F491914

General Info

Members Datasets Scaffolds Average Seq Length
1225 352 2450 158

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10043071|Ga0207659_100430714
Length 181
Sequence LGETPGTTLQRPMIDLRYVKKLIEIIDESTVDSIEITSDKGMKIRISKSPQQRGAVQVAAPIPIPAIIPGGAAPRVSPPQGMQMIAEGEAPAAAPEPPKATTVDIKSPMVGTFYKSPEPSAKAYVAVGDRVSKGQIVCIIEAMKIMNEIESDHSGVIREILAQDAQPVEYGQVLFKLDPNG

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
240 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
328 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
329 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
330 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
331 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
332 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 98.12
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10043071 3300025926 Bacteria 3168
2 JGI24746J21847_1007663 3300001977 Bacteria 1644
3 JGI24738J21930_10060531 3300002075 Bacteria 777
4 Ga0065704_10091146 3300005289 Bacteria 2737
5 Ga0065712_10162544 3300005290 Bacteria 1292
6 Ga0065715_10120853 3300005293 Bacteria 2243
7 Ga0065707_10085983 3300005295 Bacteria 5745
8 Ga0065707_10100397 3300005295 Bacteria 2934
9 Ga0070658_10027902 3300005327 Bacteria 4531
10 Ga0070658_10184036 3300005327 Bacteria 1759
11 Ga0070658_10248408 3300005327 Bacteria 1509
12 Ga0070658_10485306 3300005327 Bacteria 1067
13 Ga0070658_10578041 3300005327 Bacteria 973
14 Ga0070676_10000129 3300005328 Bacteria 28439
15 Ga0070676_10123050 3300005328 Bacteria 1631
16 Ga0070676_10216867 3300005328 Bacteria 1262
17 Ga0070683_100000272 3300005329 Bacteria 35458
18 Ga0070683_100007464 3300005329 Bacteria 9238
19 Ga0070683_100026903 3300005329 Bacteria 5184
20 Ga0070683_100035492 3300005329 Bacteria 4558
21 Ga0070683_100056471 3300005329 Bacteria 3646
22 Ga0070683_100062372 3300005329 Bacteria 3466
23 Ga0070683_100096817 3300005329 Bacteria 2776
24 Ga0070683_100097260 3300005329 Bacteria 2769
25 Ga0070683_100122534 3300005329 Bacteria 2457
26 Ga0070683_100151322 3300005329 Bacteria 2200
27 Ga0070683_100276081 3300005329 Bacteria 1599
28 Ga0070683_100280596 3300005329 Bacteria 1585
29 Ga0070683_100423518 3300005329 Bacteria 1270
30 Ga0070683_100458912 3300005329 Bacteria 1216
31 Ga0070683_100508692 3300005329 Bacteria 1151
32 Ga0070690_100030647 3300005330 Bacteria 3344
33 Ga0070690_100047103 3300005330 Bacteria 2742
34 Ga0070690_100130240 3300005330 Bacteria 1698
35 Ga0070690_100510046 3300005330 Bacteria 901
36 Ga0070690_100630247 3300005330 Bacteria 817
37 Ga0070670_100005164 3300005331 Bacteria 10989
38 Ga0070670_100011537 3300005331 Bacteria 7557
39 Ga0070670_100018847 3300005331 Bacteria 5918
40 Ga0070670_100121525 3300005331 Bacteria 2253
41 Ga0070677_10038443 3300005333 Bacteria 1873
42 Ga0070677_10063750 3300005333 Bacteria 1529
43 Ga0068869_100006238 3300005334 Bacteria 7549
44 Ga0068869_100058058 3300005334 Bacteria 2828
45 Ga0068869_100219393 3300005334 Bacteria 1507
46 Ga0068869_100301014 3300005334 Bacteria 1295
47 Ga0068869_101312127 3300005334 Bacteria 639
48 Ga0070666_10038190 3300005335 Bacteria 3195
49 Ga0070666_10384435 3300005335 Bacteria 1008
50 Ga0070666_10547173 3300005335 Bacteria 842
51 Ga0070680_100000060 3300005336 Bacteria 56659
52 Ga0070680_100001824 3300005336 Bacteria 15645
53 Ga0070680_100004967 3300005336 Bacteria 10017
54 Ga0070680_100005079 3300005336 Bacteria 9927
55 Ga0070680_100021540 3300005336 Bacteria 5123
56 Ga0070680_100036311 3300005336 Bacteria 3981
57 Ga0070680_100062033 3300005336 Bacteria 3061
58 Ga0070680_100221865 3300005336 Bacteria 1596
59 Ga0070680_100421090 3300005336 Bacteria 1139
60 Ga0070680_100487717 3300005336 Bacteria 1054
61 Ga0070680_100622526 3300005336 Bacteria 927
62 Ga0070680_101042659 3300005336 Bacteria 706
63 Ga0070682_100011928 3300005337 Bacteria 4972
64 Ga0070682_100017108 3300005337 Bacteria 4225
65 Ga0070682_100190706 3300005337 Bacteria 1439
66 Ga0070682_100239123 3300005337 Bacteria 1303
67 Ga0070682_100338451 3300005337 Bacteria 1118
68 Ga0070682_100670732 3300005337 Bacteria 828
69 Ga0070682_100704548 3300005337 Bacteria 810
70 Ga0070682_100735598 3300005337 Bacteria 795
71 Ga0068868_100007660 3300005338 Bacteria 7702
72 Ga0068868_100050548 3300005338 Bacteria 3265
73 Ga0068868_100235919 3300005338 Bacteria 1536
74 Ga0070660_100282432 3300005339 Bacteria 1359
75 Ga0070660_100643512 3300005339 Bacteria 888
76 Ga0070660_100786210 3300005339 Bacteria 800
77 Ga0070689_100031979 3300005340 Bacteria 4000
78 Ga0070689_100796186 3300005340 Bacteria 831
79 Ga0070691_10000263 3300005341 Bacteria 18269
80 Ga0070691_10029661 3300005341 Bacteria 2560
81 Ga0070691_10098068 3300005341 Bacteria 1453
82 Ga0070691_10108524 3300005341 Bacteria 1386
83 Ga0070687_100003047 3300005343 Bacteria 6449
84 Ga0070687_100208926 3300005343 Bacteria 1188
85 Ga0070687_100213710 3300005343 Bacteria 1177
86 Ga0070687_100767718 3300005343 Bacteria 680
87 Ga0070661_100001442 3300005344 Bacteria 16527
88 Ga0070661_100001955 3300005344 Bacteria 14265
89 Ga0070661_100128833 3300005344 Bacteria 1899
90 Ga0070661_100336530 3300005344 Bacteria 1181
91 Ga0070661_100439141 3300005344 Bacteria 1037
92 Ga0070661_100614334 3300005344 Bacteria 880
93 Ga0070692_10004699 3300005345 Bacteria 5725
94 Ga0070692_10492683 3300005345 Bacteria 793
95 Ga0070668_100000732 3300005347 Bacteria 22429
96 Ga0070668_100096643 3300005347 Bacteria 2335
97 Ga0070668_100432099 3300005347 Bacteria 1129
98 Ga0070668_100617497 3300005347 Bacteria 950
99 Ga0070669_100003510 3300005353 Bacteria 11307
100 Ga0070669_100004021 3300005353 Bacteria 10631
101 Ga0070669_100083955 3300005353 Bacteria 2376
102 Ga0070669_100582560 3300005353 Bacteria 936
103 Ga0070675_100001283 3300005354 Bacteria 18359
104 Ga0070675_100002017 3300005354 Bacteria 15069
105 Ga0070675_100035903 3300005354 Bacteria 4030
106 Ga0070675_100072173 3300005354 Bacteria 2866
107 Ga0070671_100052688 3300005355 Bacteria 3383
108 Ga0070671_100121841 3300005355 Bacteria 2195
109 Ga0070671_100133781 3300005355 Bacteria 2089
110 Ga0070671_100410296 3300005355 Bacteria 1159
111 Ga0070674_100242413 3300005356 Bacteria 1412
112 Ga0070674_100275847 3300005356 Bacteria 1331
113 Ga0070674_100542228 3300005356 Bacteria 975
114 Ga0070673_100044957 3300005364 Bacteria 3422
115 Ga0070673_100057589 3300005364 Bacteria 3070
116 Ga0070673_100083618 3300005364 Bacteria 2593
117 Ga0070673_100097481 3300005364 Bacteria 2414
118 Ga0070673_100348112 3300005364 Bacteria 1314
119 Ga0070673_100536576 3300005364 Bacteria 1061
120 Ga0070688_100010384 3300005365 Bacteria 5133
121 Ga0070688_100066384 3300005365 Bacteria 2296
122 Ga0070688_100287498 3300005365 Bacteria 1184
123 Ga0070688_100721449 3300005365 Bacteria 774
124 Ga0070659_100015466 3300005366 Bacteria 5716
125 Ga0070659_100016463 3300005366 Bacteria 5550
126 Ga0070659_100165237 3300005366 Bacteria 1811
127 Ga0070659_100278390 3300005366 Bacteria 1391
128 Ga0070667_100003520 3300005367 Bacteria 13338
129 Ga0070667_100056035 3300005367 Bacteria 3329
130 Ga0070667_100096766 3300005367 Bacteria 2546
131 Ga0070667_100126126 3300005367 Bacteria 2231
132 Ga0070667_100152022 3300005367 Bacteria 2034
133 Ga0070667_100355738 3300005367 Bacteria 1326
134 Ga0070709_10011503 3300005434 Bacteria 4936
135 Ga0070709_10014916 3300005434 Bacteria 4409
136 Ga0070709_10084226 3300005434 Bacteria 2082
137 Ga0070709_10097259 3300005434 Bacteria 1954
138 Ga0070709_10238038 3300005434 Bacteria 1306
139 Ga0070709_10404340 3300005434 Bacteria 1020
140 Ga0070714_100004782 3300005435 Bacteria 10261
141 Ga0070714_100008339 3300005435 Bacteria 8084
142 Ga0070714_100125379 3300005435 Bacteria 2289
143 Ga0070714_100459824 3300005435 Bacteria 1210
144 Ga0070714_101079698 3300005435 Bacteria 782
145 Ga0070713_100001880 3300005436 Bacteria 13539
146 Ga0070713_100016596 3300005436 Bacteria 5538
147 Ga0070713_100027133 3300005436 Bacteria 4505
148 Ga0070713_100052558 3300005436 Bacteria 3374
149 Ga0070713_100118868 3300005436 Bacteria 2315
150 Ga0070713_100259761 3300005436 Bacteria 1587
151 Ga0070710_10031760 3300005437 Bacteria 2854
152 Ga0070701_10004074 3300005438 Bacteria 5864
153 Ga0070701_10018898 3300005438 Bacteria 3246
154 Ga0070701_10060398 3300005438 Bacteria 1996
155 Ga0070701_10322201 3300005438 Bacteria 957
156 Ga0070701_10682901 3300005438 Unclassified 689
157 Ga0070711_100174829 3300005439 Bacteria 1639
158 Ga0070711_100225842 3300005439 Bacteria 1458
159 Ga0070711_100294553 3300005439 Bacteria 1288
160 Ga0070711_100322423 3300005439 Bacteria 1235
161 Ga0070711_100553444 3300005439 Bacteria 955
162 Ga0070705_100196654 3300005440 Bacteria 1379
163 Ga0070700_100511278 3300005441 Bacteria 926
164 Ga0070694_100000130 3300005444 Bacteria 37512
165 Ga0070694_100055653 3300005444 Bacteria 2684
166 Ga0070694_100324326 3300005444 Bacteria 1186
167 Ga0070694_100438419 3300005444 Bacteria 1029
168 Ga0070708_100000056 3300005445 Bacteria 73469
169 Ga0070708_100034750 3300005445 Bacteria 4387
170 Ga0070708_100119510 3300005445 Bacteria 2429
171 Ga0070708_100245018 3300005445 Bacteria 1683
172 Ga0070708_100625476 3300005445 Bacteria 1015
173 Ga0070678_100081946 3300005456 Bacteria 2448
174 Ga0070678_100167564 3300005456 Bacteria 1786
175 Ga0070678_100796513 3300005456 Bacteria 858
176 Ga0070678_100861986 3300005456 Bacteria 826
177 Ga0070662_100018767 3300005457 Bacteria 4684
178 Ga0070662_100420873 3300005457 Bacteria 1105
179 Ga0070662_100444134 3300005457 Bacteria 1076
180 Ga0070662_100519396 3300005457 Bacteria 995
181 Ga0070681_10000084 3300005458 Bacteria 70932
182 Ga0070681_10001135 3300005458 Bacteria 22891
183 Ga0070681_10003261 3300005458 Bacteria 15133
184 Ga0070681_10011033 3300005458 Bacteria 8932
185 Ga0070681_10020623 3300005458 Bacteria 6604
186 Ga0070681_10118709 3300005458 Bacteria 2581
187 Ga0070681_10212002 3300005458 Bacteria 1853
188 Ga0070681_10222265 3300005458 Bacteria 1804
189 Ga0070681_10492455 3300005458 Bacteria 1139
190 Ga0068867_100065315 3300005459 Bacteria 2708
191 Ga0068867_100186836 3300005459 Bacteria 1651
192 Ga0070685_10016062 3300005466 Bacteria 3982
193 Ga0070706_100035529 3300005467 Bacteria 4602
194 Ga0070706_100268778 3300005467 Bacteria 1591
195 Ga0070707_100102043 3300005468 Bacteria 2780
196 Ga0070707_100312659 3300005468 Bacteria 1527
197 Ga0070707_100544616 3300005468 Bacteria 1123
198 Ga0070707_100600786 3300005468 Bacteria 1063
199 Ga0070707_101567843 3300005468 Bacteria 625
200 Ga0070698_100000081 3300005471 Bacteria 73806
201 Ga0070698_100010819 3300005471 Bacteria 9711
202 Ga0070698_100071699 3300005471 Bacteria 3473
203 Ga0070698_100145599 3300005471 Bacteria 2319
204 Ga0070698_100274567 3300005471 Bacteria 1617
205 Ga0070699_100084690 3300005518 Bacteria 2767
206 Ga0070699_101582721 3300005518 Bacteria 600
207 Ga0070679_100001687 3300005530 Bacteria 19882
208 Ga0070679_100002225 3300005530 Bacteria 17524
209 Ga0070679_100006082 3300005530 Bacteria 11230
210 Ga0070679_100012338 3300005530 Bacteria 8161
211 Ga0070679_100042029 3300005530 Bacteria 4552
212 Ga0070679_100100882 3300005530 Bacteria 2873
213 Ga0070679_100489833 3300005530 Bacteria 1173
214 Ga0070684_100000133 3300005535 Bacteria 49355
215 Ga0070684_100004534 3300005535 Bacteria 10583
