F491778

General Info

Members Datasets Scaffolds Average Seq Length
1215 366 1212 135

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100350689|Ga0068865_1003506892
Length 160
Sequence METGRVANGERIGGRNAEMKANMPEIDAKKPDISSIAPLSLPGDRQLVMRVMPMGNGDIFGGWIMAQVDVAGAVLPARIAKGRIATVAVNQFVFKQPVSISDLLSFYAKVERVGRTSVTVNVEVYAERNPADLHVVKVTEANLTYVAIDNQGKPRPIPVE

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
3 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
109 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
221 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
242 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
243 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
244 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
247 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
248 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
292 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
296 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
358 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 3.46
Rhizosphere 87.49
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10055872 3300005290 Bacteria 628
2 Ga0065715_10257303 3300005293 Bacteria 1148
3 Ga0070658_10085529 3300005327 Bacteria 2593
4 Ga0070658_10354831 3300005327 Bacteria 1255
5 Ga0070676_10003412 3300005328 Bacteria 8274
6 Ga0070676_10031850 3300005328 Bacteria 3017
7 Ga0070676_10088232 3300005328 Bacteria 1895
8 Ga0070676_10116226 3300005328 Bacteria 1673
9 Ga0070676_10153551 3300005328 Bacteria 1476
10 Ga0070676_10361948 3300005328 Bacteria 1000
11 Ga0070676_10865272 3300005328 Bacteria 671
12 Ga0070683_100093636 3300005329 Bacteria 2823
13 Ga0070683_100116512 3300005329 Bacteria 2522
14 Ga0070683_100223855 3300005329 Bacteria 1788
15 Ga0070683_100373007 3300005329 Bacteria 1359
16 Ga0070683_100769598 3300005329 Bacteria 922
17 Ga0070690_100000071 3300005330 Bacteria 50633
18 Ga0070690_100050643 3300005330 Bacteria 2649
19 Ga0070690_100233372 3300005330 Bacteria 1295
20 Ga0070690_100732992 3300005330 Bacteria 761
21 Ga0070670_100004046 3300005331 Bacteria 12240
22 Ga0070670_100019607 3300005331 Bacteria 5805
23 Ga0070670_100037357 3300005331 Bacteria 4179
24 Ga0070670_100045429 3300005331 Bacteria 3776
25 Ga0070670_100051046 3300005331 Bacteria 3553
26 Ga0070670_100120681 3300005331 Bacteria 2261
27 Ga0070670_100352332 3300005331 Bacteria 1293
28 Ga0070670_100914673 3300005331 Bacteria 796
29 Ga0070670_101442086 3300005331 Bacteria 631
30 Ga0070677_10006708 3300005333 Bacteria 3830
31 Ga0070677_10014643 3300005333 Bacteria 2765
32 Ga0070677_10024471 3300005333 Bacteria 2245
33 Ga0070677_10073598 3300005333 Bacteria 1443
34 Ga0070677_10074985 3300005333 Bacteria 1432
35 Ga0070677_10089367 3300005333 Bacteria 1336
36 Ga0068869_100001972 3300005334 Bacteria 12309
37 Ga0068869_100002262 3300005334 Bacteria 11585
38 Ga0068869_100005381 3300005334 Bacteria 8043
39 Ga0068869_100013091 3300005334 Bacteria 5506
40 Ga0068869_100051251 3300005334 Bacteria 2994
41 Ga0068869_100209219 3300005334 Bacteria 1541
42 Ga0068869_100482190 3300005334 Bacteria 1033
43 Ga0070666_10004324 3300005335 Bacteria 8642
44 Ga0070666_10016666 3300005335 Bacteria 4702
45 Ga0070666_10553878 3300005335 Bacteria 836
46 Ga0070680_100067265 3300005336 Bacteria 2939
47 Ga0070680_100522163 3300005336 Bacteria 1017
48 Ga0070680_100636454 3300005336 Bacteria 916
49 Ga0070682_100095554 3300005337 Bacteria 1952
50 Ga0070682_100665662 3300005337 Bacteria 830
51 Ga0068868_100005809 3300005338 Bacteria 8695
52 Ga0068868_100033493 3300005338 Bacteria 3960
53 Ga0068868_100037946 3300005338 Bacteria 3738
54 Ga0068868_100042909 3300005338 Bacteria 3532
55 Ga0068868_100167205 3300005338 Bacteria 1819
56 Ga0068868_100324319 3300005338 Bacteria 1313
57 Ga0068868_100858626 3300005338 Bacteria 822
58 Ga0068868_101357151 3300005338 Bacteria 662
59 Ga0070660_100001621 3300005339 Bacteria 15476
60 Ga0070660_100024244 3300005339 Bacteria 4501
61 Ga0070660_100724503 3300005339 Bacteria 834
62 Ga0070660_100773904 3300005339 Bacteria 806
63 Ga0070660_100871418 3300005339 Bacteria 759
64 Ga0070689_100679113 3300005340 Bacteria 898
65 Ga0070691_10019893 3300005341 Unclassified 3099
66 Ga0070687_100073399 3300005343 Bacteria 1844
67 Ga0070687_100140696 3300005343 Bacteria 1405
68 Ga0070687_100462020 3300005343 Bacteria 847
69 Ga0070661_100000883 3300005344 Bacteria 21543
70 Ga0070661_100016402 3300005344 Bacteria 5236
71 Ga0070661_100027619 3300005344 Bacteria 4088
72 Ga0070661_100092259 3300005344 Bacteria 2244
73 Ga0070661_100120752 3300005344 Bacteria 1963
74 Ga0070661_100559980 3300005344 Bacteria 920
75 Ga0070661_101009237 3300005344 Bacteria 690
76 Ga0070692_10008442 3300005345 Bacteria 4598
77 Ga0070692_10152013 3300005345 Bacteria 1319
78 Ga0070668_100001633 3300005347 Bacteria 16240
79 Ga0070668_100002643 3300005347 Bacteria 13163
80 Ga0070668_100006830 3300005347 Bacteria 8459
81 Ga0070668_100008227 3300005347 Bacteria 7744
82 Ga0070668_100012517 3300005347 Bacteria 6319
83 Ga0070668_100068273 3300005347 Bacteria 2763
84 Ga0070668_100205185 3300005347 Bacteria 1619
85 Ga0070668_100684130 3300005347 Bacteria 903
86 Ga0070669_100005723 3300005353 Bacteria 8963
87 Ga0070669_100022067 3300005353 Bacteria 4554
88 Ga0070669_100034226 3300005353 Bacteria 3679
89 Ga0070669_100175989 3300005353 Bacteria 1671
90 Ga0070669_100205662 3300005353 Bacteria 1551
91 Ga0070669_100232717 3300005353 Bacteria 1461
92 Ga0070669_100508870 3300005353 Bacteria 1000
93 Ga0070675_100001504 3300005354 Bacteria 17211
94 Ga0070675_100005698 3300005354 Bacteria 9537
95 Ga0070675_100006735 3300005354 Bacteria 8836
96 Ga0070675_100015539 3300005354 Bacteria 6021
97 Ga0070675_100099368 3300005354 Bacteria 2449
98 Ga0070675_100455759 3300005354 Bacteria 1147
99 Ga0070675_100663155 3300005354 Bacteria 949
100 Ga0070675_100750323 3300005354 Bacteria 890
101 Ga0070671_100106901 3300005355 Bacteria 2349
102 Ga0070671_100110135 3300005355 Bacteria 2313
103 Ga0070671_100120369 3300005355 Bacteria 2209
104 Ga0070671_100245040 3300005355 Bacteria 1521
105 Ga0070671_100436350 3300005355 Bacteria 1123
106 Ga0070671_100444775 3300005355 Bacteria 1112
107 Ga0070671_100572831 3300005355 Bacteria 974
108 Ga0070674_100021439 3300005356 Bacteria 4148
109 Ga0070674_100061702 3300005356 Bacteria 2617
110 Ga0070674_100092575 3300005356 Bacteria 2185
111 Ga0070674_100256948 3300005356 Bacteria 1375
112 Ga0070674_100555722 3300005356 Bacteria 964
113 Ga0070673_100003672 3300005364 Bacteria 9611
114 Ga0070673_100041075 3300005364 Bacteria 3553
115 Ga0070673_100154152 3300005364 Bacteria 1948
116 Ga0070673_100207717 3300005364 Bacteria 1689
117 Ga0070673_100251214 3300005364 Bacteria 1541
118 Ga0070673_100332455 3300005364 Bacteria 1345
119 Ga0070673_100423052 3300005364 Bacteria 1194
120 Ga0070673_100451502 3300005364 Bacteria 1156
121 Ga0070673_100475857 3300005364 Bacteria 1127
122 Ga0070673_100502520 3300005364 Bacteria 1097
123 Ga0070673_100721444 3300005364 Bacteria 916
124 Ga0070673_100862807 3300005364 Bacteria 838
125 Ga0070688_100048508 3300005365 Bacteria 2639
126 Ga0070688_100079655 3300005365 Bacteria 2117
127 Ga0070688_100163981 3300005365 Bacteria 1529
128 Ga0070688_100703668 3300005365 Bacteria 783
129 Ga0070659_100004167 3300005366 Bacteria 10307
130 Ga0070659_100040759 3300005366 Bacteria 3629
131 Ga0070659_100322564 3300005366 Bacteria 1291
132 Ga0070659_100381316 3300005366 Bacteria 1187
133 Ga0070659_100862334 3300005366 Bacteria 790
134 Ga0070667_100003036 3300005367 Bacteria 14420
135 Ga0070667_100012676 3300005367 Bacteria 6972
136 Ga0070667_100109157 3300005367 Bacteria 2397
137 Ga0070667_100151341 3300005367 Bacteria 2038
138 Ga0070667_100343907 3300005367 Bacteria 1349
139 Ga0070667_100468745 3300005367 Bacteria 1152
140 Ga0070667_100486179 3300005367 Bacteria 1130
141 Ga0070667_100533530 3300005367 Bacteria 1077
142 Ga0070667_101008908 3300005367 Bacteria 777
143 Ga0070667_101154176 3300005367 Bacteria 725
144 Ga0070667_101321307 3300005367 Bacteria 676
145 Ga0070703_10186542 3300005406 Bacteria 805
146 Ga0070714_100002673 3300005435 Bacteria 13131
147 Ga0070713_100292656 3300005436 Bacteria 1497
148 Ga0070710_10537779 3300005437 Bacteria 805
149 Ga0070701_10606366 3300005438 Bacteria 726
150 Ga0070700_100001764 3300005441 Bacteria 10889
151 Ga0070700_100141465 3300005441 Bacteria 1636
152 Ga0070700_100558314 3300005441 Bacteria 891
153 Ga0070708_100120229 3300005445 Bacteria 2423
154 Ga0070663_100036207 3300005455 Bacteria 3428
155 Ga0070663_100043101 3300005455 Bacteria 3174
156 Ga0070663_100093633 3300005455 Bacteria 2229
157 Ga0070663_100225421 3300005455 Bacteria 1473
158 Ga0070663_100277334 3300005455 Bacteria 1335
159 Ga0070663_100319018 3300005455 Bacteria 1249
160 Ga0070663_100628113 3300005455 Bacteria 906
161 Ga0070663_100734837 3300005455 Bacteria 842
162 Ga0070663_100899610 3300005455 Bacteria 764
163 Ga0070678_100007314 3300005456 Bacteria 6541
164 Ga0070678_100026967 3300005456 Bacteria 3893
165 Ga0070678_100120316 3300005456 Bacteria 2069
166 Ga0070678_100486738 3300005456 Bacteria 1086
167 Ga0070678_100532718 3300005456 Bacteria 1040
168 Ga0070678_100884168 3300005456 Bacteria 816
169 Ga0070662_100003247 3300005457 Bacteria 10112
170 Ga0070662_100086754 3300005457 Bacteria 2341
171 Ga0070662_100315595 3300005457 Bacteria 1273
172 Ga0070662_100613799 3300005457 Bacteria 915
173 Ga0070662_100795187 3300005457 Bacteria 804
174 Ga0070681_10020561 3300005458 Bacteria 6615
175 Ga0070681_10187824 3300005458 Bacteria 1986
176 Ga0070681_10339518 3300005458 Bacteria 1412
177 Ga0068867_100000042 3300005459 Bacteria 77140
178 Ga0068867_100000264 3300005459 Bacteria 34575
179 Ga0068867_100002482 3300005459 Bacteria 12965
180 Ga0068867_100006029 3300005459 Bacteria 8591
181 Ga0068867_100023386 3300005459 Bacteria 4424
182 Ga0068867_100166882 3300005459 Bacteria 1740
183 Ga0068867_100189458 3300005459 Bacteria 1640
184 Ga0068867_100253275 3300005459 Bacteria 1432
185 Ga0068867_100297459 3300005459 Bacteria 1329
186 Ga0068867_100403507 3300005459 Bacteria 1153
187 Ga0068867_100409572 3300005459 Bacteria 1146
188 Ga0068867_100450507 3300005459 Bacteria 1096
189 Ga0068867_100511203 3300005459 Bacteria 1034
190 Ga0070685_10736459 3300005466 Bacteria 722
191 Ga0070685_11339386 3300005466 Bacteria 548
192 Ga0070706_100021331 3300005467 Bacteria 5966
193 Ga0070706_100422346 3300005467 Bacteria 1241
194 Ga0070707_100611169 3300005468 Bacteria 1053
195 Ga0070698_100405636 3300005471 Bacteria 1297
196 Ga0070699_100137968 3300005518 Bacteria 2152
197 Ga0070699_100425887 3300005518 Bacteria 1202
198 Ga0070699_100660174 3300005518 Bacteria 955
199 Ga0070699_101506708 3300005518 Bacteria 617
200 Ga0070679_100002789 3300005530 Bacteria 15890
201 Ga0070679_100003691 3300005530 Bacteria 14023
202 Ga0070679_100029405 3300005530 Bacteria 5421
203 Ga0070684_100000910 3300005535 Bacteria 20963
204 Ga0070684_100110716 3300005535 Bacteria 2462
205 Ga0070684_100335578 3300005535 Bacteria 1389
206 Ga0068853_100014105 3300005539 Bacteria 6542
207 Ga0068853_100015444 3300005539 Bacteria 6273
208 Ga0068853_100053357 3300005539 Bacteria 3482
209 Ga0068853_100082865 3300005539 Bacteria 2809
210 Ga0068853_100956337 3300005539 Bacteria 824
211 Ga0068853_101139503 3300005539 Bacteria 752
212 Ga0070672_100008935 3300005543 Bacteria 6885
213 Ga0070672_100020423 3300005543 Bacteria 4831
214 Ga0070672_100052763 3300005543 Bacteria 3176
215 Ga0070672_100119798 3300005543 Bacteria 2153
216 Ga0070672_100143320 3300005543 Bacteria 1972
217 Ga0070672_100177248 3300005543 Bacteria 1775
218 Ga0070672_100197078 3300005543 Bacteria 1683
219 Ga0070672_100266828 3300005543 Bacteria 1445
220 Ga0070672_100573973 3300005543 Bacteria 981
221 Ga0070672_100784959 3300005543 Bacteria 837
222 Ga0070672_101598685 3300005543 Bacteria 585
223 Ga0070686_100001065 3300005544 Bacteria 15826
224 Ga0070695_100002447 3300005545 Bacteria 10679
225 Ga0070693_100081870 3300005547 Bacteria 1926
226 Ga0070693_100097109 3300005547 Bacteria 1787
227 Ga0070693_100197118 3300005547 Bacteria 1306
228 Ga0070693_100309929 3300005547 Bacteria 1067
229 Ga0070665_100048754 3300005548 Bacteria 4252
230 Ga0070665_100382987 3300005548 Bacteria 1414
231 Ga0070665_100558882 3300005548 Bacteria 1157
232 Ga0070665_100909477 3300005548 Bacteria 893
233 Ga0070665_101247205 3300005548 Bacteria 754
234 Ga0070665_101925863 3300005548 Bacteria 597
235 Ga0070704_100347489 3300005549 Bacteria 1251
236 Ga0070704_101398879 3300005549 Bacteria 642
237 Ga0068855_100002371 3300005563 Bacteria 23222
238 Ga0068855_100040710 3300005563 Bacteria 5513
239 Ga0068855_100050372 3300005563 Bacteria 4908
240 Ga0068855_100111712 3300005563 Bacteria 3137
241 Ga0068855_100535245 3300005563 Bacteria 1270
242 Ga0070664_100001040 3300005564 Bacteria 21786
243 Ga0070664_100008231 3300005564 Bacteria 8430
244 Ga0070664_100099422 3300005564 Bacteria 2528
245 Ga0070664_100112593 3300005564 Bacteria 2377
246 Ga0070664_100144031 3300005564 Bacteria 2100
247 Ga0070664_100249051 3300005564 Bacteria 1597
248 Ga0070664_100303798 3300005564 Bacteria 1442
249 Ga0070664_100413195 3300005564 Bacteria 1235
250 Ga0070664_100501471 3300005564 Bacteria 1119
251 Ga0070664_100592639 3300005564 Bacteria 1027
252 Ga0068857_100001304 3300005577 Bacteria 19593
253 Ga0068857_100073617 3300005577 Bacteria 3044
254 Ga0068857_100131719 3300005577 Bacteria 2255
255 Ga0068857_100158121 3300005577 Bacteria 2055
256 Ga0068857_100406428 3300005577 Bacteria 1268
257 Ga0068857_100638288 3300005577 Bacteria 1008
258 Ga0068857_100702854 3300005577 Bacteria 961
259 Ga0068857_102155581 3300005577 Bacteria 547
260 Ga0068854_100005968 3300005578 Bacteria 7715
261 Ga0068854_100030959 3300005578 Bacteria 3715
262 Ga0068854_100074787 3300005578 Bacteria 2486
263 Ga0068854_100183358 3300005578 Bacteria 1636
264 Ga0068854_100493502 3300005578 Bacteria 1030
265 Ga0068854_100499083 3300005578 Bacteria 1025
266 Ga0068854_100560127 3300005578 Bacteria 971
267 Ga0068854_100623596 3300005578 Bacteria 923
268 Ga0068856_100003525 3300005614 Bacteria 15776
269 Ga0068856_100143927 3300005614 Bacteria 2392
270 Ga0068856_100159681 3300005614 Bacteria 2264
271 Ga0068856_100703905 3300005614 Bacteria 1030
272 Ga0070702_100000283 3300005615 Bacteria 17337
273 Ga0070702_100072312 3300005615 Bacteria 2040
274 Ga0070702_100340434 3300005615 Bacteria 1052
275 Ga0068852_100002204 3300005616 Bacteria 13373
276 Ga0068852_100039417 3300005616 Bacteria 3977
277 Ga0068852_100044023 3300005616 Bacteria 3788
278 Ga0068852_100048572 3300005616 Bacteria 3626
279 Ga0068852_100074480 3300005616 Bacteria 2990
280 Ga0068852_100081401 3300005616 Bacteria 2874
281 Ga0068852_100159016 3300005616 Bacteria 2108
282 Ga0068852_100259676 3300005616 Bacteria 1667
283 Ga0068852_100481425 3300005616 Bacteria 1233
284 Ga0068852_100650155 3300005616 Bacteria 1062
285 Ga0068852_100782693 3300005616 Bacteria 967
286 Ga0068852_100800206 3300005616 Bacteria 957
287 Ga0068852_101165133 3300005616 Bacteria 792
288 Ga0068852_101271058 3300005616 Bacteria 758
289 Ga0068859_100002179 3300005617 Bacteria 19887
290 Ga0068859_100028193 3300005617 Bacteria 5629
291 Ga0068859_100038297 3300005617 Bacteria 4811
292 Ga0068859_100050971 3300005617 Bacteria 4160
293 Ga0068859_100097653 3300005617 Bacteria 2990
294 Ga0068859_100146218 3300005617 Bacteria 2439
295 Ga0068859_100384989 3300005617 Bacteria 1498
296 Ga0068859_100591655 3300005617 Bacteria 1203
297 Ga0068859_101562174 3300005617 Bacteria 729
298 Ga0068864_100001559 3300005618 Bacteria 18876
299 Ga0068864_100010197 3300005618 Bacteria 7757
300 Ga0068864_100025613 3300005618 Bacteria 4970
301 Ga0068864_100033200 3300005618 Bacteria 4387
302 Ga0068864_100125852 3300005618 Bacteria 2296
303 Ga0068864_100208969 3300005618 Bacteria 1796
304 Ga0068864_100217643 3300005618 Bacteria 1761
305 Ga0068864_100389540 3300005618 Bacteria 1322
306 Ga0068864_100409761 3300005618 Bacteria 1289
307 Ga0068864_100411680 3300005618 Bacteria 1286
308 Ga0068864_101155621 3300005618 Bacteria 772
309 Ga0068864_101978874 3300005618 Bacteria 589
310 Ga0068864_102075835 3300005618 Bacteria 575
311 Ga0068866_10000189 3300005718 Bacteria 28868
312 Ga0068866_10001669 3300005718 Bacteria 9360
313 Ga0068866_10053037 3300005718 Bacteria 2072
314 Ga0068866_10537247 3300005718 Bacteria 780
315 Ga0068861_100000532 3300005719 Bacteria 22319
316 Ga0068861_100001035 3300005719 Bacteria 17040
317 Ga0068861_100009576 3300005719 Bacteria 6692
318 Ga0068861_100019060 3300005719 Bacteria 4898
319 Ga0068861_100031212 3300005719 Bacteria 3912
320 Ga0068861_100079288 3300005719 Bacteria 2567
321 Ga0068861_100119973 3300005719 Bacteria 2120
322 Ga0068861_101656686 3300005719 Bacteria 632
323 Ga0068861_102539191 3300005719 Bacteria 516
324 Ga0068851_10007841 3300005834 Bacteria 4917
