0038102 | Ga0495594_0038102_556_1668 | 366 |
| 845 | 3300046507 | Ga0495606_0015892 | Ga0495606_0015892_1505_2605 | 366 |
| 846 | 3300046507 | Ga0495606_0022638 | Ga0495606_0022638_1003_2133 | 366 |
| 847 | 3300046511 | Ga0495608_0041347 | Ga0495608_0041347_201_1301 | 366 |
| 848 | 3300046513 | Ga0495616_0032875 | Ga0495616_0032875_125_1225 | 366 |
| 849 | 3300046514 | Ga0495618_0009256 | Ga0495618_0009256_2600_3700 | 366 |
| 850 | 3300046514 | Ga0495618_0017563 | Ga0495618_0017563_713_1813 | 366 |
| 851 | 3300046514 | Ga0495618_0039877 | Ga0495618_0039877_140_1240 | 366 |
| 852 | 3300046515 | Ga0495620_0046480 | Ga0495620_0046480_559_1662 | 366 |
| 853 | 3300046516 | Ga0495628_0005097 | Ga0495628_0005097_5465_6565 | 366 |
| 854 | 3300046516 | Ga0495628_0040062 | Ga0495628_0040062_947_2047 | 366 |
| 855 | 3300046517 | Ga0495630_0009422 | Ga0495630_0009422_4775_5875 | 366 |
| 856 | 3300046517 | Ga0495630_0051936 | Ga0495630_0051936_575_1675 | 366 |
| 857 | 3300046517 | Ga0495630_0236611 | Ga0495630_0236611_154_1254 | 366 |
| 858 | 3300046519 | Ga0495632_0074302 | Ga0495632_0074302_159_1262 | 366 |
| 859 | 3300046522 | Ga0495643_0060904 | Ga0495643_0060904_411_1511 | 366 |
| 860 | 3300046523 | Ga0495644_0006757 | Ga0495644_0006757_3057_4187 | 366 |
| 861 | 3300046524 | Ga0495648_0001680 | Ga0495648_0001680_10550_11650 | 366 |
| 862 | 3300046524 | Ga0495648_0019543 | Ga0495648_0019543_3087_4187 | 366 |
| 863 | 3300046524 | Ga0495648_0058195 | Ga0495648_0058195_576_1727 | 366 |
| 864 | 3300046526 | Ga0495666_0003461 | Ga0495666_0003461_6341_7441 | 366 |
| 865 | 3300046529 | Ga0495652_0061223 | Ga0495652_0061223_701_1804 | 366 |
| 866 | 3300046529 | Ga0495652_0087350 | Ga0495652_0087350_835_1986 | 366 |
| 867 | 3300046529 | Ga0495652_0112503 | Ga0495652_0112503_365_1465 | 366 |
| 868 | 3300046529 | Ga0495652_0156871 | Ga0495652_0156871_599_1699 | 366 |
| 869 | 3300046529 | Ga0495652_0279926 | Ga0495652_0279926_104_1204 | 366 |
| 870 | 3300046531 | Ga0495665_0000361 | Ga0495665_0000361_2829_3929 | 366 |
| 871 | 3300046531 | Ga0495665_0168695 | Ga0495665_0168695_12_1112 | 366 |
| 872 | 3300046533 | Ga0495640_0003002 | Ga0495640_0003002_2828_3928 | 366 |
| 873 | 3300046533 | Ga0495640_0017400 | Ga0495640_0017400_1605_2705 | 366 |
| 874 | 3300046533 | Ga0495640_0022271 | Ga0495640_0022271_1100_2200 | 366 |
| 875 | 3300046536 | Ga0495587_0017008 | Ga0495587_0017008_1642_2742 | 366 |
| 876 | 3300046543 | Ga0495645_0001286 | Ga0495645_0001286_483_1583 | 366 |
| 877 | 3300046543 | Ga0495645_0020761 | Ga0495645_0020761_3489_4592 | 366 |
| 878 | 3300046543 | Ga0495645_0023607 | Ga0495645_0023607_1298_2404 | 366 |
| 879 | 3300046543 | Ga0495645_0083631 | Ga0495645_0083631_965_2065 | 366 |
| 880 | 3300046543 | Ga0495645_0203809 | Ga0495645_0203809_54_1154 | 366 |
| 881 | 3300046557 | Ga0495622_0006317 | Ga0495622_0006317_3399_4499 | 366 |
| 882 | 3300046558 | Ga0495633_0063543 | Ga0495633_0063543_162_1292 | 366 |
| 883 | 3300046559 | Ga0495667_0012248 | Ga0495667_0012248_2742_3842 | 366 |
| 884 | 3300046559 | Ga0495667_0033462 | Ga0495667_0033462_1397_2497 | 366 |
| 885 | 3300046559 | Ga0495667_0126311 | Ga0495667_0126311_440_1540 | 366 |
| 886 | 3300046615 | Ga0495656_0004410 | Ga0495656_0004410_3288_4418 | 366 |
| 887 | 3300046616 | Ga0495668_0091477 | Ga0495668_0091477_356_1456 | 366 |
| 888 | 3300046642 | Ga0495634_0000249 | Ga0495634_0000249_9463_10563 | 366 |
| 889 | 3300046642 | Ga0495634_0012218 | Ga0495634_0012218_4012_5112 | 366 |
| 890 | 3300046642 | Ga0495634_0022747 | Ga0495634_0022747_3230_4330 | 366 |
| 891 | 3300046642 | Ga0495634_0068360 | Ga0495634_0068360_947_2047 | 366 |
| 892 | 3300046642 | Ga0495634_0109805 | Ga0495634_0109805_577_1680 | 366 |
| 893 | 3300046660 | Ga0495625_0036379 | Ga0495625_0036379_1150_2250 | 366 |
| 894 | 3300046663 | Ga0495635_0000239 | Ga0495635_0000239_7122_8222 | 366 |
| 895 | 3300046663 | Ga0495635_0003846 | Ga0495635_0003846_6561_7661 | 366 |