216 Ga0070684_100008387 3300005535 Bacteria 8073
217 Ga0070684_100023290 3300005535 Bacteria 5177
218 Ga0070684_100030976 3300005535 Bacteria 4550
219 Ga0070684_100074507 3300005535 Bacteria 2992
220 Ga0070684_100155171 3300005535 Bacteria 2076
221 Ga0070684_100171775 3300005535 Bacteria 1969
222 Ga0070684_100175256 3300005535 Bacteria 1949
223 Ga0070684_100211927 3300005535 Bacteria 1766
224 Ga0070684_100242897 3300005535 Bacteria 1645
225 Ga0070684_100328001 3300005535 Bacteria 1406
226 Ga0070684_101216090 3300005535 Bacteria 709
227 Ga0070684_101296347 3300005535 Bacteria 685
228 Ga0070697_100302961 3300005536 Bacteria 1374
229 Ga0070697_101177699 3300005536 Bacteria 683
230 Ga0068853_100088346 3300005539 Bacteria 2721
231 Ga0068853_100169145 3300005539 Bacteria 1977
232 Ga0068853_100421899 3300005539 Bacteria 1251
233 Ga0068853_101014935 3300005539 Bacteria 799
234 Ga0070672_100005354 3300005543 Bacteria 8496
235 Ga0070672_100026328 3300005543 Bacteria 4326
236 Ga0070672_100683867 3300005543 Bacteria 898
237 Ga0070686_100091844 3300005544 Bacteria 2032
238 Ga0070686_100234103 3300005544 Bacteria 1334
239 Ga0070686_100293920 3300005544 Bacteria 1203
240 Ga0070686_100748204 3300005544 Bacteria 784
241 Ga0070695_100149869 3300005545 Bacteria 1627
242 Ga0070695_100175521 3300005545 Bacteria 1514
243 Ga0070695_100222032 3300005545 Unclassified 1362
244 Ga0070696_100000112 3300005546 Bacteria 41636
245 Ga0070696_100045267 3300005546 Bacteria 3049
246 Ga0070696_100349816 3300005546 Bacteria 1144
247 Ga0070693_100002520 3300005547 Bacteria 8440
248 Ga0070693_100017497 3300005547 Bacteria 3727
249 Ga0070693_100029019 3300005547 Bacteria 3013
250 Ga0070693_100494938 3300005547 Bacteria 866
251 Ga0070693_100682729 3300005547 Bacteria 750
252 Ga0070665_100016720 3300005548 Bacteria 7353
253 Ga0070704_100123300 3300005549 Bacteria 1995
254 Ga0070704_100169715 3300005549 Bacteria 1734
255 Ga0070704_100261286 3300005549 Bacteria 1426
256 Ga0070704_101347518 3300005549 Bacteria 654
257 Ga0068855_100023850 3300005563 Bacteria 7328
258 Ga0068855_100104599 3300005563 Bacteria 3256
259 Ga0068855_100267583 3300005563 Bacteria 1902
260 Ga0068855_100906548 3300005563 Bacteria 931
261 Ga0068855_100994024 3300005563 Bacteria 882
262 Ga0070664_100073583 3300005564 Bacteria 2932
263 Ga0070664_100092529 3300005564 Bacteria 2618
264 Ga0070664_100093640 3300005564 Bacteria 2603
265 Ga0070664_100189739 3300005564 Bacteria 1831
266 Ga0070664_100229200 3300005564 Bacteria 1665
267 Ga0070664_100248972 3300005564 Bacteria 1597
268 Ga0070664_100638554 3300005564 Bacteria 989
269 Ga0070664_101029009 3300005564 Bacteria 774
270 Ga0070664_101130937 3300005564 Unclassified 738
271 Ga0068857_100000089 3300005577 Bacteria 52738
272 Ga0068857_100007141 3300005577 Bacteria 9619
273 Ga0068857_100087950 3300005577 Bacteria 2779
274 Ga0068857_100109494 3300005577 Bacteria 2482
275 Ga0068854_100268560 3300005578 Bacteria 1369
276 Ga0068854_100549822 3300005578 Bacteria 979
277 Ga0068856_100001425 3300005614 Bacteria 25070
278 Ga0068856_100029136 3300005614 Bacteria 5393
279 Ga0068856_100043400 3300005614 Bacteria 4425
280 Ga0068856_100741228 3300005614 Bacteria 1002
281 Ga0070702_100014302 3300005615 Bacteria 4025
282 Ga0070702_100159864 3300005615 Bacteria 1455
283 Ga0068852_100114873 3300005616 Bacteria 2453
284 Ga0068852_100154717 3300005616 Bacteria 2135
285 Ga0068852_100260833 3300005616 Bacteria 1664
286 Ga0068859_100153223 3300005617 Bacteria 2381
287 Ga0068859_100234291 3300005617 Bacteria 1924
288 Ga0068859_100317592 3300005617 Bacteria 1651
289 Ga0068859_100637808 3300005617 Bacteria 1158
290 Ga0068864_100035042 3300005618 Bacteria 4271
291 Ga0068864_100045968 3300005618 Bacteria 3745
292 Ga0068864_100079228 3300005618 Bacteria 2876
293 Ga0068864_100658958 3300005618 Bacteria 1020
294 Ga0068866_10074723 3300005718 Bacteria 1802
295 Ga0068866_10297950 3300005718 Bacteria 1006
296 Ga0068861_100001219 3300005719 Bacteria 16009
297 Ga0068861_100028486 3300005719 Bacteria 4076
298 Ga0068861_100343650 3300005719 Bacteria 1307
299 Ga0068851_10039319 3300005834 Bacteria 2375
300 Ga0068851_10178483 3300005834 Bacteria 1175
301 Ga0068870_10085423 3300005840 Bacteria 1754
302 Ga0068870_10094657 3300005840 Bacteria 1677
303 Ga0068870_10134120 3300005840 Bacteria 1442
304 Ga0068863_100005540 3300005841 Bacteria 12414
305 Ga0068863_100309794 3300005841 Bacteria 1532
306 Ga0068858_100005050 3300005842 Bacteria 12938
307 Ga0068858_100238446 3300005842 Bacteria 1725
308 Ga0068858_100441636 3300005842 Bacteria 1253
309 Ga0068858_100470200 3300005842 Bacteria 1213
310 Ga0068860_100005336 3300005843 Bacteria 13042
311 Ga0068860_100460594 3300005843 Unclassified 1265
312 Ga0068860_100985295 3300005843 Bacteria 860
313 Ga0068860_101027208 3300005843 Bacteria 843
314 Ga0068862_100000130 3300005844 Bacteria 87869
315 Ga0068862_100039945 3300005844 Bacteria 3987
316 Ga0068862_100052626 3300005844 Bacteria 3484
317 Ga0068862_100525909 3300005844 Unclassified 1126
318 Ga0081455_10148673 3300005937 Bacteria 1808
319 Ga0081539_10000104 3300005985 Bacteria 197478
320 Ga0081539_10008024 3300005985 Bacteria 9361
321 Ga0081539_10175407 3300005985 Bacteria 1010
322 Ga0070717_10002126 3300006028 Bacteria 13889
323 Ga0070717_10125849 3300006028 Bacteria 2200
324 Ga0070717_10410589 3300006028 Bacteria 1217
325 Ga0070716_100178616 3300006173 Bacteria 1391
326 Ga0070716_100215962 3300006173 Bacteria 1285
327 Ga0070716_100236560 3300006173 Bacteria 1236
328 Ga0070712_100171795 3300006175 Bacteria 1682
329 Ga0070712_101294939 3300006175 Unclassified 635
330 Ga0097621_100058255 3300006237 Bacteria 3161
331 Ga0097621_100270368 3300006237 Bacteria 1493
332 Ga0097621_100554898 3300006237 Bacteria 1046
333 Ga0097621_100838151 3300006237 Bacteria 854
334 Ga0068871_100051487 3300006358 Bacteria 3334
335 Ga0068871_100088940 3300006358 Bacteria 2570
336 Ga0068871_100335304 3300006358 Bacteria 1335
337 Ga0075428_100007881 3300006844 Bacteria 11810
338 Ga0075428_100129846 3300006844 Bacteria 2741
339 Ga0075428_100177084 3300006844 Bacteria 2310
340 Ga0075428_100191331 3300006844 Bacteria 2213
341 Ga0075428_100243344 3300006844 Bacteria 1941
342 Ga0075428_100274833 3300006844 Bacteria 1813
343 Ga0075428_100515688 3300006844 Bacteria 1279
344 Ga0075430_100000326 3300006846 Bacteria 34031
345 Ga0075430_100026971 3300006846 Bacteria 4885
346 Ga0075430_100027788 3300006846 Bacteria 4805
347 Ga0075430_100062884 3300006846 Bacteria 3118
348 Ga0075430_100170111 3300006846 Bacteria 1813
349 Ga0075430_100449972 3300006846 Bacteria 1063
350 Ga0075431_100066661 3300006847 Bacteria 3717
351 Ga0075431_100081655 3300006847 Bacteria 3337
352 Ga0075431_100165983 3300006847 Bacteria 2270
353 Ga0075431_100296593 3300006847 Bacteria 1634
354 Ga0075431_100567817 3300006847 Bacteria 1121
355 Ga0075433_10002025 3300006852 Bacteria 15286
356 Ga0075433_10008881 3300006852 Bacteria 8018
357 Ga0075433_10078455 3300006852 Bacteria 2910
358 Ga0075433_10113423 3300006852 Bacteria 2404
359 Ga0075433_10443083 3300006852 Bacteria 1145
360 Ga0075434_100015209 3300006871 Bacteria 7373
361 Ga0075434_100016167 3300006871 Bacteria 7172
362 Ga0075434_100019855 3300006871 Bacteria 6507
363 Ga0075434_100049905 3300006871 Bacteria 4156
364 Ga0075434_100132049 3300006871 Bacteria 2517
365 Ga0075434_100796716 3300006871 Bacteria 961
366 Ga0075429_100006201 3300006880 Bacteria 10343
367 Ga0075429_100261689 3300006880 Bacteria 1514
368 Ga0068865_100001505 3300006881 Bacteria 13590
369 Ga0068865_100031600 3300006881 Bacteria 3531
370 Ga0068865_100058886 3300006881 Bacteria 2685
371 Ga0068865_100131956 3300006881 Bacteria 1873
372 Ga0068865_100252699 3300006881 Bacteria 1392
373 Ga0068865_100964073 3300006881 Bacteria 745
374 Ga0075436_100024099 3300006914 Bacteria 4184
375 Ga0075436_100109055 3300006914 Bacteria 1931
376 Ga0075436_100344170 3300006914 Bacteria 1074
377 Ga0097620_100153226 3300006931 Bacteria 2381
378 Ga0097620_100234295 3300006931 Bacteria 1924
379 Ga0097620_100317600 3300006931 Bacteria 1651
380 Ga0097620_100637836 3300006931 Bacteria 1158
381 Ga0075435_100011632 3300007076 Bacteria 6486
382 Ga0075435_100178036 3300007076 Bacteria 1796
383 Ga0075435_100190967 3300007076 Bacteria 1734
384 Ga0075435_100229326 3300007076 Bacteria 1578
385 Ga0075435_100385781 3300007076 Bacteria 1204
386 Ga0099794_10108902 3300007265 Bacteria 1387
387 Ga0099795_10034286 3300007788 Bacteria 1768
388 Ga0105240_10078343 3300009093 Bacteria 4070
389 Ga0105240_10083403 3300009093 Bacteria 3922
390 Ga0105240_10176093 3300009093 Bacteria 2529
391 Ga0105240_10369502 3300009093 Bacteria 1622
392 Ga0105240_10589245 3300009093 Bacteria 1226
393 Ga0105240_10600681 3300009093 Bacteria 1212
394 Ga0105240_10639945 3300009093 Unclassified 1167
395 Ga0111539_10033701 3300009094 Bacteria 6216
396 Ga0111539_10164313 3300009094 Bacteria 2596
397 Ga0111539_10167584 3300009094 Bacteria 2567
398 Ga0111539_10171639 3300009094 Bacteria 2533
399 Ga0111539_10178509 3300009094 Bacteria 2481
400 Ga0111539_10521606 3300009094 Bacteria 1384
401 Ga0111539_10663938 3300009094 Bacteria 1214
402 Ga0105245_10053096 3300009098 Bacteria 3637
403 Ga0105245_10059463 3300009098 Bacteria 3441
404 Ga0105245_10088834 3300009098 Bacteria 2839
405 Ga0105245_10177900 3300009098 Bacteria 2030
406 Ga0105245_10243319 3300009098 Bacteria 1745
407 Ga0105247_10150714 3300009101 Bacteria 1532
408 Ga0114129_10036603 3300009147 Bacteria 6929
409 Ga0114129_10057151 3300009147 Bacteria 5462
410 Ga0114129_10245030 3300009147 Bacteria 2408
411 Ga0114129_10253731 3300009147 Bacteria 2360
412 Ga0114129_10325190 3300009147 Bacteria 2043
413 Ga0114129_11971150 3300009147 Bacteria 707
414 Ga0105243_10253602 3300009148 Bacteria 1572
415 Ga0105243_10282454 3300009148 Bacteria 1496
416 Ga0105243_10825386 3300009148 Bacteria 916
417 Ga0105243_11022357 3300009148 Bacteria 830
418 Ga0105241_10000741 3300009174 Bacteria 24816
419 Ga0105241_10019881 3300009174 Bacteria 4957
420 Ga0105242_10094362 3300009176 Bacteria 2524
421 Ga0105242_10101391 3300009176 Bacteria 2439
422 Ga0105242_10124885 3300009176 Bacteria 2214
423 Ga0105242_10125041 3300009176 Bacteria 2212
424 Ga0105242_10149118 3300009176 Bacteria 2038
425 Ga0105242_10291796 3300009176 Bacteria 1485
426 Ga0105242_11112696 3300009176 Bacteria 805
427 Ga0105248_10018118 3300009177 Bacteria 7775
428 Ga0105248_10065014 3300009177 Bacteria 4094
429 Ga0105248_10306504 3300009177 Bacteria 1788
430 Ga0105248_10316299 3300009177 Bacteria 1758
431 Ga0105248_10359677 3300009177 Bacteria 1639
432 Ga0105248_10415864 3300009177 Bacteria 1514
433 Ga0105237_10224412 3300009545 Bacteria 1879
434 Ga0105237_10553243 3300009545 Bacteria 1157
435 Ga0105237_10598650 3300009545 Bacteria 1109
436 Ga0105238_10540992 3300009551 Bacteria 1168
437 Ga0105238_10563894 3300009551 Bacteria 1144
438 Ga0105238_11232100 3300009551 Bacteria 773
439 Ga0105249_10000750 3300009553 Bacteria 29188
440 Ga0105249_10002711 3300009553 Bacteria 15299
441 Ga0105249_10507064 3300009553 Bacteria 1252
442 Ga0105249_10923250 3300009553 Bacteria 940
443 Ga0105249_11223170 3300009553 Bacteria 822
444 Ga0105239_10083353 3300010375 Bacteria 3521
445 Ga0105239_10111985 3300010375 Bacteria 3026