325 Ga0068851_10024775 3300005834 Bacteria 2939
326 Ga0068851_10049404 3300005834 Bacteria 2133
327 Ga0068851_10050848 3300005834 Bacteria 2105
328 Ga0068851_10111214 3300005834 Bacteria 1462
329 Ga0068851_10594598 3300005834 Bacteria 673
330 Ga0068870_10011875 3300005840 Bacteria 4054
331 Ga0068870_10328910 3300005840 Bacteria 974
332 Ga0068870_10625305 3300005840 Bacteria 734
333 Ga0068863_100001600 3300005841 Bacteria 22378
334 Ga0068863_100014606 3300005841 Bacteria 7560
335 Ga0068863_100025975 3300005841 Bacteria 5588
336 Ga0068863_100182663 3300005841 Bacteria 2013
337 Ga0068863_100330245 3300005841 Bacteria 1482
338 Ga0068863_100411610 3300005841 Bacteria 1324
339 Ga0068863_100663967 3300005841 Bacteria 1034
340 Ga0068863_100759724 3300005841 Bacteria 966
341 Ga0068858_100002794 3300005842 Bacteria 17548
342 Ga0068858_100004165 3300005842 Bacteria 14230
343 Ga0068858_100011145 3300005842 Bacteria 8500
344 Ga0068858_100043719 3300005842 Bacteria 4153
345 Ga0068858_100054654 3300005842 Bacteria 3692
346 Ga0068858_100121039 3300005842 Bacteria 2447
347 Ga0068860_100011584 3300005843 Bacteria 8694
348 Ga0068860_100020693 3300005843 Bacteria 6373
349 Ga0068860_100065754 3300005843 Bacteria 3443
350 Ga0068860_100162251 3300005843 Bacteria 2155
351 Ga0068860_100335600 3300005843 Bacteria 1485
352 Ga0068860_100380910 3300005843 Bacteria 1392
353 Ga0068860_100438210 3300005843 Bacteria 1298
354 Ga0068860_100511458 3300005843 Bacteria 1200
355 Ga0068860_101427222 3300005843 Bacteria 713
356 Ga0068862_100013997 3300005844 Bacteria 6652
357 Ga0068862_100029123 3300005844 Bacteria 4650
358 Ga0068862_100068635 3300005844 Bacteria 3058
359 Ga0068862_100110348 3300005844 Bacteria 2414
360 Ga0068862_100132802 3300005844 Bacteria 2203
361 Ga0068862_100278287 3300005844 Bacteria 1533
362 Ga0068862_100516880 3300005844 Bacteria 1136
363 Ga0068862_101135574 3300005844 Bacteria 778
364 Ga0075365_10130022 3300006038 Bacteria 1742
365 Ga0075368_10058597 3300006042 Bacteria 1539
366 Ga0075368_10108081 3300006042 Bacteria 1145
367 Ga0075363_100033871 3300006048 Bacteria 2664
368 Ga0075363_100102836 3300006048 Bacteria 1582
369 Ga0075363_100426360 3300006048 Bacteria 781
370 Ga0075364_10159517 3300006051 Bacteria 1522
371 Ga0075432_10281256 3300006058 Bacteria 685
372 Ga0070715_10059828 3300006163 Bacteria 1668
373 Ga0070716_100268217 3300006173 Bacteria 1171
374 Ga0070716_101735759 3300006173 Bacteria 515
375 Ga0075362_10030651 3300006177 Bacteria 2323
376 Ga0075367_10016724 3300006178 Bacteria 4010
377 Ga0075367_10123421 3300006178 Bacteria 1597
378 Ga0075369_10002059 3300006186 Bacteria 7092
379 Ga0075366_10004629 3300006195 Bacteria 7393
380 Ga0075366_10008533 3300006195 Bacteria 5701
381 Ga0075366_10088678 3300006195 Bacteria 1852
382 Ga0075366_10105555 3300006195 Bacteria 1693
383 Ga0075366_10136854 3300006195 Bacteria 1479
384 Ga0075366_10301825 3300006195 Bacteria 980
385 Ga0075366_10347282 3300006195 Bacteria 910
386 Ga0097621_100095762 3300006237 Bacteria 2490
387 Ga0097621_100163550 3300006237 Bacteria 1914
388 Ga0097621_100396116 3300006237 Bacteria 1235
389 Ga0097621_100959405 3300006237 Bacteria 798
390 Ga0075370_10005755 3300006353 Bacteria 6192
391 Ga0075370_10007311 3300006353 Bacteria 5624
392 Ga0075370_10007660 3300006353 Bacteria 5511
393 Ga0075370_10011047 3300006353 Bacteria 4735
394 Ga0075370_10274166 3300006353 Bacteria 1001
395 Ga0075370_10343912 3300006353 Bacteria 890
396 Ga0075370_10948690 3300006353 Bacteria 526
397 Ga0068871_100054687 3300006358 Bacteria 3239
398 Ga0068871_100089256 3300006358 Bacteria 2566
399 Ga0068871_100231622 3300006358 Bacteria 1603
400 Ga0068871_100501049 3300006358 Bacteria 1094
401 Ga0068871_100552992 3300006358 Bacteria 1043
402 Ga0068871_100567191 3300006358 Bacteria 1029
403 Ga0068871_100741213 3300006358 Bacteria 902
404 Ga0068871_101277787 3300006358 Bacteria 690
405 Ga0075434_100332453 3300006871 Bacteria 1540
406 Ga0068865_100002413 3300006881 Bacteria 11034
407 Ga0068865_100143169 3300006881 Bacteria 1805
408 Ga0068865_100191105 3300006881 Bacteria 1583
409 Ga0068865_100249235 3300006881 Bacteria 1401
410 Ga0068865_100266056 3300006881 Bacteria 1359
411 Ga0068865_100276744 3300006881 Bacteria 1335
412 Ga0068865_100339497 3300006881 Bacteria 1214
413 Ga0068865_100350689 3300006881 Bacteria 1195
414 Ga0068865_101207037 3300006881 Bacteria 670
415 Ga0075436_100242618 3300006914 Bacteria 1282
416 Ga0097620_100002179 3300006931 Bacteria 19887
417 Ga0097620_100028193 3300006931 Bacteria 5629
418 Ga0097620_100038291 3300006931 Bacteria 4811
419 Ga0097620_100050972 3300006931 Bacteria 4160
420 Ga0097620_100097655 3300006931 Bacteria 2990
421 Ga0097620_100146208 3300006931 Bacteria 2439
422 Ga0097620_100385011 3300006931 Bacteria 1498
423 Ga0097620_100591656 3300006931 Bacteria 1203
424 Ga0097620_101562107 3300006931 Bacteria 729
425 Ga0075435_100082967 3300007076 Bacteria 2635
426 Ga0075435_100725946 3300007076 Bacteria 864
427 Ga0099794_10067892 3300007265 Bacteria 1742
428 Ga0105240_10006424 3300009093 Bacteria 17278
429 Ga0105240_10546324 3300009093 Bacteria 1282
430 Ga0111539_10388677 3300009094 Bacteria 1625
431 Ga0111539_10462883 3300009094 Bacteria 1477
432 Ga0105245_10000708 3300009098 Bacteria 30036
433 Ga0105245_10040417 3300009098 Bacteria 4155
434 Ga0105245_10341208 3300009098 Bacteria 1482
435 Ga0105245_10368587 3300009098 Bacteria 1427
436 Ga0105245_12407699 3300009098 Bacteria 580
437 Ga0105247_10962390 3300009101 Bacteria 664
438 Ga0105243_10000265 3300009148 Bacteria 58881
439 Ga0105243_10000525 3300009148 Bacteria 39020
440 Ga0105243_10359140 3300009148 Bacteria 1340
441 Ga0105243_10479545 3300009148 Bacteria 1173
442 Ga0105243_11275660 3300009148 Bacteria 751
443 Ga0105243_12842577 3300009148 Bacteria 525
444 Ga0105241_10071824 3300009174 Bacteria 2688
445 Ga0105241_10225862 3300009174 Bacteria 1576
446 Ga0105241_11989727 3300009174 Bacteria 572
447 Ga0105242_10000363 3300009176 Bacteria 36241
448 Ga0105242_10077404 3300009176 Bacteria 2775
449 Ga0105248_10000869 3300009177 Bacteria 33920
450 Ga0105248_10004278 3300009177 Bacteria 15797
451 Ga0105248_10038093 3300009177 Bacteria 5380
452 Ga0105248_10243294 3300009177 Bacteria 2025
453 Ga0105248_10331810 3300009177 Bacteria 1713
454 Ga0105248_10410489 3300009177 Bacteria 1525
455 Ga0105248_10785831 3300009177 Bacteria 1074
456 Ga0105248_10809457 3300009177 Bacteria 1057
457 Ga0105248_11791794 3300009177 Bacteria 696
458 Ga0105237_10007357 3300009545 Bacteria 12064
459 Ga0105237_10116620 3300009545 Bacteria 2664
460 Ga0105237_10610307 3300009545 Bacteria 1098
461 Ga0105237_10708732 3300009545 Bacteria 1013
462 Ga0105237_11339849 3300009545 Bacteria 722
463 Ga0105238_10003030 3300009551 Bacteria 16758
464 Ga0105238_10064482 3300009551 Bacteria 3663
465 Ga0105238_10106782 3300009551 Bacteria 2781
466 Ga0105238_10274885 3300009551 Bacteria 1665
467 Ga0105238_10681440 3300009551 Bacteria 1039
468 Ga0105238_10849596 3300009551 Bacteria 930
469 Ga0105249_10011625 3300009553 Bacteria 7739
470 Ga0105249_10041092 3300009553 Bacteria 4203
471 Ga0105249_10054209 3300009553 Bacteria 3666
472 Ga0105249_10115706 3300009553 Bacteria 2541
473 Ga0105249_10301958 3300009553 Bacteria 1606
474 Ga0105249_10683688 3300009553 Bacteria 1085
475 Ga0105249_13236342 3300009553 Bacteria 524
476 Ga0105239_10095454 3300010375 Bacteria 3285
477 Ga0105239_10133742 3300010375 Bacteria 2760
478 Ga0105246_12490449 3300011119 Unclassified 509
479 Ga0157337_1033484 3300012483 Bacteria 537
480 Ga0157342_1056228 3300012507 Bacteria 566
481 Ga0157373_10009276 3300013100 Bacteria 7275
482 Ga0157373_10009763 3300013100 Bacteria 7079
483 Ga0157373_10268206 3300013100 Bacteria 1208
484 Ga0157371_10214518 3300013102 Bacteria 1382
485 Ga0157370_10016712 3300013104 Bacteria 7426
486 Ga0157370_10056677 3300013104 Bacteria 3729
487 Ga0157370_10329927 3300013104 Bacteria 1407
488 Ga0157369_10013153 3300013105 Bacteria 9365
489 Ga0157369_10069163 3300013105 Bacteria 3793
490 Ga0157369_10326777 3300013105 Bacteria 1594
491 Ga0157369_10969193 3300013105 Bacteria 871
492 Ga0157374_10008380 3300013296 Bacteria 8829
493 Ga0157374_10009389 3300013296 Bacteria 8394
494 Ga0157374_10207652 3300013296 Bacteria 1920
495 Ga0157374_10409724 3300013296 Bacteria 1353
496 Ga0157374_10654758 3300013296 Bacteria 1062
497 Ga0157374_10654881 3300013296 Bacteria 1062
498 Ga0157374_10909498 3300013296 Bacteria 898
499 Ga0157378_10023701 3300013297 Bacteria 5399
500 Ga0157378_10044306 3300013297 Bacteria 3951
501 Ga0157378_10131702 3300013297 Bacteria 2315
502 Ga0157378_10152110 3300013297 Bacteria 2157
503 Ga0157378_10411366 3300013297 Bacteria 1335
504 Ga0157378_10421212 3300013297 Bacteria 1320
505 Ga0157378_10736819 3300013297 Bacteria 1007
506 Ga0163162_10009806 3300013306 Bacteria 9320
507 Ga0163162_10013601 3300013306 Bacteria 7950
508 Ga0163162_10014191 3300013306 Bacteria 7785
509 Ga0163162_10068596 3300013306 Bacteria 3598
510 Ga0163162_10171055 3300013306 Bacteria 2297
511 Ga0163162_10205503 3300013306 Bacteria 2099
512 Ga0163162_10269115 3300013306 Bacteria 1835
513 Ga0163162_10669729 3300013306 Bacteria 1161
514 Ga0163162_10699647 3300013306 Bacteria 1135
515 Ga0163162_13073500 3300013306 Bacteria 536
516 Ga0157372_10004735 3300013307 Bacteria 14452
517 Ga0157372_10069719 3300013307 Bacteria 3954
518 Ga0157372_10208417 3300013307 Bacteria 2265
519 Ga0157372_10479060 3300013307 Bacteria 1451
520 Ga0157375_10001486 3300013308 Bacteria 20123
521 Ga0157375_10026950 3300013308 Bacteria 5364
522 Ga0157375_10027995 3300013308 Bacteria 5275
523 Ga0157375_10029477 3300013308 Bacteria 5162
524 Ga0157375_10030618 3300013308 Bacteria 5077
525 Ga0157375_10042812 3300013308 Bacteria 4386
526 Ga0157375_10091030 3300013308 Bacteria 3111
527 Ga0157375_10148409 3300013308 Bacteria 2478
528 Ga0157375_10210834 3300013308 Bacteria 2100
529 Ga0157375_10317158 3300013308 Bacteria 1723
530 Ga0157375_10410618 3300013308 Bacteria 1520
531 Ga0157375_10661448 3300013308 Bacteria 1200
532 Ga0157375_10941214 3300013308 Bacteria 1006
533 Ga0157375_10948691 3300013308 Bacteria 1002
534 Ga0157375_11177334 3300013308 Bacteria 899
535 Ga0157375_12091054 3300013308 Bacteria 674
536 Ga0157375_13807750 3300013308 Bacteria 501
537 Ga0163163_10009499 3300014325 Bacteria 8687
538 Ga0163163_10011598 3300014325 Bacteria 8005
539 Ga0163163_10311598 3300014325 Bacteria 1627
540 Ga0163163_11529984 3300014325 Bacteria 728
541 Ga0157380_10002505 3300014326 Bacteria 12373
542 Ga0157380_10019139 3300014326 Bacteria 5099
543 Ga0157380_10070423 3300014326 Bacteria 2826
544 Ga0157380_10092211 3300014326 Bacteria 2502
545 Ga0157380_10941256 3300014326 Bacteria 893
546 Ga0157380_12748928 3300014326 Bacteria 559
547 Ga0182008_10012937 3300014497 Bacteria 4393
548 Ga0157377_10000038 3300014745 Bacteria 113777
549 Ga0157379_10010333 3300014968 Bacteria 8128
550 Ga0157379_10013394 3300014968 Bacteria 7183
551 Ga0157379_10098990 3300014968 Unclassified 2618
552 Ga0157379_10148335 3300014968 Bacteria 2115
553 Ga0157379_10186169 3300014968 Bacteria 1876
554 Ga0157379_10216243 3300014968 Bacteria 1736
555 Ga0157379_10231886 3300014968 Bacteria 1673
556 Ga0157379_10512205 3300014968 Bacteria 1113
557 Ga0157376_10013251 3300014969 Bacteria 6147
558 Ga0157376_10057217 3300014969 Bacteria 3260
559 Ga0157376_10066860 3300014969 Bacteria 3039
560 Ga0157376_10076861 3300014969 Bacteria 2854
561 Ga0157376_10362084 3300014969 Bacteria 1391
562 Ga0157376_10603741 3300014969 Bacteria 1092
563 Ga0157376_10880672 3300014969 Bacteria 912
564 Ga0157376_11702384 3300014969 Bacteria 666
565 Ga0157376_12237943 3300014969 Bacteria 586
566 Ga0182007_10059475 3300015262 Bacteria 1253
567 Ga0182007_10191580 3300015262 Bacteria 711
568 Ga0163161_10009253 3300017792 Bacteria 6812
569 Ga0163161_10009506 3300017792 Bacteria 6728
570 Ga0163161_10069082 3300017792 Bacteria 2582
571 Ga0163161_10099022 3300017792 Bacteria 2167
572 Ga0163161_10123375 3300017792 Bacteria 1948
573 Ga0163161_10238256 3300017792 Bacteria 1414
574 Ga0163161_10250531 3300017792 Bacteria 1380
575 Ga0163161_10673800 3300017792 Bacteria 859
576 Ga0209257_1017474 3300025304 Bacteria 2822
577 Ga0207697_10049795 3300025315 Bacteria 1729
578 Ga0207697_10056336 3300025315 Bacteria 1631
579 Ga0207697_10195989 3300025315 Bacteria 888
580 Ga0207697_10346269 3300025315 Bacteria 660
581 Ga0207656_10012636 3300025321 Bacteria 3214
582 Ga0207656_10014424 3300025321 Bacteria 3044
583 Ga0207656_10027869 3300025321 Bacteria 2314
584 Ga0207656_10043479 3300025321 Bacteria 1916
585 Ga0207656_10152678 3300025321 Bacteria 1095
586 Ga0207656_10577957 3300025321 Bacteria 573
587 Ga0207682_10005613 3300025893 Bacteria 5102
588 Ga0207682_10074810 3300025893 Bacteria 1441
589 Ga0207692_10562275 3300025898 Bacteria 730
590 Ga0207642_10000975 3300025899 Bacteria 8931
591 Ga0207642_10126255 3300025899 Bacteria 1328
592 Ga0207642_10145372 3300025899 Bacteria 1255
593 Ga0207688_10046193 3300025901 Bacteria 2431
594 Ga0207680_10223331 3300025903 Bacteria 1292
595 Ga0207680_10377503 3300025903 Bacteria 999
596 Ga0207680_10833341 3300025903 Bacteria 661
597 Ga0207685_10106748 3300025905 Bacteria 1207
598 Ga0207699_10504661 3300025906 Bacteria 873
599 Ga0207645_10007830 3300025907 Bacteria 7513
600 Ga0207645_10063684 3300025907 Bacteria 2356
601 Ga0207645_10075514 3300025907 Bacteria 2157
602 Ga0207645_10126029 3300025907 Bacteria 1664
603 Ga0207645_10150684 3300025907 Bacteria 1518
604 Ga0207645_10173121 3300025907 Bacteria 1415
605 Ga0207645_10311078 3300025907 Bacteria 1050
606 Ga0207643_10001046 3300025908 Bacteria 16403
607 Ga0207643_10085050 3300025908 Bacteria 1837
608 Ga0207705_10172821 3300025909 Bacteria 1627
609 Ga0207705_10275105 3300025909 Bacteria 1288
610 Ga0207684_10003630 3300025910 Bacteria 15000
611 Ga0207684_10534499 3300025910 Bacteria 1004
612 Ga0207654_10148258 3300025911 Bacteria 1503
613 Ga0207654_10651453 3300025911 Bacteria 754
614 Ga0207707_10018607 3300025912 Bacteria 6055
615 Ga0207707_10199234 3300025912 Bacteria 1746
616 Ga0207707_10222393 3300025912 Bacteria 1643
617 Ga0207707_10276546 3300025912 Bacteria 1455
618 Ga0207707_10513269 3300025912 Bacteria 1021
619 Ga0207695_10013448 3300025913 Bacteria 9762
620 Ga0207671_10020267 3300025914 Bacteria 5065
621 Ga0207671_10446259 3300025914 Bacteria 1030
622 Ga0207660_10062116 3300025917 Bacteria 2691
623 Ga0207660_10224412 3300025917 Bacteria 1475
624 Ga0207662_10003776 3300025918 Bacteria 7859
625 Ga0207662_10021166 3300025918 Bacteria 3713
626 Ga0207657_10003925 3300025919 Bacteria 15787
627 Ga0207657_10029767 3300025919 Bacteria 4964
628 Ga0207657_10053292 3300025919 Bacteria 3505
629 Ga0207649_10003005 3300025920 Bacteria 9280
630 Ga0207649_10003313 3300025920 Bacteria 8816
631 Ga0207649_10066882 3300025920 Bacteria 2280
632 Ga0207649_10131865 3300025920 Bacteria 1699
633 Ga0207649_10369254 3300025920 Bacteria 1067
634 Ga0207649_10460544 3300025920 Bacteria 961
635 Ga0207652_10008747 3300025921 Bacteria 8148
636 Ga0207652_10040517 3300025921 Bacteria 3956
637 Ga0207646_10511692 3300025922 Bacteria 1081
638 Ga0207646_10531738 3300025922 Bacteria 1058
639 Ga0207681_10002399 3300025923 Bacteria 11913
640 Ga0207681_10086334 3300025923 Bacteria 2229
641 Ga0207681_10258073 3300025923 Bacteria 1363
642 Ga0207694_10003251 3300025924 Bacteria 12941
643 Ga0207694_10060063 3300025924 Bacteria 2958
644 Ga0207694_11191900 3300025924 Bacteria 644
645 Ga0207694_11275355 3300025924 Unclassified 621
646 Ga0207650_10012475 3300025925 Bacteria 5866
647 Ga0207650_10033151 3300025925 Bacteria 3739
648 Ga0207650_10040742 3300025925 Bacteria 3400
649 Ga0207650_10042985 3300025925 Bacteria 3315
650 Ga0207650_10045822 3300025925 Bacteria 3218
651 Ga0207650_10050059 3300025925 Bacteria 3088
652 Ga0207650_10157266 3300025925 Bacteria 1798
653 Ga0207650_10164184 3300025925 Bacteria 1761
654 Ga0207650_10240066 3300025925 Bacteria 1464
655 Ga0207650_10393736 3300025925 Bacteria 1146
656 Ga0207659_10003145 3300025926 Bacteria 9869
657 Ga0207659_10004238 3300025926 Bacteria 8674
658 Ga0207659_10038030 3300025926 Unclassified 3344
659 Ga0207659_10045314 3300025926 Bacteria 3100
660 Ga0207659_10057869 3300025926 Bacteria 2782
661 Ga0207659_10081329 3300025926 Bacteria 2395
662 Ga0207659_10593047 3300025926 Bacteria 944
663 Ga0207659_10598982 3300025926 Bacteria 939
664 Ga0207659_10798175 3300025926 Bacteria 811
665 Ga0207659_10907083 3300025926 Bacteria 758
666 Ga0207687_10000272 3300025927 Bacteria 35402
667 Ga0207687_10016519 3300025927 Bacteria 4848
668 Ga0207687_10058619 3300025927 Bacteria 2710
669 Ga0207687_10073662 3300025927 Bacteria 2445
670 Ga0207687_10214273 3300025927 Bacteria 1512
671 Ga0207687_10741523 3300025927 Bacteria 835
672 Ga0207700_10289283 3300025928 Bacteria 1412
673 Ga0207664_10016109 3300025929 Bacteria 5446
674 Ga0207644_10147354 3300025931 Bacteria 1818