| 896 | 3300046663 | Ga0495635_0014377 | Ga0495635_0014377_2781_3881 | 366 |
| 897 | 3300046663 | Ga0495635_0081350 | Ga0495635_0081350_293_1393 | 366 |
| 898 | 3300046663 | Ga0495635_0095584 | Ga0495635_0095584_52_1155 | 366 |
| 899 | 3300046665 | Ga0495661_0012048 | Ga0495661_0012048_1374_2474 | 366 |
| 900 | 3300046674 | Ga0495588_0069307 | Ga0495588_0069307_155_1255 | 366 |
| 901 | 3300046675 | Ga0495657_0003492 | Ga0495657_0003492_4689_5792 | 366 |
| 902 | 3300046675 | Ga0495657_0006927 | Ga0495657_0006927_2612_3712 | 366 |
| 903 | 3300046675 | Ga0495657_0026654 | Ga0495657_0026654_824_1924 | 366 |
| 904 | 3300046678 | Ga0495599_0001556 | Ga0495599_0001556_2850_3950 | 366 |
| 905 | 3300046678 | Ga0495599_0008411 | Ga0495599_0008411_2286_3386 | 366 |
| 906 | 3300046678 | Ga0495599_0016849 | Ga0495599_0016849_1361_2464 | 366 |
| 907 | 3300046679 | Ga0495623_0002296 | Ga0495623_0002296_5185_6288 | 366 |
| 908 | 3300046679 | Ga0495623_0009107 | Ga0495623_0009107_5211_6311 | 366 |
| 909 | 3300046679 | Ga0495623_0010478 | Ga0495623_0010478_2641_3741 | 366 |
| 910 | 3300046680 | Ga0495646_0001918 | Ga0495646_0001918_4977_6077 | 366 |
| 911 | 3300046680 | Ga0495646_0005453 | Ga0495646_0005453_4660_5760 | 366 |
| 912 | 3300046680 | Ga0495646_0011250 | Ga0495646_0011250_1399_2499 | 366 |
| 913 | 3300046680 | Ga0495646_0102031 | Ga0495646_0102031_523_1623 | 366 |
| 914 | 3300046681 | Ga0495647_0003088 | Ga0495647_0003088_2949_4049 | 366 |
| 915 | 3300046681 | Ga0495647_0022746 | Ga0495647_0022746_1042_2142 | 366 |
| 916 | 3300046681 | Ga0495647_0030086 | Ga0495647_0030086_798_1904 | 366 |
| 917 | 3300046683 | Ga0495658_0001058 | Ga0495658_0001058_8120_9220 | 366 |
| 918 | 3300046683 | Ga0495658_0019298 | Ga0495658_0019298_1543_2643 | 366 |
| 919 | 3300046683 | Ga0495658_0102410 | Ga0495658_0102410_301_1413 | 366 |
| 920 | 3300046689 | Ga0495613_0000929 | Ga0495613_0000929_13186_14286 | 366 |
| 921 | 3300046689 | Ga0495613_0067749 | Ga0495613_0067749_901_2001 | 366 |
| 922 | 3300046689 | Ga0495613_0255689 | Ga0495613_0255689_84_1187 | 366 |
| 923 | 3300046690 | Ga0495624_0000538 | Ga0495624_0000538_2017_3117 | 366 |
| 924 | 3300046690 | Ga0495624_0184045 | Ga0495624_0184045_68_1168 | 366 |
| 925 | 3300046691 | Ga0495670_0017939 | Ga0495670_0017939_1899_2999 | 366 |
| 926 | 3300046692 | Ga0495671_0055254 | Ga0495671_0055254_347_1450 | 366 |
| 927 | 3300046694 | Ga0495649_0085341 | Ga0495649_0085341_520_1623 | 366 |
| 928 | 3300046794 | Ga0495589_0069305 | Ga0495589_0069305_99_1202 | 366 |
| 929 | 3300046809 | Ga0495600_0002229 | Ga0495600_0002229_6065_7165 | 366 |
| 930 | 3300046809 | Ga0495600_0029557 | Ga0495600_0029557_2394_3497 | 366 |
| 931 | 3300047315 | Ga0495581_0001238 | Ga0495581_0001238_9828_10928 | 366 |
| 932 | 3300047315 | Ga0495581_0057166 | Ga0495581_0057166_939_2045 | 366 |
| 933 | 3300047317 | Ga0495604_0005469 | Ga0495604_0005469_4896_5999 | 366 |
| 934 | 3300047317 | Ga0495604_0074523 | Ga0495604_0074523_1385_2485 | 366 |
| 935 | 3300047317 | Ga0495604_0134829 | Ga0495604_0134829_114_1214 | 366 |
| 936 | 3300047317 | Ga0495604_0204143 | Ga0495604_0204143_62_1162 | 366 |
| 937 | 3300047319 | Ga0495674_0001854 | Ga0495674_0001854_9800_10900 | 366 |
| 938 | 3300047319 | Ga0495674_0020768 | Ga0495674_0020768_2914_4014 | 366 |
| 939 | 3300047319 | Ga0495674_0021792 | Ga0495674_0021792_1896_2996 | 366 |
| 940 | 3300047319 | Ga0495674_0113269 | Ga0495674_0113269_823_1923 | 366 |
| 941 | 3300047320 | Ga0495672_0062942 | Ga0495672_0062942_526_1638 | 366 |
| 942 | 3300047321 | Ga0495676_0027183 | Ga0495676_0027183_1371_2471 | 366 |
| 943 | 3300047322 | Ga0495680_0021114 | Ga0495680_0021114_2187_3287 | 366 |
| 944 | 3300047322 | Ga0495680_0024023 | Ga0495680_0024023_1174_2277 | 366 |
| 945 | 3300047322 | Ga0495680_0131314 | Ga0495680_0131314_256_1356 | 366 |
| 946 | 3300047443 | Ga0495687_043987 | Ga0495687_043987_25_1125 | 366 |