446 Ga0105239_10796595 3300010375 Bacteria 1083
447 Ga0105239_10910207 3300010375 Bacteria 1010
448 Ga0105246_10000048 3300011119 Bacteria 47038
449 Ga0105246_10083893 3300011119 Bacteria 2278
450 Ga0157327_1011495 3300012512 Bacteria 856
451 Ga0157373_10008981 3300013100 Bacteria 7395
452 Ga0157371_10004866 3300013102 Bacteria 11548
453 Ga0157371_10022660 3300013102 Bacteria 4596
454 Ga0157371_10185402 3300013102 Bacteria 1489
455 Ga0157371_10792828 3300013102 Bacteria 714
456 Ga0157370_10022231 3300013104 Bacteria 6311
457 Ga0157370_10098527 3300013104 Bacteria 2741
458 Ga0157370_10294481 3300013104 Bacteria 1499
459 Ga0157370_10298460 3300013104 Bacteria 1488
460 Ga0157370_11316530 3300013104 Bacteria 651
461 Ga0157369_10000885 3300013105 Bacteria 38170
462 Ga0157369_10103688 3300013105 Bacteria 3030
463 Ga0157369_10152158 3300013105 Bacteria 2445
464 Ga0157369_10513591 3300013105 Bacteria 1239
465 Ga0157369_10746867 3300013105 Bacteria 1007
466 Ga0157374_10041992 3300013296 Bacteria 4217
467 Ga0157374_10621567 3300013296 Bacteria 1091
468 Ga0157374_11033201 3300013296 Bacteria 841
469 Ga0157378_10074090 3300013297 Unclassified 3063
470 Ga0157378_10252859 3300013297 Bacteria 1688
471 Ga0157378_10295293 3300013297 Bacteria 1566
472 Ga0157378_10395811 3300013297 Bacteria 1360
473 Ga0157378_11725049 3300013297 Bacteria 674
474 Ga0163162_10001389 3300013306 Bacteria 22536
475 Ga0163162_10008153 3300013306 Bacteria 10223
476 Ga0163162_10734895 3300013306 Bacteria 1107
477 Ga0163162_10899476 3300013306 Bacteria 998
478 Ga0163162_11539040 3300013306 Bacteria 758
479 Ga0157372_10000963 3300013307 Bacteria 31400
480 Ga0157372_10006156 3300013307 Bacteria 12755
481 Ga0157372_10015400 3300013307 Bacteria 8195
482 Ga0157372_10132547 3300013307 Bacteria 2868
483 Ga0157372_10325442 3300013307 Bacteria 1790
484 Ga0157372_10341715 3300013307 Bacteria 1744
485 Ga0157372_10373968 3300013307 Bacteria 1660
486 Ga0157372_10534070 3300013307 Bacteria 1367
487 Ga0157372_10914558 3300013307 Bacteria 1018
488 Ga0157372_11196490 3300013307 Bacteria 878
489 Ga0157372_11247510 3300013307 Bacteria 858
490 Ga0157375_10006794 3300013308 Bacteria 9961
491 Ga0157375_10012226 3300013308 Bacteria 7611
492 Ga0157375_10025375 3300013308 Bacteria 5506
493 Ga0157375_10025502 3300013308 Bacteria 5494
494 Ga0157375_10201273 3300013308 Bacteria 2147
495 Ga0157375_10250475 3300013308 Bacteria 1932
496 Ga0163163_10003767 3300014325 Bacteria 12916
497 Ga0163163_10029145 3300014325 Bacteria 5309
498 Ga0163163_10305923 3300014325 Bacteria 1642
499 Ga0163163_10742037 3300014325 Bacteria 1045
500 Ga0157380_10100477 3300014326 Bacteria 2408
501 Ga0157380_10241620 3300014326 Bacteria 1628
502 Ga0157377_10006106 3300014745 Bacteria 5718
503 Ga0157377_10067267 3300014745 Bacteria 2063
504 Ga0157377_10100239 3300014745 Bacteria 1724
505 Ga0157379_10001582 3300014968 Bacteria 18756
506 Ga0157379_11186242 3300014968 Unclassified 734
507 Ga0157376_10019042 3300014969 Bacteria 5280
508 Ga0157376_10124451 3300014969 Bacteria 2290
509 Ga0157376_10314599 3300014969 Bacteria 1486
510 Ga0157376_10439742 3300014969 Bacteria 1270
511 Ga0157376_11824593 3300014969 Bacteria 644
512 Ga0182007_10197306 3300015262 Bacteria 702
513 Ga0182005_1050076 3300015265 Bacteria 1135
514 Ga0182005_1170866 3300015265 Bacteria 641
515 Ga0163161_10007616 3300017792 Bacteria 7490
516 Ga0163161_10261208 3300017792 Bacteria 1352
517 Ga0163161_10585454 3300017792 Bacteria 918
518 Ga0206350_11560318 3300020080 Bacteria 1539
519 Ga0206354_11146190 3300020081 Bacteria 569
520 Ga0206353_10444321 3300020082 Bacteria 628
521 Ga0206353_10585941 3300020082 Bacteria 1489
522 Ga0224712_10002762 3300022467 Bacteria 4416
523 Ga0224712_10003065 3300022467 Bacteria 4265
524 Ga0224712_10166504 3300022467 Bacteria 986
525 Ga0207697_10001440 3300025315 Bacteria 13010
526 Ga0207656_10198853 3300025321 Bacteria 967
527 Ga0207682_10079917 3300025893 Bacteria 1400
528 Ga0207682_10083605 3300025893 Bacteria 1372
529 Ga0207692_10257425 3300025898 Bacteria 1048
530 Ga0207642_10138474 3300025899 Bacteria 1280
531 Ga0207688_10077333 3300025901 Bacteria 1896
532 Ga0207680_10457704 3300025903 Unclassified 906
533 Ga0207647_10077986 3300025904 Bacteria 1991
534 Ga0207647_10644834 3300025904 Unclassified 581
535 Ga0207685_10184696 3300025905 Bacteria 969
536 Ga0207699_10001907 3300025906 Bacteria 9823
537 Ga0207699_10076190 3300025906 Bacteria 2066
538 Ga0207699_10078723 3300025906 Bacteria 2037
539 Ga0207699_10079131 3300025906 Bacteria 2033
540 Ga0207699_10196335 3300025906 Bacteria 1365
541 Ga0207699_10250141 3300025906 Bacteria 1221
542 Ga0207699_10426684 3300025906 Bacteria 948
543 Ga0207645_10000196 3300025907 Bacteria 49371
544 Ga0207645_10027561 3300025907 Bacteria 3667
545 Ga0207645_10093755 3300025907 Bacteria 1932
546 Ga0207645_10106644 3300025907 Bacteria 1811
547 Ga0207645_10141556 3300025907 Bacteria 1567
548 Ga0207643_10006469 3300025908 Bacteria 6272
549 Ga0207643_10047025 3300025908 Bacteria 2440
550 Ga0207643_10122683 3300025908 Bacteria 1540
551 Ga0207643_10217390 3300025908 Bacteria 1168
552 Ga0207705_10101761 3300025909 Bacteria 2114
553 Ga0207705_10125236 3300025909 Bacteria 1909
554 Ga0207705_11061371 3300025909 Bacteria 625
555 Ga0207684_10080753 3300025910 Bacteria 2767
556 Ga0207684_10131219 3300025910 Bacteria 2150
557 Ga0207654_10000564 3300025911 Bacteria 20953
558 Ga0207654_10037194 3300025911 Bacteria 2723
559 Ga0207654_10145844 3300025911 Bacteria 1514
560 Ga0207707_10001737 3300025912 Bacteria 20030
561 Ga0207707_10001810 3300025912 Bacteria 19629
562 Ga0207707_10041155 3300025912 Bacteria 4035
563 Ga0207707_10060452 3300025912 Bacteria 3296
564 Ga0207707_10061964 3300025912 Bacteria 3255
565 Ga0207707_10077929 3300025912 Bacteria 2893
566 Ga0207707_10164576 3300025912 Bacteria 1938
567 Ga0207707_10296323 3300025912 Bacteria 1399
568 Ga0207707_10306835 3300025912 Bacteria 1372
569 Ga0207695_10009046 3300025913 Bacteria 12380
570 Ga0207695_10254071 3300025913 Bacteria 1656
571 Ga0207695_10257636 3300025913 Bacteria 1643
572 Ga0207671_10246023 3300025914 Bacteria 1405
573 Ga0207693_10002541 3300025915 Bacteria 15863
574 Ga0207693_10062878 3300025915 Bacteria 2908
575 Ga0207693_10071012 3300025915 Bacteria 2725
576 Ga0207693_10344562 3300025915 Bacteria 1166
577 Ga0207693_10527409 3300025915 Unclassified 921
578 Ga0207663_10088789 3300025916 Bacteria 2045
579 Ga0207663_10403088 3300025916 Bacteria 1046
580 Ga0207663_10868494 3300025916 Bacteria 720
581 Ga0207660_10000019 3300025917 Bacteria 74841
582 Ga0207660_10011773 3300025917 Bacteria 5702
583 Ga0207660_10026350 3300025917 Bacteria 3959
584 Ga0207660_10040784 3300025917 Bacteria 3251
585 Ga0207660_10063863 3300025917 Bacteria 2656
586 Ga0207660_10623402 3300025917 Bacteria 879
587 Ga0207662_10000726 3300025918 Bacteria 15063
588 Ga0207662_10007764 3300025918 Bacteria 5846
589 Ga0207662_10011767 3300025918 Bacteria 4862
590 Ga0207662_10181725 3300025918 Bacteria 1354
591 Ga0207662_10497783 3300025918 Bacteria 839
592 Ga0207657_10355739 3300025919 Bacteria 1155
593 Ga0207657_10400247 3300025919 Bacteria 1080
594 Ga0207657_10918710 3300025919 Bacteria 674
595 Ga0207649_10011507 3300025920 Bacteria 4880
596 Ga0207649_10012915 3300025920 Bacteria 4651
597 Ga0207649_10015103 3300025920 Bacteria 4335
598 Ga0207649_10076884 3300025920 Bacteria 2149
599 Ga0207649_10311185 3300025920 Bacteria 1154
600 Ga0207649_10500455 3300025920 Bacteria 924
601 Ga0207649_10806358 3300025920 Bacteria 733
602 Ga0207652_10002559 3300025921 Bacteria 15261
603 Ga0207652_10003676 3300025921 Bacteria 12620
604 Ga0207652_10004181 3300025921 Bacteria 11771
605 Ga0207652_10006723 3300025921 Bacteria 9266
606 Ga0207652_10011841 3300025921 Bacteria 7036
607 Ga0207652_10055734 3300025921 Bacteria 3401
608 Ga0207652_10117155 3300025921 Bacteria 2367
609 Ga0207652_10138005 3300025921 Bacteria 2178
610 Ga0207646_10221326 3300025922 Bacteria 1710
611 Ga0207646_10554363 3300025922 Bacteria 1033
612 Ga0207646_10824482 3300025922 Bacteria 825
613 Ga0207681_10001072 3300025923 Bacteria 17739
614 Ga0207681_10065845 3300025923 Bacteria 2506
615 Ga0207681_10067189 3300025923 Bacteria 2485
616 Ga0207681_10158958 3300025923 Bacteria 1701
617 Ga0207681_10710979 3300025923 Bacteria 836
618 Ga0207694_10121362 3300025924 Bacteria 2087
619 Ga0207694_10440810 3300025924 Bacteria 1086
620 Ga0207694_10547101 3300025924 Bacteria 971
621 Ga0207694_10578321 3300025924 Bacteria 944
622 Ga0207650_10012270 3300025925 Bacteria 5914
623 Ga0207650_10014277 3300025925 Bacteria 5518
624 Ga0207650_10022934 3300025925 Bacteria 4422
625 Ga0207650_10113114 3300025925 Bacteria 2104
626 Ga0207659_10004530 3300025926 Bacteria 8407
627 Ga0207659_10005975 3300025926 Bacteria 7427
628 Ga0207659_10006090 3300025926 Bacteria 7366
629 Ga0207659_10055807 3300025926 Bacteria 2827
630 Ga0207659_10078350 3300025926 Bacteria 2435
631 Ga0207659_10285465 3300025926 Bacteria 1351
632 Ga0207687_10042625 3300025927 Bacteria 3124
633 Ga0207687_10062300 3300025927 Bacteria 2637
634 Ga0207687_10077463 3300025927 Bacteria 2391
635 Ga0207687_10087950 3300025927 Bacteria 2259
636 Ga0207687_10188387 3300025927 Bacteria 1604
637 Ga0207700_10001041 3300025928 Bacteria 16016
638 Ga0207700_10004547 3300025928 Bacteria 8197
639 Ga0207700_10026675 3300025928 Bacteria 4032
640 Ga0207700_10082732 3300025928 Bacteria 2511
641 Ga0207700_11059445 3300025928 Bacteria 725
642 Ga0207664_10009493 3300025929 Bacteria 6829
643 Ga0207664_10025835 3300025929 Bacteria 4430
644 Ga0207664_10317024 3300025929 Bacteria 1375
645 Ga0207664_10485950 3300025929 Bacteria 1105
646 Ga0207664_10577819 3300025929 Bacteria 1009
647 Ga0207644_10128908 3300025931 Bacteria 1934
648 Ga0207644_10218927 3300025931 Bacteria 1508
649 Ga0207690_10015144 3300025932 Bacteria 4669
650 Ga0207690_10020657 3300025932 Bacteria 4073
651 Ga0207690_10238792 3300025932 Bacteria 1399
652 Ga0207690_10313388 3300025932 Bacteria 1231
653 Ga0207690_10544138 3300025932 Bacteria 943
654 Ga0207706_10046594 3300025933 Bacteria 3838
655 Ga0207706_10196120 3300025933 Bacteria 1771
656 Ga0207706_10583279 3300025933 Bacteria 961
657 Ga0207686_10021306 3300025934 Bacteria 3718
658 Ga0207686_10066037 3300025934 Bacteria 2309
659 Ga0207686_10112639 3300025934 Bacteria 1838
660 Ga0207709_10146614 3300025935 Bacteria 1629
661 Ga0207709_10317230 3300025935 Bacteria 1165
662 Ga0207709_10372858 3300025935 Bacteria 1084
663 Ga0207709_10376293 3300025935 Bacteria 1079
664 Ga0207670_10052301 3300025936 Bacteria 2746
665 Ga0207670_10103531 3300025936 Bacteria 2037
666 Ga0207669_10025008 3300025937 Bacteria 3219
667 Ga0207669_10104487 3300025937 Bacteria 1882
668 Ga0207669_10188360 3300025937 Unclassified 1486
669 Ga0207704_10026143 3300025938 Bacteria 3198
670 Ga0207704_10076805 3300025938 Bacteria 2141
671 Ga0207704_10124772 3300025938 Bacteria 1770
672 Ga0207704_10452491 3300025938 Bacteria 1025
673 Ga0207704_10739830 3300025938 Bacteria 817
674 Ga0207665_10103702 3300025939 Bacteria 1989
675 Ga0207665_10190219 3300025939 Bacteria 1491
676 Ga0207691_10000643 3300025940 Bacteria 34530
677 Ga0207691_10005659 3300025940 Bacteria 12082
678 Ga0207691_10042317 3300025940 Bacteria 4200
679 Ga0207691_10104472 3300025940 Bacteria 2525
680 Ga0207691_10278002 3300025940 Bacteria 1441
681 Ga0207691_10480896 3300025940 Bacteria 1055
682 Ga0207711_10021350 3300025941 Bacteria 5409
683 Ga0207711_10063451 3300025941 Bacteria 3189
684 Ga0207711_10066354 3300025941 Bacteria 3121
685 Ga0207711_10138144 3300025941 Bacteria 2190
686 Ga0207711_10192867 3300025941 Bacteria 1857
687 Ga0207711_10312675 3300025941 Bacteria 1450
688 Ga0207711_10317897 3300025941 Bacteria 1438
689 Ga0207689_10026202 3300025942 Bacteria 4883
690 Ga0207689_10030455 3300025942 Bacteria 4497
691 Ga0207689_10137264 3300025942 Bacteria 2014
692 Ga0207689_10224782 3300025942 Bacteria 1551
693 Ga0207689_10292601 3300025942 Bacteria 1349
694 Ga0207661_10000075 3300025944 Bacteria 68028
695 Ga0207661_10017935 3300025944 Bacteria 5250
696 Ga0207661_10031699 3300025944 Bacteria 4087
697 Ga0207661_10059871 3300025944 Bacteria 3070
698 Ga0207661_10083040 3300025944 Bacteria 2650
699 Ga0207661_10124096 3300025944 Bacteria 2203
700 Ga0207661_10143734 3300025944 Bacteria 2055
701 Ga0207661_10143967 3300025944 Bacteria 2054
702 Ga0207661_10436888 3300025944 Bacteria 1190
703 Ga0207661_10533811 3300025944 Bacteria 1074
704 Ga0207661_10609673 3300025944 Bacteria 1002
705 Ga0207661_10875288 3300025944 Bacteria 827
706 Ga0207661_10952838 3300025944 Bacteria 790
707 Ga0207661_10993310 3300025944 Bacteria 773
708 Ga0207661_11042585 3300025944 Bacteria 753
709 Ga0207679_10003103 3300025945 Bacteria 10289
710 Ga0207679_10005748 3300025945 Bacteria 7784
711 Ga0207679_10139692 3300025945 Bacteria 1956
712 Ga0207679_10188493 3300025945 Bacteria 1713
713 Ga0207679_10332757 3300025945 Bacteria 1318
714 Ga0207679_10490239 3300025945 Bacteria 1095
715 Ga0207679_10571101 3300025945 Bacteria 1016
716 Ga0207679_10774261 3300025945 Bacteria 874
717 Ga0207679_11210064 3300025945 Unclassified 693
718 Ga0207667_10034423 3300025949 Bacteria 5439
719 Ga0207667_10106956 3300025949 Bacteria 2885
720 Ga0207667_11123950 3300025949 Bacteria 768
721 Ga0207667_11284477 3300025949 Unclassified 709
722 Ga0207651_10035981 3300025960 Bacteria 3227
723 Ga0207651_10058552 3300025960 Bacteria 2663
724 Ga0207651_10365104 3300025960 Bacteria 1220
725 Ga0207651_10414458 3300025960 Bacteria 1148
726 Ga0207651_10988920 3300025960 Bacteria 751
727 Ga0207712_10000417 3300025961 Bacteria 36471
728 Ga0207712_10001917 3300025961 Bacteria 13683
729 Ga0207712_11341536 3300025961 Bacteria 640
730 Ga0207668_10003575 3300025972 Bacteria 9132
731 Ga0207668_10062043 3300025972 Bacteria 2631
732 Ga0207668_10132867 3300025972 Bacteria 1903
733 Ga0207640_10412230 3300025981 Bacteria 1103
734 Ga0207658_10078682 3300025986 Bacteria 2520
735 Ga0207658_10291682 3300025986 Bacteria 1402
736 Ga0207658_10326586 3300025986 Bacteria 1329
737 Ga0207677_10002380 3300026023 Bacteria 9846
738 Ga0207677_10047570 3300026023 Bacteria 2881
739 Ga0207677_10056431 3300026023 Bacteria 2691
740 Ga0207677_10364335 3300026023 Bacteria 1215
741 Ga0207703_10118792 3300026035 Bacteria 2267
742 Ga0207703_10393301 3300026035 Bacteria 1285
743 Ga0207639_10043935 3300026041 Bacteria 3358
744 Ga0207639_10306952 3300026041 Bacteria 1404
745 Ga0207639_10562911 3300026041 Bacteria 1048
746 Ga0207678_10011975 3300026067 Bacteria 7617
747 Ga0207678_11040756 3300026067 Unclassified 725
748 Ga0207708_10006844 3300026075 Bacteria 8432
749 Ga0207708_10056125 3300026075 Bacteria 3004
750 Ga0207708_10218503 3300026075 Bacteria 1526
751 Ga0207708_10255434 3300026075 Bacteria 1413
752 Ga0207708_10266980 3300026075 Bacteria 1383
753 Ga0207702_10000358 3300026078 Bacteria 52196
754 Ga0207702_10070288 3300026078 Bacteria 3011
755 Ga0207702_10186865 3300026078 Bacteria 1912
756 Ga0207641_10027626 3300026088 Bacteria 4687
757 Ga0207641_10042327 3300026088 Bacteria 3820
758 Ga0207641_10123551 3300026088 Bacteria 2314
759 Ga0207648_10007496 3300026089 Bacteria 10717
760 Ga0207648_10028448 3300026089 Bacteria 4955
761 Ga0207648_10163447 3300026089 Bacteria 1967
762 Ga0207648_10411629 3300026089 Bacteria 1226
763 Ga0207676_10003976 3300026095 Bacteria 10429
764 Ga0207676_10041048 3300026095 Bacteria 3549
765 Ga0207676_10277531 3300026095 Bacteria 1520
766 Ga0207674_10000028 3300026116 Bacteria 149277
767 Ga0207674_10001277 3300026116 Bacteria 32891
768 Ga0207674_10006145 3300026116 Bacteria 14182
769 Ga0207674_10006616 3300026116 Bacteria 13619
770 Ga0207674_10009015 3300026116 Bacteria 11460
771 Ga0207674_10009376 3300026116 Bacteria 11195
772 Ga0207674_10279501 3300026116 Bacteria 1617
773 Ga0207674_10347657 3300026116 Bacteria 1434
774 Ga0207675_100000836 3300026118 Bacteria 30634
775 Ga0207675_100008771 3300026118 Bacteria 9494
776 Ga0207675_100171901 3300026118 Bacteria 2071
777 Ga0207675_101147720 3300026118 Bacteria 797
778 Ga0207683_10087983 3300026121 Bacteria 2763
779 Ga0207683_11096222 3300026121 Bacteria 739
780 Ga0207698_10084125 3300026142 Bacteria 2578
781 Ga0207698_12178323 3300026142 Bacteria 567
782 Ga0209981_1001809 3300027378 Bacteria 2711
783 Ga0209996_1004101 3300027395 Bacteria 1847
784 Ga0210000_1004988 3300027462 Bacteria 1924
785 Ga0209995_1003922 3300027471 Bacteria 2376
786 Ga0209968_1005026 3300027526 Bacteria 1986
787 Ga0209999_1003479 3300027543 Bacteria 2818
788 Ga0207428_10074066 3300027907 Bacteria 2670
789 Ga0207428_10117894 3300027907 Bacteria 2037
790 Ga0207428_10282053 3300027907 Bacteria 1233
791 Ga0207428_10516200 3300027907 Bacteria 866
792 Ga0207428_10699997 3300027907 Bacteria 725
793 Ga0268266_10038059 3300028379 Bacteria 4096
794 Ga0268266_10048784 3300028379 Bacteria 3630
795 Ga0268265_10000327 3300028380 Bacteria 51788
796 Ga0268265_10006692 3300028380 Bacteria 7801
797 Ga0268265_10055465 3300028380 Bacteria 3011
798 Ga0268265_10368171 3300028380 Bacteria 1318
799 Ga0268264_10024337 3300028381 Bacteria 4944
800 Ga0268264_10061218 3300028381 Bacteria 3157
801 Ga0265332_10011890 3300031238 Bacteria 3866
802 Ga0307408_100000925 3300031548 Bacteria 22876
803 Ga0307408_100025284 3300031548 Bacteria 4066
804 Ga0307408_100069735 3300031548 Bacteria 2593
805 Ga0307408_100072485 3300031548 Bacteria 2550
806 Ga0307408_100082788 3300031548 Bacteria 2403
807 Ga0307408_100319639 3300031548 Bacteria 1307
808 Ga0307408_100375931 3300031548 Bacteria 1213
809 Ga0265314_10003325 3300031711 Bacteria 15662
810 Ga0316578_10029397 3300031728 Bacteria 3119
811 Ga0307405_10001095 3300031731 Bacteria 11056
812 Ga0307405_10003833 3300031731 Bacteria 7001
813 Ga0307405_10126830 3300031731 Bacteria 1756
814 Ga0307405_10171344 3300031731 Bacteria 1549
815 Ga0307405_10198875 3300031731 Bacteria 1454
816 Ga0307405_10468131 3300031731 Bacteria 1003
817 Ga0307413_10003062 3300031824 Bacteria 6954
818 Ga0307413_10033762 3300031824 Bacteria 2917
819 Ga0307413_10037902 3300031824 Bacteria 2788
820 Ga0307410_10002803 3300031852 Bacteria 8543
821 Ga0307410_10003923 3300031852 Bacteria 7569
822 Ga0307410_10005322 3300031852 Bacteria 6795
823 Ga0307410_10046079 3300031852 Bacteria 2907
824 Ga0307410_10074123 3300031852 Bacteria 2369
825 Ga0307410_10205002 3300031852 Bacteria 1508
826 Ga0307410_10270209 3300031852 Bacteria 1330
827 Ga0307410_10355306 3300031852 Bacteria 1172
828 Ga0307406_10000826 3300031901 Bacteria 17400
829 Ga0307406_10002975 3300031901 Bacteria 9240
830 Ga0307406_10030745 3300031901 Bacteria 3263
831 Ga0307406_10056590 3300031901 Bacteria 2512
832 Ga0307406_10067051 3300031901 Bacteria 2338
833 Ga0307406_10071586 3300031901 Bacteria 2273
834 Ga0307406_10248134 3300031901 Bacteria 1339
835 Ga0307407_10002762 3300031903 Bacteria 6989
836 Ga0307407_10013238 3300031903 Bacteria 3996
837 Ga0307407_10016291 3300031903 Bacteria 3697
838 Ga0307407_10218349 3300031903 Bacteria 1288
839 Ga0307412_10010541 3300031911 Bacteria 5324
840 Ga0307412_10182656 3300031911 Bacteria 1579
841 Ga0307412_11102858 3300031911 Bacteria 706
842 Ga0307409_100001582 3300031995 Bacteria 11361
843 Ga0307409_100046350 3300031995 Bacteria 3290
844 Ga0307409_100070565 3300031995 Bacteria 2773
845 Ga0307409_100101623 3300031995 Bacteria 2386
846 Ga0307409_100111479 3300031995 Bacteria 2295
847 Ga0307409_100194725 3300031995 Bacteria 1808
848 Ga0307409_100366231 3300031995 Bacteria 1365
849 Ga0307409_100963899 3300031995 Bacteria 869
850 Ga0307416_100002942 3300032002 Bacteria 9932
851 Ga0307416_100005920 3300032002 Bacteria 7592
852 Ga0307416_100070275 3300032002 Bacteria 2902
853 Ga0307416_100086305 3300032002 Bacteria 2675
854 Ga0307416_100109146 3300032002 Bacteria 2433
855 Ga0307416_100421525 3300032002 Bacteria 1379
856 Ga0307416_100558403 3300032002 Bacteria 1219
857 Ga0307416_100639900 3300032002 Bacteria 1147
858 Ga0307416_101127132 3300032002 Bacteria 889
859 Ga0307414_10023116 3300032004 Bacteria 3935
860 Ga0307414_10032727 3300032004 Bacteria 3428
861 Ga0307414_10546996 3300032004 Bacteria 1031
862 Ga0307414_11191140 3300032004 Bacteria 705
863 Ga0307411_10015028 3300032005 Bacteria 4330
864 Ga0307411_10021756 3300032005 Bacteria 3760
865 Ga0307411_10033902 3300032005 Bacteria 3171
866 Ga0307411_10308422 3300032005 Bacteria 1272
867 Ga0307411_10525378 3300032005 Bacteria 1005
868 Ga0307415_100005454 3300032126 Bacteria 6758
869 Ga0307415_100022095 3300032126 Bacteria 3922
870 Ga0307415_100037632 3300032126 Bacteria 3181
871 Ga0307415_100042151 3300032126 Bacteria 3036
872 Ga0307415_100075939 3300032126 Bacteria 2380
873 Ga0307415_100178276 3300032126 Bacteria 1664
874 Ga0307415_100296294 3300032126 Bacteria 1338
875 Ga0307415_100341260 3300032126 Bacteria 1257
876 Ga0373926_0005792 3300035083 Bacteria 4082
877 Ga0373926_0071391 3300035083 Bacteria 1276
878 Ga0373934_0001971 3300035086 Bacteria 7524
879 Ga0373934_0008097 3300035086 Bacteria 3915
880 Ga0373934_0016071 3300035086 Bacteria 2843
881 Ga0373923_0104384 3300035111 Bacteria 1253
882 Ga0373945_0280247 3300035116 Bacteria 710
883 Ga0373953_0009228 3300035117 Bacteria 3384
884 Ga0373953_0014905 3300035117 Bacteria 2806
885 Ga0373953_0026634 3300035117 Bacteria 2216
886 Ga0373953_0082749 3300035117 Bacteria 1336
887 Ga0373954_0017113 3300035118 Bacteria 3252
888 Ga0373954_0087629 3300035118 Bacteria 1492
889 Ga0373954_0162697 3300035118 Bacteria 1092
890 Ga0373956_0012872 3300035119 Bacteria 3474
891 Ga0373957_0011090 3300035120 Bacteria 2998
892 Ga0373957_0073242 3300035120 Bacteria 1343
893 Ga0373943_0035642 3300035170 Bacteria 2379
894 Ga0373943_0082872 3300035170 Bacteria 1647
895 Ga0373943_0169430 3300035170 Bacteria 1194
896 Ga0373943_0328120 3300035170 Bacteria 873
897 Ga0373946_0001566 3300035171 Bacteria 7970
898 Ga0373946_0076989 3300035171 Bacteria 1453
899 Ga0373955_0001514 3300035172 Bacteria 9918
900 Ga0373955_0041798 3300035172 Bacteria 2459
901 Ga0373955_0151852 3300035172 Bacteria 1363
902 Ga0373961_0182922 3300035241 Bacteria 731
903 Ga0373962_0065936 3300035242 Bacteria 1073
904 Ga0316574_0068370 3300035398 Bacteria 2240
905 Ga0373924_0086641 3300035410 Bacteria 1336
906 Ga0373924_0104325 3300035410 Bacteria 1221
907 Ga0373931_0119694 3300035691 Bacteria 1504
908 Ga0373931_0511593 3300035691 Bacteria 776
909 Ga0373931_0950701 3300035691 Bacteria 580
910 Ga0373935_0002527 3300035692 Bacteria 10481
911 Ga0373935_0066615 3300035692 Bacteria 2314
912 Ga0373935_0195661 3300035692 Unclassified 1395
913 Ga0373935_0603309 3300035692 Bacteria 803
914 Ga0373927_0002489 3300035695 Bacteria 13444
915 Ga0373927_0030862 3300035695 Bacteria 3496
916 Ga0373933_0001158 3300035724 Bacteria 15630
917 Ga0373933_0001226 3300035724 Bacteria 15174
918 Ga0373933_0021270 3300035724 Bacteria 3683
919 Ga0373933_0173541 3300035724 Bacteria 1373
920 Ga0373947_0001941 3300035725 Bacteria 12666
921 Ga0373947_0011795 3300035725 Bacteria 5007
922 Ga0373947_0402196 3300035725 Bacteria 924
923 Ga0373947_0727332 3300035725 Bacteria 677
924 Ga0373937_0001287 3300036401 Bacteria 20998
925 Ga0373937_0005795 3300036401 Bacteria 10618
926 Ga0373937_0112179 3300036401 Bacteria 2536
927 Ga0373937_0150493 3300036401 Bacteria 2180
928 Ga0373937_0431525 3300036401 Bacteria 1251
929 Ga0316582_0126649 3300036647 Bacteria 1713
930 Ga0373925_0006635 3300037068 Bacteria 8499
931 Ga0373925_0157065 3300037068 Bacteria 1789
932 Ga0373925_0333400 3300037068 Bacteria 1229
933 Ga0316581_0058243 3300037588 Bacteria 1185
934 Ga0436364_1458527 3300037853 Bacteria 1540
935 Ga0436365_0332529 3300039437 Bacteria 2173
936 Ga0436365_1128121 3300039437 Bacteria 1351
937 Ga0436365_1210784 3300039437 Bacteria 17499
938 Ga0436362_0696497 3300039453 Bacteria 643
939 Ga0451802_1974431 3300041460 Bacteria 589
940 Ga0451843_1016260 3300041509 Bacteria 1039
941 Ga0439431_0160658 3300041997 Bacteria 642
942 Ga0439455_0063347 3300042012 Bacteria 984
943 Ga0451577_0545607 3300042876 Bacteria 1053
944 Ga0453683_0021931 3300044673 Bacteria 4075
945 Ga0466966_0169796 3300044684 Bacteria 1326
946 Ga0466963_0294343 3300044694 Bacteria 1141
947 Ga0453684_0553190 3300044712 Bacteria 1267
948 Ga0451576_0113886 3300045051 Bacteria 2815
949 Ga0451576_0222248 3300045051 Bacteria 1972
950 Ga0466967_0078025 3300045976 Bacteria 2983
951 Ga0466967_0095371 3300045976 Bacteria 2711
952 Ga0466967_0507448 3300045976 Bacteria 1184
953 Ga0495592_0002836 3300046454 Bacteria 12293
954 Ga0495592_0164084 3300046454 Bacteria 1526
955 Ga0495592_0435223 3300046454 Bacteria 824
956 Ga0495603_0002313 3300046455 Bacteria 11180
957 Ga0495603_0057861 3300046455 Bacteria 2293
958 Ga0495629_0013113 3300046459 Bacteria 5987
959 Ga0495629_0037192 3300046459 Bacteria 3431
960 Ga0495629_0187408 3300046459 Bacteria 1433
961 Ga0495651_0003555 3300046462 Bacteria 11954
962 Ga0495651_0008771 3300046462 Bacteria 7755
963 Ga0495651_0045518 3300046462 Bacteria 3399
964 Ga0495651_0776946 3300046462 Bacteria 592
965 Ga0495653_0008223 3300046463 Bacteria 8547
966 Ga0495653_0013047 3300046463 Bacteria 6776
967 Ga0495653_0038995 3300046463 Bacteria 3725
968 Ga0495580_0020835 3300046472 Bacteria 4846
969 Ga0495580_0027574 3300046472 Bacteria 4131
970 Ga0495580_0068306 3300046472 Bacteria 2485
971 Ga0495580_0265237 3300046472 Bacteria 1174
972 Ga0495582_0003973 3300046473 Bacteria 8309
973 Ga0495582_0092377 3300046473 Bacteria 1688
974 Ga0495582_0145948 3300046473 Bacteria 1342
975 Ga0495582_0158335 3300046473 Bacteria 1287
976 Ga0495582_0688633 3300046473 Bacteria 591
977 Ga0495639_0000173 3300046475 Bacteria 33769
978 Ga0495639_0007843 3300046475 Bacteria 4589
979 Ga0495639_0027721 3300046475 Bacteria 2508
980 Ga0495639_0086190 3300046475 Bacteria 1468
981 Ga0495662_0008864 3300046476 Bacteria 4941
982 Ga0495662_0021218 3300046476 Bacteria 3140
983 Ga0495662_0131216 3300046476 Bacteria 1232
984 Ga0495662_0551638 3300046476 Bacteria 564
985 Ga0495664_0008641 3300046477 Bacteria 5682
986 Ga0495664_0286742 3300046477 Bacteria 994
987 Ga0495664_0610620 3300046477 Bacteria 648
988 Ga0495594_0013003 3300046499 Bacteria 4341
989 Ga0495594_0035214 3300046499 Bacteria 2726
990 Ga0495594_0035810 3300046499 Bacteria 2705
991 Ga0495594_0083405 3300046499 Bacteria 1787
992 Ga0495594_0109048 3300046499 Bacteria 1560
993 Ga0495594_0265785 3300046499 Bacteria 977
994 Ga0495594_0312543 3300046499 Bacteria 895
995 Ga0495608_0007840 3300046511 Bacteria 7507
996 Ga0495608_0008110 3300046511 Bacteria 7382
997 Ga0495608_0014029 3300046511 Bacteria 5560
998 Ga0495618_0011447 3300046514 Bacteria 5381
999 Ga0495628_0003031 3300046516 Bacteria 15057
1000 Ga0495628_0039285 3300046516 Bacteria 3785
1001 Ga0495628_0114286 3300046516 Bacteria 2074
1002 Ga0495628_0154353 3300046516 Bacteria 1747
1003 Ga0495628_0385085 3300046516 Bacteria 1026
1004 Ga0495628_0532296 3300046516 Bacteria 845
1005 Ga0495630_0008869 3300046517 Bacteria 7221
1006 Ga0495630_0089504 3300046517 Bacteria 2325
1007 Ga0495630_0093418 3300046517 Bacteria 2274
1008 Ga0495630_0134530 3300046517 Bacteria 1878
1009 Ga0495630_0204939 3300046517 Bacteria 1505
1010 Ga0495630_0385477 3300046517 Bacteria 1073
1011 Ga0495652_0019412 3300046529 Bacteria 6054
1012 Ga0495652_0028078 3300046529 Bacteria 4956
1013 Ga0495652_0059656 3300046529 Bacteria 3227
1014 Ga0495665_0004339 3300046531 Bacteria 7655
1015 Ga0495665_0007184 3300046531 Bacteria 6010
1016 Ga0495665_0023006 3300046531 Bacteria 3347
1017 Ga0495665_0041547 3300046531 Bacteria 2448
1018 Ga0495665_0045874 3300046531 Bacteria 2322
1019 Ga0495640_0001785 3300046533 Bacteria 17070
1020 Ga0495586_0020702 3300046535 Bacteria 3503
1021 Ga0495586_0021575 3300046535 Bacteria 3434
1022 Ga0495586_0024612 3300046535 Bacteria 3220
1023 Ga0495586_0903734 3300046535 Bacteria 509
1024 Ga0495587_0004098 3300046536 Bacteria 9643
1025 Ga0495587_0008030 3300046536 Bacteria 6813
1026 Ga0495587_0069962 3300046536 Bacteria 2043
1027 Ga0495598_0098224 3300046537 Bacteria 965
1028 Ga0495645_0000123 3300046543 Bacteria 52408
1029 Ga0495645_0000203 3300046543 Bacteria 42525
1030 Ga0495645_0000449 3300046543 Bacteria 28285
1031 Ga0495645_0131675 3300046543 Bacteria 1752
1032 Ga0495645_0143396 3300046543 Bacteria 1665
1033 Ga0495667_0016878 3300046559 Bacteria 4929
1034 Ga0495667_0020377 3300046559 Bacteria 4475
1035 Ga0495667_0030065 3300046559 Bacteria 3652
1036 Ga0495667_0030900 3300046559 Bacteria 3597
1037 Ga0495667_0129581 3300046559 Bacteria 1627
1038 Ga0495634_0048722 3300046642 Bacteria 2851
1039 Ga0495634_0202499 3300046642 Bacteria 1232
1040 Ga0495635_0003518 3300046663 Bacteria 10835
1041 Ga0495635_0022908 3300046663 Bacteria 4353
1042 Ga0495635_0081557 3300046663 Bacteria 2213
1043 Ga0495635_0792706 3300046663 Bacteria 611
1044 Ga0495588_0008185 3300046674 Bacteria 4785
1045 Ga0495588_0020829 3300046674 Bacteria 3227
1046 Ga0495588_0126791 3300046674 Bacteria 1346
1047 Ga0495657_0008172 3300046675 Bacteria 8019
1048 Ga0495657_0011202 3300046675 Bacteria 6716
1049 Ga0495657_0053753 3300046675 Bacteria 2693
1050 Ga0495657_0176077 3300046675 Bacteria 1315
1051 Ga0495599_0002570 3300046678 Bacteria 10574
1052 Ga0495599_0004727 3300046678 Bacteria 8089
1053 Ga0495599_0056655 3300046678 Bacteria 2453
1054 Ga0495599_0088210 3300046678 Bacteria 1937
1055 Ga0495599_0336064 3300046678 Bacteria 907
1056 Ga0495623_0001257 3300046679 Bacteria 17210
1057 Ga0495623_0002189 3300046679 Bacteria 13034
1058 Ga0495623_0011984 3300046679 Bacteria 5617
1059 Ga0495623_0144765 3300046679 Bacteria 1410
1060 Ga0495623_0407392 3300046679 Bacteria 730
1061 Ga0495646_0007522 3300046680 Bacteria 6922
1062 Ga0495646_0024265 3300046680 Bacteria 3819
1063 Ga0495646_0032930 3300046680 Bacteria 3223
1064 Ga0495646_0236661 3300046680 Bacteria 982
1065 Ga0495647_0157924 3300046681 Bacteria 976
1066 Ga0495658_0010641 3300046683 Bacteria 4604
1067 Ga0495658_0164147 3300046683 Bacteria 1371
1068 Ga0495658_0217643 3300046683 Bacteria 1195
1069 Ga0495658_0391182 3300046683 Bacteria 886
1070 Ga0495613_0037042 3300046689 Bacteria 3617
1071 Ga0495613_0043625 3300046689 Bacteria 3318
1072 Ga0495613_0073223 3300046689 Bacteria 2496
1073 Ga0495613_0091958 3300046689 Bacteria 2197
1074 Ga0495613_0181521 3300046689 Bacteria 1490
1075 Ga0495600_0000945 3300046809 Bacteria 15638
1076 Ga0495600_0034113 3300046809 Bacteria 3304
1077 Ga0495600_0160130 3300046809 Bacteria 1455
1078 Ga0495600_0180435 3300046809 Bacteria 1361
1079 Ga0495600_0371891 3300046809 Bacteria 893
1080 Ga0495600_0386844 3300046809 Bacteria 872
1081 Ga0495581_0001138 3300047315 Bacteria 14569
1082 Ga0495581_0054904 3300047315 Bacteria 2299
1083 Ga0495581_0091339 3300047315 Bacteria 1766
1084 Ga0495581_0135260 3300047315 Bacteria 1437
1085 Ga0495581_0529961 3300047315 Bacteria 684
1086 Ga0495604_0002093 3300047317 Bacteria 16057
1087 Ga0495604_0002278 3300047317 Bacteria 15366
1088 Ga0495604_0005843 3300047317 Bacteria 9754
1089 Ga0495604_0489468 3300047317 Bacteria 799
1090 Ga0495674_0014329 3300047319 Bacteria 7424
1091 Ga0495674_0029532 3300047319 Bacteria 4991
1092 Ga0495674_0037421 3300047319 Bacteria 4360
1093 Ga0495674_0050061 3300047319 Bacteria 3687
1094 Ga0495674_0266908 3300047319 Bacteria 1405
1095 Ga0495674_0504179 3300047319 Bacteria 968
1096 Ga0495680_0019665 3300047322 Bacteria 5698
1097 Ga0495680_0039761 3300047322 Bacteria 3750
1098 Ga0495680_0165727 3300047322 Bacteria 1602
1099 Ga0495680_0299514 3300047322 Bacteria 1129
1100 Ga0495675_0000928 3300047444 Bacteria 17808
1101 Ga0495675_0003105 3300047444 Bacteria 9975
1102 Ga0495675_0018865 3300047444 Bacteria 4382
1103 Ga0495675_0074535 3300047444 Bacteria 2138
1104 Ga0495675_0130108 3300047444 Bacteria 1565
1105 Ga0495684_0004117 3300047471 Bacteria 11359
1106 Ga0495684_0008778 3300047471 Bacteria 7814
1107 Ga0495684_0033216 3300047471 Bacteria 3959
1108 Ga0495684_0035384 3300047471 Bacteria 3830
1109 Ga0495684_0156608 3300047471 Bacteria 1701
1110 Ga0495684_0931140 3300047471 Bacteria 557
1111 Ga0495593_0001537 3300047673 Bacteria 13596
1112 Ga0495593_0113084 3300047673 Bacteria 1385
1113 Ga0495593_0464991 3300047673 Bacteria 633
1114 Ga0495602_0046688 3300048088 Bacteria 3910
1115 Ga0495602_0048459 3300048088 Bacteria 3818
1116 Ga0495602_0058223 3300048088 Bacteria 3384
1117 Ga0495602_0490932 3300048088 Bacteria 860
1118 Ga0495614_0002391 3300048089 Bacteria 8345
1119 Ga0496104_0113294 3300048907 Bacteria 2601
1120 Ga0496104_0247426 3300048907 Bacteria 1696
1121 Ga0496105_0432462 3300048908 Bacteria 1041
1122 Ga0496108_0066840 3300048911 Bacteria 3032
1123 Ga0496108_0488381 3300048911 Bacteria 1076
1124 Ga0496110_0019549 3300048913 Bacteria 5703
1125 Ga0496110_0324947 3300048913 Bacteria 1401
1126 Ga0496111_0214843 3300048914 Bacteria 1428
1127 Ga0496112_0000380 3300048915 Bacteria 29128
1128 Ga0496112_0008647 3300048915 Bacteria 9129
1129 Ga0496113_0078381 3300048916 Bacteria 2528
1130 Ga0496113_0133699 3300048916 Bacteria 1948
1131 Ga0496113_0204244 3300048916 Bacteria 1571
1132 Ga0496115_0085213 3300048918 Bacteria 2577
1133 Ga0496115_0215521 3300048918 Bacteria 1585
1134 Ga0496115_0379704 3300048918 Bacteria 1149
1135 Ga0496115_0445469 3300048918 Bacteria 1047
1136 Ga0501033_0009389 3300049570 Bacteria 7532
1137 Ga0501034_0064819 3300049571 Bacteria 3667
1138 Ga0501034_0093575 3300049571 Bacteria 3002
1139 Ga0501036_0138842 3300049572 Bacteria 2051
1140 Ga0501036_0480592 3300049572 Bacteria 1034
1141 Ga0501041_0145698 3300049577 Bacteria 1478
1142 Ga0501043_0139998 3300049579 Bacteria 1895
1143 Ga0501046_0266959 3300049580 Bacteria 1256
1144 Ga0501047_0280875 3300049581 Bacteria 1510
1145 Ga0501048_1262601 3300049582 Bacteria 531
1146 Ga0501069_0396706 3300049585 Bacteria 816
1147 Ga0501071_0301931 3300049587 Bacteria 1214
1148 Ga0501073_0325330 3300049589 Bacteria 1061
1149 Ga0501075_1129714 3300049591 Bacteria 595
1150 Ga0501202_023241 3300049652 Bacteria 1249
1151 Ga0501235_041663 3300049669 Bacteria 1051
1152 Ga0501235_130907 3300049669 Bacteria 635
1153 Ga0501242_005162 3300049674 Bacteria 1463
1154 Ga0501249_010911 3300049679 Bacteria 1904
1155 Ga0501251_034261 3300049681 Bacteria 740
1156 Ga0501259_062828 3300049688 Bacteria 780
1157 Ga0501081_0161320 3300049743 Bacteria 1615
1158 Ga0501273_011928 3300049770 Bacteria 1089
1159 Ga0501035_0021741 3300049822 Bacteria 5898
1160 Ga0501044_0011009 3300049823 Bacteria 9818
1161 Ga0501044_0240530 3300049823 Bacteria 1754
1162 Ga0501212_023327 3300049851 Bacteria 969
1163 nmdc:mga05p37_119023_c1 3300050507 Bacteria 3245
1164 nmdc:mga05p37_138461_c1 3300050507 Bacteria 2983
1165 nmdc:mga05p37_181428_c1 3300050507 Bacteria 2561
1166 nmdc:mga05p37_220243_c1 3300050507 Bacteria 2290
1167 nmdc:mga05p37_268558_c1 3300050507 Bacteria 2039
1168 nmdc:mga05p37_35010_c1 3300050507 Bacteria 6155
1169 nmdc:mga05p37_394940_c1 3300050507 Bacteria 1616
1170 nmdc:mga09592_122464_c1 3300050508 Bacteria 2234
1171 nmdc:mga09592_153233_c1 3300050508 Bacteria 1989
1172 nmdc:mga09592_62757_c1 3300050508 Bacteria 3144
1173 nmdc:mga0qj67_152287_c1 3300050509 Bacteria 1876
1174 nmdc:mga0qj67_2195_c1 3300050509 Bacteria 13871
1175 nmdc:mga0qj67_289250_c1 3300050509 Bacteria 1328
1176 nmdc:mga0qj67_507124_c1 3300050509 Bacteria 970
1177 nmdc:mga0qj67_522837_c1 3300050509 Unclassified 953
1178 nmdc:mga0qj67_574465_c1 3300050509 Bacteria 903
1179 nmdc:mga0qj67_63801_c1 3300050509 Bacteria 2929
1180 nmdc:mga0qj67_64043_c1 3300050509 Bacteria 2923
1181 nmdc:mga0qj67_76504_c1 3300050509 Bacteria 2677
1182 nmdc:mga06r32_63239_c1 3300050510 Bacteria 3566
1183 nmdc:mga06r32_706376_c1 3300050510 Bacteria 974
1184 nmdc:mga06r32_95601_c1 3300050510 Bacteria 2908
1185 nmdc:mga08y16_1304147_c1 3300050511 Bacteria 693
1186 nmdc:mga08y16_293981_c1 3300050511 Bacteria 1675
1187 nmdc:mga08y16_639401_c1 3300050511 Bacteria 1069
1188 nmdc:mga0n895_12843_c1 3300050512 Bacteria 7524
1189 nmdc:mga0n895_472734_c1 3300050512 Bacteria 1264
1190 nmdc:mga0n895_91106_c1 3300050512 Bacteria 3051
1191 nmdc:mga0rr50_105843_c1 3300050513 Bacteria 2218
1192 nmdc:mga0rr50_1382685_c1 3300050513 Bacteria 596
1193 nmdc:mga0rr50_222795_c1 3300050513 Bacteria 1558
1194 nmdc:mga0rr50_618554_c1 3300050513 Bacteria 924
1195 nmdc:mga0rr50_692535_c1 3300050513 Bacteria 870
1196 nmdc:mga0rr50_75918_c2 3300050513 Bacteria 1803
1197 nmdc:mga08x19_179252_c1 3300050514 Bacteria 1446
1198 nmdc:mga08x19_182803_c1 3300050514 Bacteria 1432
1199 nmdc:mga08x19_643898_c1 3300050514 Bacteria 752
1200 nmdc:mga08x19_70662_c1 3300050514 Bacteria 2275
1201 nmdc:mga08x19_729467_c1 3300050514 Bacteria 703
1202 nmdc:mga08x19_894603_c1 3300050514 Bacteria 631
1203 nmdc:mga0a205_1064627_c1 3300050515 Bacteria 656
1204 nmdc:mga0a205_124546_c1 3300050515 Bacteria 2477
1205 nmdc:mga0a205_2458_c1 3300050515 Bacteria 16351
1206 nmdc:mga0a205_32184_c1 3300050515 Bacteria 5029
1207 nmdc:mga0a205_360718_c1 3300050515 Bacteria 1320
1208 nmdc:mga0a205_39112_c1 3300050515 Bacteria 4564
1209 Ga0495601_0021368 3300053077 Bacteria 3963
1210 Ga0495601_0039127 3300053077 Bacteria 2969
1211 Ga0495601_0084946 3300053077 Bacteria 2033
1212 Ga0495601_0223553 3300053077 Unclassified 1230
1213 Ga0495601_0267803 3300053077 Unclassified 1115
1214 Ga0495601_0478232 3300053077 Bacteria 805
1215 Ga0495612_0002661 3300053078 Bacteria 7370
1216 Ga0495612_0010512 3300053078 Bacteria 3740
1217 Ga0495612_0210275 3300053078 Unclassified 860
1218 Ga0495595_0021390 3300053084 Bacteria 2826
1219 Ga0495595_0276569 3300053084 Bacteria 842
1220 Ga0495595_0480175 3300053084 Bacteria 633
1221 Ga0495619_0018682 3300053085 Bacteria 4400
1222 Ga0495619_0066751 3300053085 Bacteria 2401
1223 Ga0495619_0079921 3300053085 Bacteria 2200
1224 Ga0501084_0867228 3300054114 Bacteria 760
1225 Ga0590075_090169 3300059424 Unclassified 795
1226 Ga0207659_10043071
1227 JGI24746J21847_1007663
1228 JGI24738J21930_10060531
1229 Ga0065704_10091146
1230 Ga0065712_10162544
1231 Ga0065715_10120853
1232 Ga0065707_10085983
1233 Ga0065707_10100397
1234 Ga0070658_10027902
1235 Ga0070658_10184036
1236 Ga0070658_10248408
1237 Ga0070658_10485306
1238 Ga0070658_10578041
1239 Ga0070676_10000129
1240 Ga0070676_10123050
1241 Ga0070676_10216867
1242 Ga0070683_100000272
1243 Ga0070683_100007464
1244 Ga0070683_100026903
1245 Ga0070683_100035492
1246 Ga0070683_100056471
1247 Ga0070683_100062372
1248 Ga0070683_100096817
1249 Ga0070683_100097260
1250 Ga0070683_100122534
1251 Ga0070683_100151322
1252 Ga0070683_100276081
1253 Ga0070683_100280596
1254 Ga0070683_100423518
1255 Ga0070683_100458912
1256 Ga0070683_100508692
1257 Ga0070690_100030647
1258 Ga0070690_100047103
1259 Ga0070690_100130240
1260 Ga0070690_100510046
1261 Ga0070690_100630247
1262 Ga0070670_100005164
1263 Ga0070670_100011537
1264 Ga0070670_100018847
1265 Ga0070670_100121525
1266 Ga0070677_10038443
1267 Ga0070677_10063750
1268 Ga0068869_100006238
1269 Ga0068869_100058058
1270 Ga0068869_100219393
1271 Ga0068869_100301014
1272 Ga0068869_101312127
1273 Ga0070666_10038190
1274 Ga0070666_10384435
1275 Ga0070666_10547173
1276 Ga0070680_100000060
1277 Ga0070680_100001824
1278 Ga0070680_100004967
1279 Ga0070680_100005079
1280 Ga0070680_100021540
1281 Ga0070680_100036311
1282 Ga0070680_100062033
1283 Ga0070680_100221865
1284 Ga0070680_100421090
1285 Ga0070680_100487717
1286 Ga0070680_100622526
1287 Ga0070680_101042659
1288 Ga0070682_100011928
1289 Ga0070682_100017108
1290 Ga0070682_100190706
1291 Ga0070682_100239123
1292 Ga0070682_100338451
1293 Ga0070682_100670732
1294 Ga0070682_100704548
1295 Ga0070682_100735598
1296 Ga0068868_100007660
1297 Ga0068868_100050548
1298 Ga0068868_100235919
1299 Ga0070660_100282432
1300 Ga0070660_100643512
1301 Ga0070660_100786210
1302 Ga0070689_100031979
1303 Ga0070689_100796186
1304 Ga0070691_10000263
1305 Ga0070691_10029661
1306 Ga0070691_10098068
1307 Ga0070691_10108524
1308 Ga0070687_100003047
1309 Ga0070687_100208926
1310 Ga0070687_100213710
1311 Ga0070687_100767718
1312 Ga0070661_100001442
1313 Ga0070661_100001955
1314 Ga0070661_100128833
1315 Ga0070661_100336530
1316 Ga0070661_100439141
1317 Ga0070661_100614334
1318 Ga0070692_10004699
1319 Ga0070692_10492683
1320 Ga0070668_100000732
1321 Ga0070668_100096643
1322 Ga0070668_100432099
1323 Ga0070668_100617497
1324 Ga0070669_100003510
1325 Ga0070669_100004021
1326 Ga0070669_100083955
1327 Ga0070669_100582560
1328 Ga0070675_100001283
1329 Ga0070675_100002017
1330 Ga0070675_100035903
1331 Ga0070675_100072173
1332 Ga0070671_100052688
1333 Ga0070671_100121841
1334 Ga0070671_100133781
1335 Ga0070671_100410296
1336 Ga0070674_100242413
1337 Ga0070674_100275847
1338 Ga0070674_100542228
1339 Ga0070673_100044957
1340 Ga0070673_100057589
1341 Ga0070673_100083618
1342 Ga0070673_100097481
1343 Ga0070673_100348112
1344 Ga0070673_100536576
1345 Ga0070688_100010384
1346 Ga0070688_100066384
1347 Ga0070688_100287498
1348 Ga0070688_100721449
1349 Ga0070659_100015466
1350 Ga0070659_100016463
1351 Ga0070659_100165237
1352 Ga0070659_100278390
1353 Ga0070667_100003520
1354 Ga0070667_100056035
1355 Ga0070667_100096766
1356 Ga0070667_100126126
1357 Ga0070667_100152022
1358 Ga0070667_100355738
1359 Ga0070709_10011503
1360 Ga0070709_10014916
1361 Ga0070709_10084226
1362 Ga0070709_10097259
1363 Ga0070709_10238038
1364 Ga0070709_10404340
1365 Ga0070714_100004782
1366 Ga0070714_100008339
1367 Ga0070714_100125379
1368 Ga0070714_100459824
1369 Ga0070714_101079698
1370 Ga0070713_100001880
1371 Ga0070713_100016596
1372 Ga0070713_100027133
1373 Ga0070713_100052558
1374 Ga0070713_100118868
1375 Ga0070713_100259761
1376 Ga0070710_10031760
1377 Ga0070701_10004074
1378 Ga0070701_10018898
1379 Ga0070701_10060398
1380 Ga0070701_10322201
1381 Ga0070701_10682901
1382 Ga0070711_100174829
1383 Ga0070711_100225842
1384 Ga0070711_100294553
1385 Ga0070711_100322423
1386 Ga0070711_100553444
1387 Ga0070705_100196654
1388 Ga0070700_100511278
1389 Ga0070694_100000130
1390 Ga0070694_100055653
1391 Ga0070694_100324326
1392 Ga0070694_100438419
1393 Ga0070708_100000056
1394 Ga0070708_100034750
1395 Ga0070708_100119510
1396 Ga0070708_100245018
1397 Ga0070708_100625476
1398 Ga0070678_100081946
1399 Ga0070678_100167564
1400 Ga0070678_100796513
1401 Ga0070678_100861986
1402 Ga0070662_100018767
1403 Ga0070662_100420873
1404 Ga0070662_100444134
1405 Ga0070662_100519396
1406 Ga0070681_10000084
1407 Ga0070681_10001135
1408 Ga0070681_10003261
1409 Ga0070681_10011033
1410 Ga0070681_10020623
1411 Ga0070681_10118709
1412 Ga0070681_10212002
1413 Ga0070681_10222265
1414 Ga0070681_10492455
1415 Ga0068867_100065315
1416 Ga0068867_100186836
1417 Ga0070685_10016062
1418 Ga0070706_100035529
1419 Ga0070706_100268778
1420 Ga0070707_100102043
1421 Ga0070707_100312659
1422 Ga0070707_100544616
1423 Ga0070707_100600786
1424 Ga0070707_101567843
1425 Ga0070698_100000081
1426 Ga0070698_100010819
1427 Ga0070698_100071699
1428 Ga0070698_100145599
1429 Ga0070698_100274567
1430 Ga0070699_100084690
1431 Ga0070699_101582721
1432 Ga0070679_100001687
1433 Ga0070679_100002225
1434 Ga0070679_100006082
1435 Ga0070679_100012338
1436 Ga0070679_100042029
1437 Ga0070679_100100882
1438 Ga0070679_100489833
1439 Ga0070684_100000133
1440 Ga0070684_100004534
1441 Ga0070684_100008387
1442 Ga0070684_100023290
1443 Ga0070684_100030976
1444 Ga0070684_100074507
1445 Ga0070684_100155171
1446 Ga0070684_100171775
1447 Ga0070684_100175256
1448 Ga0070684_100211927
1449 Ga0070684_100242897
1450 Ga0070684_100328001
1451 Ga0070684_101216090
1452 Ga0070684_101296347
1453 Ga0070697_100302961
1454 Ga0070697_101177699
1455 Ga0068853_100088346
1456 Ga0068853_100169145
1457 Ga0068853_100421899
1458 Ga0068853_101014935
1459 Ga0070672_100005354
1460 Ga0070672_100026328
1461 Ga0070672_100683867
1462 Ga0070686_100091844
1463 Ga0070686_100234103
1464 Ga0070686_100293920
1465 Ga0070686_100748204
1466 Ga0070695_100149869
1467 Ga0070695_100175521
1468 Ga0070695_100222032
1469 Ga0070696_100000112
1470 Ga0070696_100045267
1471 Ga0070696_100349816
1472 Ga0070693_100002520
1473 Ga0070693_100017497
1474 Ga0070693_100029019
1475 Ga0070693_100494938
1476 Ga0070693_100682729
1477 Ga0070665_100016720
1478 Ga0070704_100123300
1479 Ga0070704_100169715
1480 Ga0070704_100261286
1481 Ga0070704_101347518
1482 Ga0068855_100023850
1483 Ga0068855_100104599
1484 Ga0068855_100267583
1485 Ga0068855_100906548
1486 Ga0068855_100994024
1487 Ga0070664_100073583
1488 Ga0070664_100092529
1489 Ga0070664_100093640
1490 Ga0070664_100189739
1491 Ga0070664_100229200
1492 Ga0070664_100248972
1493 Ga0070664_100638554
1494 Ga0070664_101029009
1495 Ga0070664_101130937
1496 Ga0068857_100000089
1497 Ga0068857_100007141
1498 Ga0068857_100087950
1499 Ga0068857_100109494
1500 Ga0068854_100268560
1501 Ga0068854_100549822
1502 Ga0068856_100001425
1503 Ga0068856_100029136
1504 Ga0068856_100043400
1505 Ga0068856_100741228
1506 Ga0070702_100014302
1507 Ga0070702_100159864
1508 Ga0068852_100114873
1509 Ga0068852_100154717
1510 Ga0068852_100260833
1511 Ga0068859_100153223
1512 Ga0068859_100234291
1513 Ga0068859_100317592
1514 Ga0068859_100637808
1515 Ga0068864_100035042
1516 Ga0068864_100045968
1517 Ga0068864_100079228
1518 Ga0068864_100658958
1519 Ga0068866_10074723
1520 Ga0068866_10297950
1521 Ga0068861_100001219
1522 Ga0068861_100028486
1523 Ga0068861_100343650
1524 Ga0068851_10039319
1525 Ga0068851_10178483
1526 Ga0068870_10085423
1527 Ga0068870_10094657
1528 Ga0068870_10134120
1529 Ga0068863_100005540
1530 Ga0068863_100309794
1531 Ga0068858_100005050
1532 Ga0068858_100238446
1533 Ga0068858_100441636
1534 Ga0068858_100470200
1535 Ga0068860_100005336
1536 Ga0068860_100460594
1537 Ga0068860_100985295
1538 Ga0068860_101027208
1539 Ga0068862_100000130
1540 Ga0068862_100039945
1541 Ga0068862_100052626
1542 Ga0068862_100525909
1543 Ga0081455_10148673
1544 Ga0081539_10000104
1545 Ga0081539_10008024
1546 Ga0081539_10175407
1547 Ga0070717_10002126
1548 Ga0070717_10125849
1549 Ga0070717_10410589
1550 Ga0070716_100178616
1551 Ga0070716_100215962
1552 Ga0070716_100236560
1553 Ga0070712_100171795
1554 Ga0070712_101294939
1555 Ga0097621_100058255
1556 Ga0097621_100270368
1557 Ga0097621_100554898
1558 Ga0097621_100838151
1559 Ga0068871_100051487
1560 Ga0068871_100088940
1561 Ga0068871_100335304
1562 Ga0075428_100007881
1563 Ga0075428_100129846
1564 Ga0075428_100177084
1565 Ga0075428_100191331
1566 Ga0075428_100243344
1567 Ga0075428_100274833
1568 Ga0075428_100515688
1569 Ga0075430_100000326
1570 Ga0075430_100026971
1571 Ga0075430_100027788
1572 Ga0075430_100062884
1573 Ga0075430_100170111
1574 Ga0075430_100449972
1575 Ga0075431_100066661
1576 Ga0075431_100081655
1577 Ga0075431_100165983
1578 Ga0075431_100296593
1579 Ga0075431_100567817
1580 Ga0075433_10002025
1581 Ga0075433_10008881
1582 Ga0075433_10078455
1583 Ga0075433_10113423
1584 Ga0075433_10443083
1585 Ga0075434_100015209
1586 Ga0075434_100016167
1587 Ga0075434_100019855
1588 Ga0075434_100049905
1589 Ga0075434_100132049
1590 Ga0075434_100796716
1591 Ga0075429_100006201
1592 Ga0075429_100261689
1593 Ga0068865_100001505
1594 Ga0068865_100031600
1595 Ga0068865_100058886
1596 Ga0068865_100131956
1597 Ga0068865_100252699
1598 Ga0068865_100964073
1599 Ga0075436_100024099
1600 Ga0075436_100109055
1601 Ga0075436_100344170
1602 Ga0097620_100153226
1603 Ga0097620_100234295
1604 Ga0097620_100317600
1605 Ga0097620_100637836
1606 Ga0075435_100011632
1607 Ga0075435_100178036
1608 Ga0075435_100190967
1609 Ga0075435_100229326
1610 Ga0075435_100385781
1611 Ga0099794_10108902
1612 Ga0099795_10034286
1613 Ga0105240_10078343
1614 Ga0105240_10083403
1615 Ga0105240_10176093
1616 Ga0105240_10369502
1617 Ga0105240_10589245
1618 Ga0105240_10600681
1619 Ga0105240_10639945
1620 Ga0111539_10033701
1621 Ga0111539_10164313
1622 Ga0111539_10167584
1623 Ga0111539_10171639
1624 Ga0111539_10178509
1625 Ga0111539_10521606
1626 Ga0111539_10663938
1627 Ga0105245_10053096
1628 Ga0105245_10059463
1629 Ga0105245_10088834
1630 Ga0105245_10177900
1631 Ga0105245_10243319
1632 Ga0105247_10150714
1633 Ga0114129_10036603
1634 Ga0114129_10057151
1635 Ga0114129_10245030
1636 Ga0114129_10253731
1637 Ga0114129_10325190
1638 Ga0114129_11971150
1639 Ga0105243_10253602
1640 Ga0105243_10282454
1641 Ga0105243_10825386
1642 Ga0105243_11022357
1643 Ga0105241_10000741
1644 Ga0105241_10019881
1645 Ga0105242_10094362
1646 Ga0105242_10101391
1647 Ga0105242_10124885
1648 Ga0105242_10125041
1649 Ga0105242_10149118
1650 Ga0105242_10291796
1651 Ga0105242_11112696
1652 Ga0105248_10018118
1653 Ga0105248_10065014
1654 Ga0105248_10306504
1655 Ga0105248_10316299
1656 Ga0105248_10359677
1657 Ga0105248_10415864
1658 Ga0105237_10224412
1659 Ga0105237_10553243
1660 Ga0105237_10598650
1661 Ga0105238_10540992
1662 Ga0105238_10563894
1663 Ga0105238_11232100
1664 Ga0105249_10000750
1665 Ga0105249_10002711
1666 Ga0105249_10507064
1667 Ga0105249_10923250
1668 Ga0105249_11223170
1669 Ga0105239_10083353
1670 Ga0105239_10111985
1671 Ga0105239_10796595
1672 Ga0105239_10910207
1673 Ga0105246_10000048
1674 Ga0105246_10083893
1675 Ga0157327_1011495
1676 Ga0157373_10008981
1677 Ga0157371_10004866
1678 Ga0157371_10022660
1679 Ga0157371_10185402
1680 Ga0157371_10792828
1681 Ga0157370_10022231
1682 Ga0157370_10098527
1683 Ga0157370_10294481
1684 Ga0157370_10298460
1685 Ga0157370_11316530
1686 Ga0157369_10000885
1687 Ga0157369_10103688
1688 Ga0157369_10152158
1689 Ga0157369_10513591
1690 Ga0157369_10746867
1691 Ga0157374_10041992
1692 Ga0157374_10621567
1693 Ga0157374_11033201
1694 Ga0157378_10074090
1695 Ga0157378_10252859
1696 Ga0157378_10295293
1697 Ga0157378_10395811
1698 Ga0157378_11725049
1699 Ga0163162_10001389
1700 Ga0163162_10008153
1701 Ga0163162_10734895
1702 Ga0163162_10899476
1703 Ga0163162_11539040
1704 Ga0157372_10000963
1705 Ga0157372_10006156
1706 Ga0157372_10015400
1707 Ga0157372_10132547
1708 Ga0157372_10325442
1709 Ga0157372_10341715
1710 Ga0157372_10373968
1711 Ga0157372_10534070
1712 Ga0157372_10914558
1713 Ga0157372_11196490
1714 Ga0157372_11247510
1715 Ga0157375_10006794
1716 Ga0157375_10012226
1717 Ga0157375_10025375
1718 Ga0157375_10025502
1719 Ga0157375_10201273
1720 Ga0157375_10250475
1721 Ga0163163_10003767
1722 Ga0163163_10029145
1723 Ga0163163_10305923
1724 Ga0163163_10742037
1725 Ga0157380_10100477
1726 Ga0157380_10241620
1727 Ga0157377_10006106
1728 Ga0157377_10067267
1729 Ga0157377_10100239
1730 Ga0157379_10001582
1731 Ga0157379_11186242
1732 Ga0157376_10019042
1733 Ga0157376_10124451
1734 Ga0157376_10314599
1735 Ga0157376_10439742
1736 Ga0157376_11824593
1737 Ga0182007_10197306
1738 Ga0182005_1050076
1739 Ga0182005_1170866
1740 Ga0163161_10007616
1741 Ga0163161_10261208
1742 Ga0163161_10585454
1743 Ga0206350_11560318
1744 Ga0206354_11146190
1745 Ga0206353_10444321
1746 Ga0206353_10585941
1747 Ga0224712_10002762
1748 Ga0224712_10003065
1749 Ga0224712_10166504
1750 Ga0207697_10001440
1751 Ga0207656_10198853
1752 Ga0207682_10079917
1753 Ga0207682_10083605
1754 Ga0207692_10257425
1755 Ga0207642_10138474
1756 Ga0207688_10077333
1757 Ga0207680_10457704
1758 Ga0207647_10077986
1759 Ga0207647_10644834
1760 Ga0207685_10184696
1761 Ga0207699_10001907
1762 Ga0207699_10076190
1763 Ga0207699_10078723
1764 Ga0207699_10079131
1765 Ga0207699_10196335
1766 Ga0207699_10250141
1767 Ga0207699_10426684
1768 Ga0207645_10000196
1769 Ga0207645_10027561
1770 Ga0207645_10093755
1771 Ga0207645_10106644
1772 Ga0207645_10141556
1773 Ga0207643_10006469
1774 Ga0207643_10047025
1775 Ga0207643_10122683
1776 Ga0207643_10217390
1777 Ga0207705_10101761
1778 Ga0207705_10125236
1779 Ga0207705_11061371
1780 Ga0207684_10080753
1781 Ga0207684_10131219
1782 Ga0207654_10000564
1783 Ga0207654_10037194
1784 Ga0207654_10145844
1785 Ga0207707_10001737
1786 Ga0207707_10001810
1787 Ga0207707_10041155
1788 Ga0207707_10060452
1789 Ga0207707_10061964
1790 Ga0207707_10077929
1791 Ga0207707_10164576
1792 Ga0207707_10296323
1793 Ga0207707_10306835
1794 Ga0207695_10009046
1795 Ga0207695_10254071
1796 Ga0207695_10257636
1797 Ga0207671_10246023
1798 Ga0207693_10002541
1799 Ga0207693_10062878
1800 Ga0207693_10071012
1801 Ga0207693_10344562
1802 Ga0207693_10527409
1803 Ga0207663_10088789
1804 Ga0207663_10403088
1805 Ga0207663_10868494
1806 Ga0207660_10000019
1807 Ga0207660_10011773
1808 Ga0207660_10026350
1809 Ga0207660_10040784
1810 Ga0207660_10063863
1811 Ga0207660_10623402
1812 Ga0207662_10000726
1813 Ga0207662_10007764
1814 Ga0207662_10011767
1815 Ga0207662_10181725
1816 Ga0207662_10497783
1817 Ga0207657_10355739
1818 Ga0207657_10400247
1819 Ga0207657_10918710
1820 Ga0207649_10011507
1821 Ga0207649_10012915
1822 Ga0207649_10015103
1823 Ga0207649_10076884
1824 Ga0207649_10311185
1825 Ga0207649_10500455
1826 Ga0207649_10806358
1827 Ga0207652_10002559
1828 Ga0207652_10003676
1829 Ga0207652_10004181
1830 Ga0207652_10006723
1831 Ga0207652_10011841
1832 Ga0207652_10055734
1833 Ga0207652_10117155
1834 Ga0207652_10138005
1835 Ga0207646_10221326
1836 Ga0207646_10554363
1837 Ga0207646_10824482
1838 Ga0207681_10001072
1839 Ga0207681_10065845
1840 Ga0207681_10067189
1841 Ga0207681_10158958
1842 Ga0207681_10710979
1843 Ga0207694_10121362
1844 Ga0207694_10440810
1845 Ga0207694_10547101
1846 Ga0207694_10578321
1847 Ga0207650_10012270
1848 Ga0207650_10014277
1849 Ga0207650_10022934
1850 Ga0207650_10113114
1851 Ga0207659_10004530
1852 Ga0207659_10005975
1853 Ga0207659_10006090
1854 Ga0207659_10055807
1855 Ga0207659_10078350
1856 Ga0207659_10285465
1857 Ga0207687_10042625
1858 Ga0207687_10062300
1859 Ga0207687_10077463
1860 Ga0207687_10087950
1861 Ga0207687_10188387
1862 Ga0207700_10001041
1863 Ga0207700_10004547
1864 Ga0207700_10026675
1865 Ga0207700_10082732
1866 Ga0207700_11059445
1867 Ga0207664_10009493
1868 Ga0207664_10025835
1869 Ga0207664_10317024
1870 Ga0207664_10485950
1871 Ga0207664_10577819
1872 Ga0207644_10128908
1873 Ga0207644_10218927
1874 Ga0207690_10015144
1875 Ga0207690_10020657
1876 Ga0207690_10238792
1877 Ga0207690_10313388
1878 Ga0207690_10544138
1879 Ga0207706_10046594
1880 Ga0207706_10196120
1881 Ga0207706_10583279
1882 Ga0207686_10021306
1883 Ga0207686_10066037
1884 Ga0207686_10112639
1885 Ga0207709_10146614
1886 Ga0207709_10317230
1887 Ga0207709_10372858
1888 Ga0207709_10376293
1889 Ga0207670_10052301
1890 Ga0207670_10103531
1891 Ga0207669_10025008
1892 Ga0207669_10104487
1893 Ga0207669_10188360
1894 Ga0207704_10026143
1895 Ga0207704_10076805
1896 Ga0207704_10124772
1897 Ga0207704_10452491
1898 Ga0207704_10739830
1899 Ga0207665_10103702
1900 Ga0207665_10190219
1901 Ga0207691_10000643
1902 Ga0207691_10005659
1903 Ga0207691_10042317
1904 Ga0207691_10104472
1905 Ga0207691_10278002
1906 Ga0207691_10480896
1907 Ga0207711_10021350
1908 Ga0207711_10063451
1909 Ga0207711_10066354
1910 Ga0207711_10138144
1911 Ga0207711_10192867
1912 Ga0207711_10312675
1913 Ga0207711_10317897
1914 Ga0207689_10026202
1915 Ga0207689_10030455
1916 Ga0207689_10137264
1917 Ga0207689_10224782
1918 Ga0207689_10292601
1919 Ga0207661_10000075
1920 Ga0207661_10017935
1921 Ga0207661_10031699
1922 Ga0207661_10059871
1923 Ga0207661_10083040
1924 Ga0207661_10124096
1925 Ga0207661_10143734
1926 Ga0207661_10143967
1927 Ga0207661_10436888
1928 Ga0207661_10533811
1929 Ga0207661_10609673
1930 Ga0207661_10875288
1931 Ga0207661_10952838
1932 Ga0207661_10993310
1933 Ga0207661_11042585
1934 Ga0207679_10003103
1935 Ga0207679_10005748
1936 Ga0207679_10139692
1937 Ga0207679_10188493
1938 Ga0207679_10332757
1939 Ga0207679_10490239
1940 Ga0207679_10571101
1941 Ga0207679_10774261
1942 Ga0207679_11210064
1943 Ga0207667_10034423
1944 Ga0207667_10106956
1945 Ga0207667_11123950
1946 Ga0207667_11284477
1947 Ga0207651_10035981
1948 Ga0207651_10058552
1949 Ga0207651_10365104
1950 Ga0207651_10414458
1951 Ga0207651_10988920
1952 Ga0207712_10000417
1953 Ga0207712_10001917
1954 Ga0207712_11341536
1955 Ga0207668_10003575
1956 Ga0207668_10062043
1957 Ga0207668_10132867
1958 Ga0207640_10412230
1959 Ga0207658_10078682
1960 Ga0207658_10291682
1961 Ga0207658_10326586
1962 Ga0207677_10002380
1963 Ga0207677_10047570
1964 Ga0207677_10056431
1965 Ga0207677_10364335
1966 Ga0207703_10118792
1967 Ga0207703_10393301
1968 Ga0207639_10043935
1969 Ga0207639_10306952
1970 Ga0207639_10562911
1971 Ga0207678_10011975
1972 Ga0207678_11040756
1973 Ga0207708_10006844
1974 Ga0207708_10056125
1975 Ga0207708_10218503
1976 Ga0207708_10255434
1977 Ga0207708_10266980
1978 Ga0207702_10000358
1979 Ga0207702_10070288
1980 Ga0207702_10186865
1981 Ga0207641_10027626
1982 Ga0207641_10042327
1983 Ga0207641_10123551
1984 Ga0207648_10007496
1985 Ga0207648_10028448
1986 Ga0207648_10163447
1987 Ga0207648_10411629
1988 Ga0207676_10003976
1989 Ga0207676_10041048
1990 Ga0207676_10277531
1991 Ga0207674_10000028
1992 Ga0207674_10001277
1993 Ga0207674_10006145
1994 Ga0207674_10006616
1995 Ga0207674_10009015
1996 Ga0207674_10009376
1997 Ga0207674_10279501
1998 Ga0207674_10347657
1999 Ga0207675_100000836
2000 Ga0207675_100008771
2001 Ga0207675_100171901
2002 Ga0207675_101147720
2003 Ga0207683_10087983
2004 Ga0207683_11096222
2005 Ga0207698_10084125
2006 Ga0207698_12178323
2007 Ga0209981_1001809
2008 Ga0209996_1004101
2009 Ga0210000_1004988
2010 Ga0209995_1003922
2011 Ga0209968_1005026
2012 Ga0209999_1003479
2013 Ga0207428_10074066
2014 Ga0207428_10117894
2015 Ga0207428_10282053
2016 Ga0207428_10516200
2017 Ga0207428_10699997
2018 Ga0268266_10038059
2019 Ga0268266_10048784
2020 Ga0268265_10000327
2021 Ga0268265_10006692
2022 Ga0268265_10055465
2023 Ga0268265_10368171
2024 Ga0268264_10024337
2025 Ga0268264_10061218
2026 Ga0265332_10011890
2027 Ga0307408_100000925
2028 Ga0307408_100025284
2029 Ga0307408_100069735
2030 Ga0307408_100072485
2031 Ga0307408_100082788
2032 Ga0307408_100319639
2033 Ga0307408_100375931
2034 Ga0265314_10003325
2035 Ga0316578_10029397
2036 Ga0307405_10001095
2037 Ga0307405_10003833
2038 Ga0307405_10126830
2039 Ga0307405_10171344
2040 Ga0307405_10198875
2041 Ga0307405_10468131
2042 Ga0307413_10003062
2043 Ga0307413_10033762
2044 Ga0307413_10037902
2045 Ga0307410_10002803
2046 Ga0307410_10003923
2047 Ga0307410_10005322
2048 Ga0307410_10046079
2049 Ga0307410_10074123
2050 Ga0307410_10205002
2051 Ga0307410_10270209
2052 Ga0307410_10355306
2053 Ga0307406_10000826
2054 Ga0307406_10002975
2055 Ga0307406_10030745
2056 Ga0307406_10056590
2057 Ga0307406_10067051
2058 Ga0307406_10071586
2059 Ga0307406_10248134
2060 Ga0307407_10002762
2061 Ga0307407_10013238
2062 Ga0307407_10016291
2063 Ga0307407_10218349
2064 Ga0307412_10010541
2065 Ga0307412_10182656
2066 Ga0307412_11102858
2067 Ga0307409_100001582
2068 Ga0307409_100046350
2069 Ga0307409_100070565
2070 Ga0307409_100101623
2071 Ga0307409_100111479
2072 Ga0307409_100194725
2073 Ga0307409_100366231
2074 Ga0307409_100963899
2075 Ga0307416_100002942
2076 Ga0307416_100005920
2077 Ga0307416_100070275
2078 Ga0307416_100086305
2079 Ga0307416_100109146
2080 Ga0307416_100421525
2081 Ga0307416_100558403
2082 Ga0307416_100639900
2083 Ga0307416_101127132
2084 Ga0307414_10023116
2085 Ga0307414_10032727
2086 Ga0307414_10546996
2087 Ga0307414_11191140
2088 Ga0307411_10015028
2089 Ga0307411_10021756
2090 Ga0307411_10033902
2091 Ga0307411_10308422
2092 Ga0307411_10525378
2093 Ga0307415_100005454
2094 Ga0307415_100022095
2095 Ga0307415_100037632
2096 Ga0307415_100042151
2097 Ga0307415_100075939
2098 Ga0307415_100178276
2099 Ga0307415_100296294
2100 Ga0307415_100341260
2101 Ga0373926_0005792
2102 Ga0373926_0071391
2103 Ga0373934_0001971
2104 Ga0373934_0008097
2105 Ga0373934_0016071
2106 Ga0373923_0104384
2107 Ga0373945_0280247
2108 Ga0373953_0009228
2109 Ga0373953_0014905
2110 Ga0373953_0026634
2111 Ga0373953_0082749
2112 Ga0373954_0017113
2113 Ga0373954_0087629
2114 Ga0373954_0162697
2115 Ga0373956_0012872
2116 Ga0373957_0011090
2117 Ga0373957_0073242
2118 Ga0373943_0035642
2119 Ga0373943_0082872
2120 Ga0373943_0169430
2121 Ga0373943_0328120
2122 Ga0373946_0001566
2123 Ga0373946_0076989
2124 Ga0373955_0001514
2125 Ga0373955_0041798
2126 Ga0373955_0151852
2127 Ga0373961_0182922
2128 Ga0373962_0065936
2129 Ga0316574_0068370
2130 Ga0373924_0086641
2131 Ga0373924_0104325
2132 Ga0373931_0119694
2133 Ga0373931_0511593
2134 Ga0373931_0950701
2135 Ga0373935_0002527
2136 Ga0373935_0066615
2137 Ga0373935_0195661
2138 Ga0373935_0603309
2139 Ga0373927_0002489
2140 Ga0373927_0030862
2141 Ga0373933_0001158
2142 Ga0373933_0001226
2143 Ga0373933_0021270
2144 Ga0373933_0173541
2145 Ga0373947_0001941
2146 Ga0373947_0011795
2147 Ga0373947_0402196
2148 Ga0373947_0727332
2149 Ga0373937_0001287
2150 Ga0373937_0005795
2151 Ga0373937_0112179
2152 Ga0373937_0150493
2153 Ga0373937_0431525
2154 Ga0316582_0126649
2155 Ga0373925_0006635
2156 Ga0373925_0157065
2157 Ga0373925_0333400
2158 Ga0316581_0058243
2159 Ga0436364_1458527
2160 Ga0436365_0332529
2161 Ga0436365_1128121
2162 Ga0436365_1210784
2163 Ga0436362_0696497
2164 Ga0451802_1974431
2165 Ga0451843_1016260
2166 Ga0439431_0160658
2167 Ga0439455_0063347
2168 Ga0451577_0545607
2169 Ga0453683_0021931
2170 Ga0466966_0169796
2171 Ga0466963_0294343
2172 Ga0453684_0553190
2173 Ga0451576_0113886
2174 Ga0451576_0222248
2175 Ga0466967_0078025
2176 Ga0466967_0095371
2177 Ga0466967_0507448
2178 Ga0495592_0002836
2179 Ga0495592_0164084
2180 Ga0495592_0435223
2181 Ga0495603_0002313
2182 Ga0495603_0057861
2183 Ga0495629_0013113
2184 Ga0495629_0037192
2185 Ga0495629_0187408
2186 Ga0495651_0003555
2187 Ga0495651_0008771
2188 Ga0495651_0045518
2189 Ga0495651_0776946
2190 Ga0495653_0008223
2191 Ga0495653_0013047
2192 Ga0495653_0038995
2193 Ga0495580_0020835
2194 Ga0495580_0027574
2195 Ga0495580_0068306
2196 Ga0495580_0265237
2197 Ga0495582_0003973
2198 Ga0495582_0092377
2199 Ga0495582_0145948
2200 Ga0495582_0158335
2201 Ga0495582_0688633
2202 Ga0495639_0000173
2203 Ga0495639_0007843
2204 Ga0495639_0027721
2205 Ga0495639_0086190
2206 Ga0495662_0008864
2207 Ga0495662_0021218
2208 Ga0495662_0131216
2209 Ga0495662_0551638
2210 Ga0495664_0008641
2211 Ga0495664_0286742
2212 Ga0495664_0610620
2213 Ga0495594_0013003
2214 Ga0495594_0035214
2215 Ga0495594_0035810
2216 Ga0495594_0083405
2217 Ga0495594_0109048
2218 Ga0495594_0265785
2219 Ga0495594_0312543
2220 Ga0495608_0007840
2221 Ga0495608_0008110
2222 Ga0495608_0014029
2223 Ga0495618_0011447
2224 Ga0495628_0003031
2225 Ga0495628_0039285
2226 Ga0495628_0114286
2227 Ga0495628_0154353
2228 Ga0495628_0385085
2229 Ga0495628_0532296
2230 Ga0495630_0008869
2231 Ga0495630_0089504
2232 Ga0495630_0093418
2233 Ga0495630_0134530
2234 Ga0495630_0204939
2235 Ga0495630_0385477
2236 Ga0495652_0019412
2237 Ga0495652_0028078
2238 Ga0495652_0059656
2239 Ga0495665_0004339
2240 Ga0495665_0007184
2241 Ga0495665_0023006
2242 Ga0495665_0041547
2243 Ga0495665_0045874
2244 Ga0495640_0001785
2245 Ga0495586_0020702
2246 Ga0495586_0021575
2247 Ga0495586_0024612
2248 Ga0495586_0903734
2249 Ga0495587_0004098
2250 Ga0495587_0008030
2251 Ga0495587_0069962
2252 Ga0495598_0098224
2253 Ga0495645_0000123
2254 Ga0495645_0000203
2255 Ga0495645_0000449
2256 Ga0495645_0131675
2257 Ga0495645_0143396
2258 Ga0495667_0016878
2259 Ga0495667_0020377
2260 Ga0495667_0030065
2261 Ga0495667_0030900
2262 Ga0495667_0129581
2263 Ga0495634_0048722
2264 Ga0495634_0202499
2265 Ga0495635_0003518
2266 Ga0495635_0022908
2267 Ga0495635_0081557
2268 Ga0495635_0792706
2269 Ga0495588_0008185
2270 Ga0495588_0020829
2271 Ga0495588_0126791
2272 Ga0495657_0008172
2273 Ga0495657_0011202
2274 Ga0495657_0053753
2275 Ga0495657_0176077
2276 Ga0495599_0002570
2277 Ga0495599_0004727
2278 Ga0495599_0056655
2279 Ga0495599_0088210
2280 Ga0495599_0336064
2281 Ga0495623_0001257
2282 Ga0495623_0002189
2283 Ga0495623_0011984
2284 Ga0495623_0144765
2285 Ga0495623_0407392
2286 Ga0495646_0007522
2287 Ga0495646_0024265
2288 Ga0495646_0032930
2289 Ga0495646_0236661
2290 Ga0495647_0157924
2291 Ga0495658_0010641
2292 Ga0495658_0164147
2293 Ga0495658_0217643
2294 Ga0495658_0391182
2295 Ga0495613_0037042
2296 Ga0495613_0043625
2297 Ga0495613_0073223
2298 Ga0495613_0091958
2299 Ga0495613_0181521
2300 Ga0495600_0000945
2301 Ga0495600_0034113
2302 Ga0495600_0160130
2303 Ga0495600_0180435
2304 Ga0495600_0371891
2305 Ga0495600_0386844
2306 Ga0495581_0001138
2307 Ga0495581_0054904
2308 Ga0495581_0091339
2309 Ga0495581_0135260
2310 Ga0495581_0529961
2311 Ga0495604_0002093
2312 Ga0495604_0002278
2313 Ga0495604_0005843
2314 Ga0495604_0489468
2315 Ga0495674_0014329
2316 Ga0495674_0029532
2317 Ga0495674_0037421
2318 Ga0495674_0050061
2319 Ga0495674_0266908
2320 Ga0495674_0504179
2321 Ga0495680_0019665
2322 Ga0495680_0039761
2323 Ga0495680_0165727
2324 Ga0495680_0299514
2325 Ga0495675_0000928
2326 Ga0495675_0003105
2327 Ga0495675_0018865
2328 Ga0495675_0074535
2329 Ga0495675_0130108
2330 Ga0495684_0004117
2331 Ga0495684_0008778
2332 Ga0495684_0033216
2333 Ga0495684_0035384
2334 Ga0495684_0156608
2335 Ga0495684_0931140
2336 Ga0495593_0001537
2337 Ga0495593_0113084
2338 Ga0495593_0464991
2339 Ga0495602_0046688
2340 Ga0495602_0048459
2341 Ga0495602_0058223
2342 Ga0495602_0490932
2343 Ga0495614_0002391
2344 Ga0496104_0113294
2345 Ga0496104_0247426
2346 Ga0496105_0432462
2347 Ga0496108_0066840
2348 Ga0496108_0488381
2349 Ga0496110_0019549
2350 Ga0496110_0324947
2351 Ga0496111_0214843
2352 Ga0496112_0000380
2353 Ga0496112_0008647
2354 Ga0496113_0078381
2355 Ga0496113_0133699
2356 Ga0496113_0204244
2357 Ga0496115_0085213
2358 Ga0496115_0215521
2359 Ga0496115_0379704
2360 Ga0496115_0445469
2361 Ga0501033_0009389
2362 Ga0501034_0064819
2363 Ga0501034_0093575
2364 Ga0501036_0138842
2365 Ga0501036_0480592
2366 Ga0501041_0145698
2367 Ga0501043_0139998
2368 Ga0501046_0266959
2369 Ga0501047_0280875
2370 Ga0501048_1262601
2371 Ga0501069_0396706
2372 Ga0501071_0301931
2373 Ga0501073_0325330
2374 Ga0501075_1129714
2375 Ga0501202_023241
2376 Ga0501235_041663
2377 Ga0501235_130907
2378 Ga0501242_005162
2379 Ga0501249_010911
2380 Ga0501251_034261
2381 Ga0501259_062828
2382 Ga0501081_0161320
2383 Ga0501273_011928
2384 Ga0501035_0021741
2385 Ga0501044_0011009
2386 Ga0501044_0240530
2387 Ga0501212_023327
2388 nmdc:mga05p37_119023_c1
2389 nmdc:mga05p37_138461_c1
2390 nmdc:mga05p37_181428_c1
2391 nmdc:mga05p37_220243_c1
2392 nmdc:mga05p37_268558_c1
2393 nmdc:mga05p37_35010_c1
2394 nmdc:mga05p37_394940_c1
2395 nmdc:mga09592_122464_c1
2396 nmdc:mga09592_153233_c1
2397 nmdc:mga09592_62757_c1
2398 nmdc:mga0qj67_152287_c1
2399 nmdc:mga0qj67_2195_c1
2400 nmdc:mga0qj67_289250_c1
2401 nmdc:mga0qj67_507124_c1
2402 nmdc:mga0qj67_522837_c1
2403 nmdc:mga0qj67_574465_c1
2404 nmdc:mga0qj67_63801_c1
2405 nmdc:mga0qj67_64043_c1
2406 nmdc:mga0qj67_76504_c1
2407 nmdc:mga06r32_63239_c1
2408 nmdc:mga06r32_706376_c1
2409 nmdc:mga06r32_95601_c1
2410 nmdc:mga08y16_1304147_c1
2411 nmdc:mga08y16_293981_c1
2412 nmdc:mga08y16_639401_c1
2413 nmdc:mga0n895_12843_c1
2414 nmdc:mga0n895_472734_c1
2415 nmdc:mga0n895_91106_c1
2416 nmdc:mga0rr50_105843_c1
2417 nmdc:mga0rr50_1382685_c1
2418 nmdc:mga0rr50_222795_c1
2419 nmdc:mga0rr50_618554_c1
2420 nmdc:mga0rr50_692535_c1
2421 nmdc:mga0rr50_75918_c2
2422 nmdc:mga08x19_179252_c1
2423 nmdc:mga08x19_182803_c1
2424 nmdc:mga08x19_643898_c1
2425 nmdc:mga08x19_70662_c1
2426 nmdc:mga08x19_729467_c1
2427 nmdc:mga08x19_894603_c1
2428 nmdc:mga0a205_1064627_c1
2429 nmdc:mga0a205_124546_c1
2430 nmdc:mga0a205_2458_c1
2431 nmdc:mga0a205_32184_c1
2432 nmdc:mga0a205_360718_c1
2433 nmdc:mga0a205_39112_c1
2434 Ga0495601_0021368
2435 Ga0495601_0039127
2436 Ga0495601_0084946
2437 Ga0495601_0223553
2438 Ga0495601_0267803
2439 Ga0495601_0478232
2440 Ga0495612_0002661
2441 Ga0495612_0010512
2442 Ga0495612_0210275
2443 Ga0495595_0021390
2444 Ga0495595_0276569
2445 Ga0495595_0480175
2446 Ga0495619_0018682
2447 Ga0495619_0066751
2448 Ga0495619_0079921
2449 Ga0501084_0867228
2450 Ga0590075_090169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

103

177

0.98

Map