675 Ga0207644_10210155 3300025931 Bacteria 1538
676 Ga0207644_10212340 3300025931 Bacteria 1531
677 Ga0207644_10331139 3300025931 Bacteria 1233
678 Ga0207644_10393869 3300025931 Bacteria 1131
679 Ga0207644_10398658 3300025931 Bacteria 1124
680 Ga0207644_10886674 3300025931 Bacteria 747
681 Ga0207644_11461832 3300025931 Bacteria 574
682 Ga0207690_10002241 3300025932 Bacteria 11803
683 Ga0207690_10146460 3300025932 Bacteria 1746
684 Ga0207690_10223887 3300025932 Bacteria 1441
685 Ga0207690_10543746 3300025932 Bacteria 944
686 Ga0207690_10679031 3300025932 Bacteria 846
687 Ga0207690_10853169 3300025932 Bacteria 754
688 Ga0207706_10005279 3300025933 Bacteria 12049
689 Ga0207706_10016420 3300025933 Bacteria 6683
690 Ga0207706_10091900 3300025933 Bacteria 2668
691 Ga0207706_10239600 3300025933 Bacteria 1586
692 Ga0207706_10380387 3300025933 Bacteria 1225
693 Ga0207706_10775947 3300025933 Bacteria 815
694 Ga0207706_11090607 3300025933 Bacteria 667
695 Ga0207706_11198637 3300025933 Bacteria 631
696 Ga0207686_10003160 3300025934 Bacteria 8863
697 Ga0207686_10082996 3300025934 Bacteria 2096
698 Ga0207709_10001602 3300025935 Bacteria 15414
699 Ga0207709_10016537 3300025935 Bacteria 4102
700 Ga0207709_10209333 3300025935 Bacteria 1398
701 Ga0207670_10009828 3300025936 Bacteria 5477
702 Ga0207670_10758189 3300025936 Bacteria 806
703 Ga0207669_10032142 3300025937 Bacteria 2943
704 Ga0207669_10042381 3300025937 Bacteria 2656
705 Ga0207669_10150066 3300025937 Bacteria 1631
706 Ga0207669_10230390 3300025937 Bacteria 1366
707 Ga0207669_10386044 3300025937 Bacteria 1092
708 Ga0207669_10418093 3300025937 Bacteria 1054
709 Ga0207704_10000466 3300025938 Bacteria 17960
710 Ga0207704_10003704 3300025938 Bacteria 6954
711 Ga0207704_10017537 3300025938 Bacteria 3715
712 Ga0207704_10076850 3300025938 Bacteria 2141
713 Ga0207704_10147353 3300025938 Bacteria 1656
714 Ga0207704_10216424 3300025938 Bacteria 1414
715 Ga0207704_11183901 3300025938 Bacteria 651
716 Ga0207665_10051105 3300025939 Bacteria 2781
717 Ga0207665_10120085 3300025939 Bacteria 1856
718 Ga0207691_10000585 3300025940 Bacteria 36368
719 Ga0207691_10098988 3300025940 Bacteria 2604
720 Ga0207691_10106232 3300025940 Bacteria 2501
721 Ga0207691_10202176 3300025940 Bacteria 1728
722 Ga0207691_10230852 3300025940 Bacteria 1603
723 Ga0207691_10338741 3300025940 Bacteria 1288
724 Ga0207691_10391727 3300025940 Bacteria 1185
725 Ga0207711_10005009 3300025941 Bacteria 11238
726 Ga0207711_10025434 3300025941 Bacteria 4968
727 Ga0207711_10099546 3300025941 Bacteria 2570
728 Ga0207711_10099990 3300025941 Bacteria 2565
729 Ga0207711_10237486 3300025941 Bacteria 1671
730 Ga0207711_10340832 3300025941 Bacteria 1387
731 Ga0207711_10389829 3300025941 Bacteria 1293
732 Ga0207689_10000871 3300025942 Bacteria 29097
733 Ga0207689_10002937 3300025942 Bacteria 15742
734 Ga0207689_10004042 3300025942 Bacteria 13328
735 Ga0207689_10004421 3300025942 Bacteria 12756
736 Ga0207689_10005411 3300025942 Bacteria 11429
737 Ga0207689_10067632 3300025942 Bacteria 2936
738 Ga0207689_11818660 3300025942 Bacteria 503
739 Ga0207661_10071935 3300025944 Bacteria 2828
740 Ga0207661_10745605 3300025944 Bacteria 901
741 Ga0207679_10002174 3300025945 Bacteria 12123
742 Ga0207679_10052413 3300025945 Bacteria 2992
743 Ga0207679_10124403 3300025945 Bacteria 2059
744 Ga0207679_10265151 3300025945 Bacteria 1467
745 Ga0207679_10286843 3300025945 Bacteria 1414
746 Ga0207679_10497716 3300025945 Bacteria 1087
747 Ga0207679_10559791 3300025945 Bacteria 1027
748 Ga0207679_10631818 3300025945 Bacteria 967
749 Ga0207679_10684686 3300025945 Bacteria 929
750 Ga0207667_10008246 3300025949 Bacteria 12399
751 Ga0207667_10037649 3300025949 Bacteria 5170
752 Ga0207667_10199874 3300025949 Bacteria 2051
753 Ga0207651_10006158 3300025960 Bacteria 6241
754 Ga0207651_10007488 3300025960 Bacteria 5821
755 Ga0207651_10023532 3300025960 Bacteria 3792
756 Ga0207651_10031578 3300025960 Bacteria 3388
757 Ga0207651_10062447 3300025960 Bacteria 2596
758 Ga0207651_10154014 3300025960 Bacteria 1793
759 Ga0207651_10162173 3300025960 Bacteria 1754
760 Ga0207651_10250485 3300025960 Bacteria 1449
761 Ga0207651_10828197 3300025960 Bacteria 821
762 Ga0207651_10966667 3300025960 Bacteria 760
763 Ga0207651_11237709 3300025960 Bacteria 670
764 Ga0207712_10050431 3300025961 Bacteria 2906
765 Ga0207712_10065814 3300025961 Bacteria 2588
766 Ga0207712_10125419 3300025961 Bacteria 1949
767 Ga0207712_10646066 3300025961 Bacteria 919
768 Ga0207668_10003937 3300025972 Bacteria 8754
769 Ga0207668_10004439 3300025972 Bacteria 8238
770 Ga0207668_10016951 3300025972 Bacteria 4558
771 Ga0207668_10020191 3300025972 Bacteria 4228
772 Ga0207668_10063333 3300025972 Bacteria 2608
773 Ga0207668_10072954 3300025972 Bacteria 2458
774 Ga0207668_10237954 3300025972 Bacteria 1471
775 Ga0207668_10830176 3300025972 Bacteria 819
776 Ga0207668_11630736 3300025972 Bacteria 582
777 Ga0207640_10008784 3300025981 Bacteria 5623
778 Ga0207640_10011596 3300025981 Bacteria 4995
779 Ga0207640_10471301 3300025981 Bacteria 1039
780 Ga0207640_10809467 3300025981 Bacteria 812
781 Ga0207658_10006065 3300025986 Bacteria 8254
782 Ga0207658_10007142 3300025986 Bacteria 7608
783 Ga0207658_10087341 3300025986 Bacteria 2408
784 Ga0207658_10105845 3300025986 Bacteria 2213
785 Ga0207658_10127415 3300025986 Bacteria 2040
786 Ga0207658_10189947 3300025986 Bacteria 1706
787 Ga0207658_10194071 3300025986 Bacteria 1690
788 Ga0207658_10426079 3300025986 Bacteria 1171
789 Ga0207658_10455369 3300025986 Bacteria 1133
790 Ga0207658_10518995 3300025986 Bacteria 1063
791 Ga0207658_10592752 3300025986 Bacteria 995
792 Ga0207658_10724888 3300025986 Bacteria 899
793 Ga0207658_10813894 3300025986 Bacteria 848
794 Ga0207658_10818965 3300025986 Bacteria 846
795 Ga0207677_10004016 3300026023 Bacteria 7851
796 Ga0207677_10016437 3300026023 Bacteria 4384
797 Ga0207677_10046649 3300026023 Bacteria 2903
798 Ga0207677_10145173 3300026023 Bacteria 1822
799 Ga0207677_10333154 3300026023 Bacteria 1265
800 Ga0207677_11874341 3300026023 Bacteria 557
801 Ga0207703_10001859 3300026035 Bacteria 18774
802 Ga0207703_10006259 3300026035 Bacteria 9520
803 Ga0207703_10021643 3300026035 Bacteria 5033
804 Ga0207703_10332497 3300026035 Bacteria 1394
805 Ga0207639_10013251 3300026041 Bacteria 5764
806 Ga0207639_10074528 3300026041 Bacteria 2665
807 Ga0207639_10204357 3300026041 Bacteria 1696
808 Ga0207639_10255527 3300026041 Bacteria 1530
809 Ga0207639_10678661 3300026041 Bacteria 955
810 Ga0207678_10068441 3300026067 Bacteria 3046
811 Ga0207678_10101802 3300026067 Bacteria 2452
812 Ga0207678_10403265 3300026067 Bacteria 1184
813 Ga0207678_10503139 3300026067 Bacteria 1056
814 Ga0207678_10661262 3300026067 Bacteria 918
815 Ga0207708_10001020 3300026075 Bacteria 20955
816 Ga0207708_10113091 3300026075 Bacteria 2109
817 Ga0207708_10118398 3300026075 Bacteria 2062
818 Ga0207702_10001462 3300026078 Bacteria 23492
819 Ga0207702_10122997 3300026078 Bacteria 2325
820 Ga0207702_10527318 3300026078 Bacteria 1153
821 Ga0207641_10002465 3300026088 Bacteria 17092
822 Ga0207641_10014817 3300026088 Bacteria 6391
823 Ga0207641_10034218 3300026088 Bacteria 4225
824 Ga0207641_10110003 3300026088 Bacteria 2441
825 Ga0207641_10112090 3300026088 Bacteria 2420
826 Ga0207641_10116286 3300026088 Bacteria 2379
827 Ga0207641_10164822 3300026088 Bacteria 2017
828 Ga0207641_10271458 3300026088 Bacteria 1591
829 Ga0207641_10627187 3300026088 Bacteria 1054
830 Ga0207641_11110396 3300026088 Bacteria 789
831 Ga0207648_10000118 3300026089 Bacteria 77144
832 Ga0207648_10000252 3300026089 Bacteria 57773
833 Ga0207648_10000414 3300026089 Bacteria 47501
834 Ga0207648_10003756 3300026089 Bacteria 15865
835 Ga0207648_10039984 3300026089 Bacteria 4122
836 Ga0207648_10085210 3300026089 Bacteria 2757
837 Ga0207648_10090476 3300026089 Bacteria 2674
838 Ga0207648_10100253 3300026089 Bacteria 2537
839 Ga0207648_10436881 3300026089 Bacteria 1190
840 Ga0207648_10539533 3300026089 Bacteria 1070
841 Ga0207676_10004558 3300026095 Bacteria 9812
842 Ga0207676_10007881 3300026095 Bacteria 7576
843 Ga0207676_10022208 3300026095 Bacteria 4665
844 Ga0207676_10038159 3300026095 Bacteria 3664
845 Ga0207676_10041169 3300026095 Bacteria 3544
846 Ga0207676_10083665 3300026095 Bacteria 2599
847 Ga0207676_10130804 3300026095 Bacteria 2133
848 Ga0207676_10134614 3300026095 Bacteria 2106
849 Ga0207676_10210570 3300026095 Bacteria 1724
850 Ga0207676_10271918 3300026095 Bacteria 1535
851 Ga0207676_10324543 3300026095 Bacteria 1414
852 Ga0207676_11183631 3300026095 Bacteria 757
853 Ga0207676_11258639 3300026095 Bacteria 734
854 Ga0207676_11496216 3300026095 Bacteria 672
855 Ga0207676_11979872 3300026095 Bacteria 581
856 Ga0207674_10000221 3300026116 Bacteria 70884
857 Ga0207674_10022969 3300026116 Bacteria 6690
858 Ga0207674_10103279 3300026116 Bacteria 2830
859 Ga0207674_10108193 3300026116 Bacteria 2757
860 Ga0207674_10114848 3300026116 Bacteria 2664
861 Ga0207674_10117773 3300026116 Bacteria 2627
862 Ga0207674_10320954 3300026116 Bacteria 1498
863 Ga0207674_11522421 3300026116 Bacteria 638
864 Ga0207675_100000222 3300026118 Bacteria 53252
865 Ga0207675_100002026 3300026118 Bacteria 20197
866 Ga0207675_100002097 3300026118 Bacteria 19787
867 Ga0207675_100032820 3300026118 Bacteria 4837
868 Ga0207675_100053597 3300026118 Bacteria 3764
869 Ga0207675_100071706 3300026118 Bacteria 3239
870 Ga0207675_100099610 3300026118 Bacteria 2737
871 Ga0207675_100112194 3300026118 Bacteria 2573
872 Ga0207675_100351843 3300026118 Bacteria 1444
873 Ga0207675_100519872 3300026118 Bacteria 1186
874 Ga0207675_102313120 3300026118 Bacteria 551
875 Ga0207683_10003313 3300026121 Bacteria 14038
876 Ga0207683_10042276 3300026121 Bacteria 3980
877 Ga0207683_10077370 3300026121 Bacteria 2946
878 Ga0207683_10113924 3300026121 Bacteria 2422
879 Ga0207683_10198937 3300026121 Bacteria 1821
880 Ga0207683_10403209 3300026121 Bacteria 1258
881 Ga0207683_10581795 3300026121 Bacteria 1036
882 Ga0207683_10721002 3300026121 Bacteria 925
883 Ga0207683_11007221 3300026121 Bacteria 773
884 Ga0207698_10009138 3300026142 Bacteria 6300
885 Ga0207698_10010597 3300026142 Bacteria 5936
886 Ga0207698_10019566 3300026142 Bacteria 4638
887 Ga0207698_10109677 3300026142 Bacteria 2310
888 Ga0207698_10223340 3300026142 Bacteria 1704
889 Ga0207698_10410139 3300026142 Bacteria 1297
890 Ga0209967_1017304 3300027364 Bacteria 1039
891 Ga0209981_1015970 3300027378 Bacteria 1054
892 Ga0209996_1008256 3300027395 Bacteria 1363
893 Ga0210000_1002536 3300027462 Bacteria 2602
894 Ga0209999_1001870 3300027543 Bacteria 3656
895 Ga0209983_1016343 3300027665 Bacteria 1532
896 Ga0209971_1012907 3300027682 Bacteria 1979
897 Ga0209813_10143147 3300027866 Bacteria 850
898 Ga0209974_10002781 3300027876 Bacteria 6344
899 Ga0209974_10176815 3300027876 Bacteria 780
900 Ga0207428_10399024 3300027907 Bacteria 1007
901 Ga0207428_10701559 3300027907 Bacteria 724
902 Ga0268266_10018796 3300028379 Bacteria 5889
903 Ga0268266_10169395 3300028379 Bacteria 1981
904 Ga0268266_10629905 3300028379 Bacteria 1031
905 Ga0268266_10677892 3300028379 Bacteria 993
906 Ga0268266_10726269 3300028379 Bacteria 958
907 Ga0268266_10776534 3300028379 Bacteria 925
908 Ga0268266_10892193 3300028379 Bacteria 860
909 Ga0268266_11839423 3300028379 Bacteria 580
910 Ga0268265_10036526 3300028380 Bacteria 3599
911 Ga0268265_10037234 3300028380 Bacteria 3569
912 Ga0268265_10037261 3300028380 Bacteria 3568
913 Ga0268265_10068910 3300028380 Bacteria 2745
914 Ga0268265_10142664 3300028380 Unclassified 2007
915 Ga0268265_10259110 3300028380 Bacteria 1545
916 Ga0268265_11292123 3300028380 Bacteria 729
917 Ga0268264_10002495 3300028381 Bacteria 16175
918 Ga0268264_10004937 3300028381 Bacteria 11298
919 Ga0268264_10029538 3300028381 Bacteria 4491
920 Ga0268264_10078045 3300028381 Bacteria 2822
921 Ga0268264_10113603 3300028381 Bacteria 2376
922 Ga0268264_10132402 3300028381 Bacteria 2212
923 Ga0268264_10519952 3300028381 Bacteria 1163
924 Ga0268264_10529948 3300028381 Bacteria 1153
925 Ga0307517_10000131 3300028786 Bacteria 113233
926 Ga0307517_10196678 3300028786 Bacteria 1268
927 Ga0307515_10016458 3300028794 Bacteria 13533
928 Ga0307515_10028345 3300028794 Bacteria 9520
929 Ga0307515_10093677 3300028794 Bacteria 3721
930 Ga0307515_10134131 3300028794 Bacteria 2704
931 Ga0307515_10155455 3300028794 Bacteria 2363
932 Ga0307515_10328743 3300028794 Bacteria 1189
933 Ga0307515_10554214 3300028794 Bacteria 759
934 Ga0307512_10195425 3300030522 Bacteria 1106
935 Ga0307513_10014280 3300031456 Bacteria 9708
936 Ga0307513_10037728 3300031456 Bacteria 5374
937 Ga0307513_10052818 3300031456 Bacteria 4373
938 Ga0307513_10219967 3300031456 Bacteria 1721
939 Ga0307513_10318504 3300031456 Bacteria 1314
940 Ga0307509_10004038 3300031507 Bacteria 21555
941 Ga0307509_10040444 3300031507 Bacteria 5070
942 Ga0307509_10041270 3300031507 Bacteria 5008
943 Ga0307509_10084392 3300031507 Bacteria 3271
944 Ga0307509_10188846 3300031507 Bacteria 1914
945 Ga0307508_10000727 3300031616 Bacteria 39082
946 Ga0307508_10143662 3300031616 Bacteria 1990
947 Ga0307514_10124138 3300031649 Bacteria 1793
948 Ga0307516_10001122 3300031730 Bacteria 37338
949 Ga0307516_10090515 3300031730 Bacteria 2888
950 Ga0307516_10265330 3300031730 Bacteria 1406
951 Ga0307516_10322727 3300031730 Bacteria 1215
952 Ga0307516_10476092 3300031730 Bacteria 904
953 Ga0307516_10573631 3300031730 Bacteria 782
954 Ga0307405_10109927 3300031731 Bacteria 1866
955 Ga0307405_10347514 3300031731 Bacteria 1143
956 Ga0307413_10150796 3300031824 Bacteria 1620
957 Ga0307518_10112038 3300031838 Bacteria 1943
958 Ga0307410_11450581 3300031852 Bacteria 603
959 Ga0307409_100812674 3300031995 Bacteria 943
960 Ga0307414_10179977 3300032004 Bacteria 1699
961 Ga0307414_10257254 3300032004 Bacteria 1455
962 Ga0307414_10285866 3300032004 Bacteria 1388
963 Ga0307414_11153625 3300032004 Bacteria 717
964 Ga0307507_10079435 3300033179 Bacteria 2899
965 Ga0307507_10268582 3300033179 Bacteria 1080
966 Ga0307510_10006573 3300033180 Bacteria 13866
967 Ga0307510_10009853 3300033180 Bacteria 11368
968 Ga0307510_10213116 3300033180 Bacteria 1451
969 Ga0307510_10221948 3300033180 Bacteria 1400
970 Ga0373930_0048149 3300034816 Bacteria 924
971 Ga0373929_0127539 3300035085 Bacteria 664
972 Ga0373934_0237933 3300035086 Bacteria 752
973 Ga0373940_0100864 3300035088 Bacteria 876
974 Ga0373944_0067240 3300035089 Bacteria 1161
975 Ga0373932_0043412 3300035112 Bacteria 1308
976 Ga0373936_0366126 3300035113 Bacteria 658
977 Ga0373939_0544266 3300035114 Bacteria 501
978 Ga0373957_0451129 3300035120 Bacteria 557
979 Ga0373960_0075692 3300035121 Bacteria 1050
980 Ga0373960_0125589 3300035121 Bacteria 855
981 Ga0373943_0552024 3300035170 Bacteria 676
982 Ga0373946_0362644 3300035171 Bacteria 726
983 Ga0373961_0050453 3300035241 Bacteria 1232
984 Ga0373962_0030510 3300035242 Bacteria 1475
985 Ga0373924_0026313 3300035410 Bacteria 2307
986 Ga0373931_0002625 3300035691 Bacteria 8001
987 Ga0373931_0792534 3300035691 Bacteria 631
988 Ga0373935_0036090 3300035692 Bacteria 3089
989 Ga0373937_0237061 3300036401 Bacteria 1718
990 Ga0373937_0680947 3300036401 Bacteria 974
991 Ga0373925_0013121 3300037068 Bacteria 5996
992 Ga0395905_0012328 3300037471 Bacteria 8229
993 Ga0395901_0023099 3300038443 Bacteria 6374
994 Ga0451798_0432743 3300041458 Bacteria 660
995 Ga0451802_0078565 3300041460 Bacteria 569
996 Ga0451835_0602591 3300041492 Bacteria 754
997 Ga0451855_1606860 3300041511 Bacteria 814
998 Ga0451853_0546941 3300041512 Bacteria 594
999 Ga0451853_1843137 3300041512 Bacteria 1062
1000 Ga0451853_2789341 3300041512 Bacteria 1626
1001 Ga0439462_0164052 3300042015 Bacteria 627
1002 Ga0450913_000850 3300042117 Bacteria 1487
1003 Ga0450905_012733 3300042142 Bacteria 1187
1004 Ga0439435_0077750 3300042436 Bacteria 992
1005 Ga0451577_0020789 3300042876 Bacteria 6018
1006 Ga0453684_0129774 3300044712 Bacteria 3026
1007 Ga0451576_0055580 3300045051 Bacteria 4141
1008 Ga0451576_0742279 3300045051 Bacteria 1031
1009 Ga0451576_1243286 3300045051 Bacteria 777
1010 Ga0495592_0001337 3300046454 Bacteria 17100
1011 Ga0495629_0245974 3300046459 Bacteria 1231
1012 Ga0495638_0295334 3300046460 Bacteria 875
1013 Ga0495638_0588965 3300046460 Bacteria 548
1014 Ga0495651_0056390 3300046462 Bacteria 3018
1015 Ga0495651_0212562 3300046462 Bacteria 1345
1016 Ga0495653_0279644 3300046463 Bacteria 1096
1017 Ga0495580_0068802 3300046472 Bacteria 2475
1018 Ga0495580_0078136 3300046472 Bacteria 2308
1019 Ga0495605_0001689 3300046474 Bacteria 14177
1020 Ga0495585_0186446 3300046492 Bacteria 1064
1021 Ga0495583_0008255 3300046506 Bacteria 6385
1022 Ga0495606_0010357 3300046507 Bacteria 7747
1023 Ga0495606_0135102 3300046507 Bacteria 1462
1024 Ga0495606_0157471 3300046507 Bacteria 1328
1025 Ga0495610_0039173 3300046512 Bacteria 2399
1026 Ga0495618_0284898 3300046514 Bacteria 1030