| 947 | 3300047444 | Ga0495675_0062117 | Ga0495675_0062117_966_2066 | 366 |
| 948 | 3300047469 | Ga0495673_0010245 | Ga0495673_0010245_1544_2644 | 366 |
| 949 | 3300047471 | Ga0495684_0000893 | Ga0495684_0000893_5488_6588 | 366 |
| 950 | 3300047471 | Ga0495684_0003057 | Ga0495684_0003057_10884_11984 | 366 |
| 951 | 3300047673 | Ga0495593_0000034 | Ga0495593_0000034_48283_49383 | 366 |
| 952 | 3300047673 | Ga0495593_0005088 | Ga0495593_0005088_803_1903 | 366 |
| 953 | 3300047673 | Ga0495593_0030123 | Ga0495593_0030123_1804_2904 | 366 |
| 954 | 3300048088 | Ga0495602_0025294 | Ga0495602_0025294_891_1994 | 366 |
| 955 | 3300048088 | Ga0495602_0045096 | Ga0495602_0045096_2805_3905 | 366 |
| 956 | 3300048089 | Ga0495614_0012106 | Ga0495614_0012106_2656_3756 | 366 |
| 957 | 3300048090 | Ga0495615_0022350 | Ga0495615_0022350_12_1112 | 366 |
| 958 | 3300048903 | Ga0496100_0024419 | Ga0496100_0024419_1201_2301 | 366 |
| 959 | 3300048903 | Ga0496100_0221778 | Ga0496100_0221778_39_1139 | 366 |
| 960 | 3300048904 | Ga0496101_0005889 | Ga0496101_0005889_4430_5530 | 366 |
| 961 | 3300048904 | Ga0496101_0022103 | Ga0496101_0022103_2406_3506 | 366 |
| 962 | 3300048904 | Ga0496101_0075060 | Ga0496101_0075060_67_1170 | 366 |
| 963 | 3300048904 | Ga0496101_0086002 | Ga0496101_0086002_402_1502 | 366 |
| 964 | 3300048905 | Ga0496102_0041716 | Ga0496102_0041716_2147_3247 | 366 |
| 965 | 3300048905 | Ga0496102_0085515 | Ga0496102_0085515_1332_2435 | 366 |
| 966 | 3300048905 | Ga0496102_0129517 | Ga0496102_0129517_1077_2177 | 366 |
| 967 | 3300048905 | Ga0496102_0169801 | Ga0496102_0169801_744_1844 | 366 |
| 968 | 3300048906 | Ga0496103_0148981 | Ga0496103_0148981_260_1360 | 366 |
| 969 | 3300048907 | Ga0496104_0044141 | Ga0496104_0044141_2014_3114 | 366 |
| 970 | 3300048907 | Ga0496104_0078027 | Ga0496104_0078027_1460_2560 | 366 |
| 971 | 3300048907 | Ga0496104_0085182 | Ga0496104_0085182_1724_2824 | 366 |
| 972 | 3300048907 | Ga0496104_0176933 | Ga0496104_0176933_32_1132 | 366 |
| 973 | 3300048907 | Ga0496104_0198086 | Ga0496104_0198086_245_1345 | 366 |
| 974 | 3300048908 | Ga0496105_0017518 | Ga0496105_0017518_1664_2764 | 366 |
| 975 | 3300048908 | Ga0496105_0082763 | Ga0496105_0082763_996_2102 | 366 |
| 976 | 3300048909 | Ga0496106_0000649 | Ga0496106_0000649_15416_16516 | 366 |
| 977 | 3300048909 | Ga0496106_0001165 | Ga0496106_0001165_15299_16399 | 366 |
| 978 | 3300048909 | Ga0496106_0281869 | Ga0496106_0281869_161_1261 | 366 |
| 979 | 3300048910 | Ga0496107_0025520 | Ga0496107_0025520_252_1352 | 366 |
| 980 | 3300048910 | Ga0496107_0028181 | Ga0496107_0028181_251_1351 | 366 |
| 981 | 3300048910 | Ga0496107_0043555 | Ga0496107_0043555_1114_2217 | 366 |
| 982 | 3300048910 | Ga0496107_0202412 | Ga0496107_0202412_306_1406 | 366 |
| 983 | 3300048911 | Ga0496108_0000744 | Ga0496108_0000744_23862_24962 | 366 |
| 984 | 3300048911 | Ga0496108_0247857 | Ga0496108_0247857_432_1532 | 366 |
| 985 | 3300048912 | Ga0496109_0001766 | Ga0496109_0001766_9012_10112 | 366 |
| 986 | 3300048912 | Ga0496109_0048359 | Ga0496109_0048359_628_1728 | 366 |
| 987 | 3300048912 | Ga0496109_0309442 | Ga0496109_0309442_141_1256 | 366 |
| 988 | 3300048913 | Ga0496110_0006833 | Ga0496110_0006833_6842_7942 | 366 |
| 989 | 3300048913 | Ga0496110_0018692 | Ga0496110_0018692_4608_5708 | 366 |
| 990 | 3300048913 | Ga0496110_0056020 | Ga0496110_0056020_1686_2789 | 366 |
| 991 | 3300048913 | Ga0496110_0085668 | Ga0496110_0085668_722_1822 | 366 |
| 992 | 3300048913 | Ga0496110_0112391 | Ga0496110_0112391_1156_2256 | 366 |
| 993 | 3300048914 | Ga0496111_0031499 | Ga0496111_0031499_140_1240 | 366 |
| 994 | 3300048914 | Ga0496111_0121446 | Ga0496111_0121446_198_1298 | 366 |
| 995 | 3300048914 | Ga0496111_0184210 | Ga0496111_0184210_238_1338 | 366 |
| 996 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_7364_8464 | 366 |
| 997 | 3300048915 | Ga0496112_0050851 | Ga0496112_0050851_2371_3474 | 366 |