1027 Ga0495620_0008826 3300046515 Bacteria 5392
1028 Ga0495628_0028451 3300046516 Bacteria 4541
1029 Ga0495630_0015929 3300046517 Bacteria 5495
1030 Ga0495630_0142355 3300046517 Bacteria 1824
1031 Ga0495632_0118099 3300046519 Bacteria 1241
1032 Ga0495648_0288769 3300046524 Bacteria 774
1033 Ga0495666_0005962 3300046526 Bacteria 6144
1034 Ga0495665_0334274 3300046531 Bacteria 773
1035 Ga0495598_0027114 3300046537 Bacteria 1577
1036 Ga0495598_0128537 3300046537 Bacteria 866
1037 Ga0495645_0412717 3300046543 Bacteria 858
1038 Ga0495645_0961624 3300046543 Bacteria 504
1039 Ga0495633_0290848 3300046558 Bacteria 743
1040 Ga0495633_0357063 3300046558 Bacteria 662
1041 Ga0495667_0825113 3300046559 Bacteria 571
1042 Ga0495634_0307458 3300046642 Bacteria 957
1043 Ga0495634_0546491 3300046642 Bacteria 676
1044 Ga0495611_0125894 3300046648 Bacteria 1195
1045 Ga0495625_0020381 3300046660 Bacteria 5119
1046 Ga0495661_0136490 3300046665 Bacteria 1338
1047 Ga0495599_0047067 3300046678 Bacteria 2703
1048 Ga0495646_0146323 3300046680 Bacteria 1317
1049 Ga0495658_0043936 3300046683 Bacteria 2502
1050 Ga0495658_0062969 3300046683 Bacteria 2133
1051 Ga0495658_0144590 3300046683 Bacteria 1456
1052 Ga0495658_0420425 3300046683 Bacteria 853
1053 Ga0495613_0431087 3300046689 Bacteria 896
1054 Ga0495613_0568341 3300046689 Bacteria 757
1055 Ga0495613_0682946 3300046689 Bacteria 677
1056 Ga0495649_0114623 3300046694 Bacteria 1427
1057 Ga0495660_0223753 3300046810 Bacteria 886
1058 Ga0495581_0125936 3300047315 Bacteria 1492
1059 Ga0495604_0044970 3300047317 Bacteria 3447
1060 Ga0495674_0274443 3300047319 Bacteria 1382
1061 Ga0495680_0029215 3300047322 Bacteria 4515
1062 Ga0495683_0432223 3300047323 Bacteria 543
1063 Ga0495679_000048 3300047446 Bacteria 127785
1064 Ga0495673_0023080 3300047469 Bacteria 3036
1065 Ga0495673_0028655 3300047469 Bacteria 2635
1066 Ga0495684_0163362 3300047471 Bacteria 1660
1067 Ga0495684_0783656 3300047471 Bacteria 624
1068 Ga0495686_0036927 3300047472 Bacteria 3133
1069 Ga0495686_0098044 3300047472 Bacteria 1772
1070 Ga0495686_0219271 3300047472 Bacteria 1083
1071 Ga0495602_0136346 3300048088 Bacteria 1949
1072 Ga0495615_0180682 3300048090 Bacteria 643
1073 Ga0496101_0020862 3300048904 Bacteria 4495
1074 Ga0496101_0594062 3300048904 Bacteria 875
1075 Ga0496101_0666903 3300048904 Bacteria 822
1076 Ga0496102_0042988 3300048905 Bacteria 4096
1077 Ga0496102_0216486 3300048905 Bacteria 1805
1078 Ga0496102_0876974 3300048905 Bacteria 819
1079 Ga0496103_0234001 3300048906 Bacteria 1182
1080 Ga0496103_0269813 3300048906 Bacteria 1095
1081 Ga0496104_0137373 3300048907 Bacteria 2348
1082 Ga0496104_0863055 3300048907 Bacteria 810
1083 Ga0496105_0054416 3300048908 Bacteria 3304
1084 Ga0496105_0085924 3300048908 Bacteria 2600
1085 Ga0496105_0095192 3300048908 Bacteria 2460
1086 Ga0496105_0455397 3300048908 Bacteria 1009
1087 Ga0496106_0005982 3300048909 Bacteria 8993
1088 Ga0496106_0017712 3300048909 Bacteria 5269
1089 Ga0496106_0115583 3300048909 Bacteria 2093
1090 Ga0496107_0040401 3300048910 Bacteria 3348
1091 Ga0496108_0134793 3300048911 Bacteria 2124
1092 Ga0496108_0376164 3300048911 Bacteria 1240
1093 Ga0496108_0392400 3300048911 Bacteria 1212
1094 Ga0496108_0524337 3300048911 Bacteria 1034
1095 Ga0496108_1064954 3300048911 Bacteria 688
1096 Ga0496109_0071857 3300048912 Bacteria 3178
1097 Ga0496109_0279918 3300048912 Bacteria 1572
1098 Ga0496109_0799973 3300048912 Bacteria 881
1099 Ga0496109_0928679 3300048912 Bacteria 808
1100 Ga0496109_1490373 3300048912 Bacteria 611
1101 Ga0496110_0009565 3300048913 Bacteria 7843
1102 Ga0496110_0108368 3300048913 Bacteria 2494
1103 Ga0496110_1544259 3300048913 Bacteria 574
1104 Ga0496111_0047491 3300048914 Bacteria 3092
1105 Ga0496112_0003822 3300048915 Bacteria 12580
1106 Ga0496112_0016174 3300048915 Bacteria 6979
1107 Ga0496112_0209108 3300048915 Bacteria 1909
1108 Ga0496113_0042410 3300048916 Bacteria 3362
1109 Ga0496113_0211149 3300048916 Bacteria 1545
1110 Ga0496114_0174372 3300048917 Bacteria 1875
1111 Ga0496115_0018970 3300048918 Bacteria 5290
1112 Ga0496115_0550763 3300048918 Bacteria 922
1113 Ga0496118_0067713 3300048921 Bacteria 2597
1114 Ga0495678_010827 3300049459 Bacteria 4404
1115 Ga0501031_0071155 3300049568 Bacteria 2265
1116 Ga0501034_0013945 3300049571 Bacteria 8273
1117 Ga0501034_0218315 3300049571 Bacteria 1860
1118 Ga0501037_0344294 3300049573 Bacteria 1029
1119 Ga0501038_0709780 3300049574 Bacteria 753
1120 Ga0501039_0194408 3300049575 Bacteria 1595
1121 Ga0501039_0287783 3300049575 Bacteria 1292
1122 Ga0501039_0537373 3300049575 Bacteria 917
1123 Ga0501039_0818599 3300049575 Bacteria 726
1124 Ga0501043_0000009 3300049579 Bacteria 214823
1125 Ga0501043_0666402 3300049579 Bacteria 763
1126 Ga0501046_0000022 3300049580 Bacteria 215451
1127 Ga0501046_0050705 3300049580 Bacteria 3278
1128 Ga0501047_0000021 3300049581 Bacteria 254841
1129 Ga0501048_0002882 3300049582 Bacteria 13123
1130 Ga0501067_0009466 3300049583 Bacteria 5399
1131 Ga0501068_0022012 3300049584 Bacteria 3725
1132 Ga0501069_0001317 3300049585 Bacteria 12163
1133 Ga0501070_0000419 3300049586 Bacteria 38553
1134 Ga0501070_0009351 3300049586 Bacteria 8288
1135 Ga0501070_0265206 3300049586 Bacteria 1403
1136 Ga0501071_1060612 3300049587 Bacteria 626
1137 Ga0501072_0008951 3300049588 Bacteria 7612
1138 Ga0501073_0001114 3300049589 Bacteria 19508
1139 Ga0501073_0001305 3300049589 Bacteria 18325
1140 Ga0501074_0022825 3300049590 Bacteria 4550
1141 Ga0501074_0023723 3300049590 Bacteria 4459
1142 Ga0501074_0035272 3300049590 Bacteria 3623
1143 Ga0501075_0946123 3300049591 Bacteria 655
1144 Ga0501076_0133204 3300049592 Bacteria 2016
1145 Ga0501079_0053227 3300049741 Bacteria 3123
1146 Ga0501080_0000564 3300049742 Bacteria 29307
1147 Ga0501080_0005245 3300049742 Bacteria 11544
1148 Ga0501080_0013786 3300049742 Bacteria 7442
1149 Ga0501080_0032785 3300049742 Bacteria 4846
1150 Ga0501081_0612066 3300049743 Bacteria 816
1151 Ga0501083_0006209 3300049744 Bacteria 8475
1152 Ga0501083_0020071 3300049744 Bacteria 4650
1153 Ga0501083_0031090 3300049744 Bacteria 3664
1154 Ga0501035_0046379 3300049822 Bacteria 3909
1155 Ga0501035_0221994 3300049822 Bacteria 1613
1156 Ga0501045_0003093 3300049824 Bacteria 11377
1157 nmdc:mga03683_21941_c1 3300050489 Bacteria 1121
1158 nmdc:mga03683_2360_c1 3300050489 Bacteria 5846
1159 nmdc:mga03683_59763_c1 3300050489 Bacteria 1609
1160 nmdc:mga03683_91404_c1 3300050489 Bacteria 1327
1161 nmdc:mga03n38_122303_c1 3300050490 Bacteria 1281
1162 nmdc:mga03n38_404544_c1 3300050490 Bacteria 752
1163 nmdc:mga00v17_223270_c1 3300050491 Bacteria 1220
1164 nmdc:mga00v17_75506_c1 3300050491 Bacteria 2096
1165 nmdc:mga0k408_16487_c1 3300050493 Bacteria 4101
1166 nmdc:mga0k408_18439_c1 3300050493 Bacteria 3897
1167 nmdc:mga0k408_326322_c1 3300050493 Bacteria 916
1168 nmdc:mga0k408_38321_c1 3300050493 Bacteria 2751
1169 nmdc:mga0k408_39814_c1 3300050493 Bacteria 2703
1170 nmdc:mga0k408_40078_c2 3300050493 Bacteria 2369
1171 nmdc:mga0k408_40570_c1 3300050493 Bacteria 2679
1172 nmdc:mga0k408_6593_c1 3300050493 Bacteria 6186
1173 nmdc:mga0k408_7540_c1 3300050493 Bacteria 5812
1174 nmdc:mga06z11_128369_c1 3300050494 Bacteria 1421
1175 nmdc:mga06z11_193036_c1 3300050494 Bacteria 1180
1176 nmdc:mga06z11_23341_c1 3300050494 Bacteria 2904
1177 nmdc:mga04h51_30893_c1 3300050495 Bacteria 1689
1178 nmdc:mga04h51_56146_c1 3300050495 Bacteria 1336
1179 nmdc:mga07m45_112971_c1 3300050496 Bacteria 1566
1180 nmdc:mga07m45_16449_c1 3300050496 Bacteria 3960
1181 nmdc:mga07m45_16874_c1 3300050496 Bacteria 3913
1182 nmdc:mga07m45_2015_c1 3300050496 Bacteria 9418
1183 nmdc:mga07m45_27334_c1 3300050496 Bacteria 3142
1184 nmdc:mga07m45_28658_c1 3300050496 Bacteria 3074
1185 nmdc:mga08y16_349760_c1 3300050511 Bacteria 1518
1186 nmdc:mga0n895_315103_c1 3300050512 Bacteria 1585
1187 nmdc:mga0n895_334111_c1 3300050512 Unclassified 1535
1188 nmdc:mga0rr50_20863_c1 3300050513 Bacteria 4460
1189 nmdc:mga08x19_104270_c1 3300050514 Bacteria 1884
1190 nmdc:mga0a205_1191660_c1 3300050515 Bacteria 609
1191 nmdc:mga0a205_342978_c1 3300050515 Bacteria 1362
1192 nmdc:mga0sz30_1145_c1 3300050516 Bacteria 9514
1193 nmdc:mga0sz30_131545_c1 3300050516 Bacteria 1103
1194 Ga0495601_0063497 3300053077 Bacteria 2347
1195 Ga0495601_0147605 3300053077 Bacteria 1535
1196 Ga0495612_0622238 3300053078 Bacteria 500
1197 Ga0495595_0324006 3300053084 Bacteria 776
1198 Ga0495619_0158689 3300053085 Bacteria 1562
1199 Ga0495619_0574317 3300053085 Bacteria 772
1200 Ga0500651_0218231 3300053093 Bacteria 1119
1201 Ga0500650_0199697 3300053098 Bacteria 911
1202 Ga0500652_041597 3300053131 Bacteria 1851
1203 Ga0500559_0000778 3300053136 Bacteria 20881
1204 Ga0500622_0001682 3300053156 Bacteria 17234
1205 Ga0500636_0207225 3300053177 Bacteria 1032
1206 Ga0500645_002795 3300053730 Bacteria 7526
1207 Ga0500587_005307 3300053739 Bacteria 1738
1208 Ga0501084_0074938 3300054114 Bacteria 2835
1209 Ga0501084_0215351 3300054114 Bacteria 1621
1210 Ga0501082_0026690 3300060353 Bacteria 4979
1211 Ga0501082_0755077 3300060353 Bacteria 851
1212 Ga0530510_0701303 3300061734 Bacteria 771

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0068802 Ga0495580_0068802_116_475 102
2 3300005333 Ga0070677_10089367 Ga0070677_100893672 115
3 3300005343 Ga0070687_100462020 Ga0070687_1004620202 115
4 3300005347 Ga0070668_100008227 Ga0070668_1000082275 115
5 3300005353 Ga0070669_100232717 Ga0070669_1002327172 115
6 3300005353 Ga0070669_100508870 Ga0070669_1005088702 115
7 3300005356 Ga0070674_100061702 Ga0070674_1000617023 115
8 3300005455 Ga0070663_100093633 Ga0070663_1000936332 115
9 3300005456 Ga0070678_100007314 Ga0070678_1000073145 115
10 3300005459 Ga0068867_100166882 Ga0068867_1001668822 115
11 3300005718 Ga0068866_10053037 Ga0068866_100530372 115
12 3300005719 Ga0068861_100119973 Ga0068861_1001199732 115
13 3300005841 Ga0068863_100759724 Ga0068863_1007597242 115
14 3300006237 Ga0097621_100095762 Ga0097621_1000957623 115
15 3300006358 Ga0068871_100089256 Ga0068871_1000892562 115
16 3300006881 Ga0068865_100339497 Ga0068865_1003394972 115
17 3300013306 Ga0163162_10699647 Ga0163162_106996472 115
18 3300013308 Ga0157375_13807750 Ga0157375_138077501 115
19 3300014326 Ga0157380_12748928 Ga0157380_127489281 115
20 3300014968 Ga0157379_10186169 Ga0157379_101861692 115
21 3300014969 Ga0157376_10066860 Ga0157376_100668602 115
22 3300025899 Ga0207642_10145372 Ga0207642_101453722 115
23 3300025931 Ga0207644_10212340 Ga0207644_102123402 115
24 3300025933 Ga0207706_11090607 Ga0207706_110906071 115
25 3300025937 Ga0207669_10042381 Ga0207669_100423812 115
26 3300025938 Ga0207704_10017537 Ga0207704_100175373 115
27 3300025941 Ga0207711_10340832 Ga0207711_103408322 115
28 3300025972 Ga0207668_10003937 Ga0207668_100039376 115
29 3300026067 Ga0207678_10101802 Ga0207678_101018022 115
30 3300026089 Ga0207648_10039984 Ga0207648_100399843 115
31 3300026121 Ga0207683_10003313 Ga0207683_1000331312 115
32 3300028379 Ga0268266_10726269 Ga0268266_107262692 115
33 3300049574 Ga0501038_0709780 Ga0501038_0709780_254_634 115
34 3300049575 Ga0501039_0537373 Ga0501039_0537373_166_564 115
35 3300005331 Ga0070670_100037357 Ga0070670_1000373573 116
36 3300005331 Ga0070670_100914673 Ga0070670_1009146731 116
37 3300005347 Ga0070668_100012517 Ga0070668_1000125174 116
38 3300005347 Ga0070668_100068273 Ga0070668_1000682732 116
39 3300005347 Ga0070668_100205185 Ga0070668_1002051852 116
40 3300005353 Ga0070669_100205662 Ga0070669_1002056622 116
41 3300005354 Ga0070675_100001504 Ga0070675_1000015048 116
42 3300005354 Ga0070675_100750323 Ga0070675_1007503231 116
43 3300005355 Ga0070671_100444775 Ga0070671_1004447752 116
44 3300005356 Ga0070674_100256948 Ga0070674_1002569482 116
45 3300005356 Ga0070674_100555722 Ga0070674_1005557222 116
46 3300005364 Ga0070673_100475857 Ga0070673_1004758572 116
47 3300005364 Ga0070673_100502520 Ga0070673_1005025202 116
48 3300005365 Ga0070688_100703668 Ga0070688_1007036681 116
49 3300005367 Ga0070667_101321307 Ga0070667_1013213072 116
50 3300005441 Ga0070700_100141465 Ga0070700_1001414651 116
51 3300005455 Ga0070663_100043101 Ga0070663_1000431012 116
52 3300005456 Ga0070678_100120316 Ga0070678_1001203161 116
53 3300005459 Ga0068867_100409572 Ga0068867_1004095722 116
54 3300005543 Ga0070672_100266828 Ga0070672_1002668282 116
55 3300005543 Ga0070672_100784959 Ga0070672_1007849592 116
56 3300005548 Ga0070665_100048754 Ga0070665_1000487543 116
57 3300005548 Ga0070665_100909477 Ga0070665_1009094772 116
58 3300005616 Ga0068852_100081401 Ga0068852_1000814012 116
59 3300005616 Ga0068852_100650155 Ga0068852_1006501552 116
60 3300005617 Ga0068859_100591655 Ga0068859_1005916552 116
61 3300005618 Ga0068864_101155621 Ga0068864_1011556212 116
62 3300005719 Ga0068861_100031212 Ga0068861_1000312123 116
63 3300005719 Ga0068861_100079288 Ga0068861_1000792882 116
64 3300005719 Ga0068861_101656686 Ga0068861_1016566861 116
65 3300005834 Ga0068851_10049404 Ga0068851_100494042 116
66 3300005841 Ga0068863_100182663 Ga0068863_1001826632 116
67 3300005841 Ga0068863_100411610 Ga0068863_1004116102 116
68 3300005843 Ga0068860_100011584 Ga0068860_1000115844 116
69 3300005843 Ga0068860_101427222 Ga0068860_1014272222 116
70 3300005844 Ga0068862_100029123 Ga0068862_1000291233 116
71 3300006881 Ga0068865_100276744 Ga0068865_1002767441 116
72 3300006931 Ga0097620_100591656 Ga0097620_1005916562 116
73 3300009177 Ga0105248_11791794 Ga0105248_117917942 116
74 3300009553 Ga0105249_10301958 Ga0105249_103019582 116
75 3300013296 Ga0157374_10909498 Ga0157374_109094982 116
76 3300013308 Ga0157375_10661448 Ga0157375_106614482 116
77 3300014326 Ga0157380_10070423 Ga0157380_100704232 116
78 3300014969 Ga0157376_11702384 Ga0157376_117023841 116
79 3300017792 Ga0163161_10123375 Ga0163161_101233752 116
80 3300025315 Ga0207697_10056336 Ga0207697_100563362 116
81 3300025321 Ga0207656_10027869 Ga0207656_100278692 116
82 3300025903 Ga0207680_10377503 Ga0207680_103775032 116
83 3300025907 Ga0207645_10075514 Ga0207645_100755142 116
84 3300025925 Ga0207650_10033151 Ga0207650_100331512 116
85 3300025925 Ga0207650_10393736 Ga0207650_103937362 116
86 3300025926 Ga0207659_10003145 Ga0207659_100031453 116
87 3300025926 Ga0207659_10798175 Ga0207659_107981751 116
88 3300025926 Ga0207659_10907083 Ga0207659_109070831 116
89 3300025937 Ga0207669_10032142 Ga0207669_100321422 116
90 3300025937 Ga0207669_10150066 Ga0207669_101500662 116
91 3300025938 Ga0207704_10147353 Ga0207704_101473531 116
92 3300025940 Ga0207691_10098988 Ga0207691_100989882 116
93 3300025945 Ga0207679_10559791 Ga0207679_105597912 116
94 3300025960 Ga0207651_10162173 Ga0207651_101621732 116
95 3300025960 Ga0207651_10966667 Ga0207651_109666672 116
96 3300025972 Ga0207668_10063333 Ga0207668_100633332 116
97 3300025972 Ga0207668_10072954 Ga0207668_100729542 116
98 3300025972 Ga0207668_10830176 Ga0207668_108301762 116
99 3300025981 Ga0207640_10809467 Ga0207640_108094672 116
100 3300025986 Ga0207658_10127415 Ga0207658_101274152 116
101 3300025986 Ga0207658_10518995 Ga0207658_105189952 116
102 3300026041 Ga0207639_10255527 Ga0207639_102555272 116
103 3300026067 Ga0207678_10503139 Ga0207678_105031392 116
104 3300026088 Ga0207641_10110003 Ga0207641_101100032 116
105 3300026088 Ga0207641_10627187 Ga0207641_106271872 116
106 3300026095 Ga0207676_10271918 Ga0207676_102719182 116
107 3300026118 Ga0207675_100032820 Ga0207675_1000328202 116
108 3300026118 Ga0207675_100053597 Ga0207675_1000535973 116
109 3300026118 Ga0207675_100099610 Ga0207675_1000996103 116
110 3300026121 Ga0207683_10077370 Ga0207683_100773703 116
111 3300027364 Ga0209967_1017304 Ga0209967_10173042 116
112 3300027378 Ga0209981_1015970 Ga0209981_10159702 116
113 3300027395 Ga0209996_1008256 Ga0209996_10082562 116
114 3300027462 Ga0210000_1002536 Ga0210000_10025363 116
115 3300027543 Ga0209999_1001870 Ga0209999_10018702 116
116 3300027665 Ga0209983_1016343 Ga0209983_10163432 116
117 3300027682 Ga0209971_1012907 Ga0209971_10129072 116
118 3300027876 Ga0209974_10002781 Ga0209974_100027813 116
119 3300027876 Ga0209974_10176815 Ga0209974_101768152 116
120 3300027907 Ga0207428_10399024 Ga0207428_103990241 116
121 3300028379 Ga0268266_10018796 Ga0268266_100187962 116
122 3300028379 Ga0268266_10776534 Ga0268266_107765342 116
123 3300028381 Ga0268264_10132402 Ga0268264_101324022 116
124 3300042117 Ga0450913_000850 Ga0450913_000850_154_534 116
125 3300042142 Ga0450905_012733 Ga0450905_012733_375_755 116
126 3300042436 Ga0439435_0077750 Ga0439435_0077750_314_694 116
127 3300046537 Ga0495598_0128537 Ga0495598_0128537_368_748 116
128 3300046558 Ga0495633_0357063 Ga0495633_0357063_224_604 116
129 3300005518 Ga0070699_100137968 Ga0070699_1001379682 117
130 3300013306 Ga0163162_10205503 Ga0163162_102055032 117
131 3300013308 Ga0157375_10027995 Ga0157375_100279955 117
132 3300014326 Ga0157380_10019139 Ga0157380_100191394 117