| 998 | 3300048915 | Ga0496112_0181663 | Ga0496112_0181663_224_1324 | 366 |
| 999 | 3300048917 | Ga0496114_0098129 | Ga0496114_0098129_1215_2315 | 366 |
| 1000 | 3300048917 | Ga0496114_0174356 | Ga0496114_0174356_13_1113 | 366 |
| 1001 | 3300048917 | Ga0496114_0259154 | Ga0496114_0259154_335_1435 | 366 |
| 1002 | 3300048918 | Ga0496115_0007272 | Ga0496115_0007272_6751_7851 | 366 |
| 1003 | 3300048918 | Ga0496115_0015832 | Ga0496115_0015832_2691_3791 | 366 |
| 1004 | 3300048918 | Ga0496115_0117402 | Ga0496115_0117402_74_1174 | 366 |
| 1005 | 3300048918 | Ga0496115_0140716 | Ga0496115_0140716_617_1723 | 366 |
| 1006 | 3300048919 | Ga0496116_0007242 | Ga0496116_0007242_5157_6257 | 366 |
| 1007 | 3300048920 | Ga0496117_0021643 | Ga0496117_0021643_2953_4053 | 366 |
| 1008 | 3300048920 | Ga0496117_0153317 | Ga0496117_0153317_219_1319 | 366 |
| 1009 | 3300048921 | Ga0496118_0013219 | Ga0496118_0013219_6688_7788 | 366 |
| 1010 | 3300048921 | Ga0496118_0051899 | Ga0496118_0051899_1373_2473 | 366 |
| 1011 | 3300048921 | Ga0496118_0071624 | Ga0496118_0071624_747_1847 | 366 |
| 1012 | 3300048922 | Ga0496119_0053236 | Ga0496119_0053236_352_1452 | 366 |
| 1013 | 3300048922 | Ga0496119_0068363 | Ga0496119_0068363_868_1968 | 366 |
| 1014 | 3300048922 | Ga0496119_0068812 | Ga0496119_0068812_293_1393 | 366 |
| 1015 | 3300048922 | Ga0496119_0076546 | Ga0496119_0076546_110_1213 | 366 |
| 1016 | 3300048923 | Ga0496120_0103874 | Ga0496120_0103874_329_1429 | 366 |
| 1017 | 3300048924 | Ga0496121_0000476 | Ga0496121_0000476_64765_65865 | 366 |
| 1018 | 3300048924 | Ga0496121_0001497 | Ga0496121_0001497_26858_27958 | 366 |
| 1019 | 3300048924 | Ga0496121_0001742 | Ga0496121_0001742_11168_12268 | 366 |
| 1020 | 3300048924 | Ga0496121_0003089 | Ga0496121_0003089_13530_14633 | 366 |
| 1021 | 3300048924 | Ga0496121_0017380 | Ga0496121_0017380_6082_7185 | 366 |
| 1022 | 3300048924 | Ga0496121_0025084 | Ga0496121_0025084_280_1380 | 366 |
| 1023 | 3300048924 | Ga0496121_0049287 | Ga0496121_0049287_617_1717 | 366 |
| 1024 | 3300048924 | Ga0496121_0053890 | Ga0496121_0053890_1376_2476 | 366 |
| 1025 | 3300048924 | Ga0496121_0099916 | Ga0496121_0099916_859_1959 | 366 |
| 1026 | 3300048925 | Ga0496122_0055284 | Ga0496122_0055284_706_1806 | 366 |
| 1027 | 3300048925 | Ga0496122_0060464 | Ga0496122_0060464_420_1535 | 366 |
| 1028 | 3300048925 | Ga0496122_0089939 | Ga0496122_0089939_545_1645 | 366 |
| 1029 | 3300048926 | Ga0496123_0090680 | Ga0496123_0090680_641_1741 | 366 |
| 1030 | 3300048926 | Ga0496123_0096202 | Ga0496123_0096202_23_1123 | 366 |
| 1031 | 3300048927 | Ga0496124_0001128 | Ga0496124_0001128_33871_34971 | 366 |
| 1032 | 3300048927 | Ga0496124_0153432 | Ga0496124_0153432_617_1720 | 366 |
| 1033 | 3300048927 | Ga0496124_0165776 | Ga0496124_0165776_141_1241 | 366 |
| 1034 | 3300048927 | Ga0496124_0173653 | Ga0496124_0173653_36_1136 | 366 |
| 1035 | 3300048928 | Ga0496125_0000154 | Ga0496125_0000154_45861_46976 | 366 |
| 1036 | 3300048928 | Ga0496125_0015007 | Ga0496125_0015007_2084_3184 | 366 |
| 1037 | 3300048928 | Ga0496125_0044841 | Ga0496125_0044841_718_1821 | 366 |
| 1038 | 3300048928 | Ga0496125_0153920 | Ga0496125_0153920_77_1177 | 366 |
| 1039 | 3300048929 | Ga0496126_0002744 | Ga0496126_0002744_17314_18414 | 366 |
| 1040 | 3300048929 | Ga0496126_0006113 | Ga0496126_0006113_1215_2315 | 366 |
| 1041 | 3300048929 | Ga0496126_0009402 | Ga0496126_0009402_4936_6036 | 366 |
| 1042 | 3300048929 | Ga0496126_0015910 | Ga0496126_0015910_1510_2610 | 366 |
| 1043 | 3300048929 | Ga0496126_0020832 | Ga0496126_0020832_737_1837 | 366 |
| 1044 | 3300048929 | Ga0496126_0032430 | Ga0496126_0032430_617_1717 | 366 |
| 1045 | 3300048929 | Ga0496126_0053931 | Ga0496126_0053931_1704_2807 | 366 |
| 1046 | 3300048929 | Ga0496126_0079933 | Ga0496126_0079933_944_2044 | 366 |
| 1047 | 3300048929 | Ga0496126_0089718 | Ga0496126_0089718_576_1676 | 366 |
| 1048 | 3300048929 | Ga0496126_0094162 | Ga0496126_0094162_1357_2457 | 366 |
| 1049 | 3300048929 | Ga0496126_0191581 | Ga0496126_0191581_511_1689 | 366 |
| 1050 | 3300048929 | Ga0496126_0202508 | Ga0496126_0202508_113_1213 | 366 |
| 1051 | 3300048929 | Ga0496126_0319939 | Ga0496126_0319939_18_1118 | 366 |
| 1052 | 3300049568 | Ga0501031_0012949 | Ga0501031_0012949_3760_4872 | 366 |
| 1053 | 3300049568 | Ga0501031_0064009 | Ga0501031_0064009_877_1989 | 366 |
| 1054 | 3300049569 | Ga0501032_0003534 | Ga0501032_0003534_6514_7626 | 366 |
| 1055 | 3300049569 | Ga0501032_0012670 | Ga0501032_0012670_508_1611 | 366 |
| 1056 | 3300049569 | Ga0501032_0020626 | Ga0501032_0020626_3060_4166 | 366 |
| 1057 | 3300049569 | Ga0501032_0082398 | Ga0501032_0082398_707_1858 | 366 |
| 1058 | 3300049570 | Ga0501033_0000249 | Ga0501033_0000249_28242_29354 | 366 |
| 1059 | 3300049570 | Ga0501033_0000951 | Ga0501033_0000951_22391_23503 | 366 |
| 1060 | 3300049571 | Ga0501034_0001938 | Ga0501034_0001938_8193_9305 | 366 |
| 1061 | 3300049571 | Ga0501034_0136806 | Ga0501034_0136806_157_1260 | 366 |
| 1062 | 3300049571 | Ga0501034_0183501 | Ga0501034_0183501_83_1186 | 366 |
| 1063 | 3300049571 | Ga0501034_0290404 | Ga0501034_0290404_252_1355 | 366 |
| 1064 | 3300049571 | Ga0501034_0348538 | Ga0501034_0348538_26_1186 | 366 |
| 1065 | 3300049572 | Ga0501036_0004433 | Ga0501036_0004433_8109_9221 | 366 |
| 1066 | 3300049572 | Ga0501036_0026547 | Ga0501036_0026547_34_1137 | 366 |
| 1067 | 3300049572 | Ga0501036_0050620 | Ga0501036_0050620_1148_2311 | 366 |
| 1068 | 3300049572 | Ga0501036_0095024 | Ga0501036_0095024_927_2087 | 366 |
| 1069 | 3300049573 | Ga0501037_0000112 | Ga0501037_0000112_29705_30817 | 366 |
| 1070 | 3300049573 | Ga0501037_0067387 | Ga0501037_0067387_1322_2425 | 366 |
| 1071 | 3300049573 | Ga0501037_0130451 | Ga0501037_0130451_283_1443 | 366 |
| 1072 | 3300049574 | Ga0501038_0000160 | Ga0501038_0000160_42932_44044 | 366 |
| 1073 | 3300049574 | Ga0501038_0002206 | Ga0501038_0002206_1853_3004 | 366 |
| 1074 | 3300049574 | Ga0501038_0036532 | Ga0501038_0036532_2652_3758 | 366 |
| 1075 | 3300049574 | Ga0501038_0145474 | Ga0501038_0145474_578_1741 | 366 |
| 1076 | 3300049574 | Ga0501038_0168699 | Ga0501038_0168699_96_1208 | 366 |
| 1077 | 3300049574 | Ga0501038_0341018 | Ga0501038_0341018_32_1138 | 366 |
| 1078 | 3300049575 | Ga0501039_0000472 | Ga0501039_0000472_27618_28721 | 366 |
| 1079 | 3300049575 | Ga0501039_0001057 | Ga0501039_0001057_298_1410 | 366 |
| 1080 | 3300049575 | Ga0501039_0017068 | Ga0501039_0017068_23_1135 | 366 |
| 1081 | 3300049575 | Ga0501039_0142515 | Ga0501039_0142515_709_1812 | 366 |
| 1082 | 3300049578 | Ga0501042_0015592 | Ga0501042_0015592_2404_3564 | 366 |
| 1083 | 3300049578 | Ga0501042_0071253 | Ga0501042_0071253_254_1366 | 366 |
| 1084 | 3300049579 | Ga0501043_0000278 | Ga0501043_0000278_26089_27201 | 366 |
| 1085 | 3300049579 | Ga0501043_0008635 | Ga0501043_0008635_1106_2257 | 366 |
| 1086 | 3300049579 | Ga0501043_0022578 | Ga0501043_0022578_391_1497 | 366 |
| 1087 | 3300049579 | Ga0501043_0073668 | Ga0501043_0073668_965_2128 | 366 |
| 1088 | 3300049579 | Ga0501043_0096156 | Ga0501043_0096156_855_1958 | 366 |
| 1089 | 3300049579 | Ga0501043_0150931 | Ga0501043_0150931_106_1218 | 366 |
| 1090 | 3300049580 | Ga0501046_0000937 | Ga0501046_0000937_1597_2709 | 366 |
| 1091 | 3300049580 | Ga0501046_0008812 | Ga0501046_0008812_3192_4298 | 366 |
| 1092 | 3300049580 | Ga0501046_0012556 | Ga0501046_0012556_3802_4905 | 366 |
| 1093 | 3300049580 | Ga0501046_0021462 | Ga0501046_0021462_115_1227 | 366 |
| 1094 | 3300049580 | Ga0501046_0065853 | Ga0501046_0065853_1574_2737 | 366 |
| 1095 | 3300049581 | Ga0501047_0000275 | Ga0501047_0000275_36699_37811 | 366 |
| 1096 | 3300049581 | Ga0501047_0009938 | Ga0501047_0009938_3189_4295 | 366 |
| 1097 | 3300049581 | Ga0501047_0089000 | Ga0501047_0089000_255_1406 | 366 |
| 1098 | 3300049581 | Ga0501047_0122575 | Ga0501047_0122575_740_1903 | 366 |