133 3300014968 Ga0157379_10013394 Ga0157379_100133946 117
134 3300026121 Ga0207683_11007221 Ga0207683_110072211 117
135 3300028379 Ga0268266_11839423 Ga0268266_118394232 117
136 3300050515 nmdc:mga0a205_342978_c1 nmdc:mga0a205_342978_c1_840_1223 117
137 3300005334 Ga0068869_100001972 Ga0068869_1000019721 118
138 3300005347 Ga0070668_100002643 Ga0070668_1000026433 118
139 3300005353 Ga0070669_100034226 Ga0070669_1000342263 118
140 3300005367 Ga0070667_100003036 Ga0070667_10000303611 118
141 3300005406 Ga0070703_10186542 Ga0070703_101865422 118
142 3300005441 Ga0070700_100558314 Ga0070700_1005583141 118
143 3300005455 Ga0070663_100734837 Ga0070663_1007348371 118
144 3300005459 Ga0068867_100002482 Ga0068867_1000024826 118
145 3300005549 Ga0070704_100347489 Ga0070704_1003474892 118
146 3300005563 Ga0068855_100050372 Ga0068855_1000503722 118
147 3300005564 Ga0070664_100413195 Ga0070664_1004131952 118
148 3300005578 Ga0068854_100623596 Ga0068854_1006235962 118
149 3300005617 Ga0068859_100002179 Ga0068859_10000217915 118
150 3300005719 Ga0068861_100009576 Ga0068861_1000095761 118
151 3300005840 Ga0068870_10011875 Ga0068870_100118751 118
152 3300005841 Ga0068863_100001600 Ga0068863_10000160012 118
153 3300005842 Ga0068858_100011145 Ga0068858_1000111451 118
154 3300005843 Ga0068860_100162251 Ga0068860_1001622511 118
155 3300005844 Ga0068862_100068635 Ga0068862_1000686351 118
156 3300006931 Ga0097620_100002179 Ga0097620_10000217915 118
157 3300009177 Ga0105248_10000869 Ga0105248_1000086917 118
158 3300013297 Ga0157378_10044306 Ga0157378_100443062 118
159 3300013306 Ga0163162_10068596 Ga0163162_100685963 118
160 3300013308 Ga0157375_10210834 Ga0157375_102108342 118
161 3300014968 Ga0157379_10512205 Ga0157379_105122051 118
162 3300025908 Ga0207643_10001046 Ga0207643_1000104612 118
163 3300025938 Ga0207704_11183901 Ga0207704_111839011 118
164 3300025960 Ga0207651_10007488 Ga0207651_100074882 118
165 3300025961 Ga0207712_10065814 Ga0207712_100658143 118
166 3300025972 Ga0207668_10016951 Ga0207668_100169512 118
167 3300025981 Ga0207640_10471301 Ga0207640_104713012 118
168 3300025986 Ga0207658_10189947 Ga0207658_101899472 118
169 3300026023 Ga0207677_10145173 Ga0207677_101451732 118
170 3300026035 Ga0207703_10006259 Ga0207703_100062591 118
171 3300026075 Ga0207708_10118398 Ga0207708_101183982 118
172 3300026088 Ga0207641_10034218 Ga0207641_100342183 118
173 3300026089 Ga0207648_10000414 Ga0207648_1000041430 118
174 3300026095 Ga0207676_10004558 Ga0207676_100045581 118
175 3300026095 Ga0207676_10041169 Ga0207676_100411692 118
176 3300026118 Ga0207675_100002026 Ga0207675_10000202614 118
177 3300026121 Ga0207683_10403209 Ga0207683_104032093 118
178 3300028380 Ga0268265_10037261 Ga0268265_100372613 118
179 3300028381 Ga0268264_10002495 Ga0268264_100024956 118
180 3300048905 Ga0496102_0042988 Ga0496102_0042988_2537_2923 118
181 3300048909 Ga0496106_0115583 Ga0496106_0115583_301_687 118
182 3300048911 Ga0496108_0376164 Ga0496108_0376164_667_1053 118
183 3300048912 Ga0496109_0071857 Ga0496109_0071857_122_508 118
184 3300048913 Ga0496110_0108368 Ga0496110_0108368_1728_2114 118
185 3300049571 Ga0501034_0218315 Ga0501034_0218315_930_1322 118
186 3300050515 nmdc:mga0a205_1191660_c1 nmdc:mga0a205_1191660_c1_20_406 118
187 iso_pu_bacteria 2734482258 2735816313 118
188 iso_pu_bacteria 2739367655 2739611926 118
189 3300005548 Ga0070665_101247205 Ga0070665_1012472052 119
190 3300009094 Ga0111539_10462883 Ga0111539_104628832 119
191 3300013308 Ga0157375_10148409 Ga0157375_101484092 119
192 3300014326 Ga0157380_10941256 Ga0157380_109412562 119
193 3300017792 Ga0163161_10250531 Ga0163161_102505312 119
194 3300025923 Ga0207681_10086334 Ga0207681_100863342 119
195 3300025937 Ga0207669_10230390 Ga0207669_102303902 119
196 3300026118 Ga0207675_100351843 Ga0207675_1003518432 119
197 3300027907 Ga0207428_10701559 Ga0207428_107015592 119
198 3300005339 Ga0070660_100024244 Ga0070660_1000242442 120
199 3300005344 Ga0070661_100016402 Ga0070661_1000164023 120
200 3300005366 Ga0070659_100004167 Ga0070659_1000041674 120
201 3300005455 Ga0070663_100628113 Ga0070663_1006281131 120
202 3300005466 Ga0070685_11339386 Ga0070685_113393861 120
203 3300005564 Ga0070664_100008231 Ga0070664_1000082317 120
204 3300012483 Ga0157337_1033484 Ga0157337_10334841 120
205 3300025919 Ga0207657_10029767 Ga0207657_100297674 120
206 3300025932 Ga0207690_10002241 Ga0207690_100022415 120
207 3300025945 Ga0207679_10052413 Ga0207679_100524132 120
208 3300038443 Ga0395901_0023099 Ga0395901_0023099_2443_2850 120
209 3300045051 Ga0451576_0742279 Ga0451576_0742279_119_520 120
210 3300060353 Ga0501082_0026690 Ga0501082_0026690_4021_4419 120
211 3300005328 Ga0070676_10116226 Ga0070676_101162261 121
212 3300005328 Ga0070676_10865272 Ga0070676_108652722 121
213 3300005329 Ga0070683_100093636 Ga0070683_1000936361 121
214 3300005329 Ga0070683_100223855 Ga0070683_1002238551 121
215 3300005331 Ga0070670_100004046 Ga0070670_1000040468 121
216 3300005331 Ga0070670_100019607 Ga0070670_1000196072 121
217 3300005331 Ga0070670_100051046 Ga0070670_1000510462 121
218 3300005336 Ga0070680_100636454 Ga0070680_1006364542 121
219 3300005338 Ga0068868_101357151 Ga0068868_1013571511 121
220 3300005339 Ga0070660_100001621 Ga0070660_10000162118 121
221 3300005344 Ga0070661_100000883 Ga0070661_1000008839 121
222 3300005344 Ga0070661_100120752 Ga0070661_1001207522 121
223 3300005344 Ga0070661_100559980 Ga0070661_1005599802 121
224 3300005345 Ga0070692_10152013 Ga0070692_101520132 121
225 3300005347 Ga0070668_100001633 Ga0070668_1000016336 121
226 3300005353 Ga0070669_100022067 Ga0070669_1000220672 121
227 3300005353 Ga0070669_100175989 Ga0070669_1001759892 121
228 3300005354 Ga0070675_100005698 Ga0070675_10000569811 121
229 3300005354 Ga0070675_100663155 Ga0070675_1006631551 121
230 3300005355 Ga0070671_100110135 Ga0070671_1001101352 121
231 3300005364 Ga0070673_100041075 Ga0070673_1000410752 121
232 3300005364 Ga0070673_100332455 Ga0070673_1003324552 121
233 3300005364 Ga0070673_100862807 Ga0070673_1008628072 121
234 3300005365 Ga0070688_100079655 Ga0070688_1000796552 121
235 3300005366 Ga0070659_100040759 Ga0070659_1000407592 121
236 3300005366 Ga0070659_100862334 Ga0070659_1008623341 121
237 3300005367 Ga0070667_100109157 Ga0070667_1001091572 121
238 3300005367 Ga0070667_100468745 Ga0070667_1004687452 121
239 3300005367 Ga0070667_100486179 Ga0070667_1004861792 121
240 3300005435 Ga0070714_100002673 Ga0070714_10000267311 121
241 3300005436 Ga0070713_100292656 Ga0070713_1002926561 121
242 3300005437 Ga0070710_10537779 Ga0070710_105377791 121
243 3300005457 Ga0070662_100003247 Ga0070662_1000032471 121
244 3300005457 Ga0070662_100795187 Ga0070662_1007951872 121
245 3300005458 Ga0070681_10187824 Ga0070681_101878242 121
246 3300005459 Ga0068867_100511203 Ga0068867_1005112031 121
247 3300005530 Ga0070679_100029405 Ga0070679_1000294052 121
248 3300005535 Ga0070684_100000910 Ga0070684_10000091016 121
249 3300005539 Ga0068853_100956337 Ga0068853_1009563372 121
250 3300005543 Ga0070672_100008935 Ga0070672_1000089352 121
251 3300005543 Ga0070672_100177248 Ga0070672_1001772482 121
252 3300005543 Ga0070672_101598685 Ga0070672_1015986851 121
253 3300005547 Ga0070693_100309929 Ga0070693_1003099292 121
254 3300005548 Ga0070665_100382987 Ga0070665_1003829872 121
255 3300005548 Ga0070665_101925863 Ga0070665_1019258632 121
256 3300005563 Ga0068855_100002371 Ga0068855_10000237117 121
257 3300005564 Ga0070664_100001040 Ga0070664_10000104017 121
258 3300005564 Ga0070664_100099422 Ga0070664_1000994222 121
259 3300005564 Ga0070664_100112593 Ga0070664_1001125932 121
260 3300005564 Ga0070664_100501471 Ga0070664_1005014712 121
261 3300005577 Ga0068857_100001304 Ga0068857_1000013043 121
262 3300005577 Ga0068857_102155581 Ga0068857_1021555811 121
263 3300005578 Ga0068854_100005968 Ga0068854_1000059683 121
264 3300005578 Ga0068854_100560127 Ga0068854_1005601272 121
265 3300005614 Ga0068856_100003525 Ga0068856_10000352517 121
266 3300005616 Ga0068852_100002204 Ga0068852_1000022044 121
267 3300005616 Ga0068852_101271058 Ga0068852_1012710582 121
268 3300005618 Ga0068864_100010197 Ga0068864_1000101973 121
269 3300005618 Ga0068864_100217643 Ga0068864_1002176431 121
270 3300005618 Ga0068864_100389540 Ga0068864_1003895402 121
271 3300005719 Ga0068861_102539191 Ga0068861_1025391911 121
272 3300005834 Ga0068851_10050848 Ga0068851_100508482 121
273 3300005834 Ga0068851_10594598 Ga0068851_105945982 121
274 3300005841 Ga0068863_100014606 Ga0068863_1000146065 121
275 3300005841 Ga0068863_100330245 Ga0068863_1003302452 121
276 3300005843 Ga0068860_100335600 Ga0068860_1003356001 121
277 3300005843 Ga0068860_100511458 Ga0068860_1005114581 121
278 3300005844 Ga0068862_100110348 Ga0068862_1001103482 121
279 3300005844 Ga0068862_100132802 Ga0068862_1001328022 121
280 3300005844 Ga0068862_101135574 Ga0068862_1011355741 121
281 3300006358 Ga0068871_101277787 Ga0068871_1012777871 121
282 3300006881 Ga0068865_100249235 Ga0068865_1002492352 121
283 3300006914 Ga0075436_100242618 Ga0075436_1002426182 121
284 3300007076 Ga0075435_100725946 Ga0075435_1007259462 121
285 3300009093 Ga0105240_10006424 Ga0105240_100064243 121
286 3300009148 Ga0105243_12842577 Ga0105243_128425771 121
287 3300009177 Ga0105248_10038093 Ga0105248_100380931 121
288 3300009177 Ga0105248_10243294 Ga0105248_102432942 121
289 3300009177 Ga0105248_10331810 Ga0105248_103318101 121
290 3300009545 Ga0105237_10708732 Ga0105237_107087322 121
291 3300009551 Ga0105238_10003030 Ga0105238_100030306 121
292 3300012507 Ga0157342_1056228 Ga0157342_10562281 121
293 3300013100 Ga0157373_10009763 Ga0157373_100097633 121
294 3300013102 Ga0157371_10214518 Ga0157371_102145182 121
295 3300013104 Ga0157370_10016712 Ga0157370_100167123 121
296 3300013105 Ga0157369_10013153 Ga0157369_1001315310 121
297 3300013105 Ga0157369_10969193 Ga0157369_109691932 121
298 3300013296 Ga0157374_10207652 Ga0157374_102076522 121
299 3300013306 Ga0163162_10269115 Ga0163162_102691152 121
300 3300013307 Ga0157372_10004735 Ga0157372_1000473510 121
301 3300013307 Ga0157372_10479060 Ga0157372_104790601 121
302 3300013308 Ga0157375_10001486 Ga0157375_100014867 121
303 3300013308 Ga0157375_10030618 Ga0157375_100306187 121
304 3300013308 Ga0157375_10941214 Ga0157375_109412142 121
305 3300013308 Ga0157375_11177334 Ga0157375_111773342 121
306 3300014325 Ga0163163_10011598 Ga0163163_100115985 121
307 3300014325 Ga0163163_11529984 Ga0163163_115299842 121
308 3300014497 Ga0182008_10012937 Ga0182008_100129372 121
309 3300014969 Ga0157376_10362084 Ga0157376_103620842 121
310 3300017792 Ga0163161_10009253 Ga0163161_100092532 121
311 3300025315 Ga0207697_10049795 Ga0207697_100497952 121
312 3300025321 Ga0207656_10012636 Ga0207656_100126362 121
313 3300025898 Ga0207692_10562275 Ga0207692_105622751 121
314 3300025906 Ga0207699_10504661 Ga0207699_105046612 121
315 3300025907 Ga0207645_10063684 Ga0207645_100636842 121
316 3300025907 Ga0207645_10173121 Ga0207645_101731212 121
317 3300025912 Ga0207707_10199234 Ga0207707_101992343 121
318 3300025912 Ga0207707_10222393 Ga0207707_102223932 121
319 3300025913 Ga0207695_10013448 Ga0207695_100134482 121
320 3300025914 Ga0207671_10446259 Ga0207671_104462592 121
321 3300025919 Ga0207657_10003925 Ga0207657_1000392518 121
322 3300025920 Ga0207649_10003005 Ga0207649_1000300510 121
323 3300025920 Ga0207649_10131865 Ga0207649_101318652 121
324 3300025923 Ga0207681_10258073 Ga0207681_102580732 121
325 3300025924 Ga0207694_10003251 Ga0207694_1000325111 121
326 3300025925 Ga0207650_10040742 Ga0207650_100407422 121
327 3300025925 Ga0207650_10050059 Ga0207650_100500592 121
328 3300025926 Ga0207659_10038030 Ga0207659_100380301 121
329 3300025926 Ga0207659_10057869 Ga0207659_100578692 121
330 3300025926 Ga0207659_10598982 Ga0207659_105989822 121
331 3300025928 Ga0207700_10289283 Ga0207700_102892832 121
332 3300025929 Ga0207664_10016109 Ga0207664_100161094 121
333 3300025931 Ga0207644_10393869 Ga0207644_103938692 121
334 3300025931 Ga0207644_10398658 Ga0207644_103986582 121
335 3300025931 Ga0207644_11461832 Ga0207644_114618321 121
336 3300025932 Ga0207690_10543746 Ga0207690_105437462 121
337 3300025933 Ga0207706_10005279 Ga0207706_100052794 121
338 3300025933 Ga0207706_11198637 Ga0207706_111986372 121
339 3300025938 Ga0207704_10216424 Ga0207704_102164242 121
340 3300025940 Ga0207691_10000585 Ga0207691_1000058512 121
341 3300025940 Ga0207691_10106232 Ga0207691_101062321 121
342 3300025941 Ga0207711_10099546 Ga0207711_100995463 121
343 3300025941 Ga0207711_10099990 Ga0207711_100999902 121
344 3300025944 Ga0207661_10071935 Ga0207661_100719353 121
345 3300025945 Ga0207679_10002174 Ga0207679_100021744 121
346 3300025945 Ga0207679_10124403 Ga0207679_101244032 121
347 3300025949 Ga0207667_10008246 Ga0207667_100082464 121
348 3300025960 Ga0207651_10006158 Ga0207651_100061586 121
349 3300025960 Ga0207651_10023532 Ga0207651_100235322 121
350 3300025960 Ga0207651_10250485 Ga0207651_102504851 121
351 3300025960 Ga0207651_11237709 Ga0207651_112377092 121
352 3300025972 Ga0207668_10237954 Ga0207668_102379542 121
353 3300025972 Ga0207668_11630736 Ga0207668_116307361 121
354 3300025981 Ga0207640_10011596 Ga0207640_100115964 121
355 3300025986 Ga0207658_10455369 Ga0207658_104553692 121
356 3300025986 Ga0207658_10818965 Ga0207658_108189652 121
357 3300026023 Ga0207677_11874341 Ga0207677_118743411 121
358 3300026041 Ga0207639_10678661 Ga0207639_106786612 121
359 3300026067 Ga0207678_10068441 Ga0207678_100684413 121
360 3300026078 Ga0207702_10001462 Ga0207702_100014628 121
361 3300026088 Ga0207641_10014817 Ga0207641_100148173 121
362 3300026089 Ga0207648_10085210 Ga0207648_100852102 121
363 3300026089 Ga0207648_10539533 Ga0207648_105395332 121
364 3300026095 Ga0207676_10022208 Ga0207676_100222083 121
365 3300026095 Ga0207676_10083665 Ga0207676_100836651 121
366 3300026095 Ga0207676_10210570 Ga0207676_102105702 121
367 3300026095 Ga0207676_10324543 Ga0207676_103245432 121
368 3300026095 Ga0207676_11183631 Ga0207676_111836312 121
369 3300026095 Ga0207676_11496216 Ga0207676_114962161 121
370 3300026116 Ga0207674_10000221 Ga0207674_1000022126 121
371 3300026116 Ga0207674_11522421 Ga0207674_115224211 121
372 3300026118 Ga0207675_100112194 Ga0207675_1001121942 121
373 3300026118 Ga0207675_102313120 Ga0207675_1023131201 121
374 3300026142 Ga0207698_10019566 Ga0207698_100195662 121
375 3300026142 Ga0207698_10223340 Ga0207698_102233402 121
376 3300028379 Ga0268266_10677892 Ga0268266_106778921 121
377 3300028379 Ga0268266_10892193 Ga0268266_108921932 121
378 3300028380 Ga0268265_10037234 Ga0268265_100372343 121
379 3300028380 Ga0268265_10259110 Ga0268265_102591102 121
380 3300028380 Ga0268265_11292123 Ga0268265_112921231 121
381 3300028381 Ga0268264_10113603 Ga0268264_101136031 121
382 3300028381 Ga0268264_10529948 Ga0268264_105299482 121
383 3300031995 Ga0307409_100812674 Ga0307409_1008126742 121
384 3300035121 Ga0373960_0075692 Ga0373960_0075692_485_877 121
385 3300041458 Ga0451798_0432743 Ga0451798_0432743_68_463 121
386 3300042876 Ga0451577_0020789 Ga0451577_0020789_427_831 121
387 3300048905 Ga0496102_0876974 Ga0496102_0876974_263_703 121
388 3300048908 Ga0496105_0455397 Ga0496105_0455397_27_467 121
389 3300048911 Ga0496108_0134793 Ga0496108_0134793_1382_1822 121
390 3300048912 Ga0496109_0279918 Ga0496109_0279918_222_641 121
391 3300048912 Ga0496109_0799973 Ga0496109_0799973_243_638 121
392 3300048912 Ga0496109_1490373 Ga0496109_1490373_112_552 121
393 3300048915 Ga0496112_0003822 Ga0496112_0003822_9670_10089 121
394 3300048915 Ga0496112_0016174 Ga0496112_0016174_2347_2787 121
395 3300048915 Ga0496112_0209108 Ga0496112_0209108_1188_1583 121
396 3300048916 Ga0496113_0042410 Ga0496113_0042410_138_578 121
397 3300049575 Ga0501039_0194408 Ga0501039_0194408_788_1186 121
398 3300049579 Ga0501043_0666402 Ga0501043_0666402_58_456 121
399 3300049587 Ga0501071_1060612 Ga0501071_1060612_205_603 121
400 3300049592 Ga0501076_0133204 Ga0501076_0133204_484_882 121
401 3300050514 nmdc:mga08x19_104270_c1 nmdc:mga08x19_104270_c1_755_1147 121
402 3300060353 Ga0501082_0755077 Ga0501082_0755077_80_478 121
403 3300005336 Ga0070680_100067265 Ga0070680_1000672652 122
404 3300005455 Ga0070663_100277334 Ga0070663_1002773342 122
405 3300005458 Ga0070681_10020561 Ga0070681_100205614 122
406 3300005530 Ga0070679_100003691 Ga0070679_10000369111 122
407 3300005539 Ga0068853_100014105 Ga0068853_1000141053 122
408 3300005563 Ga0068855_100535245 Ga0068855_1005352452 122
409 3300005577 Ga0068857_100073617 Ga0068857_1000736173 122
410 3300009174 Ga0105241_10225862 Ga0105241_102258622 122
411 3300013100 Ga0157373_10009276 Ga0157373_100092764 122
412 3300013104 Ga0157370_10056677 Ga0157370_100566773 122
413 3300013307 Ga0157372_10069719 Ga0157372_100697193 122
414 3300025911 Ga0207654_10148258 Ga0207654_101482581 122
415 3300025912 Ga0207707_10018607 Ga0207707_100186073 122