| 1099 | 3300049581 | Ga0501047_0336852 | Ga0501047_0336852_85_1185 | 366 |
| 1100 | 3300049582 | Ga0501048_0001248 | Ga0501048_0001248_4196_5308 | 366 |
| 1101 | 3300049582 | Ga0501048_0011414 | Ga0501048_0011414_2726_3829 | 366 |
| 1102 | 3300049582 | Ga0501048_0022723 | Ga0501048_0022723_2269_3429 | 366 |
| 1103 | 3300049582 | Ga0501048_0036570 | Ga0501048_0036570_2318_3424 | 366 |
| 1104 | 3300049583 | Ga0501067_0000258 | Ga0501067_0000258_13692_14804 | 366 |
| 1105 | 3300049583 | Ga0501067_0013462 | Ga0501067_0013462_2844_3947 | 366 |
| 1106 | 3300049583 | Ga0501067_0084036 | Ga0501067_0084036_250_1350 | 366 |
| 1107 | 3300049584 | Ga0501068_0004146 | Ga0501068_0004146_1819_2931 | 366 |
| 1108 | 3300049584 | Ga0501068_0015819 | Ga0501068_0015819_2830_3990 | 366 |
| 1109 | 3300049584 | Ga0501068_0026245 | Ga0501068_0026245_1562_2665 | 366 |
| 1110 | 3300049584 | Ga0501068_0064658 | Ga0501068_0064658_99_1262 | 366 |
| 1111 | 3300049584 | Ga0501068_0140272 | Ga0501068_0140272_169_1281 | 366 |
| 1112 | 3300049585 | Ga0501069_0013808 | Ga0501069_0013808_296_1408 | 366 |
| 1113 | 3300049586 | Ga0501070_0002548 | Ga0501070_0002548_4167_5279 | 366 |
| 1114 | 3300049586 | Ga0501070_0006200 | Ga0501070_0006200_3354_4517 | 366 |
| 1115 | 3300049586 | Ga0501070_0020554 | Ga0501070_0020554_2445_3548 | 366 |
| 1116 | 3300049586 | Ga0501070_0068502 | Ga0501070_0068502_1035_2195 | 366 |
| 1117 | 3300049587 | Ga0501071_0196477 | Ga0501071_0196477_199_1302 | 366 |
| 1118 | 3300049588 | Ga0501072_0003198 | Ga0501072_0003198_1333_2445 | 366 |
| 1119 | 3300049589 | Ga0501073_0000103 | Ga0501073_0000103_17113_18225 | 366 |
| 1120 | 3300049589 | Ga0501073_0038356 | Ga0501073_0038356_1493_2656 | 366 |
| 1121 | 3300049589 | Ga0501073_0096064 | Ga0501073_0096064_594_1697 | 366 |
| 1122 | 3300049590 | Ga0501074_0000456 | Ga0501074_0000456_19879_20991 | 366 |
| 1123 | 3300049590 | Ga0501074_0067246 | Ga0501074_0067246_737_1900 | 366 |
| 1124 | 3300049590 | Ga0501074_0085067 | Ga0501074_0085067_432_1592 | 366 |
| 1125 | 3300049592 | Ga0501076_0063997 | Ga0501076_0063997_497_1657 | 366 |
| 1126 | 3300049593 | Ga0501077_0104803 | Ga0501077_0104803_294_1454 | 366 |
| 1127 | 3300049741 | Ga0501079_0000451 | Ga0501079_0000451_11606_12718 | 366 |
| 1128 | 3300049741 | Ga0501079_0010445 | Ga0501079_0010445_2543_3706 | 366 |
| 1129 | 3300049742 | Ga0501080_0000082 | Ga0501080_0000082_3679_4782 | 366 |
| 1130 | 3300049742 | Ga0501080_0002998 | Ga0501080_0002998_7863_8975 | 366 |
| 1131 | 3300049742 | Ga0501080_0016338 | Ga0501080_0016338_3305_4408 | 366 |
| 1132 | 3300049742 | Ga0501080_0071776 | Ga0501080_0071776_1386_2546 | 366 |
| 1133 | 3300049742 | Ga0501080_0082435 | Ga0501080_0082435_1295_2458 | 366 |
| 1134 | 3300049744 | Ga0501083_0009193 | Ga0501083_0009193_4167_5279 | 366 |
| 1135 | 3300049744 | Ga0501083_0058731 | Ga0501083_0058731_965_2128 | 366 |
| 1136 | 3300049822 | Ga0501035_0000766 | Ga0501035_0000766_17113_18225 | 366 |
| 1137 | 3300049822 | Ga0501035_0011386 | Ga0501035_0011386_931_2037 | 366 |
| 1138 | 3300049822 | Ga0501035_0018251 | Ga0501035_0018251_2916_4019 | 366 |
| 1139 | 3300049822 | Ga0501035_0045134 | Ga0501035_0045134_1785_2897 | 366 |
| 1140 | 3300049822 | Ga0501035_0078488 | Ga0501035_0078488_199_1305 | 366 |
| 1141 | 3300049822 | Ga0501035_0124942 | Ga0501035_0124942_1035_2198 | 366 |
| 1142 | 3300049822 | Ga0501035_0159477 | Ga0501035_0159477_548_1708 | 366 |
| 1143 | 3300049823 | Ga0501044_0000418 | Ga0501044_0000418_43245_44357 | 366 |
| 1144 | 3300049823 | Ga0501044_0024381 | Ga0501044_0024381_283_1434 | 366 |
| 1145 | 3300049823 | Ga0501044_0034063 | Ga0501044_0034063_490_1593 | 366 |
| 1146 | 3300049823 | Ga0501044_0078546 | Ga0501044_0078546_883_1983 | 366 |
| 1147 | 3300049823 | Ga0501044_0196236 | Ga0501044_0196236_793_1953 | 366 |
| 1148 | 3300049823 | Ga0501044_0218611 | Ga0501044_0218611_645_1808 | 366 |
| 1149 | 3300049823 | Ga0501044_0272344 | Ga0501044_0272344_300_1412 | 366 |
| 1150 | 3300049823 | Ga0501044_0325483 | Ga0501044_0325483_282_1382 | 366 |
| 1151 | 3300049824 | Ga0501045_0038807 | Ga0501045_0038807_1321_2481 | 366 |
| 1152 | 3300049824 | Ga0501045_0077486 | Ga0501045_0077486_721_1833 | 366 |
| 1153 | 3300050492 | nmdc:mga0yw44_1397_c1 | nmdc:mga0yw44_1397_c1_3820_4923 | 366 |
| 1154 | 3300050492 | nmdc:mga0yw44_17247_c1 | nmdc:mga0yw44_17247_c1_478_1578 | 366 |
| 1155 | 3300050492 | nmdc:mga0yw44_94319_c1 | nmdc:mga0yw44_94319_c1_484_1584 | 366 |
| 1156 | 3300050494 | nmdc:mga06z11_31082_c1 | nmdc:mga06z11_31082_c1_641_1741 | 366 |
| 1157 | 3300050511 | nmdc:mga08y16_196743_c1 | nmdc:mga08y16_196743_c1_879_1982 | 366 |
| 1158 | 3300050512 | nmdc:mga0n895_80110_c1 | nmdc:mga0n895_80110_c1_1997_3103 | 366 |
| 1159 | 3300050514 | nmdc:mga08x19_192730_c1 | nmdc:mga08x19_192730_c1_128_1228 | 366 |
| 1160 | 3300050514 | nmdc:mga08x19_24160_c1 | nmdc:mga08x19_24160_c1_1602_2702 | 366 |
| 1161 | 3300050515 | nmdc:mga0a205_311035_c1 | nmdc:mga0a205_311035_c1_303_1406 | 366 |
| 1162 | 3300050515 | nmdc:mga0a205_3227_c1 | nmdc:mga0a205_3227_c1_9186_10292 | 366 |
| 1163 | 3300050516 | nmdc:mga0sz30_22811_c2 | nmdc:mga0sz30_22811_c2_391_1491 | 366 |
| 1164 | 3300053077 | Ga0495601_0009529 | Ga0495601_0009529_3566_4666 | 366 |
| 1165 | 3300053077 | Ga0495601_0037183 | Ga0495601_0037183_1425_2525 | 366 |
| 1166 | 3300053077 | Ga0495601_0083052 | Ga0495601_0083052_766_1866 | 366 |
| 1167 | 3300053077 | Ga0495601_0220392 | Ga0495601_0220392_41_1141 | 366 |
| 1168 | 3300053078 | Ga0495612_0046196 | Ga0495612_0046196_529_1635 | 366 |
| 1169 | 3300053085 | Ga0495619_0077914 | Ga0495619_0077914_574_1674 | 366 |
| 1170 | 3300053087 | Ga0500643_000267 | Ga0500643_000267_12579_13679 | 366 |
| 1171 | 3300053087 | Ga0500643_018509 | Ga0500643_018509_127_1227 | 366 |
| 1172 | 3300053089 | Ga0500581_085026 | Ga0500581_085026_164_1264 | 366 |
| 1173 | 3300053092 | Ga0500583_0086589 | Ga0500583_0086589_73_1173 | 366 |
| 1174 | 3300053093 | Ga0500651_0000861 | Ga0500651_0000861_11924_13027 | 366 |
| 1175 | 3300053094 | Ga0500566_0000157 | Ga0500566_0000157_7558_8658 | 366 |
| 1176 | 3300053094 | Ga0500566_0001146 | Ga0500566_0001146_6657_7757 | 366 |
| 1177 | 3300053096 | Ga0500641_0058981 | Ga0500641_0058981_174_1274 | 366 |
| 1178 | 3300053098 | Ga0500650_0001493 | Ga0500650_0001493_1241_2341 | 366 |
| 1179 | 3300053102 | Ga0500554_000718 | Ga0500554_000718_2176_3285 | 366 |
| 1180 | 3300053102 | Ga0500554_003128 | Ga0500554_003128_1780_2880 | 366 |
| 1181 | 3300053103 | Ga0500555_002718 | Ga0500555_002718_2493_3593 | 366 |
| 1182 | 3300053104 | Ga0500556_0000413 | Ga0500556_0000413_5063_6163 | 366 |
| 1183 | 3300053105 | Ga0500557_000041 | Ga0500557_000041_39908_41008 | 366 |
| 1184 | 3300053109 | Ga0500569_001799 | Ga0500569_001799_2373_3473 | 366 |
| 1185 | 3300053116 | Ga0500592_004170 | Ga0500592_004170_309_1409 | 366 |
| 1186 | 3300053118 | Ga0500594_0030081 | Ga0500594_0030081_97_1197 | 366 |
| 1187 | 3300053119 | Ga0500595_003818 | Ga0500595_003818_5145_6245 | 366 |
| 1188 | 3300053119 | Ga0500595_006228 | Ga0500595_006228_3331_4431 | 366 |
| 1189 | 3300053122 | Ga0500608_004754 | Ga0500608_004754_1837_2937 | 366 |
| 1190 | 3300053128 | Ga0500626_057934 | Ga0500626_057934_505_1605 | 366 |
| 1191 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_25015_26115 | 366 |
| 1192 | 3300053131 | Ga0500652_000531 | Ga0500652_000531_7915_9015 | 366 |
| 1193 | 3300053134 | Ga0500658_0011515 | Ga0500658_0011515_486_1589 | 366 |
| 1194 | 3300053134 | Ga0500658_0013696 | Ga0500658_0013696_1677_2777 | 366 |
| 1195 | 3300053134 | Ga0500658_0044143 | Ga0500658_0044143_241_1341 | 366 |
| 1196 | 3300053134 | Ga0500658_0081505 | Ga0500658_0081505_11_1111 | 366 |
| 1197 | 3300053136 | Ga0500559_0003580 | Ga0500559_0003580_5960_7060 | 366 |
| 1198 | 3300053136 | Ga0500559_0018273 | Ga0500559_0018273_766_1869 | 366 |