416 3300025917 Ga0207660_10062116 Ga0207660_100621162 122
417 3300025920 Ga0207649_10066882 Ga0207649_100668822 122
418 3300025921 Ga0207652_10008747 Ga0207652_100087475 122
419 3300025949 Ga0207667_10199874 Ga0207667_101998742 122
420 3300026067 Ga0207678_10661262 Ga0207678_106612622 122
421 3300026116 Ga0207674_10103279 Ga0207674_101032793 122
422 3300046462 Ga0495651_0056390 Ga0495651_0056390_194_607 122
423 3300046472 Ga0495580_0078136 Ga0495580_0078136_1582_2019 122
424 3300046474 Ga0495605_0001689 Ga0495605_0001689_10833_11270 122
425 3300046506 Ga0495583_0008255 Ga0495583_0008255_5730_6167 122
426 3300046507 Ga0495606_0010357 Ga0495606_0010357_2119_2556 122
427 3300046514 Ga0495618_0284898 Ga0495618_0284898_71_508 122
428 3300046515 Ga0495620_0008826 Ga0495620_0008826_4212_4649 122
429 3300046516 Ga0495628_0028451 Ga0495628_0028451_1406_1819 122
430 3300046517 Ga0495630_0015929 Ga0495630_0015929_3143_3580 122
431 3300046526 Ga0495666_0005962 Ga0495666_0005962_3848_4261 122
432 3300046543 Ga0495645_0412717 Ga0495645_0412717_219_617 122
433 3300046642 Ga0495634_0307458 Ga0495634_0307458_143_556 122
434 3300046665 Ga0495661_0136490 Ga0495661_0136490_801_1238 122
435 3300046678 Ga0495599_0047067 Ga0495599_0047067_2256_2669 122
436 3300046694 Ga0495649_0114623 Ga0495649_0114623_855_1292 122
437 3300046810 Ga0495660_0223753 Ga0495660_0223753_38_475 122
438 3300047317 Ga0495604_0044970 Ga0495604_0044970_2730_3143 122
439 3300047319 Ga0495674_0274443 Ga0495674_0274443_572_1009 122
440 3300047322 Ga0495680_0029215 Ga0495680_0029215_1801_2214 122
441 3300047446 Ga0495679_000048 Ga0495679_000048_78364_78801 122
442 3300047469 Ga0495673_0028655 Ga0495673_0028655_268_705 122
443 3300047471 Ga0495684_0783656 Ga0495684_0783656_165_578 122
444 3300047472 Ga0495686_0036927 Ga0495686_0036927_1887_2324 122
445 3300048088 Ga0495602_0136346 Ga0495602_0136346_394_831 122
446 3300048906 Ga0496103_0234001 Ga0496103_0234001_704_1141 122
447 3300048921 Ga0496118_0067713 Ga0496118_0067713_1336_1773 122
448 3300049459 Ga0495678_010827 Ga0495678_010827_2174_2611 122
449 3300049571 Ga0501034_0013945 Ga0501034_0013945_5207_5611 122
450 3300049583 Ga0501067_0009466 Ga0501067_0009466_3445_3849 122
451 3300049586 Ga0501070_0009351 Ga0501070_0009351_1921_2325 122
452 3300049588 Ga0501072_0008951 Ga0501072_0008951_1470_1874 122
453 3300049589 Ga0501073_0001114 Ga0501073_0001114_11135_11539 122
454 3300049590 Ga0501074_0023723 Ga0501074_0023723_4041_4445 122
455 3300049741 Ga0501079_0053227 Ga0501079_0053227_1362_1766 122
456 3300049742 Ga0501080_0000564 Ga0501080_0000564_14779_15183 122
457 3300049742 Ga0501080_0032785 Ga0501080_0032785_727_1131 122
458 3300049744 Ga0501083_0006209 Ga0501083_0006209_5046_5450 122
459 3300049744 Ga0501083_0020071 Ga0501083_0020071_775_1179 122
460 3300049822 Ga0501035_0046379 Ga0501035_0046379_1529_1933 122
461 3300054114 Ga0501084_0074938 Ga0501084_0074938_60_464 122
462 3300005455 Ga0070663_100319018 Ga0070663_1003190182 123
463 3300005539 Ga0068853_100053357 Ga0068853_1000533574 123
464 3300005563 Ga0068855_100111712 Ga0068855_1001117122 123
465 3300042015 Ga0439462_0164052 Ga0439462_0164052_210_614 123
466 3300049575 Ga0501039_0287783 Ga0501039_0287783_629_1033 123
467 3300049743 Ga0501081_0612066 Ga0501081_0612066_206_610 123
468 3300061734 Ga0530510_0701303 Ga0530510_0701303_203_607 123
469 3300013297 Ga0157378_10421212 Ga0157378_104212122 124
470 3300025910 Ga0207684_10534499 Ga0207684_105344992 124
471 3300025912 Ga0207707_10513269 Ga0207707_105132692 124
472 3300025922 Ga0207646_10531738 Ga0207646_105317382 124
473 3300025939 Ga0207665_10120085 Ga0207665_101200852 124
474 3300048918 Ga0496115_0550763 Ga0496115_0550763_480_890 124
475 3300049575 Ga0501039_0818599 Ga0501039_0818599_41_448 124
476 3300049585 Ga0501069_0001317 Ga0501069_0001317_4778_5188 124
477 3300049586 Ga0501070_0000419 Ga0501070_0000419_17029_17439 124
478 3300049590 Ga0501074_0035272 Ga0501074_0035272_3110_3520 124
479 3300049591 Ga0501075_0946123 Ga0501075_0946123_160_567 124
480 3300049742 Ga0501080_0013786 Ga0501080_0013786_658_1068 124
481 3300005547 Ga0070693_100197118 Ga0070693_1001971182 125
482 3300005614 Ga0068856_100143927 Ga0068856_1001439272 125
483 3300009553 Ga0105249_10683688 Ga0105249_106836882 125
484 3300035085 Ga0373929_0127539 Ga0373929_0127539_99_545 125
485 3300041512 Ga0451853_0546941 Ga0451853_0546941_136_543 125
486 3300049573 Ga0501037_0344294 Ga0501037_0344294_596_1015 125
487 3300049584 Ga0501068_0022012 Ga0501068_0022012_1801_2220 125
488 3300049586 Ga0501070_0265206 Ga0501070_0265206_697_1116 125
489 3300049589 Ga0501073_0001305 Ga0501073_0001305_17008_17427 125
490 3300049590 Ga0501074_0022825 Ga0501074_0022825_1287_1706 125
491 3300049742 Ga0501080_0005245 Ga0501080_0005245_6684_7103 125
492 3300049744 Ga0501083_0031090 Ga0501083_0031090_2230_2649 125
493 3300054114 Ga0501084_0215351 Ga0501084_0215351_592_1011 125
494 3300005330 Ga0070690_100000071 Ga0070690_10000007139 126
495 3300005334 Ga0068869_100013091 Ga0068869_1000130914 126
496 3300005338 Ga0068868_100033493 Ga0068868_1000334932 126
497 3300005341 Ga0070691_10019893 Ga0070691_100198933 126
498 3300005343 Ga0070687_100140696 Ga0070687_1001406961 126
499 3300005345 Ga0070692_10008442 Ga0070692_100084423 126
500 3300005365 Ga0070688_100048508 Ga0070688_1000485083 126
501 3300005441 Ga0070700_100001764 Ga0070700_1000017648 126
502 3300005459 Ga0068867_100000264 Ga0068867_1000002643 126
503 3300005544 Ga0070686_100001065 Ga0070686_1000010653 126
504 3300005545 Ga0070695_100002447 Ga0070695_1000024474 126
505 3300005549 Ga0070704_101398879 Ga0070704_1013988791 126
506 3300005578 Ga0068854_100493502 Ga0068854_1004935022 126
507 3300005615 Ga0070702_100000283 Ga0070702_1000002836 126
508 3300005617 Ga0068859_100038297 Ga0068859_1000382974 126
509 3300005718 Ga0068866_10000189 Ga0068866_1000018918 126
510 3300005719 Ga0068861_100019060 Ga0068861_1000190604 126
511 3300005842 Ga0068858_100002794 Ga0068858_1000027946 126
512 3300005843 Ga0068860_100065754 Ga0068860_1000657543 126
513 3300006881 Ga0068865_100002413 Ga0068865_1000024134 126
514 3300006931 Ga0097620_100038291 Ga0097620_1000382914 126
515 3300009098 Ga0105245_10000708 Ga0105245_1000070826 126
516 3300009148 Ga0105243_10000265 Ga0105243_1000026510 126
517 3300009176 Ga0105242_10000363 Ga0105242_100003631 126
518 3300009551 Ga0105238_10274885 Ga0105238_102748851 126
519 3300009553 Ga0105249_10011625 Ga0105249_100116255 126
520 3300011119 Ga0105246_12490449 Ga0105246_124904491 126
521 3300013297 Ga0157378_10023701 Ga0157378_100237014 126
522 3300013306 Ga0163162_10014191 Ga0163162_100141915 126
523 3300013308 Ga0157375_10029477 Ga0157375_100294774 126
524 3300014326 Ga0157380_10002505 Ga0157380_100025058 126
525 3300014968 Ga0157379_10098990 Ga0157379_100989903 126
526 3300014969 Ga0157376_10603741 Ga0157376_106037412 126
527 3300025899 Ga0207642_10000975 Ga0207642_100009753 126
528 3300025924 Ga0207694_11275355 Ga0207694_112753551 126
529 3300025927 Ga0207687_10000272 Ga0207687_100002725 126
530 3300025934 Ga0207686_10003160 Ga0207686_100031605 126
531 3300025935 Ga0207709_10016537 Ga0207709_100165372 126
532 3300025936 Ga0207670_10009828 Ga0207670_100098284 126
533 3300025938 Ga0207704_10000466 Ga0207704_100004669 126
534 3300025942 Ga0207689_10000871 Ga0207689_100008717 126
535 3300025961 Ga0207712_10050431 Ga0207712_100504312 126
536 3300026075 Ga0207708_10001020 Ga0207708_100010208 126
537 3300026089 Ga0207648_10000252 Ga0207648_1000025239 126
538 3300026118 Ga0207675_100000222 Ga0207675_10000022228 126
539 3300026121 Ga0207683_10113924 Ga0207683_101139242 126
540 3300028380 Ga0268265_10142664 Ga0268265_101426642 126
541 3300028381 Ga0268264_10029538 Ga0268264_100295383 126
542 3300007265 Ga0099794_10067892 Ga0099794_100678922 127
543 3300050512 nmdc:mga0n895_334111_c1 nmdc:mga0n895_334111_c1_1106_1522 127
544 3300005618 Ga0068864_101978874 Ga0068864_1019788742 128
545 3300025940 Ga0207691_10338741 Ga0207691_103387412 128
546 3300025945 Ga0207679_10286843 Ga0207679_102868432 128
547 3300026095 Ga0207676_11258639 Ga0207676_112586391 128
548 3300031824 Ga0307413_10150796 Ga0307413_101507962 128
549 3300032004 Ga0307414_10179977 Ga0307414_101799772 128
550 3300037471 Ga0395905_0012328 Ga0395905_0012328_2056_2484 128
551 iso_pu_bacteria 2643221654 2644303191 128
552 3300005616 Ga0068852_100800206 Ga0068852_1008002062 129
553 3300009551 Ga0105238_10681440 Ga0105238_106814401 129
554 3300041492 Ga0451835_0602591 Ga0451835_0602591_258_674 129
555 3300049568 Ga0501031_0071155 Ga0501031_0071155_189_641 129
556 3300049580 Ga0501046_0050705 Ga0501046_0050705_339_791 129
557 3300049822 Ga0501035_0221994 Ga0501035_0221994_696_1148 129
558 3300006195 Ga0075366_10136854 Ga0075366_101368542 130
559 3300015262 Ga0182007_10191580 Ga0182007_101915801 130
560 3300005328 Ga0070676_10153551 Ga0070676_101535512 131
561 3300005328 Ga0070676_10361948 Ga0070676_103619482 131
562 3300005334 Ga0068869_100482190 Ga0068869_1004821902 131
563 3300005367 Ga0070667_101008908 Ga0070667_1010089082 131
564 3300005367 Ga0070667_101154176 Ga0070667_1011541761 131
565 3300005457 Ga0070662_100315595 Ga0070662_1003155952 131
566 3300005459 Ga0068867_100253275 Ga0068867_1002532752 131
567 3300005518 Ga0070699_101506708 Ga0070699_1015067081 131
568 3300005577 Ga0068857_100406428 Ga0068857_1004064282 131
569 3300005578 Ga0068854_100499083 Ga0068854_1004990832 131
570 3300005617 Ga0068859_100384989 Ga0068859_1003849892 131
571 3300005617 Ga0068859_101562174 Ga0068859_1015621742 131
572 3300006038 Ga0075365_10130022 Ga0075365_101300221 131
573 3300006042 Ga0075368_10058597 Ga0075368_100585972 131
574 3300006042 Ga0075368_10108081 Ga0075368_101080812 131
575 3300006048 Ga0075363_100033871 Ga0075363_1000338712 131
576 3300006048 Ga0075363_100102836 Ga0075363_1001028362 131
577 3300006048 Ga0075363_100426360 Ga0075363_1004263602 131
578 3300006051 Ga0075364_10159517 Ga0075364_101595172 131
579 3300006058 Ga0075432_10281256 Ga0075432_102812562 131
580 3300006177 Ga0075362_10030651 Ga0075362_100306512 131
581 3300006178 Ga0075367_10123421 Ga0075367_101234212 131
582 3300006186 Ga0075369_10002059 Ga0075369_100020594 131
583 3300006195 Ga0075366_10004629 Ga0075366_100046298 131
584 3300006195 Ga0075366_10008533 Ga0075366_1000853310 131
585 3300006195 Ga0075366_10105555 Ga0075366_101055551 131
586 3300006195 Ga0075366_10347282 Ga0075366_103472821 131
587 3300006353 Ga0075370_10005755 Ga0075370_100057556 131
588 3300006353 Ga0075370_10007311 Ga0075370_100073115 131
589 3300006353 Ga0075370_10007660 Ga0075370_100076605 131
590 3300006353 Ga0075370_10343912 Ga0075370_103439122 131
591 3300006353 Ga0075370_10948690 Ga0075370_109486902 131
592 3300006931 Ga0097620_100385011 Ga0097620_1003850112 131
593 3300006931 Ga0097620_101562107 Ga0097620_1015621072 131
594 3300009093 Ga0105240_10546324 Ga0105240_105463242 131
595 3300009148 Ga0105243_10359140 Ga0105243_103591402 131
596 3300009545 Ga0105237_10007357 Ga0105237_100073574 131
597 3300009553 Ga0105249_10115706 Ga0105249_101157064 131
598 3300010375 Ga0105239_10095454 Ga0105239_100954543 131
599 3300013308 Ga0157375_12091054 Ga0157375_120910541 131
600 3300025899 Ga0207642_10126255 Ga0207642_101262552 131
601 3300025903 Ga0207680_10833341 Ga0207680_108333411 131
602 3300025914 Ga0207671_10020267 Ga0207671_100202677 131
603 3300025933 Ga0207706_10091900 Ga0207706_100919002 131
604 3300025933 Ga0207706_10775947 Ga0207706_107759471 131
605 3300025935 Ga0207709_10209333 Ga0207709_102093332 131
606 3300025942 Ga0207689_10067632 Ga0207689_100676322 131
607 3300025942 Ga0207689_11818660 Ga0207689_118186601 131
608 3300026041 Ga0207639_10074528 Ga0207639_100745282 131
609 3300026089 Ga0207648_10100253 Ga0207648_101002532 131
610 3300026116 Ga0207674_10108193 Ga0207674_101081932 131
611 3300026142 Ga0207698_10109677 Ga0207698_101096772 131
612 3300027866 Ga0209813_10143147 Ga0209813_101431472 131
613 3300028786 Ga0307517_10196678 Ga0307517_101966782 131
614 3300028794 Ga0307515_10134131 Ga0307515_101341314 131
615 3300028794 Ga0307515_10554214 Ga0307515_105542141 131
616 3300031456 Ga0307513_10037728 Ga0307513_100377284 131
617 3300031456 Ga0307513_10318504 Ga0307513_103185042 131
618 3300031730 Ga0307516_10090515 Ga0307516_100905152 131
619 3300031730 Ga0307516_10573631 Ga0307516_105736312 131
620 3300032004 Ga0307414_10285866 Ga0307414_102858662 131
621 3300046648 Ga0495611_0125894 Ga0495611_0125894_150_575 131
622 3300046660 Ga0495625_0020381 Ga0495625_0020381_2585_3010 131
623 3300050489 nmdc:mga03683_21941_c1 nmdc:mga03683_21941_c1_347_772 131
624 3300050489 nmdc:mga03683_2360_c1 nmdc:mga03683_2360_c1_1695_2120 131
625 3300050489 nmdc:mga03683_59763_c1 nmdc:mga03683_59763_c1_127_552 131
626 3300050489 nmdc:mga03683_91404_c1 nmdc:mga03683_91404_c1_153_578 131
627 3300050490 nmdc:mga03n38_122303_c1 nmdc:mga03n38_122303_c1_448_873 131
628 3300050490 nmdc:mga03n38_404544_c1 nmdc:mga03n38_404544_c1_285_710 131
629 3300050491 nmdc:mga00v17_223270_c1 nmdc:mga00v17_223270_c1_349_774 131
630 3300050491 nmdc:mga00v17_75506_c1 nmdc:mga00v17_75506_c1_1411_1836 131
631 3300050493 nmdc:mga0k408_16487_c1 nmdc:mga0k408_16487_c1_453_878 131
632 3300050493 nmdc:mga0k408_18439_c1 nmdc:mga0k408_18439_c1_1509_1934 131
633 3300050493 nmdc:mga0k408_38321_c1 nmdc:mga0k408_38321_c1_2200_2625 131
634 3300050493 nmdc:mga0k408_39814_c1 nmdc:mga0k408_39814_c1_1457_1882 131
635 3300050493 nmdc:mga0k408_40570_c1 nmdc:mga0k408_40570_c1_943_1368 131
636 3300050493 nmdc:mga0k408_6593_c1 nmdc:mga0k408_6593_c1_753_1178 131
637 3300050494 nmdc:mga06z11_128369_c1 nmdc:mga06z11_128369_c1_422_847 131
638 3300050494 nmdc:mga06z11_193036_c1 nmdc:mga06z11_193036_c1_301_726 131
639 3300050494 nmdc:mga06z11_23341_c1 nmdc:mga06z11_23341_c1_1803_2228 131
640 3300050495 nmdc:mga04h51_30893_c1 nmdc:mga04h51_30893_c1_207_632 131
641 3300050495 nmdc:mga04h51_56146_c1 nmdc:mga04h51_56146_c1_759_1184 131
642 3300050496 nmdc:mga07m45_112971_c1 nmdc:mga07m45_112971_c1_1115_1540 131
643 3300050496 nmdc:mga07m45_16449_c1 nmdc:mga07m45_16449_c1_2786_3211 131
644 3300050496 nmdc:mga07m45_16874_c1 nmdc:mga07m45_16874_c1_2102_2527 131
645 3300050496 nmdc:mga07m45_2015_c1 nmdc:mga07m45_2015_c1_5428_5853 131
646 3300050496 nmdc:mga07m45_28658_c1 nmdc:mga07m45_28658_c1_1373_1798 131
647 3300050516 nmdc:mga0sz30_1145_c1 nmdc:mga0sz30_1145_c1_4978_5403 131
648 3300050516 nmdc:mga0sz30_131545_c1 nmdc:mga0sz30_131545_c1_455_880 131
649 3300005333 Ga0070677_10073598 Ga0070677_100735981 132
650 3300005518 Ga0070699_100660174 Ga0070699_1006601741 132
651 3300005844 Ga0068862_100516880 Ga0068862_1005168802 132
652 3300006163 Ga0070715_10059828 Ga0070715_100598282 132
653 3300006358 Ga0068871_100552992 Ga0068871_1005529921 132
654 3300009148 Ga0105243_11275660 Ga0105243_112756602 132
655 3300009176 Ga0105242_10077404 Ga0105242_100774044 132
656 3300013306 Ga0163162_13073500 Ga0163162_130735001 132
657 3300017792 Ga0163161_10099022 Ga0163161_100990222 132
658 3300025907 Ga0207645_10150684 Ga0207645_101506842 132
659 3300025937 Ga0207669_10418093 Ga0207669_104180932 132
660 3300028381 Ga0268264_10519952 Ga0268264_105199521 132
661 3300028794 Ga0307515_10028345 Ga0307515_100283456 132
662 3300031730 Ga0307516_10001122 Ga0307516_1000112234 132
663 3300046683 Ga0495658_0420425 Ga0495658_0420425_243_671 132
664 3300048904 Ga0496101_0666903 Ga0496101_0666903_359_787 132
665 3300048908 Ga0496105_0054416 Ga0496105_0054416_581_1009 132
666 3300048913 Ga0496110_1544259 Ga0496110_1544259_86_514 132
667 3300005327 Ga0070658_10354831 Ga0070658_103548311 133
668 3300005330 Ga0070690_100732992 Ga0070690_1007329921 133
669 3300005333 Ga0070677_10006708 Ga0070677_100067081 133
670 3300005334 Ga0068869_100209219 Ga0068869_1002092192 133
671 3300005335 Ga0070666_10016666 Ga0070666_100166664 133
672 3300005337 Ga0070682_100665662 Ga0070682_1006656622 133
673 3300005354 Ga0070675_100099368 Ga0070675_1000993682 133
674 3300005355 Ga0070671_100436350 Ga0070671_1004363502 133
675 3300005364 Ga0070673_100207717 Ga0070673_1002077172 133
676 3300005364 Ga0070673_100721444 Ga0070673_1007214441 133
677 3300005367 Ga0070667_100533530 Ga0070667_1005335301 133
678 3300005455 Ga0070663_100899610 Ga0070663_1008996101 133
679 3300005456 Ga0070678_100532718 Ga0070678_1005327181 133
680 3300005457 Ga0070662_100613799 Ga0070662_1006137992 133
681 3300005459 Ga0068867_100450507 Ga0068867_1004505072 133
682 3300005466 Ga0070685_10736459 Ga0070685_107364592 133
683 3300005543 Ga0070672_100143320 Ga0070672_1001433202 133
684 3300005548 Ga0070665_100558882 Ga0070665_1005588822 133
685 3300005564 Ga0070664_100592639 Ga0070664_1005926392 133
686 3300005616 Ga0068852_101165133 Ga0068852_1011651332 133
687 3300005617 Ga0068859_100028193 Ga0068859_1000281932 133
688 3300005618 Ga0068864_100001559 Ga0068864_1000015593 133
689 3300005618 Ga0068864_100411680 Ga0068864_1004116802 133
690 3300005718 Ga0068866_10537247 Ga0068866_105372471 133
691 3300005840 Ga0068870_10328910 Ga0068870_103289102 133
692 3300005842 Ga0068858_100043719 Ga0068858_1000437193 133
693 3300006358 Ga0068871_100054687 Ga0068871_1000546872 133
694 3300006881 Ga0068865_100350689 Ga0068865_1003506892 133
695 3300006931 Ga0097620_100028193 Ga0097620_1000281936 133
696 3300009553 Ga0105249_10054209 Ga0105249_100542092 133
697 3300013296 Ga0157374_10009389 Ga0157374_100093893 133
698 3300013297 Ga0157378_10736819 Ga0157378_107368192 133
699 3300013308 Ga0157375_10948691 Ga0157375_109486912 133
700 3300014325 Ga0163163_10009499 Ga0163163_100094994 133
701 3300014968 Ga0157379_10231886 Ga0157379_102318862 133
702 3300014969 Ga0157376_10057217 Ga0157376_100572175 133
703 3300017792 Ga0163161_10238256 Ga0163161_102382562 133
704 3300025304 Ga0209257_1017474 Ga0209257_10174743 133
705 3300025903 Ga0207680_10223331 Ga0207680_102233312 133
706 3300025925 Ga0207650_10164184 Ga0207650_101641842 133
707 3300025926 Ga0207659_10081329 Ga0207659_100813294 133
708 3300025926 Ga0207659_10593047 Ga0207659_105930472 133
709 3300025927 Ga0207687_10741523 Ga0207687_107415232 133
710 3300025931 Ga0207644_10331139 Ga0207644_103311392 133
711 3300025932 Ga0207690_10223887 Ga0207690_102238872 133
712 3300025940 Ga0207691_10391727 Ga0207691_103917272 133
713 3300025942 Ga0207689_10004042 Ga0207689_1000404214 133
714 3300025945 Ga0207679_10684686 Ga0207679_106846862 133
715 3300025986 Ga0207658_10194071 Ga0207658_101940713 133
716 3300026035 Ga0207703_10332497 Ga0207703_103324972 133
717 3300026088 Ga0207641_10164822 Ga0207641_101648222 133
718 3300026089 Ga0207648_10090476 Ga0207648_100904762 133
719 3300028380 Ga0268265_10036526 Ga0268265_100365262 133
720 3300031456 Ga0307513_10219967 Ga0307513_102199673 133
721 3300046537 Ga0495598_0027114 Ga0495598_0027114_206_703 133
722 3300048911 Ga0496108_1064954 Ga0496108_1064954_124_555 133
723 3300005328 Ga0070676_10003412 Ga0070676_100034123 134
724 3300005328 Ga0070676_10088232 Ga0070676_100882322 134
725 3300005329 Ga0070683_100373007 Ga0070683_1003730072 134
726 3300005329 Ga0070683_100769598 Ga0070683_1007695982 134
727 3300005330 Ga0070690_100050643 Ga0070690_1000506432 134
728 3300005330 Ga0070690_100233372 Ga0070690_1002333722 134
729 3300005333 Ga0070677_10014643 Ga0070677_100146432 134
730 3300005333 Ga0070677_10074985 Ga0070677_100749852 134
731 3300005334 Ga0068869_100002262 Ga0068869_1000022625 134
732 3300005334 Ga0068869_100051251 Ga0068869_1000512512 134
733 3300005337 Ga0070682_100095554 Ga0070682_1000955542 134
734 3300005338 Ga0068868_100005809 Ga0068868_1000058095 134
735 3300005338 Ga0068868_100037946 Ga0068868_1000379463 134
736 3300005338 Ga0068868_100042909 Ga0068868_1000429092 134
737 3300005338 Ga0068868_100324319 Ga0068868_1003243192 134
738 3300005339 Ga0070660_100724503 Ga0070660_1007245031 134
739 3300005339 Ga0070660_100871418 Ga0070660_1008714182 134
740 3300005340 Ga0070689_100679113 Ga0070689_1006791132 134
741 3300005343 Ga0070687_100073399 Ga0070687_1000733992 134
742 3300005344 Ga0070661_100027619 Ga0070661_1000276192 134
743 3300005354 Ga0070675_100006735 Ga0070675_1000067352 134
744 3300005355 Ga0070671_100120369 Ga0070671_1001203692 134
745 3300005355 Ga0070671_100245040 Ga0070671_1002450402 134
746 3300005355 Ga0070671_100572831 Ga0070671_1005728312 134
747 3300005364 Ga0070673_100003672 Ga0070673_1000036726 134
748 3300005366 Ga0070659_100381316 Ga0070659_1003813162 134
749 3300005367 Ga0070667_100012676 Ga0070667_1000126766 134
750 3300005367 Ga0070667_100151341 Ga0070667_1001513412 134
751 3300005455 Ga0070663_100036207 Ga0070663_1000362073 134
752 3300005456 Ga0070678_100884168 Ga0070678_1008841682 134
753 3300005457 Ga0070662_100086754 Ga0070662_1000867542 134
754 3300005459 Ga0068867_100000042 Ga0068867_10000004220 134
755 3300005459 Ga0068867_100006029 Ga0068867_1000060298 134
756 3300005459 Ga0068867_100403507 Ga0068867_1004035072 134
757 3300005535 Ga0070684_100110716 Ga0070684_1001107163 134
758 3300005539 Ga0068853_100015444 Ga0068853_1000154445 134
759 3300005539 Ga0068853_100082865 Ga0068853_1000828652 134
760 3300005543 Ga0070672_100197078 Ga0070672_1001970782 134
761 3300005543 Ga0070672_100573973 Ga0070672_1005739731 134
762 3300005547 Ga0070693_100081870 Ga0070693_1000818702 134
763 3300005563 Ga0068855_100040710 Ga0068855_1000407102 134
764 3300005564 Ga0070664_100144031 Ga0070664_1001440312 134
765 3300005577 Ga0068857_100131719 Ga0068857_1001317192 134
766 3300005577 Ga0068857_100158121 Ga0068857_1001581212 134
767 3300005577 Ga0068857_100702854 Ga0068857_1007028542 134
768 3300005578 Ga0068854_100030959 Ga0068854_1000309595 134
769 3300005578 Ga0068854_100074787 Ga0068854_1000747872 134
770 3300005614 Ga0068856_100159681 Ga0068856_1001596812 134
771 3300005614 Ga0068856_100703905 Ga0068856_1007039052 134
772 3300005615 Ga0070702_100072312 Ga0070702_1000723121 134
773 3300005616 Ga0068852_100044023 Ga0068852_1000440232 134
774 3300005616 Ga0068852_100048572 Ga0068852_1000485722 134
775 3300005616 Ga0068852_100074480 Ga0068852_1000744802 134
776 3300005616 Ga0068852_100159016 Ga0068852_1001590162 134
777 3300005617 Ga0068859_100050971 Ga0068859_1000509711 134
778 3300005617 Ga0068859_100146218 Ga0068859_1001462182 134
779 3300005618 Ga0068864_100033200 Ga0068864_1000332002 134
780 3300005618 Ga0068864_100125852 Ga0068864_1001258522 134
781 3300005618 Ga0068864_102075835 Ga0068864_1020758351 134
782 3300005719 Ga0068861_100001035 Ga0068861_10000103516 134
783 3300005834 Ga0068851_10007841 Ga0068851_100078413 134
784 3300005834 Ga0068851_10024775 Ga0068851_100247752 134
785 3300005842 Ga0068858_100004165 Ga0068858_1000041654 134
786 3300005842 Ga0068858_100121039 Ga0068858_1001210392 134
787 3300005843 Ga0068860_100380910 Ga0068860_1003809102 134
788 3300005843 Ga0068860_100438210 Ga0068860_1004382102 134
789 3300005844 Ga0068862_100278287 Ga0068862_1002782872 134
790 3300006353 Ga0075370_10274166 Ga0075370_102741662 134
791 3300006358 Ga0068871_100501049 Ga0068871_1005010492 134
792 3300006871 Ga0075434_100332453 Ga0075434_1003324532 134
793 3300006881 Ga0068865_100143169 Ga0068865_1001431692 134
794 3300006881 Ga0068865_101207037 Ga0068865_1012070372 134
795 3300006931 Ga0097620_100050972 Ga0097620_1000509724 134
796 3300006931 Ga0097620_100146208 Ga0097620_1001462083 134
797 3300007076 Ga0075435_100082967 Ga0075435_1000829672 134
798 3300009098 Ga0105245_10040417 Ga0105245_100404172 134
799 3300009098 Ga0105245_10341208 Ga0105245_103412081 134
800 3300009098 Ga0105245_12407699 Ga0105245_124076992 134
801 3300009101 Ga0105247_10962390 Ga0105247_109623902 134
802 3300009148 Ga0105243_10000525 Ga0105243_1000052519 134
803 3300009148 Ga0105243_10479545 Ga0105243_104795452 134
804 3300009174 Ga0105241_10071824 Ga0105241_100718242 134
805 3300009177 Ga0105248_10004278 Ga0105248_1000427812 134
806 3300009177 Ga0105248_10410489 Ga0105248_104104892 134
807 3300009545 Ga0105237_10116620 Ga0105237_101166202 134
808 3300009545 Ga0105237_11339849 Ga0105237_113398492 134
809 3300009551 Ga0105238_10064482 Ga0105238_100644822 134
810 3300009551 Ga0105238_10106782 Ga0105238_101067822 134
811 3300010375 Ga0105239_10133742 Ga0105239_101337422 134
812 3300013100 Ga0157373_10268206 Ga0157373_102682062 134
813 3300013105 Ga0157369_10069163 Ga0157369_100691632 134
814 3300013296 Ga0157374_10008380 Ga0157374_100083802 134
815 3300013296 Ga0157374_10654758 Ga0157374_106547582 134
816 3300013297 Ga0157378_10152110 Ga0157378_101521102 134
817 3300013297 Ga0157378_10411366 Ga0157378_104113662 134
818 3300013306 Ga0163162_10009806 Ga0163162_100098065 134
819 3300013306 Ga0163162_10171055 Ga0163162_101710552 134
820 3300013306 Ga0163162_10669729 Ga0163162_106697292 134
821 3300013308 Ga0157375_10042812 Ga0157375_100428122 134
822 3300013308 Ga0157375_10091030 Ga0157375_100910302 134
823 3300013308 Ga0157375_10317158 Ga0157375_103171582 134
824 3300014325 Ga0163163_10311598 Ga0163163_103115982 134
825 3300014745 Ga0157377_10000038 Ga0157377_1000003819 134
826 3300014968 Ga0157379_10010333 Ga0157379_100103334 134
827 3300014968 Ga0157379_10216243 Ga0157379_102162431 134
828 3300014969 Ga0157376_10013251 Ga0157376_100132515 134
829 3300014969 Ga0157376_12237943 Ga0157376_122379431 134
830 3300015262 Ga0182007_10059475 Ga0182007_100594752 134
831 3300017792 Ga0163161_10009506 Ga0163161_100095062 134
832 3300025315 Ga0207697_10195989 Ga0207697_101959892 134
833 3300025315 Ga0207697_10346269 Ga0207697_103462691 134
834 3300025321 Ga0207656_10014424 Ga0207656_100144242 134
835 3300025321 Ga0207656_10043479 Ga0207656_100434792 134
836 3300025893 Ga0207682_10074810 Ga0207682_100748102 134
837 3300025901 Ga0207688_10046193 Ga0207688_100461932 134
838 3300025907 Ga0207645_10007830 Ga0207645_100078302 134
839 3300025907 Ga0207645_10126029 Ga0207645_101260292 134
840 3300025909 Ga0207705_10172821 Ga0207705_101728212 134
841 3300025918 Ga0207662_10021166 Ga0207662_100211664 134
842 3300025919 Ga0207657_10053292 Ga0207657_100532925 134
843 3300025920 Ga0207649_10003313 Ga0207649_100033136 134
844 3300025920 Ga0207649_10369254 Ga0207649_103692542 134
845 3300025922 Ga0207646_10511692 Ga0207646_105116921 134
846 3300025924 Ga0207694_10060063 Ga0207694_100600632 134
847 3300025924 Ga0207694_11191900 Ga0207694_111919001 134
848 3300025925 Ga0207650_10240066 Ga0207650_102400662 134
849 3300025926 Ga0207659_10004238 Ga0207659_100042389 134
850 3300025927 Ga0207687_10016519 Ga0207687_100165194 134
851 3300025927 Ga0207687_10058619 Ga0207687_100586194 134
852 3300025927 Ga0207687_10214273 Ga0207687_102142731 134
853 3300025931 Ga0207644_10147354 Ga0207644_101473542 134
854 3300025931 Ga0207644_10210155 Ga0207644_102101551 134
855 3300025931 Ga0207644_10886674 Ga0207644_108866742 134
856 3300025932 Ga0207690_10146460 Ga0207690_101464602 134
857 3300025933 Ga0207706_10239600 Ga0207706_102396002 134
858 3300025933 Ga0207706_10380387 Ga0207706_103803871 134
859 3300025935 Ga0207709_10001602 Ga0207709_1000160210 134
860 3300025938 Ga0207704_10076850 Ga0207704_100768502 134
861 3300025940 Ga0207691_10202176 Ga0207691_102021762 134
862 3300025940 Ga0207691_10230852 Ga0207691_102308522 134
863 3300025941 Ga0207711_10005009 Ga0207711_100050093 134
864 3300025941 Ga0207711_10237486 Ga0207711_102374862 134
865 3300025942 Ga0207689_10002937 Ga0207689_1000293715 134
866 3300025942 Ga0207689_10004421 Ga0207689_100044215 134
867 3300025945 Ga0207679_10497716 Ga0207679_104977162 134
868 3300025945 Ga0207679_10631818 Ga0207679_106318181 134
869 3300025949 Ga0207667_10037649 Ga0207667_100376494 134
870 3300025960 Ga0207651_10031578 Ga0207651_100315782 134
871 3300025972 Ga0207668_10020191 Ga0207668_100201913 134
872 3300025981 Ga0207640_10008784 Ga0207640_100087845 134
873 3300025986 Ga0207658_10007142 Ga0207658_100071422 134
874 3300025986 Ga0207658_10087341 Ga0207658_100873412 134
875 3300025986 Ga0207658_10105845 Ga0207658_101058452 134
876 3300025986 Ga0207658_10813894 Ga0207658_108138941 134
877 3300026023 Ga0207677_10004016 Ga0207677_100040163 134
878 3300026023 Ga0207677_10016437 Ga0207677_100164374 134
879 3300026023 Ga0207677_10046649 Ga0207677_100466492 134
880 3300026023 Ga0207677_10333154 Ga0207677_103331541 134
881 3300026035 Ga0207703_10021643 Ga0207703_100216435 134
882 3300026041 Ga0207639_10013251 Ga0207639_100132514 134
883 3300026041 Ga0207639_10204357 Ga0207639_102043572 134
884 3300026067 Ga0207678_10403265 Ga0207678_104032652 134
885 3300026078 Ga0207702_10122997 Ga0207702_101229972 134
886 3300026078 Ga0207702_10527318 Ga0207702_105273182 134
887 3300026088 Ga0207641_10116286 Ga0207641_101162862 134
888 3300026088 Ga0207641_10271458 Ga0207641_102714582 134
889 3300026089 Ga0207648_10000118 Ga0207648_1000011819 134
890 3300026089 Ga0207648_10003756 Ga0207648_100037567 134
891 3300026089 Ga0207648_10436881 Ga0207648_104368812 134
892 3300026095 Ga0207676_10007881 Ga0207676_100078815 134
893 3300026095 Ga0207676_10130804 Ga0207676_101308042 134
894 3300026095 Ga0207676_11979872 Ga0207676_119798721 134
895 3300026116 Ga0207674_10022969 Ga0207674_100229695 134
896 3300026116 Ga0207674_10114848 Ga0207674_101148484 134
897 3300026116 Ga0207674_10320954 Ga0207674_103209542 134
898 3300026118 Ga0207675_100002097 Ga0207675_10000209716 134
899 3300026121 Ga0207683_10198937 Ga0207683_101989372 134
900 3300026121 Ga0207683_10721002 Ga0207683_107210022 134
901 3300026142 Ga0207698_10009138 Ga0207698_100091382 134
902 3300026142 Ga0207698_10010597 Ga0207698_100105975 134
903 3300026142 Ga0207698_10410139 Ga0207698_104101392 134
904 3300028379 Ga0268266_10169395 Ga0268266_101693952 134
905 3300028379 Ga0268266_10629905 Ga0268266_106299051 134
906 3300028381 Ga0268264_10078045 Ga0268264_100780452 134
907 3300028794 Ga0307515_10016458 Ga0307515_1001645813 134
908 3300028794 Ga0307515_10093677 Ga0307515_100936771 134
909 3300028794 Ga0307515_10155455 Ga0307515_101554552 134
910 3300030522 Ga0307512_10195425 Ga0307512_101954252 134
911 3300031456 Ga0307513_10014280 Ga0307513_100142809 134
912 3300031507 Ga0307509_10004038 Ga0307509_1000403815 134
913 3300031507 Ga0307509_10040444 Ga0307509_100404442 134
914 3300031507 Ga0307509_10041270 Ga0307509_100412705 134
915 3300031507 Ga0307509_10084392 Ga0307509_100843922 134
916 3300031507 Ga0307509_10188846 Ga0307509_101888462 134
917 3300031616 Ga0307508_10000727 Ga0307508_100007277 134
918 3300031616 Ga0307508_10143662 Ga0307508_101436622 134
919 3300031730 Ga0307516_10265330 Ga0307516_102653302 134
920 3300031730 Ga0307516_10322727 Ga0307516_103227272 134
921 3300031838 Ga0307518_10112038 Ga0307518_101120382 134
922 3300033179 Ga0307507_10079435 Ga0307507_100794352 134
923 3300033179 Ga0307507_10268582 Ga0307507_102685822 134
924 3300033180 Ga0307510_10006573 Ga0307510_100065736 134
925 3300033180 Ga0307510_10009853 Ga0307510_100098534 134
926 3300033180 Ga0307510_10213116 Ga0307510_102131162 134
927 3300033180 Ga0307510_10221948 Ga0307510_102219482 134
928 3300034816 Ga0373930_0048149 Ga0373930_0048149_180_617 134
929 3300035088 Ga0373940_0100864 Ga0373940_0100864_369_845 134
930 3300035112 Ga0373932_0043412 Ga0373932_0043412_32_472 134
931 3300035121 Ga0373960_0125589 Ga0373960_0125589_184_660 134
932 3300035170 Ga0373943_0552024 Ga0373943_0552024_168_605 134
933 3300035241 Ga0373961_0050453 Ga0373961_0050453_260_736 134
934 3300035242 Ga0373962_0030510 Ga0373962_0030510_792_1268 134
935 3300035691 Ga0373931_0002625 Ga0373931_0002625_1664_2140 134
936 3300037068 Ga0373925_0013121 Ga0373925_0013121_4163_4606 134
937 3300041511 Ga0451855_1606860 Ga0451855_1606860_316_795 134
938 3300041512 Ga0451853_1843137 Ga0451853_1843137_201_641 134
939 3300045051 Ga0451576_0055580 Ga0451576_0055580_418_894 134
940 3300045051 Ga0451576_1243286 Ga0451576_1243286_310_744 134
941 3300046454 Ga0495592_0001337 Ga0495592_0001337_4405_4845 134
942 3300046460 Ga0495638_0588965 Ga0495638_0588965_71_511 134
943 3300046507 Ga0495606_0135102 Ga0495606_0135102_102_542 134
944 3300046507 Ga0495606_0157471 Ga0495606_0157471_557_994 134
945 3300046512 Ga0495610_0039173 Ga0495610_0039173_1489_1929 134
946 3300046517 Ga0495630_0142355 Ga0495630_0142355_626_1063 134
947 3300046524 Ga0495648_0288769 Ga0495648_0288769_155_595 134
948 3300046680 Ga0495646_0146323 Ga0495646_0146323_356_796 134
949 3300046683 Ga0495658_0043936 Ga0495658_0043936_798_1238 134
950 3300046689 Ga0495613_0431087 Ga0495613_0431087_335_772 134
951 3300047469 Ga0495673_0023080 Ga0495673_0023080_1652_2089 134
952 3300047472 Ga0495686_0098044 Ga0495686_0098044_812_1252 134
953 3300047472 Ga0495686_0219271 Ga0495686_0219271_328_768 134
954 3300048904 Ga0496101_0020862 Ga0496101_0020862_1124_1600 134
955 3300048904 Ga0496101_0594062 Ga0496101_0594062_233_670 134
956 3300048905 Ga0496102_0216486 Ga0496102_0216486_129_605 134
957 3300048906 Ga0496103_0269813 Ga0496103_0269813_142_618 134
958 3300048907 Ga0496104_0137373 Ga0496104_0137373_242_718 134
959 3300048908 Ga0496105_0085924 Ga0496105_0085924_1579_2055 134
960 3300048909 Ga0496106_0005982 Ga0496106_0005982_8489_8965 134
961 3300048909 Ga0496106_0017712 Ga0496106_0017712_4463_4903 134
962 3300048910 Ga0496107_0040401 Ga0496107_0040401_1685_2161 134
963 3300048913 Ga0496110_0009565 Ga0496110_0009565_3197_3673 134
964 3300048914 Ga0496111_0047491 Ga0496111_0047491_902_1378 134
965 3300048916 Ga0496113_0211149 Ga0496113_0211149_279_755 134
966 3300048918 Ga0496115_0018970 Ga0496115_0018970_805_1281 134
967 3300049579 Ga0501043_0000009 Ga0501043_0000009_99229_99666 134
968 3300049580 Ga0501046_0000022 Ga0501046_0000022_99218_99655 134
969 3300049581 Ga0501047_0000021 Ga0501047_0000021_99276_99713 134
970 3300049582 Ga0501048_0002882 Ga0501048_0002882_6862_7299 134
971 3300049824 Ga0501045_0003093 Ga0501045_0003093_5469_5906 134
972 3300050493 nmdc:mga0k408_7540_c1 nmdc:mga0k408_7540_c1_3898_4395 134
973 3300050512 nmdc:mga0n895_315103_c1 nmdc:mga0n895_315103_c1_225_701 134
974 3300050513 nmdc:mga0rr50_20863_c1 nmdc:mga0rr50_20863_c1_1808_2284 134
975 3300053093 Ga0500651_0218231 Ga0500651_0218231_380_820 134
976 3300053131 Ga0500652_041597 Ga0500652_041597_736_1173 134
977 3300053136 Ga0500559_0000778 Ga0500559_0000778_12144_12584 134
978 3300053156 Ga0500622_0001682 Ga0500622_0001682_6835_7275 134
979 3300053177 Ga0500636_0207225 Ga0500636_0207225_334_774 134
980 3300053730 Ga0500645_002795 Ga0500645_002795_6774_7214 134
981 3300053739 Ga0500587_005307 Ga0500587_005307_1280_1720 134
982 3300005290 Ga0065712_10055872 Ga0065712_100558721 135
983 3300005293 Ga0065715_10257303 Ga0065715_102573032 135
984 3300005327 Ga0070658_10085529 Ga0070658_100855292 135
985 3300005328 Ga0070676_10031850 Ga0070676_100318502 135
986 3300005329 Ga0070683_100116512 Ga0070683_1001165122 135
987 3300005331 Ga0070670_100045429 Ga0070670_1000454294 135
988 3300005331 Ga0070670_100120681 Ga0070670_1001206812 135
989 3300005331 Ga0070670_100352332 Ga0070670_1003523321 135
990 3300005331 Ga0070670_101442086 Ga0070670_1014420861 135
991 3300005333 Ga0070677_10024471 Ga0070677_100244712 135
992 3300005334 Ga0068869_100005381 Ga0068869_1000053815 135
993 3300005335 Ga0070666_10004324 Ga0070666_100043247 135
994 3300005335 Ga0070666_10553878 Ga0070666_105538782 135
995 3300005336 Ga0070680_100522163 Ga0070680_1005221632 135
996 3300005338 Ga0068868_100167205 Ga0068868_1001672052 135
997 3300005338 Ga0068868_100858626 Ga0068868_1008586262 135
998 3300005339 Ga0070660_100773904 Ga0070660_1007739042 135
999 3300005344 Ga0070661_100092259 Ga0070661_1000922591 135
1000 3300005344 Ga0070661_101009237 Ga0070661_1010092371 135
1001 3300005347 Ga0070668_100006830 Ga0070668_1000068307 135
1002 3300005347 Ga0070668_100684130 Ga0070668_1006841302 135
1003 3300005353 Ga0070669_100005723 Ga0070669_1000057232 135
1004 3300005354 Ga0070675_100015539 Ga0070675_1000155392 135
1005 3300005354 Ga0070675_100455759 Ga0070675_1004557592 135
1006 3300005355 Ga0070671_100106901 Ga0070671_1001069012 135
1007 3300005356 Ga0070674_100021439 Ga0070674_1000214392 135
1008 3300005356 Ga0070674_100092575 Ga0070674_1000925753 135
1009 3300005364 Ga0070673_100154152 Ga0070673_1001541522 135
1010 3300005364 Ga0070673_100251214 Ga0070673_1002512142 135
1011 3300005364 Ga0070673_100423052 Ga0070673_1004230522 135
1012 3300005364 Ga0070673_100451502 Ga0070673_1004515021 135
1013 3300005365 Ga0070688_100163981 Ga0070688_1001639812 135
1014 3300005366 Ga0070659_100322564 Ga0070659_1003225642 135
1015 3300005367 Ga0070667_100343907 Ga0070667_1003439072 135
1016 3300005438 Ga0070701_10606366 Ga0070701_106063661 135
1017 3300005445 Ga0070708_100120229 Ga0070708_1001202292 135
1018 3300005455 Ga0070663_100225421 Ga0070663_1002254212 135
1019 3300005456 Ga0070678_100026967 Ga0070678_1000269675 135
1020 3300005456 Ga0070678_100486738 Ga0070678_1004867382 135
1021 3300005458 Ga0070681_10339518 Ga0070681_103395182 135
1022 3300005459 Ga0068867_100023386 Ga0068867_1000233865 135
1023 3300005459 Ga0068867_100189458 Ga0068867_1001894582 135
1024 3300005459 Ga0068867_100297459 Ga0068867_1002974592 135
1025 3300005467 Ga0070706_100021331 Ga0070706_1000213312 135
1026 3300005467 Ga0070706_100422346 Ga0070706_1004223462 135
1027 3300005468 Ga0070707_100611169 Ga0070707_1006111692 135
1028 3300005471 Ga0070698_100405636 Ga0070698_1004056362 135
1029 3300005518 Ga0070699_100425887 Ga0070699_1004258872 135
1030 3300005530 Ga0070679_100002789 Ga0070679_1000027898 135
1031 3300005535 Ga0070684_100335578 Ga0070684_1003355782 135
1032 3300005539 Ga0068853_101139503 Ga0068853_1011395031 135
1033 3300005543 Ga0070672_100020423 Ga0070672_1000204235 135
1034 3300005543 Ga0070672_100052763 Ga0070672_1000527633 135
1035 3300005543 Ga0070672_100119798 Ga0070672_1001197983 135
1036 3300005547 Ga0070693_100097109 Ga0070693_1000971091 135
1037 3300005564 Ga0070664_100249051 Ga0070664_1002490512 135
1038 3300005564 Ga0070664_100303798 Ga0070664_1003037982 135
1039 3300005577 Ga0068857_100638288 Ga0068857_1006382882 135
1040 3300005578 Ga0068854_100183358 Ga0068854_1001833582 135
1041 3300005615 Ga0070702_100340434 Ga0070702_1003404341 135
1042 3300005616 Ga0068852_100039417 Ga0068852_1000394174 135
1043 3300005616 Ga0068852_100259676 Ga0068852_1002596762 135
1044 3300005616 Ga0068852_100481425 Ga0068852_1004814252 135
1045 3300005616 Ga0068852_100782693 Ga0068852_1007826932 135
1046 3300005617 Ga0068859_100097653 Ga0068859_1000976532 135
1047 3300005618 Ga0068864_100025613 Ga0068864_1000256135 135
1048 3300005618 Ga0068864_100208969 Ga0068864_1002089692 135
1049 3300005618 Ga0068864_100409761 Ga0068864_1004097612 135
1050 3300005718 Ga0068866_10001669 Ga0068866_100016692 135
1051 3300005719 Ga0068861_100000532 Ga0068861_10000053224 135
1052 3300005834 Ga0068851_10111214 Ga0068851_101112142 135
1053 3300005840 Ga0068870_10625305 Ga0068870_106253052 135
1054 3300005841 Ga0068863_100025975 Ga0068863_1000259756 135
1055 3300005841 Ga0068863_100663967 Ga0068863_1006639672 135
1056 3300005842 Ga0068858_100054654 Ga0068858_1000546542 135
1057 3300005843 Ga0068860_100020693 Ga0068860_1000206933 135
1058 3300005844 Ga0068862_100013997 Ga0068862_1000139972 135
1059 3300006173 Ga0070716_100268217 Ga0070716_1002682172 135
1060 3300006173 Ga0070716_101735759 Ga0070716_1017357591 135
1061 3300006178 Ga0075367_10016724 Ga0075367_100167243 135
1062 3300006195 Ga0075366_10088678 Ga0075366_100886782 135
1063 3300006195 Ga0075366_10301825 Ga0075366_103018252 135
1064 3300006237 Ga0097621_100163550 Ga0097621_1001635502 135
1065 3300006237 Ga0097621_100396116 Ga0097621_1003961162 135
1066 3300006237 Ga0097621_100959405 Ga0097621_1009594052 135
1067 3300006353 Ga0075370_10011047 Ga0075370_100110472 135
1068 3300006358 Ga0068871_100231622 Ga0068871_1002316223 135
1069 3300006358 Ga0068871_100567191 Ga0068871_1005671912 135
1070 3300006358 Ga0068871_100741213 Ga0068871_1007412132 135
1071 3300006881 Ga0068865_100191105 Ga0068865_1001911052 135
1072 3300006881 Ga0068865_100266056 Ga0068865_1002660562 135
1073 3300006931 Ga0097620_100097655 Ga0097620_1000976552 135
1074 3300009094 Ga0111539_10388677 Ga0111539_103886772 135
1075 3300009098 Ga0105245_10368587 Ga0105245_103685872 135
1076 3300009174 Ga0105241_11989727 Ga0105241_119897271 135
1077 3300009177 Ga0105248_10785831 Ga0105248_107858312 135
1078 3300009177 Ga0105248_10809457 Ga0105248_108094572 135
1079 3300009545 Ga0105237_10610307 Ga0105237_106103072 135
1080 3300009551 Ga0105238_10849596 Ga0105238_108495962 135
1081 3300009553 Ga0105249_10041092 Ga0105249_100410925 135
1082 3300009553 Ga0105249_13236342 Ga0105249_132363421 135
1083 3300013104 Ga0157370_10329927 Ga0157370_103299272 135
1084 3300013105 Ga0157369_10326777 Ga0157369_103267772 135
1085 3300013296 Ga0157374_10409724 Ga0157374_104097242 135
1086 3300013296 Ga0157374_10654881 Ga0157374_106548811 135
1087 3300013297 Ga0157378_10131702 Ga0157378_101317022 135
1088 3300013306 Ga0163162_10013601 Ga0163162_100136017 135
1089 3300013307 Ga0157372_10208417 Ga0157372_102084172 135
1090 3300013308 Ga0157375_10026950 Ga0157375_100269506 135
1091 3300013308 Ga0157375_10410618 Ga0157375_104106182 135
1092 3300014326 Ga0157380_10092211 Ga0157380_100922114 135
1093 3300014968 Ga0157379_10148335 Ga0157379_101483352 135
1094 3300014969 Ga0157376_10076861 Ga0157376_100768612 135
1095 3300014969 Ga0157376_10880672 Ga0157376_108806722 135
1096 3300017792 Ga0163161_10069082 Ga0163161_100690822 135
1097 3300017792 Ga0163161_10673800 Ga0163161_106738001 135
1098 3300025321 Ga0207656_10152678 Ga0207656_101526782 135
1099 3300025321 Ga0207656_10577957 Ga0207656_105779571 135
1100 3300025893 Ga0207682_10005613 Ga0207682_100056136 135
1101 3300025905 Ga0207685_10106748 Ga0207685_101067482 135
1102 3300025907 Ga0207645_10311078 Ga0207645_103110781 135
1103 3300025908 Ga0207643_10085050 Ga0207643_100850502 135
1104 3300025909 Ga0207705_10275105 Ga0207705_102751052 135
1105 3300025910 Ga0207684_10003630 Ga0207684_1000363013 135
1106 3300025911 Ga0207654_10651453 Ga0207654_106514531 135
1107 3300025912 Ga0207707_10276546 Ga0207707_102765462 135
1108 3300025917 Ga0207660_10224412 Ga0207660_102244122 135
1109 3300025918 Ga0207662_10003776 Ga0207662_100037762 135
1110 3300025920 Ga0207649_10460544 Ga0207649_104605442 135
1111 3300025921 Ga0207652_10040517 Ga0207652_100405172 135
1112 3300025923 Ga0207681_10002399 Ga0207681_100023999 135
1113 3300025925 Ga0207650_10012475 Ga0207650_100124752 135
1114 3300025925 Ga0207650_10042985 Ga0207650_100429852 135
1115 3300025925 Ga0207650_10045822 Ga0207650_100458225 135
1116 3300025925 Ga0207650_10157266 Ga0207650_101572662 135
1117 3300025926 Ga0207659_10045314 Ga0207659_100453144 135
1118 3300025927 Ga0207687_10073662 Ga0207687_100736623 135
1119 3300025932 Ga0207690_10679031 Ga0207690_106790312 135
1120 3300025932 Ga0207690_10853169 Ga0207690_108531691 135
1121 3300025933 Ga0207706_10016420 Ga0207706_100164207 135
1122 3300025934 Ga0207686_10082996 Ga0207686_100829962 135
1123 3300025936 Ga0207670_10758189 Ga0207670_107581892 135
1124 3300025937 Ga0207669_10386044 Ga0207669_103860441 135
1125 3300025938 Ga0207704_10003704 Ga0207704_100037042 135
1126 3300025939 Ga0207665_10051105 Ga0207665_100511052 135
1127 3300025941 Ga0207711_10025434 Ga0207711_100254346 135
1128 3300025941 Ga0207711_10389829 Ga0207711_103898292 135
1129 3300025942 Ga0207689_10005411 Ga0207689_100054116 135
1130 3300025944 Ga0207661_10745605 Ga0207661_107456052 135
1131 3300025945 Ga0207679_10265151 Ga0207679_102651512 135
1132 3300025960 Ga0207651_10062447 Ga0207651_100624473 135
1133 3300025960 Ga0207651_10154014 Ga0207651_101540142 135
1134 3300025960 Ga0207651_10828197 Ga0207651_108281972 135
1135 3300025961 Ga0207712_10125419 Ga0207712_101254191 135
1136 3300025961 Ga0207712_10646066 Ga0207712_106460661 135
1137 3300025972 Ga0207668_10004439 Ga0207668_100044392 135
1138 3300025986 Ga0207658_10006065 Ga0207658_100060656 135
1139 3300025986 Ga0207658_10426079 Ga0207658_104260792 135
1140 3300025986 Ga0207658_10592752 Ga0207658_105927522 135
1141 3300025986 Ga0207658_10724888 Ga0207658_107248882 135
1142 3300026035 Ga0207703_10001859 Ga0207703_100018593 135
1143 3300026075 Ga0207708_10113091 Ga0207708_101130912 135
1144 3300026088 Ga0207641_10002465 Ga0207641_1000246514 135
1145 3300026088 Ga0207641_10112090 Ga0207641_101120902 135
1146 3300026088 Ga0207641_11110396 Ga0207641_111103962 135
1147 3300026095 Ga0207676_10038159 Ga0207676_100381594 135
1148 3300026095 Ga0207676_10134614 Ga0207676_101346143 135
1149 3300026116 Ga0207674_10117773 Ga0207674_101177733 135
1150 3300026118 Ga0207675_100071706 Ga0207675_1000717063 135
1151 3300026118 Ga0207675_100519872 Ga0207675_1005198722 135
1152 3300026121 Ga0207683_10042276 Ga0207683_100422765 135
1153 3300026121 Ga0207683_10581795 Ga0207683_105817952 135
1154 3300028380 Ga0268265_10068910 Ga0268265_100689103 135
1155 3300028381 Ga0268264_10004937 Ga0268264_100049373 135
1156 3300028786 Ga0307517_10000131 Ga0307517_1000013164 135
1157 3300028794 Ga0307515_10328743 Ga0307515_103287431 135
1158 3300031456 Ga0307513_10052818 Ga0307513_100528185 135
1159 3300031649 Ga0307514_10124138 Ga0307514_101241382 135
1160 3300031730 Ga0307516_10476092 Ga0307516_104760922 135
1161 3300031731 Ga0307405_10109927 Ga0307405_101099272 135
1162 3300031731 Ga0307405_10347514 Ga0307405_103475142 135
1163 3300031852 Ga0307410_11450581 Ga0307410_114505811 135
1164 3300032004 Ga0307414_10257254 Ga0307414_102572542 135
1165 3300032004 Ga0307414_11153625 Ga0307414_111536252 135
1166 3300035086 Ga0373934_0237933 Ga0373934_0237933_213_650 135
1167 3300035089 Ga0373944_0067240 Ga0373944_0067240_277_714 135
1168 3300035113 Ga0373936_0366126 Ga0373936_0366126_60_494 135
1169 3300035114 Ga0373939_0544266 Ga0373939_0544266_46_480 135
1170 3300035120 Ga0373957_0451129 Ga0373957_0451129_69_506 135
1171 3300035171 Ga0373946_0362644 Ga0373946_0362644_156_590 135
1172 3300035410 Ga0373924_0026313 Ga0373924_0026313_376_810 135
1173 3300035691 Ga0373931_0792534 Ga0373931_0792534_108_542 135
1174 3300035692 Ga0373935_0036090 Ga0373935_0036090_1219_1653 135
1175 3300036401 Ga0373937_0237061 Ga0373937_0237061_492_926 135
1176 3300036401 Ga0373937_0680947 Ga0373937_0680947_121_558 135
1177 3300041460 Ga0451802_0078565 Ga0451802_0078565_70_504 135
1178 3300041512 Ga0451853_2789341 Ga0451853_2789341_98_532 135
1179 3300044712 Ga0453684_0129774 Ga0453684_0129774_557_994 135
1180 3300046459 Ga0495629_0245974 Ga0495629_0245974_636_1070 135
1181 3300046460 Ga0495638_0295334 Ga0495638_0295334_332_775 135
1182 3300046462 Ga0495651_0212562 Ga0495651_0212562_18_455 135
1183 3300046463 Ga0495653_0279644 Ga0495653_0279644_58_495 135
1184 3300046492 Ga0495585_0186446 Ga0495585_0186446_521_961 135
1185 3300046519 Ga0495632_0118099 Ga0495632_0118099_33_476 135
1186 3300046531 Ga0495665_0334274 Ga0495665_0334274_193_627 135
1187 3300046543 Ga0495645_0961624 Ga0495645_0961624_15_449 135
1188 3300046558 Ga0495633_0290848 Ga0495633_0290848_232_666 135
1189 3300046559 Ga0495667_0825113 Ga0495667_0825113_62_499 135
1190 3300046642 Ga0495634_0546491 Ga0495634_0546491_114_548 135
1191 3300046683 Ga0495658_0062969 Ga0495658_0062969_294_728 135
1192 3300046683 Ga0495658_0144590 Ga0495658_0144590_910_1347 135
1193 3300046689 Ga0495613_0568341 Ga0495613_0568341_260_697 135
1194 3300046689 Ga0495613_0682946 Ga0495613_0682946_83_517 135
1195 3300047315 Ga0495581_0125936 Ga0495581_0125936_788_1222 135
1196 3300047323 Ga0495683_0432223 Ga0495683_0432223_61_495 135
1197 3300047471 Ga0495684_0163362 Ga0495684_0163362_911_1348 135
1198 3300048090 Ga0495615_0180682 Ga0495615_0180682_178_612 135
1199 3300048907 Ga0496104_0863055 Ga0496104_0863055_217_651 135
1200 3300048908 Ga0496105_0095192 Ga0496105_0095192_446_880 135
1201 3300048911 Ga0496108_0392400 Ga0496108_0392400_89_523 135
1202 3300048911 Ga0496108_0524337 Ga0496108_0524337_288_722 135
1203 3300048912 Ga0496109_0928679 Ga0496109_0928679_304_738 135
1204 3300048917 Ga0496114_0174372 Ga0496114_0174372_508_942 135
1205 3300050493 nmdc:mga0k408_326322_c1 nmdc:mga0k408_326322_c1_109_576 135
1206 3300050493 nmdc:mga0k408_40078_c2 nmdc:mga0k408_40078_c2_1348_1806 135
1207 3300050496 nmdc:mga07m45_27334_c1 nmdc:mga07m45_27334_c1_729_1187 135
1208 3300050511 nmdc:mga08y16_349760_c1 nmdc:mga08y16_349760_c1_293_727 135
1209 3300053077 Ga0495601_0063497 Ga0495601_0063497_1260_1697 135
1210 3300053077 Ga0495601_0147605 Ga0495601_0147605_480_914 135
1211 3300053078 Ga0495612_0622238 Ga0495612_0622238_35_469 135
1212 3300053084 Ga0495595_0324006 Ga0495595_0324006_156_590 135
1213 3300053085 Ga0495619_0158689 Ga0495619_0158689_444_881 135
1214 3300053085 Ga0495619_0574317 Ga0495619_0574317_156_590 135
1215 3300053098 Ga0500650_0199697 Ga0500650_0199697_124_567 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

56

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bjk-assembly1.cif.gz_D crystal structure of hi0827, a hexameric broad specificity acyl-coenzyme a thioesterase: the asp44ala mutant enzyme 0.9486 26 134
3d6l-assembly1.cif.gz_A crystal structure of cj0915, a hexameric hotdog fold thioesterase of campylobacter jejuni 0.9366 27 134
1yli-assembly1.cif.gz_B crystal structure of hi0827, a hexameric broad specificity acyl-coenzyme a thioesterase 0.9235 27 135
3bjk-assembly1.cif.gz_F crystal structure of hi0827, a hexameric broad specificity acyl-coenzyme a thioesterase: the asp44ala mutant enzyme 0.9187 27 132
5dm5-assembly1.cif.gz_B crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9168 21 135
ID Description Score Start End Superfamily
2eisB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9431 36 134 3.10.129.10
3d6lA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9366 27 134 3.10.129.10
1nngB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9209 27 134 3.10.129.10
2gvhC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9194 36 132 3.10.129.10
af_A4I4M9_8_175_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9087 29 135 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A5C7PYF3-F1-model_v4 Acyl-CoA thioesterase 0.9904 59 135 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A7Y8M4I6-F1-model_v4 Acyl-CoA thioesterase 0.9835 26 135 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-W0V0T1-F1-model_v4 Thioesterase superfamily protein 0.9816 29 135 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A519Z587-F1-model_v4 Acyl-CoA thioesterase 0.98 26 135 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A3B9PPB0-F1-model_v4 Acyl-CoA thioesterase 0.9788 26 126 GO:0005829
GO:0006637
GO:0009062
GO:0052816

Feature Viewer

pLDDT pTM Quality
85.45 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map