| 1199 | 3300053139 | Ga0500568_0002109 | Ga0500568_0002109_9583_10683 | 366 |
| 1200 | 3300053139 | Ga0500568_0011586 | Ga0500568_0011586_2563_3666 | 366 |
| 1201 | 3300053139 | Ga0500568_0028346 | Ga0500568_0028346_700_1800 | 366 |
| 1202 | 3300053142 | Ga0500577_0000693 | Ga0500577_0000693_2698_3798 | 366 |
| 1203 | 3300053150 | Ga0500603_000277 | Ga0500603_000277_7460_8569 | 366 |
| 1204 | 3300053151 | Ga0500604_0003539 | Ga0500604_0003539_1666_2766 | 366 |
| 1205 | 3300053153 | Ga0500616_0000166 | Ga0500616_0000166_81387_82487 | 366 |
| 1206 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_79916_81016 | 366 |
| 1207 | 3300053153 | Ga0500616_0028432 | Ga0500616_0028432_494_1645 | 366 |
| 1208 | 3300053156 | Ga0500622_0011079 | Ga0500622_0011079_2573_3673 | 366 |
| 1209 | 3300053156 | Ga0500622_0029561 | Ga0500622_0029561_1537_2688 | 366 |
| 1210 | 3300053157 | Ga0500624_002833 | Ga0500624_002833_630_1730 | 366 |
| 1211 | 3300053161 | Ga0500634_0031081 | Ga0500634_0031081_12_1112 | 366 |
| 1212 | 3300053162 | Ga0500638_001014 | Ga0500638_001014_1489_2589 | 366 |
| 1213 | 3300053163 | Ga0500639_033548 | Ga0500639_033548_94_1197 | 366 |
| 1214 | 3300053177 | Ga0500636_0001916 | Ga0500636_0001916_4452_5552 | 366 |
| 1215 | 3300053177 | Ga0500636_0011628 | Ga0500636_0011628_2092_3192 | 366 |
| 1216 | 3300053178 | Ga0500637_0000121 | Ga0500637_0000121_18687_19787 | 366 |
| 1217 | 3300053178 | Ga0500637_0002840 | Ga0500637_0002840_4673_5782 | 366 |
| 1218 | 3300053178 | Ga0500637_0103898 | Ga0500637_0103898_146_1246 | 366 |
| 1219 | 3300053729 | Ga0500625_003212 | Ga0500625_003212_2150_3250 | 366 |
| 1220 | 3300053731 | Ga0500609_004134 | Ga0500609_004134_68_1168 | 366 |
| 1221 | 3300053735 | Ga0500596_000810 | Ga0500596_000810_4738_5841 | 366 |
| 1222 | 3300053737 | Ga0500601_000076 | Ga0500601_000076_18875_19975 | 366 |
| 1223 | 3300054114 | Ga0501084_0003972 | Ga0501084_0003972_7042_8154 | 366 |
| 1224 | 3300054114 | Ga0501084_0222438 | Ga0501084_0222438_169_1272 | 366 |
| 1225 | 3300055283 | Ga0500661_000452 | Ga0500661_000452_6325_7425 | 366 |
| 1226 | 3300060353 | Ga0501082_0011183 | Ga0501082_0011183_2352_3464 | 366 |
| 1227 | iso_pu_bacteria | 2643221651 | 2644287346 | 366 |
| 1228 | iso_pu_bacteria | 2904690495 | 2904697727 | 366 |
| 1229 | iso_pu_bacteria | 8016603502 | 8016604083 | 366 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.8981 | 6 | 363 |
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.8904 | 6 | 363 |
| 8dp7-assembly1.cif.gz_A | structure of helicobacter pylori egtu bound to egt | 0.8668 | 7 | 39 |
| 7d1i-assembly1.cif.gz_B-2 | crystal structure of acinetobacter baumannii murg | 0.8416 | 4 | 362 |
| 7d1i-assembly1.cif.gz_B-2 | crystal structure of acinetobacter baumannii murg | 0.8346 | 4 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYL5_1_178_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9013 | 5 | 169 | 3.40.50.2000 |
| af_K7L509_198_322_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8951 | 222 | 346 | 3.40.50.2000 |
| 3s2uA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8789 | 167 | 348 | 3.40.50.2000 |
| 3s2uA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8763 | 6 | 166 | 3.40.50.2000 |
| af_K7KRG7_37_209_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8761 | 6 | 171 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436LCT7-F1-model_v4 | deleted | 0.9837 | 161 | 365 |
|
| AF-A0A060BN88-F1-model_v4 | Glyco_tran_28_C | 0.98 | 176 | 307 |
GO:0050511
|
| AF-A0A519JEV0-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9736 | 220 | 362 |
GO:0050511
|
| AF-A0A435JI80-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9714 | 183 | 365 |
GO:0050511
|
| AF-A5EPK4-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) | 0.9713 | 3 | 366 |
GO:0005886
GO:0005975 GO:0008360 GO:0009252 GO:0030259 GO:0050511 GO:0051301 GO:0051991 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar