F491565

General Info

Members Datasets Scaffolds Average Seq Length
1199 413 1135 182

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100592853|Ga0070700_1005928531
Length 205
Sequence MKQDLGLKVISGGAWSDWKMAEAYSKDELDRRMNGAVATLRSELAGLRTGRASAALLDPVKVEAYGNAVPINQVGSIATPESRMITVQVWDKGLAKAVDKAIRDAGLGLNPQMDGQLLRIPLPELNQERRKELSKLAAKYAEAARVAVRNVRRDGNDLLKKLEKDHKIGQDEQHTKSEELQKLTDAHIKTIDAALHAKEQEIMQV

Samples

Sample ID Description Type Environment
1 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
2 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
3 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
4 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
5 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
6 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
7 2643221629 Devosia sp. Root105 Isolate Unclassified
8 2643221662 Devosia sp. Root413D1 Isolate Unclassified
9 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
10 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
11 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
12 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
13 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
14 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
15 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
16 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
17 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
18 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
19 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
20 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
21 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
22 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
23 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
24 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
25 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
26 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
27 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
28 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
29 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
30 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
31 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
32 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
33 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
34 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
35 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
36 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
37 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
38 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
39 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
40 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
41 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
42 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
43 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
44 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
45 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
46 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
47 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
48 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
49 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
50 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
51 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
52 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
53 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
54 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
55 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
56 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
57 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
58 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
59 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
60 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
61 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
62 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
63 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
76 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
92 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
93 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
94 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
95 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
96 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
97 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
106 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
107 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
113 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
114 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
127 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
130 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
131 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
132 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
133 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
134 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
135 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
136 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
137 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
138 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
139 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
143 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
157 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
158 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
166 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
170 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
178 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
179 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
180 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
249 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
250 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
251 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
252 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
253 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
254 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
257 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
258 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
259 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
262 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
263 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
264 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
273 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
282 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
283 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
288 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
289 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
290 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
291 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
292 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
302 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
303 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
304 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
305 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
306 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
307 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
316 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
317 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
318 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
321 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
394 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
395 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
396 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
397 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
398 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
399 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
400 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
401 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
402 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
403 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
406 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
407 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
411 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
412 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
413 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 0.25
Isolates 5.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 4.5
Rhizoplane 0.75
Rhizosphere 89.99
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1015012 3300001977 Bacteria 1115
2 JGI24735J21928_10062511 3300002067 Bacteria 1069
3 JGI25165J46597_1000003 3300003214 Bacteria 694080
4 JGI25153J46596_10001307 3300003215 Bacteria 14926
5 rootH2_10062114 3300003320 Bacteria 1216
6 Ga0065714_10053664 3300005288 Bacteria 655
7 Ga0065707_10282750 3300005295 Bacteria 1024
8 Ga0070658_10013633 3300005327 Bacteria 6521
9 Ga0070658_10022862 3300005327 Bacteria 5018
10 Ga0070658_10023621 3300005327 Bacteria 4932
11 Ga0070658_10031187 3300005327 Bacteria 4280
12 Ga0070658_10334768 3300005327 Bacteria 1294
13 Ga0070658_10466681 3300005327 Bacteria 1089
14 Ga0070658_10791729 3300005327 Bacteria 824
15 Ga0070676_10006419 3300005328 Bacteria 6282
16 Ga0070676_10202948 3300005328 Bacteria 1301
17 Ga0070676_10656780 3300005328 Bacteria 762
18 Ga0070683_100010050 3300005329 Bacteria 8117
19 Ga0070683_100048394 3300005329 Bacteria 3931
20 Ga0070683_100066429 3300005329 Bacteria 3360
21 Ga0070683_100568337 3300005329 Bacteria 1084
22 Ga0070683_100578195 3300005329 Bacteria 1075
23 Ga0070683_101510764 3300005329 Bacteria 646
24 Ga0070690_100000126 3300005330 Bacteria 39613
25 Ga0070670_100650437 3300005331 Bacteria 946
26 Ga0070670_100682018 3300005331 Bacteria 923
27 Ga0068869_100029238 3300005334 Bacteria 3859
28 Ga0068869_100228696 3300005334 Bacteria 1477
29 Ga0068869_101203309 3300005334 Bacteria 666
30 Ga0070666_10001325 3300005335 Bacteria 15007
31 Ga0070666_10007147 3300005335 Bacteria 6882
32 Ga0070666_10066225 3300005335 Bacteria 2451
33 Ga0070666_10145197 3300005335 Bacteria 1654
34 Ga0070680_100000382 3300005336 Bacteria 30040
35 Ga0070680_100015474 3300005336 Bacteria 5982
36 Ga0070680_100037343 3300005336 Bacteria 3924
37 Ga0070680_100201727 3300005336 Bacteria 1678
38 Ga0070680_100271747 3300005336 Bacteria 1435
39 Ga0070680_100305703 3300005336 Bacteria 1349
40 Ga0070682_100508756 3300005337 Bacteria 935
41 Ga0068868_100021756 3300005338 Bacteria 4832
42 Ga0068868_100275143 3300005338 Bacteria 1423
43 Ga0070660_100002162 3300005339 Bacteria 13542
44 Ga0070660_100030677 3300005339 Bacteria 4033
45 Ga0070660_100145612 3300005339 Bacteria 1902
46 Ga0070660_100851740 3300005339 Bacteria 768
47 Ga0070689_100000031 3300005340 Bacteria 93387
48 Ga0070689_100409763 3300005340 Bacteria 1147
49 Ga0070691_10000026 3300005341 Bacteria 40701
50 Ga0070691_10000423 3300005341 Bacteria 15521
51 Ga0070691_10180083 3300005341 Bacteria 1100
52 Ga0070691_10252595 3300005341 Bacteria 946
53 Ga0070661_100000150 3300005344 Bacteria 57095
54 Ga0070661_100020621 3300005344 Bacteria 4702
55 Ga0070661_100050228 3300005344 Bacteria 3052
56 Ga0070661_100316152 3300005344 Bacteria 1219
57 Ga0070661_100396056 3300005344 Bacteria 1091
58 Ga0070661_100569001 3300005344 Bacteria 913
59 Ga0070692_10552224 3300005345 Unclassified 755
60 Ga0070675_100030431 3300005354 Bacteria 4359
61 Ga0070675_100092368 3300005354 Bacteria 2537
62 Ga0070675_100142853 3300005354 Bacteria 2047
63 Ga0070675_100371794 3300005354 Bacteria 1271
64 Ga0070674_100126575 3300005356 Bacteria 1899
65 Ga0070674_100136922 3300005356 Bacteria 1833
66 Ga0070673_100814489 3300005364 Bacteria 863
67 Ga0070688_100000054 3300005365 Bacteria 55061
68 Ga0070659_100007064 3300005366 Bacteria 8135
69 Ga0070659_100018815 3300005366 Bacteria 5215
70 Ga0070659_100023241 3300005366 Bacteria 4742
71 Ga0070667_100083432 3300005367 Bacteria 2737
72 Ga0070709_10001084 3300005434 Bacteria 15078
73 Ga0070709_10155417 3300005434 Bacteria 1585
74 Ga0070714_100299399 3300005435 Bacteria 1499
75 Ga0070714_100806849 3300005435 Bacteria 909
76 Ga0070713_100000008 3300005436 Bacteria 160153
77 Ga0070713_100727924 3300005436 Bacteria 948
78 Ga0070710_10243031 3300005437 Bacteria 1154
79 Ga0070701_10000100 3300005438 Bacteria 24460
80 Ga0070705_100705701 3300005440 Bacteria 793
81 Ga0070705_100804942 3300005440 Bacteria 748
82 Ga0070700_100000470 3300005441 Bacteria 20206
83 Ga0070700_100592853 3300005441 Bacteria 867
84 Ga0070694_100030134 3300005444 Bacteria 3547
85 Ga0070694_100088311 3300005444 Bacteria 2170
86 Ga0070694_100463045 3300005444 Bacteria 1003
87 Ga0070694_100539649 3300005444 Bacteria 933
88 Ga0070708_100004067 3300005445 Bacteria 11488
89 Ga0070708_100092567 3300005445 Bacteria 2754
90 Ga0070663_100426438 3300005455 Bacteria 1089
91 Ga0070663_100602337 3300005455 Bacteria 924
92 Ga0070678_100007499 3300005456 Bacteria 6476
93 Ga0070678_100013964 3300005456 Bacteria 5052
94 Ga0070678_100059543 3300005456 Bacteria 2807
95 Ga0070678_100076475 3300005456 Bacteria 2522
96 Ga0070678_100255635 3300005456 Bacteria 1471
97 Ga0070678_100412612 3300005456 Bacteria 1175
98 Ga0070678_100772362 3300005456 Bacteria 870
99 Ga0070662_100309355 3300005457 Bacteria 1286
100 Ga0070662_100645543 3300005457 Bacteria 893
101 Ga0070662_100711103 3300005457 Bacteria 850
102 Ga0070662_100787135 3300005457 Bacteria 808
103 Ga0070681_10000001 3300005458 Bacteria 946857
104 Ga0070681_10002305 3300005458 Bacteria 17466
105 Ga0070681_10028353 3300005458 Bacteria 5628
106 Ga0070681_10051541 3300005458 Bacteria 4105
107 Ga0070681_10933392 3300005458 Bacteria 787
108 Ga0068867_100004275 3300005459 Bacteria 10049
109 Ga0068867_100005925 3300005459 Bacteria 8669
110 Ga0068867_100129515 3300005459 Bacteria 1959
111 Ga0070685_10000160 3300005466 Bacteria 43908
112 Ga0070685_10569317 3300005466 Bacteria 811
113 Ga0070685_10685368 3300005466 Bacteria 746
114 Ga0070706_100008931 3300005467 Bacteria 9332
115 Ga0070706_100029873 3300005467 Bacteria 5020
116 Ga0070706_100193031 3300005467 Bacteria 1903
117 Ga0070706_100194351 3300005467 Bacteria 1896
118 Ga0070706_100233828 3300005467 Bacteria 1716
119 Ga0070707_100000795 3300005468 Bacteria 31149
120 Ga0070707_100005781 3300005468 Bacteria 11537
121 Ga0070707_100028615 3300005468 Bacteria 5304
122 Ga0070698_100004668 3300005471 Bacteria 15065
123 Ga0070698_100031139 3300005471 Bacteria 5530
124 Ga0070698_100086826 3300005471 Bacteria 3115
125 Ga0070699_100011748 3300005518 Bacteria 7557
126 Ga0070699_100016157 3300005518 Bacteria 6407
127 Ga0070699_100096821 3300005518 Bacteria 2585
128 Ga0070699_100344019 3300005518 Bacteria 1342
129 Ga0070679_100002973 3300005530 Bacteria 15467
130 Ga0070679_100008702 3300005530 Bacteria 9567
131 Ga0070679_100056119 3300005530 Bacteria 3924
132 Ga0070679_100122331 3300005530 Bacteria 2586
133 Ga0070679_100162021 3300005530 Bacteria 2211
134 Ga0070679_100190232 3300005530 Bacteria 2022
135 Ga0070679_100671190 3300005530 Bacteria 979
136 Ga0070679_100767822 3300005530 Unclassified 907
137 Ga0070684_100400975 3300005535 Bacteria 1264
138 Ga0070684_100498396 3300005535 Bacteria 1128
139 Ga0070684_100650485 3300005535 Bacteria 981
140 Ga0070697_100017581 3300005536 Bacteria 5629
141 Ga0070697_100028331 3300005536 Bacteria 4484
142 Ga0070697_100165466 3300005536 Bacteria 1870
143 Ga0070697_100478129 3300005536 Bacteria 1088
144 Ga0070697_100655508 3300005536 Bacteria 925
145 Ga0070697_100665023 3300005536 Bacteria 918
146 Ga0068853_100018064 3300005539 Bacteria 5831
147 Ga0068853_100025374 3300005539 Bacteria 4972
148 Ga0068853_100049546 3300005539 Bacteria 3610
149 Ga0068853_100078218 3300005539 Bacteria 2890
150 Ga0068853_100095631 3300005539 Bacteria 2619
151 Ga0068853_100147450 3300005539 Bacteria 2116
152 Ga0068853_100149163 3300005539 Bacteria 2104
153 Ga0068853_100387687 3300005539 Bacteria 1306
154 Ga0068853_100411286 3300005539 Bacteria 1267
155 Ga0068853_100468983 3300005539 Bacteria 1186
156 Ga0068853_101070892 3300005539 Bacteria 777
157 Ga0070686_100000246 3300005544 Bacteria 36843
158 Ga0070686_100005266 3300005544 Bacteria 7148
159 Ga0070686_100302908 3300005544 Bacteria 1186
160 Ga0070695_100014491 3300005545 Bacteria 4752
161 Ga0070695_100033491 3300005545 Bacteria 3214
162 Ga0070695_100331313 3300005545 Bacteria 1135
163 Ga0070695_100369960 3300005545 Bacteria 1079
164 Ga0070695_100512939 3300005545 Bacteria 929
165 Ga0070695_100689603 3300005545 Bacteria 810
166 Ga0070695_100907232 3300005545 Unclassified 712
167 Ga0070696_100042050 3300005546 Bacteria 3159
168 Ga0070696_100108866 3300005546 Bacteria 1994
169 Ga0070693_100060956 3300005547 Bacteria 2192
170 Ga0070693_100184665 3300005547 Bacteria 1345
171 Ga0070665_100000377 3300005548 Bacteria 66234
172 Ga0070665_100088463 3300005548 Bacteria 3103
173 Ga0070665_100090856 3300005548 Bacteria 3059
174 Ga0070665_100116908 3300005548 Bacteria 2669
175 Ga0070665_100118362 3300005548 Bacteria 2651
176 Ga0070665_100179112 3300005548 Bacteria 2120
177 Ga0070665_100294327 3300005548 Bacteria 1626
178 Ga0070665_100424971 3300005548 Bacteria 1337
179 Ga0070665_100735525 3300005548 Bacteria 1000
180 Ga0070665_101045013 3300005548 Bacteria 829
181 Ga0070704_100074278 3300005549 Bacteria 2479
182 Ga0070704_100077846 3300005549 Bacteria 2430
183 Ga0070704_100147877 3300005549 Bacteria 1843
184 Ga0068855_100000032 3300005563 Bacteria 168335
185 Ga0068855_100013144 3300005563 Bacteria 9985
186 Ga0068855_100029133 3300005563 Bacteria 6603
187 Ga0068855_100040684 3300005563 Bacteria 5515
188 Ga0068855_100045380 3300005563 Bacteria 5198
189 Ga0068855_100104119 3300005563 Bacteria 3264
190 Ga0068855_100115407 3300005563 Bacteria 3078
191 Ga0068855_100639393 3300005563 Bacteria 1144
192 Ga0068855_100654588 3300005563 Bacteria 1128
193 Ga0068855_100850242 3300005563 Bacteria 967
194 Ga0068855_100908992 3300005563 Bacteria 929
195 Ga0068857_100000572 3300005577 Bacteria 26923
196 Ga0068857_100030232 3300005577 Bacteria 4781
197 Ga0068857_100096885 3300005577 Bacteria 2644
198 Ga0068857_100317241 3300005577 Bacteria 1439
199 Ga0068857_100322871 3300005577 Bacteria 1426
200 Ga0068854_100083557 3300005578 Bacteria 2361
201 Ga0068854_100106133 3300005578 Bacteria 2113
202 Ga0068854_101287181 3300005578 Bacteria 658
203 Ga0068856_100000362 3300005614 Bacteria 49802
204 Ga0068856_100006993 3300005614 Bacteria 11023
205 Ga0068856_100099566 3300005614 Bacteria 2898
206 Ga0068856_100103685 3300005614 Bacteria 2838
207 Ga0068856_100324155 3300005614 Bacteria 1558
208 Ga0070702_100338557 3300005615 Bacteria 1055
209 Ga0068852_100012265 3300005616 Bacteria 6498
210 Ga0068852_100016637 3300005616 Bacteria 5745
211 Ga0068852_100021576 3300005616 Bacteria 5146
212 Ga0068852_100092845 3300005616 Bacteria 2704
213 Ga0068852_100132119 3300005616 Bacteria 2300
214 Ga0068852_100737491 3300005616 Bacteria 997
215 Ga0068859_100001428 3300005617 Bacteria 24223
216 Ga0068859_100527304 3300005617 Bacteria 1276
217 Ga0068859_100949822 3300005617 Bacteria 943
218 Ga0068859_101031183 3300005617 Bacteria 904
219 Ga0068864_100735858 3300005618 Bacteria 966
220 Ga0068864_101652334 3300005618 Bacteria 645
221 Ga0068866_10005699 3300005718 Bacteria 5161
222 Ga0068866_10160885 3300005718 Bacteria 1309
223 Ga0068861_100055611 3300005719 Bacteria 3018
224 Ga0068861_100500131 3300005719 Bacteria 1099
225 Ga0068851_10117237 3300005834 Bacteria 1427
226 Ga0068851_10319889 3300005834 Bacteria 896
227 Ga0068870_10066881 3300005840 Bacteria 1948
228 Ga0068863_100076142 3300005841 Bacteria 3174
229 Ga0068863_100376847 3300005841 Bacteria 1385
230 Ga0068858_100024740 3300005842 Bacteria 5591
231 Ga0068858_100702561 3300005842 Bacteria 984
232 Ga0068858_100837932 3300005842 Bacteria 898
233 Ga0068858_101034979 3300005842 Bacteria 805
234 Ga0068858_101182558 3300005842 Bacteria 751
235 Ga0068860_100128943 3300005843 Bacteria 2426
236 Ga0068862_100358847 3300005844 Bacteria 1354
237 Ga0081455_10000349 3300005937 Bacteria 60630
238 Ga0081455_10181036 3300005937 Bacteria 1595
239 Ga0081539_10216430 3300005985 Bacteria 874
240 Ga0070717_11300470 3300006028 Bacteria 661
241 Ga0070715_10051465 3300006163 Bacteria 1772
242 Ga0070716_100247188 3300006173 Bacteria 1213
243 Ga0070712_100000264 3300006175 Bacteria 29360
244 Ga0070712_100000435 3300006175 Bacteria 23865
245 Ga0097621_100000211 3300006237 Bacteria 38289
246 Ga0097621_100014338 3300006237 Bacteria 5929
247 Ga0097621_100047141 3300006237 Bacteria 3491
248 Ga0097621_100082443 3300006237 Bacteria 2678
249 Ga0097621_100097675 3300006237 Bacteria 2466
250 Ga0097621_100099772 3300006237 Bacteria 2441
251 Ga0097621_100218793 3300006237 Bacteria 1659
252 Ga0097621_100326332 3300006237 Bacteria 1360
253 Ga0097621_100365696 3300006237 Bacteria 1286
254 Ga0097621_100672862 3300006237 Bacteria 951
255 Ga0097621_100857266 3300006237 Unclassified 844
256 Ga0068871_100002499 3300006358 Bacteria 12546
257 Ga0068871_100013560 3300006358 Bacteria 6051
258 Ga0068871_100013750 3300006358 Bacteria 6017
259 Ga0068871_100221709 3300006358 Bacteria 1638
260 Ga0068871_100510523 3300006358 Bacteria 1084
261 Ga0075433_10061018 3300006852 Bacteria 3303
262 Ga0075434_100019465 3300006871 Bacteria 6571
263 Ga0068865_100020404 3300006881 Bacteria 4296
264 Ga0068865_100089567 3300006881 Bacteria 2229
265 Ga0068865_100449756 3300006881 Bacteria 1065
266 Ga0075436_100000099 3300006914 Bacteria 51125
267 Ga0075436_100002921 3300006914 Bacteria 11716
268 Ga0075436_100031551 3300006914 Bacteria 3649
269 Ga0097620_100001428 3300006931 Bacteria 24223
270 Ga0097620_100527332 3300006931 Bacteria 1276
271 Ga0097620_100949685 3300006931 Bacteria 943
272 Ga0097620_101031211 3300006931 Bacteria 904
273 Ga0075435_100008130 3300007076 Bacteria 7512
274 Ga0105240_10000122 3300009093 Bacteria 162728
275 Ga0105240_10003858 3300009093 Bacteria 23159
276 Ga0105240_10008089 3300009093 Bacteria 15108
277 Ga0105240_10010600 3300009093 Bacteria 12951
278 Ga0105240_10042522 3300009093 Bacteria 5790
279 Ga0105240_10106706 3300009093 Bacteria 3396
280 Ga0105240_10136259 3300009093 Bacteria 2940
281 Ga0105240_10245374 3300009093 Bacteria 2074
282 Ga0105240_10248698 3300009093 Bacteria 2057
283 Ga0105240_10295065 3300009093 Bacteria 1857
284 Ga0105240_10306625 3300009093 Bacteria 1815
285 Ga0105240_10313971 3300009093 Bacteria 1789
286 Ga0105240_10357367 3300009093 Bacteria 1656
287 Ga0105240_10440570 3300009093 Bacteria 1460
288 Ga0105240_10762413 3300009093 Bacteria 1051
289 Ga0105245_10083985 3300009098 Bacteria 2916
290 Ga0105245_10166946 3300009098 Bacteria 2093
291 Ga0105245_10312721 3300009098 Bacteria 1545
292 Ga0105245_10327308 3300009098 Bacteria 1511
293 Ga0105247_10290875 3300009101 Bacteria 1130
294 Ga0105247_10308872 3300009101 Bacteria 1099
295 Ga0114129_10096743 3300009147 Bacteria 4087
296 Ga0114129_10544686 3300009147 Bacteria 1510
297 Ga0114129_11451837 3300009147 Unclassified 845
298 Ga0105243_10003136 3300009148 Bacteria 13575
299 Ga0105241_10059972 3300009174 Bacteria 2926
300 Ga0105241_10061952 3300009174 Bacteria 2883
301 Ga0105241_10153356 3300009174 Bacteria 1887
302 Ga0105241_10195496 3300009174 Bacteria 1686
303 Ga0105241_10228341 3300009174 Bacteria 1568
304 Ga0105241_10235454 3300009174 Bacteria 1545
305 Ga0105241_10241759 3300009174 Bacteria 1526
306 Ga0105241_10367559 3300009174 Bacteria 1253
307 Ga0105241_10425580 3300009174 Bacteria 1169
308 Ga0105241_10750363 3300009174 Bacteria 895
309 Ga0105242_10101018 3300009176 Bacteria 2444
310 Ga0105242_10231009 3300009176 Bacteria 1658
311 Ga0105242_10232864 3300009176 Bacteria 1651
312 Ga0105242_10314331 3300009176 Bacteria 1434
313 Ga0105248_10000005 3300009177 Bacteria 673111
314 Ga0105248_10003105 3300009177 Bacteria 18396
315 Ga0105248_10092092 3300009177 Bacteria 3414
316 Ga0105248_10182042 3300009177 Bacteria 2368
317 Ga0105248_10312922 3300009177 Bacteria 1769
318 Ga0105248_10328699 3300009177 Bacteria 1722
319 Ga0105248_10421972 3300009177 Bacteria 1502
320 Ga0105248_10910511 3300009177 Bacteria 993
321 Ga0105248_10950259 3300009177 Bacteria 971
322 Ga0105237_10012207 3300009545 Bacteria 9057
323 Ga0105237_10103025 3300009545 Bacteria 2846
324 Ga0105237_10199481 3300009545 Bacteria 2000
325 Ga0105237_10360803 3300009545 Bacteria 1457
326 Ga0105237_10489329 3300009545 Bacteria 1236
327 Ga0105237_10648664 3300009545 Bacteria 1062
328 Ga0105237_10766137 3300009545 Bacteria 972
329 Ga0105237_10988870 3300009545 Bacteria 848
330 Ga0105238_10001957 3300009551 Bacteria 20734
331 Ga0105238_10024452 3300009551 Bacteria 6156
332 Ga0105238_10044453 3300009551 Bacteria 4490
333 Ga0105238_10044693 3300009551 Bacteria 4477
334 Ga0105238_10079347 3300009551 Bacteria 3273
335 Ga0105238_10091347 3300009551 Bacteria 3032
336 Ga0105238_10145589 3300009551 Bacteria 2346
337 Ga0105238_10163485 3300009551 Bacteria 2202
338 Ga0105238_10199543 3300009551 Bacteria 1976
339 Ga0105238_10246387 3300009551 Bacteria 1765
340 Ga0105238_10283839 3300009551 Bacteria 1637
341 Ga0105238_10623714 3300009551 Bacteria 1087
342 Ga0105238_10775285 3300009551 Bacteria 974
343 Ga0105238_11621501 3300009551 Bacteria 677
344 Ga0105249_11160533 3300009553 Bacteria 843
345 Ga0105239_10002396 3300010375 Bacteria 23907
346 Ga0105239_10006805 3300010375 Bacteria 13192
347 Ga0105239_10010902 3300010375 Bacteria 10154
348 Ga0105239_10012817 3300010375 Bacteria 9327
349 Ga0105239_10182269 3300010375 Bacteria 2350
350 Ga0105239_10205236 3300010375 Bacteria 2208
351 Ga0105239_10280701 3300010375 Bacteria 1875
352 Ga0105239_10294199 3300010375 Bacteria 1828
353 Ga0105239_10324054 3300010375 Bacteria 1738
354 Ga0105239_10431450 3300010375 Bacteria 1494
355 Ga0105239_10571435 3300010375 Bacteria 1288
356 Ga0105239_10683603 3300010375 Bacteria 1173
357 Ga0105239_10807708 3300010375 Bacteria 1075
358 Ga0105246_10003704 3300011119 Bacteria 9252
359 Ga0157373_10000393 3300013100 Bacteria 35085
360 Ga0157373_10034786 3300013100 Bacteria 3619
361 Ga0157373_10177773 3300013100 Bacteria 1498
362 Ga0157371_10386420 3300013102 Bacteria 1023
363 Ga0157371_10611317 3300013102 Bacteria 811
364 Ga0157370_10005885 3300013104 Bacteria 13673
365 Ga0157370_10006364 3300013104 Bacteria 13035
366 Ga0157370_10025580 3300013104 Bacteria 5842
367 Ga0157370_10621503 3300013104 Bacteria 988
368 Ga0157370_10774663 3300013104 Bacteria 873
369 Ga0157369_10004678 3300013105 Bacteria 16088
370 Ga0157369_10049035 3300013105 Bacteria 4579
371 Ga0157369_10156713 3300013105 Bacteria 2405
372 Ga0157369_10256399 3300013105 Bacteria 1825
373 Ga0157369_10545155 3300013105 Bacteria 1199
374 Ga0157369_10840942 3300013105 Bacteria 942
375 Ga0157374_10059924 3300013296 Bacteria 3561
376 Ga0157374_10080725 3300013296 Bacteria 3085
377 Ga0157374_10319856 3300013296 Bacteria 1537
378 Ga0157374_10450748 3300013296 Bacteria 1288
379 Ga0157374_10469534 3300013296 Bacteria 1261
380 Ga0157374_10670896 3300013296 Bacteria 1049
381 Ga0157374_10721078 3300013296 Bacteria 1011
382 Ga0157374_10721973 3300013296 Bacteria 1010
383 Ga0157378_10299128 3300013297 Bacteria 1557
384 Ga0157378_10348865 3300013297 Unclassified 1445
385 Ga0157378_10449816 3300013297 Bacteria 1278
386 Ga0157378_10462508 3300013297 Bacteria 1261
387 Ga0157378_10539458 3300013297 Bacteria 1170
388 Ga0157378_10790370 3300013297 Bacteria 974
389 Ga0157378_10874157 3300013297 Bacteria 928
390 Ga0163162_10142362 3300013306 Bacteria 2512
391 Ga0163162_10245922 3300013306 Bacteria 1920
392 Ga0163162_11097175 3300013306 Bacteria 902
393 Ga0157372_10004098 3300013307 Bacteria 15629
394 Ga0157372_10034021 3300013307 Bacteria 5599
395 Ga0157372_10117108 3300013307 Bacteria 3055
396 Ga0157372_10288987 3300013307 Bacteria 1907
397 Ga0157372_12166316 3300013307 Bacteria 639
398 Ga0157375_10154128 3300013308 Bacteria 2435
399 Ga0157375_10277760 3300013308 Bacteria 1838
400 Ga0157375_10299149 3300013308 Bacteria 1773
401 Ga0157375_10353192 3300013308 Bacteria 1636
402 Ga0157375_10813835 3300013308 Bacteria 1082
403 Ga0163163_10000374 3300014325 Bacteria 42870
404 Ga0163163_10025260 3300014325 Bacteria 5664
405 Ga0163163_10320449 3300014325 Bacteria 1604
406 Ga0163163_10395822 3300014325 Bacteria 1439
407 Ga0163163_11202027 3300014325 Bacteria 821
408 Ga0157379_10000809 3300014968 Bacteria 25373
409 Ga0157379_10002383 3300014968 Bacteria 15713
410 Ga0157379_10002785 3300014968 Bacteria 14743
411 Ga0157379_10002800 3300014968 Bacteria 14691
412 Ga0157379_10018004 3300014968 Bacteria 6226
413 Ga0157379_10050980 3300014968 Bacteria 3696
414 Ga0157379_10170072 3300014968 Bacteria 1967
415 Ga0157379_10610948 3300014968 Bacteria 1018
416 Ga0157379_10936947 3300014968 Bacteria 823
417 Ga0157376_10011362 3300014969 Bacteria 6561
418 Ga0157376_10393993 3300014969 Bacteria 1337
419 Ga0157376_10460149 3300014969 Bacteria 1243
420 Ga0157376_11021924 3300014969 Bacteria 850
421 Ga0157376_11288484 3300014969 Bacteria 760
422 Ga0163161_10632206 3300017792 Bacteria 885
423 Ga0206356_10618293 3300020070 Bacteria 1113
424 Ga0206351_10148948 3300020077 Bacteria 1620
425 Ga0206353_11321961 3300020082 Bacteria 774
426 Ga0213874_10005913 3300021377 Bacteria 2872
427 Ga0213876_10000215 3300021384 Bacteria 58307
428 Ga0213876_10061774 3300021384 Bacteria 1977
429 Ga0213875_10008490 3300021388 Bacteria 5257
430 Ga0209233_1000015 3300025261 Bacteria 980563
431 Ga0209233_1002975 3300025261 Bacteria 6039
432 Ga0209758_1000013 3300025297 Bacteria 873003
433 Ga0207656_10116204 3300025321 Bacteria 1241
434 Ga0207656_10161313 3300025321 Bacteria 1067
435 Ga0207692_10059367 3300025898 Bacteria 1975
436 Ga0207642_10003258 3300025899 Bacteria 5100
437 Ga0207642_10285786 3300025899 Bacteria 950
438 Ga0207710_10353555 3300025900 Bacteria 749
439 Ga0207680_10001877 3300025903 Bacteria 9861
440 Ga0207680_10010949 3300025903 Bacteria 4560
441 Ga0207680_10132462 3300025903 Bacteria 1644
442 Ga0207647_10035502 3300025904 Bacteria 3177
443 Ga0207685_10034535 3300025905 Bacteria 1838
444 Ga0207685_10040154 3300025905 Bacteria 1742
445 Ga0207699_10000140 3300025906 Bacteria 48523
446 Ga0207699_10312872 3300025906 Bacteria 1099
447 Ga0207645_10024042 3300025907 Bacteria 3954
448 Ga0207645_10086079 3300025907 Bacteria 2019
449 Ga0207645_10096782 3300025907 Bacteria 1902
450 Ga0207645_10490343 3300025907 Bacteria 831
451 Ga0207643_10088641 3300025908 Bacteria 1801
452 Ga0207705_10000130 3300025909 Bacteria 82082
453 Ga0207705_10044073 3300025909 Bacteria 3205
454 Ga0207705_10046870 3300025909 Bacteria 3108
455 Ga0207705_10073405 3300025909 Bacteria 2482
456 Ga0207705_10115251 3300025909 Bacteria 1989
457 Ga0207705_10128660 3300025909 Bacteria 1883
458 Ga0207705_10348937 3300025909 Bacteria 1140
459 Ga0207684_10005572 3300025910 Bacteria 11590
460 Ga0207684_10101036 3300025910 Bacteria 2465
461 Ga0207684_10204397 3300025910 Bacteria 1704
462 Ga0207684_10358819 3300025910 Bacteria 1254
463 Ga0207684_10386544 3300025910 Bacteria 1203
464 Ga0207654_10054236 3300025911 Bacteria 2316
465 Ga0207654_10069711 3300025911 Bacteria 2085
466 Ga0207654_10075469 3300025911 Bacteria 2015
467 Ga0207654_10100444 3300025911 Bacteria 1782
468 Ga0207654_10168631 3300025911 Bacteria 1420
469 Ga0207654_10314990 3300025911 Bacteria 1068
470 Ga0207654_10449248 3300025911 Bacteria 904
471 Ga0207654_10685879 3300025911 Bacteria 735
472 Ga0207707_10000048 3300025912 Bacteria 117799
473 Ga0207707_10000839 3300025912 Bacteria 30215
474 Ga0207707_10064239 3300025912 Bacteria 3195
475 Ga0207707_10145827 3300025912 Bacteria 2069
476 Ga0207707_10323265 3300025912 Bacteria 1332
477 Ga0207707_10414169 3300025912 Bacteria 1156
478 Ga0207695_10000173 3300025913 Bacteria 189050
479 Ga0207695_10003968 3300025913 Bacteria 20443
480 Ga0207695_10005722 3300025913 Bacteria 16380
481 Ga0207695_10010811 3300025913 Bacteria 11124
482 Ga0207695_10055793 3300025913 Bacteria 4115
483 Ga0207695_10057112 3300025913 Bacteria 4057
484 Ga0207695_10083397 3300025913 Bacteria 3229
485 Ga0207695_10121031 3300025913 Bacteria 2585
486 Ga0207695_10127045 3300025913 Bacteria 2511
487 Ga0207695_10135029 3300025913 Bacteria 2421
488 Ga0207695_10185647 3300025913 Bacteria 1998
489 Ga0207671_10099717 3300025914 Bacteria 2198
490 Ga0207671_10233736 3300025914 Bacteria 1443
491 Ga0207671_10323771 3300025914 Bacteria 1220
492 Ga0207693_10000242 3300025915 Bacteria 50442
493 Ga0207693_10001130 3300025915 Bacteria 23920
494 Ga0207693_10178923 3300025915 Bacteria 1669
495 Ga0207693_10415156 3300025915 Bacteria 1052
496 Ga0207663_10030668 3300025916 Bacteria 3174
497 Ga0207663_10127686 3300025916 Bacteria 1752
498 Ga0207663_10386679 3300025916 Bacteria 1067
499 Ga0207660_10000072 3300025917 Bacteria 52074
500 Ga0207660_10000793 3300025917 Bacteria 20929
501 Ga0207660_10074194 3300025917 Bacteria 2482
502 Ga0207660_10136361 3300025917 Bacteria 1873
503 Ga0207660_10182248 3300025917 Bacteria 1631
504 Ga0207662_10225933 3300025918 Bacteria 1221
505 Ga0207657_10000203 3300025919 Bacteria 61390
506 Ga0207657_10015039 3300025919 Bacteria 7516
507 Ga0207657_10085815 3300025919 Bacteria 2636
508 Ga0207657_10111451 3300025919 Bacteria 2259
509 Ga0207657_10125771 3300025919 Bacteria 2106
510 Ga0207649_10000162 3300025920 Bacteria 54357
511 Ga0207649_10031260 3300025920 Bacteria 3163
512 Ga0207649_10089115 3300025920 Bacteria 2016
513 Ga0207649_10093538 3300025920 Bacteria 1973
514 Ga0207649_10648837 3300025920 Bacteria 815
515 Ga0207652_10000509 3300025921 Bacteria 39514
516 Ga0207652_10001704 3300025921 Bacteria 19206
517 Ga0207652_10391199 3300025921 Bacteria 1255
518 Ga0207652_10486718 3300025921 Bacteria 1111
519 Ga0207652_10671768 3300025921 Bacteria 926
520 Ga0207652_10702285 3300025921 Unclassified 902
521 Ga0207646_10000283 3300025922 Bacteria 69717
522 Ga0207646_10023084 3300025922 Bacteria 5718
523 Ga0207646_10082035 3300025922 Bacteria 2883
524 Ga0207646_10541644 3300025922 Bacteria 1047
525 Ga0207694_10000005 3300025924 Bacteria 823704
526 Ga0207694_10021487 3300025924 Bacteria 4890
527 Ga0207694_10036914 3300025924 Bacteria 3750
528 Ga0207694_10043175 3300025924 Bacteria 3480
529 Ga0207694_10053944 3300025924 Bacteria 3118
530 Ga0207694_10054698 3300025924 Bacteria 3097
531 Ga0207694_10084143 3300025924 Bacteria 2502
532 Ga0207694_10116740 3300025924 Bacteria 2127
533 Ga0207694_10142006 3300025924 Bacteria 1931
534 Ga0207694_10182210 3300025924 Bacteria 1703
535 Ga0207694_10650175 3300025924 Bacteria 888
536 Ga0207694_10710637 3300025924 Bacteria 848
537 Ga0207650_10419331 3300025925 Bacteria 1110
538 Ga0207650_10522533 3300025925 Bacteria 993
539 Ga0207659_10092082 3300025926 Bacteria 2266
540 Ga0207687_10184137 3300025927 Bacteria 1620
541 Ga0207687_10318269 3300025927 Bacteria 1258
542 Ga0207687_10468742 3300025927 Bacteria 1047
543 Ga0207687_10483895 3300025927 Bacteria 1031
544 Ga0207700_10000011 3300025928 Bacteria 266323
545 Ga0207700_10515184 3300025928 Bacteria 1059
546 Ga0207664_10191400 3300025929 Bacteria 1761
547 Ga0207664_10297652 3300025929 Bacteria 1419
548 Ga0207664_11185608 3300025929 Bacteria 681
549 Ga0207644_10947599 3300025931 Bacteria 722
550 Ga0207644_10985855 3300025931 Bacteria 707
551 Ga0207690_10052953 3300025932 Bacteria 2721
552 Ga0207690_10101512 3300025932 Bacteria 2055
553 Ga0207690_10196435 3300025932 Bacteria 1529
554 Ga0207686_10026081 3300025934 Bacteria 3407
555 Ga0207686_10295938 3300025934 Bacteria 1200
556 Ga0207686_10430455 3300025934 Bacteria 1011
557 Ga0207709_10017792 3300025935 Bacteria 3972
558 Ga0207709_10146584 3300025935 Bacteria 1629
559 Ga0207670_10000040 3300025936 Bacteria 102329
560 Ga0207670_10278503 3300025936 Bacteria 1303
561 Ga0207670_10335047 3300025936 Bacteria 1194
562 Ga0207669_10274072 3300025937 Bacteria 1269
563 Ga0207669_10370444 3300025937 Bacteria 1113
564 Ga0207669_10442522 3300025937 Bacteria 1028
565 Ga0207704_10006555 3300025938 Bacteria 5440
566 Ga0207704_10021580 3300025938 Bacteria 3433
567 Ga0207704_10041652 3300025938 Bacteria 2695
568 Ga0207704_10611585 3300025938 Bacteria 893
569 Ga0207665_10404325 3300025939 Bacteria 1040
570 Ga0207665_10707723 3300025939 Bacteria 792
571 Ga0207691_10042818 3300025940 Bacteria 4173
572 Ga0207691_10204199 3300025940 Bacteria 1719
573 Ga0207711_10000002 3300025941 Bacteria 1228676
574 Ga0207711_10002043 3300025941 Bacteria 18257
575 Ga0207711_10020955 3300025941 Bacteria 5458
576 Ga0207711_10202636 3300025941 Bacteria 1811
577 Ga0207689_10088833 3300025942 Bacteria 2538
578 Ga0207689_10272370 3300025942 Bacteria 1402
579 Ga0207661_10040111 3300025944 Bacteria 3679
580 Ga0207661_10297159 3300025944 Bacteria 1447
581 Ga0207661_10449209 3300025944 Bacteria 1174
582 Ga0207667_10000011 3300025949 Bacteria 447785
583 Ga0207667_10002009 3300025949 Bacteria 25530
584 Ga0207667_10006070 3300025949 Bacteria 14691
585 Ga0207667_10018856 3300025949 Bacteria 7722
586 Ga0207667_10025465 3300025949 Bacteria 6473
587 Ga0207667_10123623 3300025949 Bacteria 2666
588 Ga0207667_10603829 3300025949 Bacteria 1106
589 Ga0207651_10475629 3300025960 Bacteria 1076
590 Ga0207651_10677660 3300025960 Bacteria 907
591 Ga0207640_10039961 3300025981 Bacteria 2973
592 Ga0207658_10018223 3300025986 Bacteria 4844
593 Ga0207658_10638931 3300025986 Bacteria 959
594 Ga0207677_10008414 3300026023 Bacteria 5758
595 Ga0207677_10085528 3300026023 Bacteria 2276
596 Ga0207677_10136291 3300026023 Bacteria 1872
597 Ga0207677_10180702 3300026023 Bacteria 1659
598 Ga0207703_10039522 3300026035 Bacteria 3771
599 Ga0207703_10091378 3300026035 Bacteria 2560
600 Ga0207703_10459513 3300026035 Bacteria 1190
601 Ga0207703_10500424 3300026035 Bacteria 1141
602 Ga0207703_10671087 3300026035 Bacteria 984
603 Ga0207639_10016682 3300026041 Bacteria 5201
604 Ga0207639_10055272 3300026041 Bacteria 3038
605 Ga0207639_10073439 3300026041 Bacteria 2681
606 Ga0207639_10077621 3300026041 Bacteria 2619
607 Ga0207639_10137895 3300026041 Bacteria 2028
608 Ga0207639_10195891 3300026041 Bacteria 1729
609 Ga0207639_10353287 3300026041 Bacteria 1313
610 Ga0207678_10149069 3300026067 Bacteria 1997
611 Ga0207678_10296442 3300026067 Bacteria 1389
612 Ga0207708_10000501 3300026075 Bacteria 30147
613 Ga0207708_10207758 3300026075 Bacteria 1564
614 Ga0207702_10000162 3300026078 Bacteria 79378
615 Ga0207702_10000968 3300026078 Bacteria 29412
616 Ga0207702_10132283 3300026078 Bacteria 2246
617 Ga0207702_10457169 3300026078 Bacteria 1239
618 Ga0207641_10057653 3300026088 Bacteria 3303
619 Ga0207641_10193705 3300026088 Bacteria 1870
620 Ga0207648_10001432 3300026089 Bacteria 26257
621 Ga0207648_10005188 3300026089 Bacteria 13192
622 Ga0207648_10036675 3300026089 Bacteria 4319
623 Ga0207648_10292990 3300026089 Bacteria 1457
624 Ga0207648_10589323 3300026089 Bacteria 1024
625 Ga0207676_10019578 3300026095 Bacteria 4940
626 Ga0207676_10709918 3300026095 Bacteria 975
627 Ga0207676_11140083 3300026095 Bacteria 772
628 Ga0207674_10001803 3300026116 Bacteria 27309
629 Ga0207674_10024874 3300026116 Bacteria 6391
630 Ga0207674_10118532 3300026116 Bacteria 2617
631 Ga0207674_10134150 3300026116 Bacteria 2439
632 Ga0207674_10212751 3300026116 Bacteria 1882
633 Ga0207674_10247344 3300026116 Bacteria 1730
634 Ga0207674_10516724 3300026116 Bacteria 1153
635 Ga0207675_100056924 3300026118 Bacteria 3647
636 Ga0207675_101446195 3300026118 Bacteria 708
637 Ga0207683_10009458 3300026121 Bacteria 8304
638 Ga0207683_10022706 3300026121 Bacteria 5388
639 Ga0207683_10036115 3300026121 Bacteria 4300
640 Ga0207683_10039431 3300026121 Bacteria 4121
641 Ga0207683_10314883 3300026121 Bacteria 1433
642 Ga0207698_10010897 3300026142 Bacteria 5870
643 Ga0207698_10126692 3300026142 Bacteria 2173
644 Ga0207698_10193483 3300026142 Bacteria 1814
645 Ga0207698_10248102 3300026142 Bacteria 1627
646 Ga0207698_10439059 3300026142 Bacteria 1257
647 Ga0207698_10535344 3300026142 Bacteria 1145
648 Ga0209967_1043533 3300027364 Unclassified 684
649 Ga0209971_1038559 3300027682 Bacteria 1150
650 Ga0209966_1024496 3300027695 Bacteria 1192
651 Ga0209974_10076755 3300027876 Bacteria 1145
652 Ga0268266_10000727 3300028379 Bacteria 44221
653 Ga0268266_10028641 3300028379 Bacteria 4733
654 Ga0268266_10043109 3300028379 Bacteria 3855
655 Ga0268266_10044647 3300028379 Bacteria 3788
656 Ga0268266_10074627 3300028379 Bacteria 2945
657 Ga0268266_10131540 3300028379 Bacteria 2238
658 Ga0268266_10446783 3300028379 Bacteria 1228
659 Ga0268266_10626965 3300028379 Bacteria 1034
660 Ga0268265_10270752 3300028380 Bacteria 1515
661 Ga0268265_10381203 3300028380 Bacteria 1297
662 Ga0268264_10100852 3300028381 Bacteria 2508
663 Ga0268264_10133970 3300028381 Bacteria 2201
664 Ga0265334_10005599 3300028573 Bacteria 5487
665 Ga0265318_10000015 3300028577 Bacteria 187234
666 Ga0265318_10000872 3300028577 Bacteria 19744
667 Ga0265338_10000005 3300028800 Bacteria 571137
668 Ga0265338_10004191 3300028800 Bacteria 19669
669 Ga0265338_10008175 3300028800 Bacteria 12757
670 Ga0265338_10018409 3300028800 Bacteria 7477
671 Ga0265338_10052693 3300028800 Bacteria 3647
672 Ga0265338_10056099 3300028800 Bacteria 3498
673 Ga0265338_10108372 3300028800 Bacteria 2244
674 Ga0265330_10011357 3300031235 Bacteria 4180
675 Ga0265330_10030909 3300031235 Bacteria 2401
676 Ga0265330_10037460 3300031235 Bacteria 2159
677 Ga0265330_10069314 3300031235 Bacteria 1527
678 Ga0265330_10071669 3300031235 Bacteria 1499
679 Ga0265332_10022558 3300031238 Bacteria 2777
680 Ga0265332_10118697 3300031238 Bacteria 1111
681 Ga0265328_10109533 3300031239 Bacteria 1026
682 Ga0265328_10153680 3300031239 Bacteria 866
683 Ga0265320_10000561 3300031240 Bacteria 28649
684 Ga0265325_10000005 3300031241 Bacteria 321343
685 Ga0265325_10000152 3300031241 Bacteria 49062
686 Ga0265325_10000677 3300031241 Bacteria 24870
687 Ga0265325_10002084 3300031241 Bacteria 13686
688 Ga0265325_10002415 3300031241 Bacteria 12617
689 Ga0265325_10019652 3300031241 Bacteria 3731
690 Ga0265325_10026697 3300031241 Bacteria 3126
691 Ga0265329_10044151 3300031242 Bacteria 1425
692 Ga0265340_10037526 3300031247 Bacteria 2400
693 Ga0265340_10056824 3300031247 Bacteria 1882
694 Ga0265340_10162018 3300031247 Bacteria 1016
695 Ga0265339_10000502 3300031249 Bacteria 30556
696 Ga0265339_10001940 3300031249 Bacteria 15206
697 Ga0265339_10007789 3300031249 Bacteria 6884
698 Ga0265339_10019156 3300031249 Bacteria 4020
699 Ga0265339_10083894 3300031249 Bacteria 1680
700 Ga0265339_10087047 3300031249 Bacteria 1643
701 Ga0265339_10186607 3300031249 Bacteria 1030
702 Ga0265331_10000003 3300031250 Bacteria 499358
703 Ga0265331_10009003 3300031250 Bacteria 5640
704 Ga0265331_10009982 3300031250 Bacteria 5281
705 Ga0265331_10018685 3300031250 Bacteria 3589
706 Ga0265331_10039445 3300031250 Bacteria 2303
707 Ga0265327_10096734 3300031251 Bacteria 1431
708 Ga0265316_10021107 3300031344 Bacteria 5526
709 Ga0265316_10105906 3300031344 Bacteria 2133
710 Ga0265316_10187611 3300031344 Bacteria 1537
711 Ga0265316_10474444 3300031344 Bacteria 896
712 Ga0265313_10000482 3300031595 Bacteria 41863
713 Ga0265313_10000570 3300031595 Bacteria 38442
714 Ga0265313_10002814 3300031595 Bacteria 14667
715 Ga0265313_10026643 3300031595 Bacteria 3041
716 Ga0265313_10045567 3300031595 Bacteria 2134
717 Ga0265313_10055647 3300031595 Bacteria 1873
718 Ga0265313_10074128 3300031595 Bacteria 1561
719 Ga0265313_10079792 3300031595 Bacteria 1489
720 Ga0265314_10001066 3300031711 Bacteria 31856
721 Ga0265314_10003381 3300031711 Bacteria 15464
722 Ga0265314_10004545 3300031711 Bacteria 12813
723 Ga0265314_10023618 3300031711 Bacteria 4683
724 Ga0265314_10049532 3300031711 Bacteria 2940
725 Ga0265314_10054751 3300031711 Bacteria 2759
726 Ga0265314_10055351 3300031711 Bacteria 2739
727 Ga0265314_10221817 3300031711 Bacteria 1103
728 Ga0265342_10002934 3300031712 Bacteria 14342
729 Ga0265342_10021457 3300031712 Bacteria 4123
730 Ga0265342_10029577 3300031712 Bacteria 3401
731 Ga0265342_10049352 3300031712 Bacteria 2518
732 Ga0265342_10076600 3300031712 Bacteria 1939
733 Ga0307407_10847211 3300031903 Bacteria 698
734 Ga0307409_100975111 3300031995 Bacteria 865
735 Ga0307416_100191990 3300032002 Bacteria 1927
736 Ga0373926_0008616 3300035083 Bacteria 3395
737 Ga0373926_0029010 3300035083 Bacteria 1944
738 Ga0373928_0022834 3300035084 Bacteria 1330
739 Ga0373951_0027575 3300035091 Bacteria 1327
740 Ga0373923_0023853 3300035111 Bacteria 2411
741 Ga0373932_0013397 3300035112 Bacteria 2039
742 Ga0373939_0016746 3300035114 Bacteria 1937
743 Ga0373953_0114353 3300035117 Bacteria 1143
744 Ga0373954_0063119 3300035118 Bacteria 1751
745 Ga0373956_0102767 3300035119 Bacteria 1327
746 Ga0373960_0107056 3300035121 Bacteria 913
747 Ga0373943_0373096 3300035170 Bacteria 820
748 Ga0373946_0129359 3300035171 Bacteria 1160
749 Ga0373955_0179903 3300035172 Bacteria 1254
750 Ga0373961_0219399 3300035241 Bacteria 677
751 Ga0373962_0144071 3300035242 Bacteria 776
752 Ga0373924_0011821 3300035410 Bacteria 3249
753 Ga0373931_0056582 3300035691 Bacteria 2102
754 Ga0373935_0214416 3300035692 Bacteria 1335
755 Ga0373935_0226359 3300035692 Bacteria 1301
756 Ga0373927_0181952 3300035695 Bacteria 1379
757 Ga0373927_0190902 3300035695 Bacteria 1344
758 Ga0373933_0042520 3300035724 Bacteria 2686
759 Ga0373947_0053664 3300035725 Bacteria 2431
760 Ga0373937_0013567 3300036401 Bacteria 7178
761 Ga0373937_0020864 3300036401 Bacteria 5876
762 Ga0373937_0021346 3300036401 Bacteria 5812
763 Ga0373937_0080289 3300036401 Bacteria 3016
764 Ga0373937_0268496 3300036401 Bacteria 1610
765 Ga0373937_0972861 3300036401 Bacteria 797
766 Ga0373937_1772822 3300036401 Bacteria 564
767 Ga0316582_0237154 3300036647 Bacteria 1249
768 Ga0373925_0023782 3300037068 Bacteria 4469
769 Ga0373925_0257681 3300037068 Bacteria 1401
770 Ga0373925_0341179 3300037068 Bacteria 1215
771 Ga0395899_0084530 3300037312 Bacteria 2307
772 Ga0395900_0000121 3300037418 Bacteria 135026
773 Ga0395900_0054045 3300037418 Bacteria 4134
774 Ga0395900_0057587 3300037418 Bacteria 4001
775 Ga0395898_0000247 3300037466 Bacteria 135026
776 Ga0395898_0023177 3300037466 Bacteria 6275
777 Ga0395898_0034335 3300037466 Bacteria 5056
778 Ga0395905_0000112 3300037471 Bacteria 135010
779 Ga0436364_0663275 3300037853 Bacteria 97909
780 Ga0395901_0000078 3300038443 Bacteria 135026
781 Ga0395901_0016245 3300038443 Bacteria 7583
782 Ga0395901_0065872 3300038443 Bacteria 3773
783 Ga0395901_0419069 3300038443 Bacteria 1373
784 Ga0395901_1237521 3300038443 Bacteria 711
785 Ga0436365_0486415 3300039437 Bacteria 766
786 Ga0436365_0614371 3300039437 Bacteria 2623
787 Ga0436365_0927245 3300039437 Bacteria 3550
788 Ga0436365_0967687 3300039437 Bacteria 706
789 Ga0436365_1138142 3300039437 Bacteria 8488
790 Ga0436365_1452608 3300039437 Bacteria 67441
791 Ga0436365_1605052 3300039437 Bacteria 982
792 Ga0436360_0692893 3300039438 Bacteria 729
793 Ga0436361_0936313 3300039447 Bacteria 1004
794 Ga0436363_0301167 3300039450 Bacteria 7985
795 Ga0436363_0549865 3300039450 Bacteria 9549
796 Ga0436363_1705146 3300039450 Bacteria 649
797 Ga0436362_0032378 3300039453 Bacteria 783
798 Ga0436362_0275172 3300039453 Bacteria 742
799 Ga0436362_0381121 3300039453 Bacteria 1879
800 Ga0439465_0094628 3300041413 Bacteria 1026
801 Ga0439465_0148015 3300041413 Bacteria 837
802 Ga0451793_1380469 3300041452 Bacteria 2071
803 Ga0451849_0253183 3300041505 Bacteria 552
804 Ga0439450_046867 3300042008 Bacteria 1018
805 Ga0453683_0338949 3300044673 Bacteria 965
806 Ga0466963_0313952 3300044694 Bacteria 1103
807 Ga0466957_0908882 3300044842 Bacteria 629
808 Ga0466967_0096885 3300045976 Bacteria 2692
809 Ga0495592_0086004 3300046454 Bacteria 2266
810 Ga0495592_0828232 3300046454 Bacteria 548
811 Ga0495651_0182713 3300046462 Bacteria 1483
812 Ga0495651_0499681 3300046462 Bacteria 779
813 Ga0495580_0036356 3300046472 Bacteria 3536
814 Ga0495664_0050052 3300046477 Bacteria 2480
815 Ga0495664_0195513 3300046477 Bacteria 1226
816 Ga0495585_0126074 3300046492 Bacteria 1350
817 Ga0495594_0031170 3300046499 Bacteria 2890
818 Ga0495606_0101767 3300046507 Bacteria 1748
819 Ga0495606_0189771 3300046507 Bacteria 1179
820 Ga0495630_0323437 3300046517 Bacteria 1179
821 Ga0495630_0325260 3300046517 Bacteria 1176
822 Ga0495648_0158654 3300046524 Bacteria 1172
823 Ga0495652_0020474 3300046529 Bacteria 5882
824 Ga0495652_0046154 3300046529 Bacteria 3742
825 Ga0495654_0120222 3300046530 Bacteria 1190
826 Ga0495609_0049525 3300046538 Bacteria 1875
827 Ga0495621_0111769 3300046539 Bacteria 1048
828 Ga0495645_0005420 3300046543 Bacteria 8750
829 Ga0495645_0210510 3300046543 Bacteria 1313
830 Ga0495645_0645395 3300046543 Bacteria 647
831 Ga0495622_0006812 3300046557 Bacteria 5303
832 Ga0495667_0184719 3300046559 Bacteria 1337
833 Ga0495656_0400355 3300046615 Bacteria 718
834 Ga0495611_0123408 3300046648 Bacteria 1208
835 Ga0495625_0377789 3300046660 Bacteria 890
836 Ga0495625_0398831 3300046660 Bacteria 860
837 Ga0495661_0225139 3300046665 Bacteria 970
838 Ga0495599_0311481 3300046678 Bacteria 949
839 Ga0495647_0380959 3300046681 Bacteria 646
840 Ga0495658_0133200 3300046683 Bacteria 1515
841 Ga0495669_0174976 3300046684 Bacteria 1022
842 Ga0495671_0104887 3300046692 Bacteria 1381
843 Ga0495600_0176460 3300046809 Bacteria 1378
844 Ga0495600_0232828 3300046809 Bacteria 1176
845 Ga0495581_0057001 3300047315 Bacteria 2255
846 Ga0495672_0180190 3300047320 Bacteria 1071
847 Ga0495672_0296241 3300047320 Bacteria 768
848 Ga0495676_0344514 3300047321 Bacteria 997
849 Ga0495680_0059220 3300047322 Unclassified 2958
850 Ga0495675_0085347 3300047444 Bacteria 1985
851 Ga0495675_0496830 3300047444 Bacteria 701
852 Ga0495686_0177102 3300047472 Bacteria 1237
853 Ga0495602_0094173 3300048088 Bacteria 2476
854 Ga0495602_0167787 3300048088 Bacteria 1707
855 Ga0495602_0433811 3300048088 Bacteria 930
856 Ga0495614_0017825 3300048089 Bacteria 3081
857 Ga0496101_0759572 3300048904 Bacteria 765
858 Ga0496104_0052920 3300048907 Bacteria 3835
859 Ga0496106_0363396 3300048909 Bacteria 1163
860 Ga0496107_0184626 3300048910 Bacteria 1549
861 Ga0496107_0784063 3300048910 Bacteria 698
862 Ga0496110_0672361 3300048913 Bacteria 936
863 Ga0496111_0609148 3300048914 Bacteria 799
864 Ga0496115_0609756 3300048918 Bacteria 867
865 Ga0496121_0001453 3300048924 Bacteria 40007
866 Ga0496121_0044835 3300048924 Bacteria 3808
867 Ga0496126_0000382 3300048929 Bacteria 91611
868 Ga0496126_0029741 3300048929 Bacteria 5186
869 Ga0496126_0181034 3300048929 Bacteria 1790
870 Ga0495682_0002697 3300049460 Bacteria 8248
871 Ga0495682_0069490 3300049460 Bacteria 1268
872 Ga0501031_0003938 3300049568 Bacteria 9562
873 Ga0501031_0004180 3300049568 Bacteria 9325
874 Ga0501031_0012359 3300049568 Bacteria 5568
875 Ga0501031_0013123 3300049568 Bacteria 5405
876 Ga0501031_0187276 3300049568 Bacteria 1352
877 Ga0501031_0640144 3300049568 Bacteria 683
878 Ga0501032_0000117 3300049569 Bacteria 67270
879 Ga0501032_0002879 3300049569 Bacteria 13385
880 Ga0501032_0014058 3300049569 Bacteria 5678
881 Ga0501032_0062165 3300049569 Bacteria 2502
882 Ga0501032_0067117 3300049569 Bacteria 2397
883 Ga0501032_0107602 3300049569 Bacteria 1846
884 Ga0501032_0172421 3300049569 Bacteria 1418
885 Ga0501032_0189848 3300049569 Bacteria 1343
886 Ga0501033_0000224 3300049570 Bacteria 54346
887 Ga0501033_0010846 3300049570 Bacteria 6987
888 Ga0501033_0017525 3300049570 Bacteria 5411
889 Ga0501033_0019935 3300049570 Bacteria 5068
890 Ga0501033_0022889 3300049570 Bacteria 4710
891 Ga0501033_0032973 3300049570 Bacteria 3889
892 Ga0501033_0037348 3300049570 Bacteria 3636
893 Ga0501033_0072928 3300049570 Bacteria 2520
894 Ga0501033_0112221 3300049570 Bacteria 1983
895 Ga0501033_0143427 3300049570 Bacteria 1726
896 Ga0501033_0206367 3300049570 Bacteria 1402
897 Ga0501033_0207890 3300049570 Bacteria 1396
898 Ga0501033_0380446 3300049570 Bacteria 986
899 Ga0501033_0673697 3300049570 Bacteria 705
900 Ga0501034_0008004 3300049571 Bacteria 11219
901 Ga0501034_0024746 3300049571 Bacteria 6108
902 Ga0501034_0028875 3300049571 Bacteria 5641
903 Ga0501034_0037159 3300049571 Bacteria 4931
904 Ga0501034_0050752 3300049571 Bacteria 4184
905 Ga0501034_0061665 3300049571 Bacteria 3765
906 Ga0501034_0199220 3300049571 Bacteria 1961
907 Ga0501034_0200241 3300049571 Bacteria 1955
908 Ga0501034_0292398 3300049571 Bacteria 1567
909 Ga0501034_0532761 3300049571 Bacteria 1085
910 Ga0501034_0686318 3300049571 Bacteria 923
911 Ga0501036_0000645 3300049572 Bacteria 25508
912 Ga0501036_0001707 3300049572 Bacteria 17065
913 Ga0501036_0009086 3300049572 Bacteria 8175
914 Ga0501036_0025013 3300049572 Bacteria 5035
915 Ga0501036_0063277 3300049572 Bacteria 3133
916 Ga0501036_0092119 3300049572 Bacteria 2560
917 Ga0501036_0164352 3300049572 Bacteria 1871
918 Ga0501036_0173519 3300049572 Bacteria 1816
919 Ga0501036_0280048 3300049572 Bacteria 1396
920 Ga0501036_0298255 3300049572 Bacteria 1348
921 Ga0501036_0349735 3300049572 Bacteria 1234
922 Ga0501036_0519650 3300049572 Bacteria 990
923 Ga0501036_0678094 3300049572 Bacteria 852
924 Ga0501037_0001126 3300049573 Bacteria 19773
925 Ga0501037_0001908 3300049573 Bacteria 15140
926 Ga0501037_0010046 3300049573 Bacteria 6943
927 Ga0501037_0019872 3300049573 Bacteria 4957
928 Ga0501037_0061859 3300049573 Bacteria 2730
929 Ga0501037_0063198 3300049573 Bacteria 2699
930 Ga0501037_0067245 3300049573 Bacteria 2609
931 Ga0501037_0109154 3300049573 Bacteria 1994
932 Ga0501037_0307621 3300049573 Bacteria 1099
933 Ga0501037_0416019 3300049573 Bacteria 920
934 Ga0501037_0426827 3300049573 Bacteria 907
935 Ga0501037_0544375 3300049573 Bacteria 784
936 Ga0501037_0610963 3300049573 Bacteria 731
937 Ga0501038_0000260 3300049574 Bacteria 44473
938 Ga0501038_0004396 3300049574 Bacteria 13117
939 Ga0501038_0025758 3300049574 Bacteria 5239
940 Ga0501038_0037442 3300049574 Bacteria 4253
941 Ga0501038_0039711 3300049574 Bacteria 4116
942 Ga0501038_0078159 3300049574 Bacteria 2792
943 Ga0501038_0219310 3300049574 Bacteria 1518
944 Ga0501038_0254597 3300049574 Bacteria 1389
945 Ga0501039_0000048 3300049575 Bacteria 102012
946 Ga0501039_0001573 3300049575 Bacteria 16801
947 Ga0501039_0002950 3300049575 Bacteria 12734
948 Ga0501039_0019696 3300049575 Bacteria 5173
949 Ga0501039_0123889 3300049575 Bacteria 2026
950 Ga0501039_0170126 3300049575 Bacteria 1713
951 Ga0501039_0273285 3300049575 Bacteria 1328
952 Ga0501039_0361986 3300049575 Bacteria 1140
953 Ga0501039_0362359 3300049575 Bacteria 1139
954 Ga0501040_0021591 3300049576 Bacteria 4302
955 Ga0501040_0136817 3300049576 Bacteria 1725
956 Ga0501042_0011142 3300049578 Bacteria 6058
957 Ga0501042_0138532 3300049578 Bacteria 1754
958 Ga0501043_0000068 3300049579 Bacteria 93023
959 Ga0501043_0026773 3300049579 Bacteria 4524
960 Ga0501043_0044199 3300049579 Bacteria 3502
961 Ga0501043_0047734 3300049579 Bacteria 3366
962 Ga0501043_0048058 3300049579 Bacteria 3354
963 Ga0501043_0103614 3300049579 Bacteria 2236
964 Ga0501043_0163121 3300049579 Bacteria 1741
965 Ga0501043_0301665 3300049579 Bacteria 1224
966 Ga0501043_0326996 3300049579 Bacteria 1168
967 Ga0501043_0441265 3300049579 Bacteria 979
968 Ga0501043_0593469 3300049579 Bacteria 819
969 Ga0501043_0600199 3300049579 Bacteria 813
970 Ga0501043_0610812 3300049579 Bacteria 804
971 Ga0501046_0006278 3300049580 Bacteria 10541
972 Ga0501046_0022323 3300049580 Bacteria 5213
973 Ga0501046_0070115 3300049580 Bacteria 2726
974 Ga0501046_0232626 3300049580 Bacteria 1361
975 Ga0501046_0383458 3300049580 Bacteria 1017
976 Ga0501046_0464146 3300049580 Bacteria 910
977 Ga0501047_0000350 3300049581 Bacteria 52125
978 Ga0501047_0006414 3300049581 Bacteria 11068
979 Ga0501047_0007287 3300049581 Bacteria 10398
980 Ga0501047_0010032 3300049581 Bacteria 8955
981 Ga0501047_0014477 3300049581 Bacteria 7501
982 Ga0501047_0031326 3300049581 Bacteria 5128
983 Ga0501047_0040472 3300049581 Bacteria 4507
984 Ga0501047_0042551 3300049581 Bacteria 4389
985 Ga0501047_0051089 3300049581 Bacteria 3993
986 Ga0501047_0074045 3300049581 Bacteria 3278
987 Ga0501047_0098142 3300049581 Bacteria 2808
988 Ga0501047_0119626 3300049581 Bacteria 2516
989 Ga0501047_0191966 3300049581 Bacteria 1905
990 Ga0501047_0291916 3300049581 Bacteria 1474
991 Ga0501047_0384712 3300049581 Bacteria 1237
992 Ga0501048_0003926 3300049582 Bacteria 11295
993 Ga0501048_0161932 3300049582 Bacteria 1584
994 Ga0501048_1069590 3300049582 Bacteria 580
995 Ga0501067_0001121 3300049583 Bacteria 14495
996 Ga0501067_0003131 3300049583 Bacteria 9134
997 Ga0501067_0003792 3300049583 Bacteria 8332
998 Ga0501067_0063293 3300049583 Bacteria 2048
999 Ga0501067_0179524 3300049583 Bacteria 1179
1000 Ga0501067_0731585 3300049583 Bacteria 556
1001 Ga0501068_0050794 3300049584 Bacteria 2507
1002 Ga0501068_0086933 3300049584 Bacteria 1925
1003 Ga0501068_0093919 3300049584 Bacteria 1853
1004 Ga0501068_0102015 3300049584 Bacteria 1779
1005 Ga0501068_0413033 3300049584 Bacteria 871
1006 Ga0501069_0009173 3300049585 Bacteria 5221
1007 Ga0501069_0352436 3300049585 Bacteria 867
1008 Ga0501070_0000002 3300049586 Bacteria 347524
1009 Ga0501070_0002559 3300049586 Bacteria 15917
1010 Ga0501070_0014075 3300049586 Bacteria 6734
1011 Ga0501070_0016697 3300049586 Bacteria 6165
1012 Ga0501070_0020814 3300049586 Bacteria 5503
1013 Ga0501070_0050257 3300049586 Bacteria 3461
1014 Ga0501070_0250203 3300049586 Bacteria 1450
1015 Ga0501070_0267641 3300049586 Bacteria 1396
1016 Ga0501070_0389186 3300049586 Bacteria 1129
1017 Ga0501070_0500798 3300049586 Bacteria 976
1018 Ga0501071_0012902 3300049587 Bacteria 5685
1019 Ga0501072_0004954 3300049588 Bacteria 10128
1020 Ga0501072_0078826 3300049588 Bacteria 2608
1021 Ga0501072_0085057 3300049588 Bacteria 2508
1022 Ga0501073_0000802 3300049589 Bacteria 22364
1023 Ga0501073_0022820 3300049589 Bacteria 4501
1024 Ga0501073_0052816 3300049589 Bacteria 2845
1025 Ga0501073_0068266 3300049589 Bacteria 2478
1026 Ga0501073_0086727 3300049589 Bacteria 2177
1027 Ga0501073_0092996 3300049589 Bacteria 2095
1028 Ga0501073_0196632 3300049589 Bacteria 1394
1029 Ga0501073_0220696 3300049589 Bacteria 1309
1030 Ga0501073_0379305 3300049589 Bacteria 977
1031 Ga0501073_0388685 3300049589 Bacteria 964
1032 Ga0501073_0705189 3300049589 Bacteria 696
1033 Ga0501074_0000138 3300049590 Bacteria 37896
1034 Ga0501074_0269797 3300049590 Bacteria 1210
1035 Ga0501074_0284959 3300049590 Bacteria 1174
1036 Ga0501076_0174028 3300049592 Bacteria 1755
1037 Ga0501079_0007294 3300049741 Bacteria 8348
1038 Ga0501079_0034048 3300049741 Bacteria 3918
1039 Ga0501079_0313156 3300049741 Bacteria 1228
1040 Ga0501079_1250523 3300049741 Bacteria 585
1041 Ga0501080_0001693 3300049742 Bacteria 18802
1042 Ga0501080_0008063 3300049742 Bacteria 9546
1043 Ga0501080_0029788 3300049742 Bacteria 5080
1044 Ga0501080_0043004 3300049742 Bacteria 4206
1045 Ga0501080_0050191 3300049742 Bacteria 3884
1046 Ga0501080_0135809 3300049742 Bacteria 2276
1047 Ga0501080_0235095 3300049742 Bacteria 1674
1048 Ga0501080_0270235 3300049742 Bacteria 1547
1049 Ga0501080_0535621 3300049742 Bacteria 1044
1050 Ga0501080_0565136 3300049742 Bacteria 1012
1051 Ga0501080_0899462 3300049742 Bacteria 772
1052 Ga0501083_0011493 3300049744 Bacteria 6212
1053 Ga0501083_0013979 3300049744 Bacteria 5609
1054 Ga0501083_0138112 3300049744 Bacteria 1596
1055 Ga0501266_037571 3300049763 Bacteria 711
1056 Ga0501035_0001988 3300049822 Bacteria 20436
1057 Ga0501035_0006141 3300049822 Bacteria 11309
1058 Ga0501035_0012091 3300049822 Bacteria 7980
1059 Ga0501035_0017376 3300049822 Bacteria 6632
1060 Ga0501035_0027566 3300049822 Bacteria 5191
1061 Ga0501035_0027849 3300049822 Bacteria 5163
1062 Ga0501035_0028741 3300049822 Bacteria 5073
1063 Ga0501035_0069115 3300049822 Bacteria 3131
1064 Ga0501035_0093049 3300049822 Bacteria 2652
1065 Ga0501035_0140601 3300049822 Bacteria 2099
1066 Ga0501035_0184043 3300049822 Bacteria 1798
1067 Ga0501035_0202359 3300049822 Bacteria 1702
1068 Ga0501035_0260713 3300049822 Bacteria 1469
1069 Ga0501035_0348031 3300049822 Bacteria 1240
1070 Ga0501035_0353356 3300049822 Bacteria 1229
1071 Ga0501035_0744250 3300049822 Bacteria 787
1072 Ga0501035_0948049 3300049822 Bacteria 679
1073 Ga0501044_0011515 3300049823 Bacteria 9583
1074 Ga0501044_0014733 3300049823 Bacteria 8430
1075 Ga0501044_0016840 3300049823 Bacteria 7841
1076 Ga0501044_0021535 3300049823 Bacteria 6875
1077 Ga0501044_0030091 3300049823 Bacteria 5722
1078 Ga0501044_0032482 3300049823 Bacteria 5487
1079 Ga0501044_0034767 3300049823 Bacteria 5282
1080 Ga0501044_0037156 3300049823 Bacteria 5091
1081 Ga0501044_0049845 3300049823 Bacteria 4322
1082 Ga0501044_0053423 3300049823 Bacteria 4156
1083 Ga0501044_0072533 3300049823 Bacteria 3500
1084 Ga0501044_0117640 3300049823 Bacteria 2661
1085 Ga0501044_0119373 3300049823 Bacteria 2639
1086 Ga0501044_0240256 3300049823 Bacteria 1755
1087 Ga0501044_0357186 3300049823 Bacteria 1379
1088 Ga0501044_0750484 3300049823 Bacteria 858
1089 Ga0501044_1075119 3300049823 Bacteria 674
1090 Ga0501045_0017914 3300049824 Bacteria 5029
1091 Ga0501045_0017987 3300049824 Bacteria 5019
1092 Ga0501045_0154162 3300049824 Bacteria 1709
1093 Ga0501045_0177978 3300049824 Bacteria 1585
1094 Ga0501045_0215602 3300049824 Bacteria 1429
1095 nmdc:mga03683_162589_c1 3300050489 Bacteria 1012
1096 nmdc:mga07m45_268286_c1 3300050496 Bacteria 993
1097 nmdc:mga05p37_452954_c1 3300050507 Bacteria 1485
1098 nmdc:mga0n895_300949_c1 3300050512 Bacteria 1626
1099 nmdc:mga0n895_36670_c1 3300050512 Bacteria 4736
1100 nmdc:mga0rr50_215713_c1 3300050513 Bacteria 1583
1101 nmdc:mga08x19_2099_c1 3300050514 Bacteria 12187
1102 nmdc:mga08x19_394_c1 3300050514 Bacteria 30675
1103 nmdc:mga0a205_7816_c1 3300050515 Bacteria 9711
1104 Ga0495601_0035675 3300053077 Bacteria 3105
1105 Ga0495601_0038799 3300053077 Bacteria 2979
1106 Ga0495595_0086836 3300053084 Bacteria 1497
1107 Ga0495595_0273956 3300053084 Bacteria 847
1108 Ga0495619_0087981 3300053085 Bacteria 2101
1109 Ga0500643_000003 3300053087 Bacteria 876659
1110 Ga0500644_0169748 3300053088 Bacteria 887
1111 Ga0500641_0103602 3300053096 Bacteria 1222
1112 Ga0500592_007559 3300053116 Bacteria 1728
1113 Ga0500595_000573 3300053119 Bacteria 21954
1114 Ga0500595_012715 3300053119 Bacteria 3246
1115 Ga0500595_021796 3300053119 Bacteria 2281
1116 Ga0500655_006821 3300053133 Bacteria 2057
1117 Ga0500655_039624 3300053133 Bacteria 922
1118 Ga0500559_0029710 3300053136 Bacteria 2342
1119 Ga0500568_0070385 3300053139 Bacteria 1340
1120 Ga0500568_0109710 3300053139 Bacteria 1032
1121 Ga0500573_0000008 3300053140 Bacteria 237795
1122 Ga0500604_0056627 3300053151 Bacteria 1222
1123 Ga0500627_0074816 3300053158 Bacteria 1504
1124 Ga0500639_055717 3300053163 Bacteria 2049
1125 Ga0500611_057157 3300053727 Bacteria 912
1126 Ga0500611_141558 3300053727 Bacteria 655
1127 Ga0501084_0000017 3300054114 Bacteria 148659
1128 Ga0501084_0001765 3300054114 Bacteria 17203
1129 Ga0501084_0005496 3300054114 Bacteria 10403
1130 Ga0501084_0061900 3300054114 Bacteria 3134
1131 Ga0501082_0009503 3300060353 Bacteria 8369
1132 Ga0501082_0111544 3300060353 Bacteria 2367
1133 Ga0501082_0175133 3300060353 Bacteria 1865
1134 Ga0501082_0336220 3300060353 Bacteria 1316
1135 Ga0501082_0444301 3300060353 Bacteria 1133

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027364 Ga0209967_1043533 Ga0209967_10435331 149
2 3300027876 Ga0209974_10076755 Ga0209974_100767552 149
3 3300049572 Ga0501036_0092119 Ga0501036_0092119_1821_2384 149
4 3300049575 Ga0501039_0361986 Ga0501039_0361986_541_1104 149
5 3300049576 Ga0501040_0021591 Ga0501040_0021591_3319_3882 149
6 3300049588 Ga0501072_0078826 Ga0501072_0078826_1694_2257 149
7 3300049589 Ga0501073_0379305 Ga0501073_0379305_380_943 149
8 3300049741 Ga0501079_0313156 Ga0501079_0313156_95_658 149
9 3300049824 Ga0501045_0154162 Ga0501045_0154162_813_1376 149
10 3300060353 Ga0501082_0175133 Ga0501082_0175133_22_585 149
11 3300005330 Ga0070690_100000126 Ga0070690_10000012616 150
12 3300005336 Ga0070680_100015474 Ga0070680_1000154747 150
13 3300005340 Ga0070689_100000031 Ga0070689_10000003194 150
14 3300005341 Ga0070691_10252595 Ga0070691_102525952 150
15 3300005365 Ga0070688_100000054 Ga0070688_10000005416 150
16 3300005438 Ga0070701_10000100 Ga0070701_100001007 150
17 3300005440 Ga0070705_100804942 Ga0070705_1008049422 150
18 3300005441 Ga0070700_100000470 Ga0070700_1000004702 150
19 3300005444 Ga0070694_100030134 Ga0070694_1000301344 150
20 3300005444 Ga0070694_100088311 Ga0070694_1000883111 150
21 3300005457 Ga0070662_100711103 Ga0070662_1007111031 150
22 3300005459 Ga0068867_100004275 Ga0068867_1000042757 150
23 3300005466 Ga0070685_10000160 Ga0070685_1000016032 150
24 3300005544 Ga0070686_100000246 Ga0070686_10000024618 150
25 3300005545 Ga0070695_100331313 Ga0070695_1003313132 150
26 3300005545 Ga0070695_100907232 Ga0070695_1009072321 150
27 3300005617 Ga0068859_100001428 Ga0068859_10000142813 150
28 3300005719 Ga0068861_100055611 Ga0068861_1000556113 150
29 3300006931 Ga0097620_100001428 Ga0097620_10000142813 150
30 3300009177 Ga0105248_10003105 Ga0105248_1000310518 150
31 3300009551 Ga0105238_10199543 Ga0105238_101995432 150
32 3300013308 Ga0157375_10813835 Ga0157375_108138352 150
33 3300025918 Ga0207662_10225933 Ga0207662_102259331 150
34 3300025924 Ga0207694_10710637 Ga0207694_107106372 150
35 3300025936 Ga0207670_10000040 Ga0207670_1000004065 150
36 3300025941 Ga0207711_10002043 Ga0207711_100020432 150
37 3300026075 Ga0207708_10000501 Ga0207708_1000050120 150
38 3300026075 Ga0207708_10207758 Ga0207708_102077582 150
39 3300026089 Ga0207648_10001432 Ga0207648_1000143224 150
40 3300026118 Ga0207675_100056924 Ga0207675_1000569243 150
41 3300027682 Ga0209971_1038559 Ga0209971_10385592 150
42 3300027695 Ga0209966_1024496 Ga0209966_10244962 150
43 3300005354 Ga0070675_100092368 Ga0070675_1000923682 151
44 3300005458 Ga0070681_10002305 Ga0070681_1000230521 151
45 3300005467 Ga0070706_100233828 Ga0070706_1002338282 151
46 3300005468 Ga0070707_100000795 Ga0070707_10000079522 151
47 3300005471 Ga0070698_100086826 Ga0070698_1000868264 151
48 3300005530 Ga0070679_100767822 Ga0070679_1007678222 151
49 3300005536 Ga0070697_100017581 Ga0070697_1000175816 151
50 3300005544 Ga0070686_100005266 Ga0070686_1000052663 151
51 3300005841 Ga0068863_100376847 Ga0068863_1003768472 151
52 3300006237 Ga0097621_100082443 Ga0097621_1000824431 151
53 3300009147 Ga0114129_10096743 Ga0114129_100967432 151
54 3300025921 Ga0207652_10702285 Ga0207652_107022852 151
55 3300025926 Ga0207659_10092082 Ga0207659_100920822 151
56 3300025936 Ga0207670_10278503 Ga0207670_102785031 151
57 3300026088 Ga0207641_10193705 Ga0207641_101937051 151
58 3300035083 Ga0373926_0008616 Ga0373926_0008616_488_1051 151
59 3300035117 Ga0373953_0114353 Ga0373953_0114353_490_1053 151
60 3300035170 Ga0373943_0373096 Ga0373943_0373096_213_776 151
61 3300035172 Ga0373955_0179903 Ga0373955_0179903_37_600 151
62 3300035410 Ga0373924_0011821 Ga0373924_0011821_1555_2118 151
63 3300035695 Ga0373927_0181952 Ga0373927_0181952_251_814 151
64 3300036401 Ga0373937_0080289 Ga0373937_0080289_2374_2937 151
65 3300046454 Ga0495592_0086004 Ga0495592_0086004_1498_2061 151
66 3300046517 Ga0495630_0323437 Ga0495630_0323437_139_702 151
67 3300046543 Ga0495645_0645395 Ga0495645_0645395_58_621 151
68 3300047315 Ga0495581_0057001 Ga0495581_0057001_1246_1809 151
69 3300048089 Ga0495614_0017825 Ga0495614_0017825_1662_2225 151
70 3300050507 nmdc:mga05p37_452954_c1 nmdc:mga05p37_452954_c1_440_1003 151
71 3300053084 Ga0495595_0086836 Ga0495595_0086836_571_1134 151
72 3300053084 Ga0495595_0273956 Ga0495595_0273956_58_621 151
73 3300005445 Ga0070708_100092567 Ga0070708_1000925672 152
74 3300005467 Ga0070706_100029873 Ga0070706_1000298735 152
75 3300005468 Ga0070707_100028615 Ga0070707_1000286153 152
76 3300005471 Ga0070698_100031139 Ga0070698_1000311394 152
77 3300005518 Ga0070699_100016157 Ga0070699_1000161573 152
78 3300005536 Ga0070697_100028331 Ga0070697_1000283312 152
79 3300006173 Ga0070716_100247188 Ga0070716_1002471882 152
80 3300009147 Ga0114129_11451837 Ga0114129_114518371 152
81 3300025905 Ga0207685_10034535 Ga0207685_100345352 152
82 3300025910 Ga0207684_10204397 Ga0207684_102043972 152
83 3300025910 Ga0207684_10386544 Ga0207684_103865442 152
84 3300025922 Ga0207646_10000283 Ga0207646_1000028372 152
85 3300025922 Ga0207646_10082035 Ga0207646_100820352 152
86 3300025939 Ga0207665_10404325 Ga0207665_104043252 152
87 3300037068 Ga0373925_0257681 Ga0373925_0257681_230_751 152
88 3300042008 Ga0439450_046867 Ga0439450_046867_256_819 152
89 3300044673 Ga0453683_0338949 Ga0453683_0338949_298_861 152
90 3300005345 Ga0070692_10552224 Ga0070692_105522241 153
91 3300050512 nmdc:mga0n895_36670_c1 nmdc:mga0n895_36670_c1_54_575 153
92 3300005440 Ga0070705_100705701 Ga0070705_1007057011 154
93 3300005444 Ga0070694_100539649 Ga0070694_1005396492 154
94 3300005545 Ga0070695_100689603 Ga0070695_1006896032 154
95 3300005546 Ga0070696_100042050 Ga0070696_1000420505 154
96 3300005549 Ga0070704_100074278 Ga0070704_1000742782 154
97 3300009553 Ga0105249_11160533 Ga0105249_111605332 154
98 3300009176 Ga0105242_10231009 Ga0105242_102310092 155
99 3300013297 Ga0157378_10299128 Ga0157378_102991282 155
100 3300025934 Ga0207686_10026081 Ga0207686_100260813 155
101 3300035118 Ga0373954_0063119 Ga0373954_0063119_931_1494 155
102 3300046499 Ga0495594_0031170 Ga0495594_0031170_957_1520 155
103 3300046683 Ga0495658_0133200 Ga0495658_0133200_632_1195 155
104 3300047321 Ga0495676_0344514 Ga0495676_0344514_91_654 155
105 3300047322 Ga0495680_0059220 Ga0495680_0059220_112_675 155
106 3300053077 Ga0495601_0038799 Ga0495601_0038799_1200_1763 155
107 3300053085 Ga0495619_0087981 Ga0495619_0087981_691_1254 155
108 3300013104 Ga0157370_10621503 Ga0157370_106215032 161
109 3300025937 Ga0207669_10442522 Ga0207669_104425221 161
110 3300014968 Ga0157379_10170072 Ga0157379_101700721 163
111 3300049582 Ga0501048_0161932 Ga0501048_0161932_32_565 163
112 3300049582 Ga0501048_1069590 Ga0501048_1069590_70_570 163
113 3300050515 nmdc:mga0a205_7816_c1 nmdc:mga0a205_7816_c1_6006_6527 163
114 3300013297 Ga0157378_10790370 Ga0157378_107903702 165
115 3300026095 Ga0207676_11140083 Ga0207676_111400832 165
116 3300039437 Ga0436365_0967687 Ga0436365_0967687_96_653 166
117 3300005336 Ga0070680_100201727 Ga0070680_1002017272 167
118 3300005458 Ga0070681_10933392 Ga0070681_109333921 167
119 3300005467 Ga0070706_100193031 Ga0070706_1001930312 167
120 3300005530 Ga0070679_100671190 Ga0070679_1006711901 167
121 3300005546 Ga0070696_100108866 Ga0070696_1001088662 167
122 3300005547 Ga0070693_100184665 Ga0070693_1001846652 167
123 3300006163 Ga0070715_10051465 Ga0070715_100514652 167
124 3300025905 Ga0207685_10040154 Ga0207685_100401542 167
125 3300025912 Ga0207707_10414169 Ga0207707_104141692 167
126 3300025917 Ga0207660_10074194 Ga0207660_100741943 167
127 3300039450 Ga0436363_0549865 Ga0436363_0549865_2153_2710 167
128 3300006175 Ga0070712_100000264 Ga0070712_10000026420 170
129 3300009174 Ga0105241_10750363 Ga0105241_107503632 170
130 3300014968 Ga0157379_10002800 Ga0157379_100028007 170
131 3300025910 Ga0207684_10358819 Ga0207684_103588192 170
132 3300025915 Ga0207693_10000242 Ga0207693_1000024241 170
133 3300025916 Ga0207663_10030668 Ga0207663_100306684 170
134 3300035121 Ga0373960_0107056 Ga0373960_0107056_21_542 170
135 3300035171 Ga0373946_0129359 Ga0373946_0129359_265_786 170
136 3300035695 Ga0373927_0190902 Ga0373927_0190902_550_1071 170
137 3300036401 Ga0373937_0972861 Ga0373937_0972861_248_769 170
138 3300036401 Ga0373937_1772822 Ga0373937_1772822_16_537 170
139 3300037068 Ga0373925_0023782 Ga0373925_0023782_2860_3381 170
140 3300039437 Ga0436365_1138142 Ga0436365_1138142_2935_3456 170
141 3300039453 Ga0436362_0381121 Ga0436362_0381121_596_1117 170
142 3300041505 Ga0451849_0253183 Ga0451849_0253183_10_531 170
143 3300046454 Ga0495592_0828232 Ga0495592_0828232_10_531 170
144 3300047320 Ga0495672_0296241 Ga0495672_0296241_230_751 170
145 3300047444 Ga0495675_0496830 Ga0495675_0496830_163_684 170
146 3300048088 Ga0495602_0433811 Ga0495602_0433811_21_542 170
147 3300048907 Ga0496104_0052920 Ga0496104_0052920_829_1350 170
148 3300048909 Ga0496106_0363396 Ga0496106_0363396_428_949 170
149 3300048910 Ga0496107_0184626 Ga0496107_0184626_952_1473 170
150 3300048913 Ga0496110_0672361 Ga0496110_0672361_86_607 170
151 3300048924 Ga0496121_0044835 Ga0496121_0044835_584_1105 170
152 3300049583 Ga0501067_0731585 Ga0501067_0731585_21_542 170
153 3300049589 Ga0501073_0705189 Ga0501073_0705189_139_660 170
154 3300049741 Ga0501079_1250523 Ga0501079_1250523_36_557 170
155 3300049823 Ga0501044_1075119 Ga0501044_1075119_139_660 170
156 3300053077 Ga0495601_0035675 Ga0495601_0035675_2403_2960 171
157 3300049568 Ga0501031_0012359 Ga0501031_0012359_1946_2512 172
158 3300049569 Ga0501032_0014058 Ga0501032_0014058_2658_3224 172
159 3300049572 Ga0501036_0001707 Ga0501036_0001707_6622_7188 172
160 3300049573 Ga0501037_0067245 Ga0501037_0067245_399_965 172
161 3300049574 Ga0501038_0025758 Ga0501038_0025758_2506_3072 172
162 3300049575 Ga0501039_0002950 Ga0501039_0002950_8179_8745 172
163 3300049579 Ga0501043_0026773 Ga0501043_0026773_3381_3947 172
164 3300049581 Ga0501047_0074045 Ga0501047_0074045_2174_2740 172
165 3300049584 Ga0501068_0050794 Ga0501068_0050794_905_1471 172
166 3300049586 Ga0501070_0014075 Ga0501070_0014075_2825_3391 172
167 3300049589 Ga0501073_0068266 Ga0501073_0068266_1081_1647 172
168 3300049822 Ga0501035_0184043 Ga0501035_0184043_694_1260 172
169 3300049823 Ga0501044_0357186 Ga0501044_0357186_539_1105 172
170 3300049824 Ga0501045_0215602 Ga0501045_0215602_570_1136 172
171 3300049569 Ga0501032_0107602 Ga0501032_0107602_1274_1810 175
172 3300049570 Ga0501033_0072928 Ga0501033_0072928_743_1279 175
173 3300049572 Ga0501036_0009086 Ga0501036_0009086_4634_5170 175
174 3300049572 Ga0501036_0349735 Ga0501036_0349735_52_588 175
175 3300049579 Ga0501043_0610812 Ga0501043_0610812_77_613 175
176 3300049580 Ga0501046_0383458 Ga0501046_0383458_394_930 175
177 3300049822 Ga0501035_0353356 Ga0501035_0353356_12_548 175
178 3300049823 Ga0501044_0014733 Ga0501044_0014733_6289_6825 175
179 3300049568 Ga0501031_0003938 Ga0501031_0003938_3544_4086 176
180 3300049573 Ga0501037_0010046 Ga0501037_0010046_6210_6752 176
181 3300049574 Ga0501038_0078159 Ga0501038_0078159_424_966 176
182 3300049575 Ga0501039_0123889 Ga0501039_0123889_426_968 176
183 3300049581 Ga0501047_0119626 Ga0501047_0119626_556_1098 176
184 3300049822 Ga0501035_0069115 Ga0501035_0069115_1920_2462 176
185 3300005340 Ga0070689_100409763 Ga0070689_1004097632 177
186 3300005544 Ga0070686_100302908 Ga0070686_1003029082 177
187 3300005545 Ga0070695_100033491 Ga0070695_1000334911 177
188 3300005549 Ga0070704_100077846 Ga0070704_1000778462 177
189 3300005617 Ga0068859_100949822 Ga0068859_1009498222 177
190 3300006852 Ga0075433_10061018 Ga0075433_100610182 177
191 3300006931 Ga0097620_100949685 Ga0097620_1009496852 177
192 3300025910 Ga0207684_10101036 Ga0207684_101010363 177
193 3300025922 Ga0207646_10541644 Ga0207646_105416442 177
194 3300039453 Ga0436362_0032378 Ga0436362_0032378_224_766 177
195 3300049571 Ga0501034_0532761 Ga0501034_0532761_401_961 177
196 3300049581 Ga0501047_0006414 Ga0501047_0006414_3786_4346 177
197 3300049583 Ga0501067_0003792 Ga0501067_0003792_5571_6131 177
198 3300049588 Ga0501072_0004954 Ga0501072_0004954_6638_7198 177
199 3300049589 Ga0501073_0092996 Ga0501073_0092996_1175_1735 177
200 3300049590 Ga0501074_0284959 Ga0501074_0284959_280_840 177
201 3300049742 Ga0501080_0050191 Ga0501080_0050191_1642_2202 177
202 3300054114 Ga0501084_0061900 Ga0501084_0061900_1335_1895 177
203 iso_pu_bacteria 2513237090 2513609839 177
204 iso_pu_bacteria 2643221550 2643773623 177
205 iso_pu_bacteria 2643221551 2643775690 177
206 iso_pu_bacteria 2643221555 2643794137 177
207 iso_pu_bacteria 2643221564 2643837371 177
208 iso_pu_bacteria 2643221623 2644132160 177
209 iso_pu_bacteria 2856349417 2856355782 177
210 iso_pu_bacteria 2871495908 2871500657 177
211 iso_pu_bacteria 2874102143 2874104444 177
212 iso_pu_bacteria 2876392853 2876395061 177
213 iso_pu_bacteria 2878760144 2878764746 177
214 iso_pu_bacteria 2878767105 2878771847 177
215 iso_pu_bacteria 2881155292 2881156015 177
216 iso_pu_bacteria 2881161766 2881168428 177
217 iso_pu_bacteria 2881853255 2881856956 177
218 iso_pu_bacteria 2882912400 2882917154 177
219 iso_pu_bacteria 2885318864 2885321675 177
220 iso_pu_bacteria 2885342637 2885349178 177
221 iso_pu_bacteria 2885350715 2885352436 177
222 iso_pu_bacteria 2903492973 2903496151 177
223 iso_pu_bacteria 2903540706 2903545470 177
224 iso_pu_bacteria 2904659560 2904661692 177
225 iso_pu_bacteria 2906328253 2906335183 177
226 iso_pu_bacteria 2924784321 2924785858 177
227 iso_pu_bacteria 2937891427 2937896391 177
228 iso_pu_bacteria 2937994558 2937999320 177
229 iso_pu_bacteria 2958115193 2958122339 177
230 iso_pu_bacteria 2958165035 2958169794 177
231 iso_pu_bacteria 2961114664 2961116845 177
232 iso_pu_bacteria 2961127735 2961135527 177
233 iso_pu_bacteria 2961163497 2961168254 177
234 iso_pu_bacteria 2965018300 2965023073 177
235 iso_pu_bacteria 2965062239 2965064549 177
236 iso_pu_bacteria 2967996073 2968000682 177
237 iso_pu_bacteria 2968003550 2968009945 177
238 iso_pu_bacteria 2968091066 2968091882 177
239 iso_pu_bacteria 2968097103 2968101108 177
240 iso_pu_bacteria 2968110612 2968112752 177
241 iso_pu_bacteria 2968128360 2968129943 177
242 iso_pu_bacteria 2968171901 2968176654 177
243 iso_pu_bacteria 2970503327 2970507333 177
244 iso_pu_bacteria 2970554993 2970559593 177
245 iso_pu_bacteria 2977828996 2977833953 177
246 iso_pu_bacteria 2977858184 2977862425 177
247 iso_pu_bacteria 2977864932 2977867536 177
248 iso_pu_bacteria 2979779861 2979785659 177
249 iso_pu_bacteria 2979808191 2979812529 177
250 iso_pu_bacteria 2987659509 2987664268 177
251 iso_pu_bacteria 3004188549 3004193323 177
252 iso_pu_bacteria 8002285264 8002286188 177
253 iso_pu_bacteria 8004374579 8004379629 177
254 iso_pu_bacteria 8004445564 8004447324 177
255 iso_pu_bacteria 8004703790 8004713773 177
256 iso_pu_bacteria 2856356410 2856357010 178
257 iso_pu_bacteria 2871488783 2871495217 178
258 iso_pu_bacteria 2878753008 2878758117 178
259 iso_pu_bacteria 2881845957 2881851740 178
260 iso_pu_bacteria 2881861095 2881861465 178
261 iso_pu_bacteria 2894817345 2894818684 178
262 iso_pu_bacteria 2961170736 2961174747 178
263 iso_pu_bacteria 2977821940 2977828809 178
264 iso_pu_bacteria 2643221629 2644167488 179
265 iso_pu_bacteria 2643221662 2644347251 179
266 iso_pu_bacteria 2757320392 2757570860 179
267 3300038443 Ga0395901_0419069 Ga0395901_0419069_165_716 180
268 3300005327 Ga0070658_10031187 Ga0070658_100311873 181
269 3300005336 Ga0070680_100037343 Ga0070680_1000373434 181
270 3300005339 Ga0070660_100002162 Ga0070660_1000021623 181
271 3300005341 Ga0070691_10000423 Ga0070691_100004234 181
272 3300005366 Ga0070659_100023241 Ga0070659_1000232414 181
273 3300005455 Ga0070663_100602337 Ga0070663_1006023372 181
274 3300005458 Ga0070681_10028353 Ga0070681_100283535 181
275 3300005530 Ga0070679_100056119 Ga0070679_1000561193 181
276 3300005539 Ga0068853_100049546 Ga0068853_1000495464 181
277 3300005563 Ga0068855_100029133 Ga0068855_1000291335 181
278 3300009093 Ga0105240_10762413 Ga0105240_107624132 181
279 3300009551 Ga0105238_10001957 Ga0105238_1000195716 181
280 3300013100 Ga0157373_10034786 Ga0157373_100347862 181
281 3300013102 Ga0157371_10386420 Ga0157371_103864201 181
282 3300013104 Ga0157370_10005885 Ga0157370_1000588513 181
283 3300013307 Ga0157372_10004098 Ga0157372_100040983 181
284 3300025909 Ga0207705_10000130 Ga0207705_1000013045 181
285 3300025912 Ga0207707_10000839 Ga0207707_1000083911 181
286 3300025917 Ga0207660_10000793 Ga0207660_100007934 181
287 3300025919 Ga0207657_10000203 Ga0207657_100002038 181
288 3300025921 Ga0207652_10001704 Ga0207652_100017044 181
289 3300025924 Ga0207694_10053944 Ga0207694_100539443 181
290 3300025932 Ga0207690_10052953 Ga0207690_100529534 181
291 3300025949 Ga0207667_10018856 Ga0207667_100188563 181
292 3300026041 Ga0207639_10055272 Ga0207639_100552723 181
293 3300026067 Ga0207678_10149069 Ga0207678_101490692 181
294 3300028800 Ga0265338_10056099 Ga0265338_100560993 181
295 3300031235 Ga0265330_10069314 Ga0265330_100693142 181
296 3300031249 Ga0265339_10083894 Ga0265339_100838942 181
297 3300031711 Ga0265314_10003381 Ga0265314_100033814 181
298 3300031712 Ga0265342_10029577 Ga0265342_100295773 181
299 3300039437 Ga0436365_0486415 Ga0436365_0486415_28_582 181
300 3300041413 Ga0439465_0148015 Ga0439465_0148015_104_658 181
301 3300048929 Ga0496126_0029741 Ga0496126_0029741_4504_5058 181
302 3300049568 Ga0501031_0640144 Ga0501031_0640144_68_622 181
303 3300049569 Ga0501032_0062165 Ga0501032_0062165_677_1231 181
304 3300049569 Ga0501032_0067117 Ga0501032_0067117_782_1336 181
305 3300049570 Ga0501033_0019935 Ga0501033_0019935_848_1402 181
306 3300049570 Ga0501033_0032973 Ga0501033_0032973_786_1340 181
307 3300049570 Ga0501033_0673697 Ga0501033_0673697_89_643 181
308 3300049572 Ga0501036_0519650 Ga0501036_0519650_40_594 181
309 3300049573 Ga0501037_0019872 Ga0501037_0019872_2133_2687 181
310 3300049573 Ga0501037_0416019 Ga0501037_0416019_221_775 181
311 3300049573 Ga0501037_0610963 Ga0501037_0610963_39_593 181
312 3300049574 Ga0501038_0254597 Ga0501038_0254597_201_755 181
313 3300049575 Ga0501039_0019696 Ga0501039_0019696_3667_4221 181
314 3300049579 Ga0501043_0593469 Ga0501043_0593469_32_586 181
315 3300049583 Ga0501067_0063293 Ga0501067_0063293_676_1230 181
316 3300049584 Ga0501068_0093919 Ga0501068_0093919_824_1378 181
317 3300049584 Ga0501068_0413033 Ga0501068_0413033_92_646 181
318 3300049586 Ga0501070_0000002 Ga0501070_0000002_146606_147160 181
319 3300049586 Ga0501070_0050257 Ga0501070_0050257_1466_2020 181
320 3300049586 Ga0501070_0389186 Ga0501070_0389186_241_795 181
321 3300049587 Ga0501071_0012902 Ga0501071_0012902_130_684 181
322 3300049589 Ga0501073_0022820 Ga0501073_0022820_3007_3561 181
323 3300049742 Ga0501080_0001693 Ga0501080_0001693_9165_9719 181
324 3300049742 Ga0501080_0029788 Ga0501080_0029788_1242_1796 181
325 3300049744 Ga0501083_0138112 Ga0501083_0138112_433_987 181
326 3300049822 Ga0501035_0027566 Ga0501035_0027566_1882_2436 181
327 3300049822 Ga0501035_0027849 Ga0501035_0027849_3889_4443 181
328 3300049823 Ga0501044_0016840 Ga0501044_0016840_3317_3871 181
329 3300049823 Ga0501044_0021535 Ga0501044_0021535_6244_6798 181
330 3300049823 Ga0501044_0053423 Ga0501044_0053423_848_1402 181
331 3300049823 Ga0501044_0240256 Ga0501044_0240256_521_1075 181
332 3300049824 Ga0501045_0017914 Ga0501045_0017914_1133_1687 181
333 3300060353 Ga0501082_0336220 Ga0501082_0336220_678_1232 181
334 3300005536 Ga0070697_100665023 Ga0070697_1006650232 182
335 3300005545 Ga0070695_100369960 Ga0070695_1003699602 182
336 3300025915 Ga0207693_10415156 Ga0207693_104151561 182
337 3300037418 Ga0395900_0000121 Ga0395900_0000121_46088_46678 182
338 3300037466 Ga0395898_0000247 Ga0395898_0000247_88349_88939 182
339 3300037471 Ga0395905_0000112 Ga0395905_0000112_88333_88923 182
340 3300038443 Ga0395901_0000078 Ga0395901_0000078_46088_46678 182
341 3300049568 Ga0501031_0004180 Ga0501031_0004180_4300_4857 182
342 3300049569 Ga0501032_0000117 Ga0501032_0000117_54984_55541 182
343 3300049570 Ga0501033_0000224 Ga0501033_0000224_44691_45248 182
344 3300049571 Ga0501034_0008004 Ga0501034_0008004_7622_8179 182
345 3300049571 Ga0501034_0292398 Ga0501034_0292398_992_1549 182
346 3300049572 Ga0501036_0000645 Ga0501036_0000645_22501_23058 182
347 3300049573 Ga0501037_0001126 Ga0501037_0001126_9140_9697 182
348 3300049574 Ga0501038_0000260 Ga0501038_0000260_41004_41561 182
349 3300049575 Ga0501039_0000048 Ga0501039_0000048_9026_9583 182
350 3300049579 Ga0501043_0000068 Ga0501043_0000068_84477_85034 182
351 3300049822 Ga0501035_0001988 Ga0501035_0001988_9257_9814 182
352 3300049823 Ga0501044_0072533 Ga0501044_0072533_132_689 182
353 3300049824 Ga0501045_0177978 Ga0501045_0177978_820_1377 182
354 3300003214 JGI25165J46597_1000003 JGI25165J46597_100000338 183
355 3300003215 JGI25153J46596_10001307 JGI25153J46596_100013074 183
356 3300003320 rootH2_10062114 rootH2_100621142 183
357 3300005327 Ga0070658_10022862 Ga0070658_100228625 183
358 3300005327 Ga0070658_10334768 Ga0070658_103347682 183
359 3300005327 Ga0070658_10466681 Ga0070658_104666812 183
360 3300005327 Ga0070658_10791729 Ga0070658_107917292 183
361 3300005328 Ga0070676_10006419 Ga0070676_100064194 183
362 3300005328 Ga0070676_10202948 Ga0070676_102029482 183
363 3300005328 Ga0070676_10656780 Ga0070676_106567801 183
364 3300005329 Ga0070683_100048394 Ga0070683_1000483942 183
365 3300005329 Ga0070683_100578195 Ga0070683_1005781952 183
366 3300005329 Ga0070683_101510764 Ga0070683_1015107641 183
367 3300005331 Ga0070670_100650437 Ga0070670_1006504372 183
368 3300005331 Ga0070670_100682018 Ga0070670_1006820181 183
369 3300005334 Ga0068869_100029238 Ga0068869_1000292384 183
370 3300005334 Ga0068869_100228696 Ga0068869_1002286962 183
371 3300005334 Ga0068869_101203309 Ga0068869_1012033091 183
372 3300005335 Ga0070666_10001325 Ga0070666_100013252 183
373 3300005335 Ga0070666_10007147 Ga0070666_100071473 183
374 3300005335 Ga0070666_10066225 Ga0070666_100662253 183
375 3300005335 Ga0070666_10145197 Ga0070666_101451972 183
376 3300005336 Ga0070680_100000382 Ga0070680_10000038226 183
377 3300005336 Ga0070680_100271747 Ga0070680_1002717472 183
378 3300005336 Ga0070680_100305703 Ga0070680_1003057032 183
379 3300005337 Ga0070682_100508756 Ga0070682_1005087561 183
380 3300005338 Ga0068868_100021756 Ga0068868_1000217565 183
381 3300005338 Ga0068868_100275143 Ga0068868_1002751432 183
382 3300005339 Ga0070660_100030677 Ga0070660_1000306773 183
383 3300005339 Ga0070660_100145612 Ga0070660_1001456122 183
384 3300005339 Ga0070660_100851740 Ga0070660_1008517401 183
385 3300005341 Ga0070691_10000026 Ga0070691_1000002623 183
386 3300005341 Ga0070691_10180083 Ga0070691_101800832 183
387 3300005344 Ga0070661_100000150 Ga0070661_10000015045 183
388 3300005344 Ga0070661_100020621 Ga0070661_1000206214 183
389 3300005344 Ga0070661_100050228 Ga0070661_1000502284 183
390 3300005344 Ga0070661_100396056 Ga0070661_1003960562 183
391 3300005354 Ga0070675_100030431 Ga0070675_1000304312 183
392 3300005354 Ga0070675_100142853 Ga0070675_1001428532 183
393 3300005354 Ga0070675_100371794 Ga0070675_1003717942 183
394 3300005356 Ga0070674_100136922 Ga0070674_1001369222 183
395 3300005364 Ga0070673_100814489 Ga0070673_1008144891 183
396 3300005366 Ga0070659_100007064 Ga0070659_1000070643 183
397 3300005366 Ga0070659_100018815 Ga0070659_1000188152 183
398 3300005367 Ga0070667_100083432 Ga0070667_1000834323 183
399 3300005434 Ga0070709_10001084 Ga0070709_1000108412 183
400 3300005434 Ga0070709_10155417 Ga0070709_101554173 183
401 3300005435 Ga0070714_100299399 Ga0070714_1002993992 183
402 3300005435 Ga0070714_100806849 Ga0070714_1008068491 183
403 3300005436 Ga0070713_100000008 Ga0070713_100000008125 183
404 3300005436 Ga0070713_100727924 Ga0070713_1007279242 183
405 3300005437 Ga0070710_10243031 Ga0070710_102430312 183
406 3300005441 Ga0070700_100592853 Ga0070700_1005928531 183
407 3300005444 Ga0070694_100463045 Ga0070694_1004630452 183
408 3300005445 Ga0070708_100004067 Ga0070708_1000040676 183
409 3300005455 Ga0070663_100426438 Ga0070663_1004264382 183
410 3300005456 Ga0070678_100007499 Ga0070678_1000074992 183
411 3300005456 Ga0070678_100013964 Ga0070678_1000139645 183
412 3300005456 Ga0070678_100059543 Ga0070678_1000595432 183
413 3300005456 Ga0070678_100076475 Ga0070678_1000764752 183
414 3300005456 Ga0070678_100255635 Ga0070678_1002556352 183
415 3300005456 Ga0070678_100412612 Ga0070678_1004126122 183
416 3300005456 Ga0070678_100772362 Ga0070678_1007723621 183
417 3300005457 Ga0070662_100309355 Ga0070662_1003093552 183
418 3300005457 Ga0070662_100645543 Ga0070662_1006455431 183
419 3300005457 Ga0070662_100787135 Ga0070662_1007871352 183
420 3300005458 Ga0070681_10000001 Ga0070681_10000001308 183
421 3300005458 Ga0070681_10051541 Ga0070681_100515414 183
422 3300005459 Ga0068867_100005925 Ga0068867_1000059254 183
423 3300005459 Ga0068867_100129515 Ga0068867_1001295153 183
424 3300005466 Ga0070685_10569317 Ga0070685_105693171 183
425 3300005466 Ga0070685_10685368 Ga0070685_106853681 183
426 3300005467 Ga0070706_100008931 Ga0070706_1000089314 183
427 3300005468 Ga0070707_100005781 Ga0070707_1000057817 183
428 3300005471 Ga0070698_100004668 Ga0070698_1000046688 183
429 3300005518 Ga0070699_100011748 Ga0070699_1000117484 183
430 3300005518 Ga0070699_100096821 Ga0070699_1000968213 183
431 3300005530 Ga0070679_100002973 Ga0070679_1000029734 183
432 3300005530 Ga0070679_100008702 Ga0070679_1000087026 183
433 3300005530 Ga0070679_100122331 Ga0070679_1001223313 183
434 3300005530 Ga0070679_100162021 Ga0070679_1001620212 183
435 3300005530 Ga0070679_100190232 Ga0070679_1001902321 183
436 3300005535 Ga0070684_100400975 Ga0070684_1004009752 183
437 3300005535 Ga0070684_100498396 Ga0070684_1004983962 183
438 3300005535 Ga0070684_100650485 Ga0070684_1006504851 183
439 3300005536 Ga0070697_100165466 Ga0070697_1001654661 183
440 3300005536 Ga0070697_100478129 Ga0070697_1004781292 183
441 3300005539 Ga0068853_100018064 Ga0068853_1000180643 183
442 3300005539 Ga0068853_100025374 Ga0068853_1000253745 183
443 3300005539 Ga0068853_100078218 Ga0068853_1000782183 183
444 3300005539 Ga0068853_100095631 Ga0068853_1000956312 183
445 3300005539 Ga0068853_100149163 Ga0068853_1001491633 183
446 3300005539 Ga0068853_100387687 Ga0068853_1003876872 183
447 3300005539 Ga0068853_100411286 Ga0068853_1004112862 183
448 3300005539 Ga0068853_100468983 Ga0068853_1004689832 183
449 3300005539 Ga0068853_101070892 Ga0068853_1010708921 183
450 3300005545 Ga0070695_100014491 Ga0070695_1000144912 183
451 3300005545 Ga0070695_100512939 Ga0070695_1005129391 183
452 3300005547 Ga0070693_100060956 Ga0070693_1000609562 183
453 3300005548 Ga0070665_100000377 Ga0070665_10000037754 183
454 3300005548 Ga0070665_100088463 Ga0070665_1000884632 183
455 3300005548 Ga0070665_100090856 Ga0070665_1000908561 183
456 3300005548 Ga0070665_100116908 Ga0070665_1001169084 183
457 3300005548 Ga0070665_100118362 Ga0070665_1001183623 183
458 3300005548 Ga0070665_100179112 Ga0070665_1001791122 183
459 3300005548 Ga0070665_100294327 Ga0070665_1002943272 183
460 3300005548 Ga0070665_100424971 Ga0070665_1004249712 183
461 3300005548 Ga0070665_100735525 Ga0070665_1007355252 183
462 3300005548 Ga0070665_101045013 Ga0070665_1010450131 183
463 3300005549 Ga0070704_100147877 Ga0070704_1001478772 183
464 3300005563 Ga0068855_100000032 Ga0068855_1000000322 183
465 3300005563 Ga0068855_100013144 Ga0068855_1000131447 183
466 3300005563 Ga0068855_100040684 Ga0068855_1000406845 183
467 3300005563 Ga0068855_100045380 Ga0068855_1000453802 183
468 3300005563 Ga0068855_100104119 Ga0068855_1001041193 183
469 3300005563 Ga0068855_100115407 Ga0068855_1001154074 183
470 3300005563 Ga0068855_100639393 Ga0068855_1006393932 183
471 3300005563 Ga0068855_100654588 Ga0068855_1006545882 183
472 3300005563 Ga0068855_100850242 Ga0068855_1008502422 183
473 3300005563 Ga0068855_100908992 Ga0068855_1009089922 183
474 3300005577 Ga0068857_100000572 Ga0068857_10000057221 183
475 3300005577 Ga0068857_100030232 Ga0068857_1000302323 183
476 3300005577 Ga0068857_100096885 Ga0068857_1000968852 183
477 3300005577 Ga0068857_100317241 Ga0068857_1003172412 183
478 3300005577 Ga0068857_100322871 Ga0068857_1003228712 183
479 3300005578 Ga0068854_100083557 Ga0068854_1000835573 183
480 3300005578 Ga0068854_100106133 Ga0068854_1001061332 183
481 3300005578 Ga0068854_101287181 Ga0068854_1012871811 183
482 3300005614 Ga0068856_100000362 Ga0068856_10000036234 183
483 3300005614 Ga0068856_100006993 Ga0068856_10000699311 183
484 3300005614 Ga0068856_100103685 Ga0068856_1001036853 183
485 3300005614 Ga0068856_100324155 Ga0068856_1003241552 183
486 3300005615 Ga0070702_100338557 Ga0070702_1003385571 183
487 3300005616 Ga0068852_100012265 Ga0068852_1000122656 183
488 3300005616 Ga0068852_100016637 Ga0068852_1000166375 183
489 3300005616 Ga0068852_100021576 Ga0068852_1000215765 183
490 3300005616 Ga0068852_100092845 Ga0068852_1000928453 183
491 3300005616 Ga0068852_100132119 Ga0068852_1001321193 183
492 3300005616 Ga0068852_100737491 Ga0068852_1007374912 183
493 3300005617 Ga0068859_100527304 Ga0068859_1005273042 183
494 3300005617 Ga0068859_101031183 Ga0068859_1010311831 183
495 3300005618 Ga0068864_100735858 Ga0068864_1007358582 183
496 3300005618 Ga0068864_101652334 Ga0068864_1016523341 183
497 3300005718 Ga0068866_10005699 Ga0068866_100056993 183
498 3300005718 Ga0068866_10160885 Ga0068866_101608852 183
499 3300005719 Ga0068861_100500131 Ga0068861_1005001311 183
500 3300005834 Ga0068851_10117237 Ga0068851_101172372 183
501 3300005834 Ga0068851_10319889 Ga0068851_103198891 183
502 3300005840 Ga0068870_10066881 Ga0068870_100668813 183
503 3300005841 Ga0068863_100076142 Ga0068863_1000761422 183
504 3300005842 Ga0068858_100024740 Ga0068858_1000247402 183
505 3300005842 Ga0068858_100702561 Ga0068858_1007025612 183
506 3300005842 Ga0068858_100837932 Ga0068858_1008379321 183
507 3300005842 Ga0068858_101034979 Ga0068858_1010349792 183
508 3300005842 Ga0068858_101182558 Ga0068858_1011825582 183
509 3300005843 Ga0068860_100128943 Ga0068860_1001289431 183
510 3300005844 Ga0068862_100358847 Ga0068862_1003588472 183
511 3300005937 Ga0081455_10181036 Ga0081455_101810363 183
512 3300006175 Ga0070712_100000435 Ga0070712_1000004356 183
513 3300006237 Ga0097621_100000211 Ga0097621_10000021139 183
514 3300006237 Ga0097621_100014338 Ga0097621_1000143382 183
515 3300006237 Ga0097621_100047141 Ga0097621_1000471414 183
516 3300006237 Ga0097621_100097675 Ga0097621_1000976754 183
517 3300006237 Ga0097621_100099772 Ga0097621_1000997724 183
518 3300006237 Ga0097621_100218793 Ga0097621_1002187932 183
519 3300006237 Ga0097621_100326332 Ga0097621_1003263322 183
520 3300006237 Ga0097621_100365696 Ga0097621_1003656962 183
521 3300006237 Ga0097621_100672862 Ga0097621_1006728622 183
522 3300006237 Ga0097621_100857266 Ga0097621_1008572661 183
523 3300006358 Ga0068871_100002499 Ga0068871_1000024995 183
524 3300006358 Ga0068871_100013560 Ga0068871_1000135605 183
525 3300006358 Ga0068871_100013750 Ga0068871_1000137502 183
526 3300006358 Ga0068871_100221709 Ga0068871_1002217092 183
527 3300006358 Ga0068871_100510523 Ga0068871_1005105232 183
528 3300006871 Ga0075434_100019465 Ga0075434_1000194651 183
529 3300006881 Ga0068865_100020404 Ga0068865_1000204045 183
530 3300006881 Ga0068865_100089567 Ga0068865_1000895672 183
531 3300006881 Ga0068865_100449756 Ga0068865_1004497562 183
532 3300006914 Ga0075436_100000099 Ga0075436_10000009934 183
533 3300006914 Ga0075436_100002921 Ga0075436_1000029214 183
534 3300006914 Ga0075436_100031551 Ga0075436_1000315512 183
535 3300006931 Ga0097620_100527332 Ga0097620_1005273321 183
536 3300006931 Ga0097620_101031211 Ga0097620_1010312112 183
537 3300007076 Ga0075435_100008130 Ga0075435_1000081305 183
538 3300009093 Ga0105240_10000122 Ga0105240_1000012254 183
539 3300009093 Ga0105240_10003858 Ga0105240_100038583 183
540 3300009093 Ga0105240_10008089 Ga0105240_1000808911 183
541 3300009093 Ga0105240_10010600 Ga0105240_100106004 183
542 3300009093 Ga0105240_10042522 Ga0105240_100425224 183
543 3300009093 Ga0105240_10106706 Ga0105240_101067063 183
544 3300009093 Ga0105240_10136259 Ga0105240_101362592 183
545 3300009093 Ga0105240_10245374 Ga0105240_102453742 183
546 3300009093 Ga0105240_10248698 Ga0105240_102486983 183
547 3300009093 Ga0105240_10295065 Ga0105240_102950652 183
548 3300009093 Ga0105240_10306625 Ga0105240_103066253 183
549 3300009093 Ga0105240_10313971 Ga0105240_103139712 183
550 3300009093 Ga0105240_10357367 Ga0105240_103573672 183
551 3300009093 Ga0105240_10440570 Ga0105240_104405702 183
552 3300009098 Ga0105245_10083985 Ga0105245_100839854 183
553 3300009098 Ga0105245_10166946 Ga0105245_101669462 183
554 3300009098 Ga0105245_10312721 Ga0105245_103127212 183
555 3300009098 Ga0105245_10327308 Ga0105245_103273082 183
556 3300009101 Ga0105247_10290875 Ga0105247_102908752 183
557 3300009101 Ga0105247_10308872 Ga0105247_103088722 183
558 3300009148 Ga0105243_10003136 Ga0105243_100031364 183
559 3300009174 Ga0105241_10059972 Ga0105241_100599723 183
560 3300009174 Ga0105241_10061952 Ga0105241_100619522 183
561 3300009174 Ga0105241_10153356 Ga0105241_101533562 183
562 3300009174 Ga0105241_10195496 Ga0105241_101954962 183
563 3300009174 Ga0105241_10228341 Ga0105241_102283411 183
564 3300009174 Ga0105241_10235454 Ga0105241_102354542 183
565 3300009174 Ga0105241_10241759 Ga0105241_102417593 183
566 3300009174 Ga0105241_10367559 Ga0105241_103675592 183
567 3300009174 Ga0105241_10425580 Ga0105241_104255802 183
568 3300009176 Ga0105242_10101018 Ga0105242_101010183 183
569 3300009176 Ga0105242_10232864 Ga0105242_102328642 183
570 3300009176 Ga0105242_10314331 Ga0105242_103143312 183
571 3300009177 Ga0105248_10000005 Ga0105248_10000005455 183
572 3300009177 Ga0105248_10092092 Ga0105248_100920921 183
573 3300009177 Ga0105248_10182042 Ga0105248_101820423 183
574 3300009177 Ga0105248_10312922 Ga0105248_103129222 183
575 3300009177 Ga0105248_10328699 Ga0105248_103286992 183
576 3300009177 Ga0105248_10421972 Ga0105248_104219722 183
577 3300009177 Ga0105248_10910511 Ga0105248_109105112 183
578 3300009177 Ga0105248_10950259 Ga0105248_109502592 183
579 3300009545 Ga0105237_10012207 Ga0105237_100122077 183
580 3300009545 Ga0105237_10103025 Ga0105237_101030252 183
581 3300009545 Ga0105237_10199481 Ga0105237_101994812 183
582 3300009545 Ga0105237_10360803 Ga0105237_103608032 183
583 3300009545 Ga0105237_10489329 Ga0105237_104893292 183
584 3300009545 Ga0105237_10648664 Ga0105237_106486642 183
585 3300009545 Ga0105237_10766137 Ga0105237_107661372 183
586 3300009545 Ga0105237_10988870 Ga0105237_109888702 183
587 3300009551 Ga0105238_10024452 Ga0105238_100244525 183
588 3300009551 Ga0105238_10044453 Ga0105238_100444533 183
589 3300009551 Ga0105238_10044693 Ga0105238_100446934 183
590 3300009551 Ga0105238_10079347 Ga0105238_100793474 183
591 3300009551 Ga0105238_10091347 Ga0105238_100913474 183
592 3300009551 Ga0105238_10145589 Ga0105238_101455892 183
593 3300009551 Ga0105238_10163485 Ga0105238_101634853 183
594 3300009551 Ga0105238_10246387 Ga0105238_102463871 183
595 3300009551 Ga0105238_10283839 Ga0105238_102838392 183
596 3300009551 Ga0105238_10623714 Ga0105238_106237142 183
597 3300009551 Ga0105238_10775285 Ga0105238_107752852 183
598 3300009551 Ga0105238_11621501 Ga0105238_116215011 183
599 3300010375 Ga0105239_10002396 Ga0105239_100023964 183
600 3300010375 Ga0105239_10006805 Ga0105239_1000680514 183
601 3300010375 Ga0105239_10010902 Ga0105239_1001090210 183
602 3300010375 Ga0105239_10012817 Ga0105239_100128175 183
603 3300010375 Ga0105239_10182269 Ga0105239_101822692 183
604 3300010375 Ga0105239_10205236 Ga0105239_102052362 183
605 3300010375 Ga0105239_10280701 Ga0105239_102807012 183
606 3300010375 Ga0105239_10294199 Ga0105239_102941991 183
607 3300010375 Ga0105239_10324054 Ga0105239_103240542 183
608 3300010375 Ga0105239_10431450 Ga0105239_104314501 183
609 3300010375 Ga0105239_10571435 Ga0105239_105714352 183
610 3300010375 Ga0105239_10683603 Ga0105239_106836032 183
611 3300010375 Ga0105239_10807708 Ga0105239_108077081 183
612 3300011119 Ga0105246_10003704 Ga0105246_100037044 183
613 3300013100 Ga0157373_10000393 Ga0157373_1000039330 183
614 3300013100 Ga0157373_10177773 Ga0157373_101777732 183
615 3300013102 Ga0157371_10611317 Ga0157371_106113172 183
616 3300013104 Ga0157370_10006364 Ga0157370_100063646 183
617 3300013104 Ga0157370_10025580 Ga0157370_100255803 183
618 3300013104 Ga0157370_10774663 Ga0157370_107746631 183
619 3300013105 Ga0157369_10004678 Ga0157369_1000467815 183
620 3300013105 Ga0157369_10049035 Ga0157369_100490355 183
621 3300013105 Ga0157369_10156713 Ga0157369_101567133 183
622 3300013105 Ga0157369_10256399 Ga0157369_102563992 183
623 3300013105 Ga0157369_10545155 Ga0157369_105451552 183
624 3300013105 Ga0157369_10840942 Ga0157369_108409422 183
625 3300013296 Ga0157374_10059924 Ga0157374_100599244 183
626 3300013296 Ga0157374_10080725 Ga0157374_100807252 183
627 3300013296 Ga0157374_10319856 Ga0157374_103198561 183
628 3300013296 Ga0157374_10450748 Ga0157374_104507482 183
629 3300013296 Ga0157374_10469534 Ga0157374_104695342 183
630 3300013296 Ga0157374_10670896 Ga0157374_106708962 183
631 3300013296 Ga0157374_10721078 Ga0157374_107210782 183
632 3300013296 Ga0157374_10721973 Ga0157374_107219732 183
633 3300013297 Ga0157378_10348865 Ga0157378_103488652 183
634 3300013297 Ga0157378_10449816 Ga0157378_104498162 183
635 3300013297 Ga0157378_10462508 Ga0157378_104625082 183
636 3300013297 Ga0157378_10539458 Ga0157378_105394582 183
637 3300013297 Ga0157378_10874157 Ga0157378_108741572 183
638 3300013306 Ga0163162_10142362 Ga0163162_101423624 183
639 3300013306 Ga0163162_10245922 Ga0163162_102459223 183
640 3300013306 Ga0163162_11097175 Ga0163162_110971752 183
641 3300013307 Ga0157372_10034021 Ga0157372_100340211 183
642 3300013307 Ga0157372_10117108 Ga0157372_101171083 183
643 3300013307 Ga0157372_10288987 Ga0157372_102889873 183
644 3300013307 Ga0157372_12166316 Ga0157372_121663161 183
645 3300013308 Ga0157375_10154128 Ga0157375_101541284 183
646 3300013308 Ga0157375_10277760 Ga0157375_102777603 183
647 3300013308 Ga0157375_10299149 Ga0157375_102991492 183
648 3300013308 Ga0157375_10353192 Ga0157375_103531923 183
649 3300014325 Ga0163163_10000374 Ga0163163_1000037435 183
650 3300014325 Ga0163163_10025260 Ga0163163_100252605 183
651 3300014325 Ga0163163_10320449 Ga0163163_103204492 183
652 3300014325 Ga0163163_10395822 Ga0163163_103958222 183
653 3300014325 Ga0163163_11202027 Ga0163163_112020271 183
654 3300014968 Ga0157379_10000809 Ga0157379_100008095 183
655 3300014968 Ga0157379_10002383 Ga0157379_100023832 183
656 3300014968 Ga0157379_10002785 Ga0157379_1000278510 183
657 3300014968 Ga0157379_10018004 Ga0157379_100180046 183
658 3300014968 Ga0157379_10050980 Ga0157379_100509802 183
659 3300014968 Ga0157379_10610948 Ga0157379_106109482 183
660 3300014968 Ga0157379_10936947 Ga0157379_109369472 183
661 3300014969 Ga0157376_10011362 Ga0157376_100113626 183
662 3300014969 Ga0157376_10393993 Ga0157376_103939932 183
663 3300014969 Ga0157376_10460149 Ga0157376_104601492 183
664 3300014969 Ga0157376_11021924 Ga0157376_110219242 183
665 3300014969 Ga0157376_11288484 Ga0157376_112884842 183
666 3300017792 Ga0163161_10632206 Ga0163161_106322062 183
667 3300020070 Ga0206356_10618293 Ga0206356_106182932 183
668 3300020077 Ga0206351_10148948 Ga0206351_101489482 183
669 3300020082 Ga0206353_11321961 Ga0206353_113219612 183
670 3300021377 Ga0213874_10005913 Ga0213874_100059132 183
671 3300021384 Ga0213876_10000215 Ga0213876_1000021514 183
672 3300021384 Ga0213876_10061774 Ga0213876_100617742 183
673 3300021388 Ga0213875_10008490 Ga0213875_100084903 183
674 3300025261 Ga0209233_1000015 Ga0209233_1000015741 183
675 3300025261 Ga0209233_1002975 Ga0209233_10029752 183
676 3300025297 Ga0209758_1000013 Ga0209758_1000013387 183
677 3300025321 Ga0207656_10116204 Ga0207656_101162042 183
678 3300025321 Ga0207656_10161313 Ga0207656_101613131 183
679 3300025898 Ga0207692_10059367 Ga0207692_100593673 183
680 3300025899 Ga0207642_10003258 Ga0207642_100032585 183
681 3300025899 Ga0207642_10285786 Ga0207642_102857862 183
682 3300025900 Ga0207710_10353555 Ga0207710_103535551 183
683 3300025903 Ga0207680_10001877 Ga0207680_100018775 183
684 3300025903 Ga0207680_10010949 Ga0207680_100109493 183
685 3300025903 Ga0207680_10132462 Ga0207680_101324622 183
686 3300025904 Ga0207647_10035502 Ga0207647_100355024 183
687 3300025906 Ga0207699_10000140 Ga0207699_1000014017 183
688 3300025906 Ga0207699_10312872 Ga0207699_103128721 183
689 3300025907 Ga0207645_10024042 Ga0207645_100240424 183
690 3300025907 Ga0207645_10086079 Ga0207645_100860793 183
691 3300025907 Ga0207645_10096782 Ga0207645_100967822 183
692 3300025907 Ga0207645_10490343 Ga0207645_104903432 183
693 3300025908 Ga0207643_10088641 Ga0207643_100886413 183
694 3300025909 Ga0207705_10044073 Ga0207705_100440733 183
695 3300025909 Ga0207705_10073405 Ga0207705_100734054 183
696 3300025909 Ga0207705_10115251 Ga0207705_101152512 183
697 3300025909 Ga0207705_10128660 Ga0207705_101286602 183
698 3300025909 Ga0207705_10348937 Ga0207705_103489372 183
699 3300025910 Ga0207684_10005572 Ga0207684_100055726 183
700 3300025911 Ga0207654_10054236 Ga0207654_100542363 183
701 3300025911 Ga0207654_10069711 Ga0207654_100697113 183
702 3300025911 Ga0207654_10075469 Ga0207654_100754691 183
703 3300025911 Ga0207654_10100444 Ga0207654_101004443 183
704 3300025911 Ga0207654_10168631 Ga0207654_101686312 183
705 3300025911 Ga0207654_10314990 Ga0207654_103149902 183
706 3300025911 Ga0207654_10449248 Ga0207654_104492481 183
707 3300025911 Ga0207654_10685879 Ga0207654_106858792 183
708 3300025912 Ga0207707_10000048 Ga0207707_100000487 183
709 3300025912 Ga0207707_10064239 Ga0207707_100642392 183
710 3300025912 Ga0207707_10145827 Ga0207707_101458272 183
711 3300025912 Ga0207707_10323265 Ga0207707_103232652 183
712 3300025913 Ga0207695_10000173 Ga0207695_1000017354 183
713 3300025913 Ga0207695_10003968 Ga0207695_100039686 183
714 3300025913 Ga0207695_10005722 Ga0207695_100057225 183
715 3300025913 Ga0207695_10010811 Ga0207695_100108115 183
716 3300025913 Ga0207695_10055793 Ga0207695_100557933 183
717 3300025913 Ga0207695_10057112 Ga0207695_100571122 183
718 3300025913 Ga0207695_10083397 Ga0207695_100833972 183
719 3300025913 Ga0207695_10121031 Ga0207695_101210313 183
720 3300025913 Ga0207695_10127045 Ga0207695_101270452 183
721 3300025913 Ga0207695_10135029 Ga0207695_101350293 183
722 3300025913 Ga0207695_10185647 Ga0207695_101856472 183
723 3300025914 Ga0207671_10099717 Ga0207671_100997173 183
724 3300025914 Ga0207671_10233736 Ga0207671_102337362 183
725 3300025914 Ga0207671_10323771 Ga0207671_103237712 183
726 3300025915 Ga0207693_10001130 Ga0207693_100011306 183
727 3300025915 Ga0207693_10178923 Ga0207693_101789232 183
728 3300025916 Ga0207663_10127686 Ga0207663_101276863 183
729 3300025916 Ga0207663_10386679 Ga0207663_103866792 183
730 3300025917 Ga0207660_10000072 Ga0207660_1000007224 183
731 3300025917 Ga0207660_10136361 Ga0207660_101363613 183
732 3300025917 Ga0207660_10182248 Ga0207660_101822482 183
733 3300025919 Ga0207657_10015039 Ga0207657_100150392 183
734 3300025919 Ga0207657_10085815 Ga0207657_100858152 183
735 3300025919 Ga0207657_10111451 Ga0207657_101114511 183
736 3300025919 Ga0207657_10125771 Ga0207657_101257713 183
737 3300025920 Ga0207649_10000162 Ga0207649_1000016211 183
738 3300025920 Ga0207649_10031260 Ga0207649_100312602 183
739 3300025920 Ga0207649_10089115 Ga0207649_100891152 183
740 3300025920 Ga0207649_10093538 Ga0207649_100935382 183
741 3300025920 Ga0207649_10648837 Ga0207649_106488372 183
742 3300025921 Ga0207652_10000509 Ga0207652_100005097 183
743 3300025921 Ga0207652_10391199 Ga0207652_103911991 183
744 3300025921 Ga0207652_10486718 Ga0207652_104867182 183
745 3300025921 Ga0207652_10671768 Ga0207652_106717681 183
746 3300025922 Ga0207646_10023084 Ga0207646_100230844 183
747 3300025924 Ga0207694_10000005 Ga0207694_10000005312 183
748 3300025924 Ga0207694_10021487 Ga0207694_100214872 183
749 3300025924 Ga0207694_10036914 Ga0207694_100369143 183
750 3300025924 Ga0207694_10043175 Ga0207694_100431751 183
751 3300025924 Ga0207694_10054698 Ga0207694_100546982 183
752 3300025924 Ga0207694_10084143 Ga0207694_100841432 183
753 3300025924 Ga0207694_10116740 Ga0207694_101167403 183
754 3300025924 Ga0207694_10142006 Ga0207694_101420061 183
755 3300025924 Ga0207694_10182210 Ga0207694_101822103 183
756 3300025924 Ga0207694_10650175 Ga0207694_106501752 183
757 3300025925 Ga0207650_10419331 Ga0207650_104193312 183
758 3300025925 Ga0207650_10522533 Ga0207650_105225332 183
759 3300025927 Ga0207687_10184137 Ga0207687_101841373 183
760 3300025927 Ga0207687_10318269 Ga0207687_103182692 183
761 3300025927 Ga0207687_10468742 Ga0207687_104687422 183
762 3300025927 Ga0207687_10483895 Ga0207687_104838952 183
763 3300025928 Ga0207700_10000011 Ga0207700_1000001167 183
764 3300025928 Ga0207700_10515184 Ga0207700_105151842 183
765 3300025929 Ga0207664_10191400 Ga0207664_101914003 183
766 3300025929 Ga0207664_10297652 Ga0207664_102976522 183
767 3300025929 Ga0207664_11185608 Ga0207664_111856081 183
768 3300025931 Ga0207644_10947599 Ga0207644_109475991 183
769 3300025931 Ga0207644_10985855 Ga0207644_109858551 183
770 3300025932 Ga0207690_10101512 Ga0207690_101015122 183
771 3300025932 Ga0207690_10196435 Ga0207690_101964352 183
772 3300025934 Ga0207686_10295938 Ga0207686_102959381 183
773 3300025934 Ga0207686_10430455 Ga0207686_104304552 183
774 3300025935 Ga0207709_10017792 Ga0207709_100177924 183
775 3300025935 Ga0207709_10146584 Ga0207709_101465842 183
776 3300025937 Ga0207669_10274072 Ga0207669_102740722 183
777 3300025937 Ga0207669_10370444 Ga0207669_103704442 183
778 3300025938 Ga0207704_10006555 Ga0207704_100065555 183
779 3300025938 Ga0207704_10021580 Ga0207704_100215804 183
780 3300025938 Ga0207704_10041652 Ga0207704_100416523 183
781 3300025938 Ga0207704_10611585 Ga0207704_106115852 183
782 3300025939 Ga0207665_10707723 Ga0207665_107077232 183
783 3300025940 Ga0207691_10042818 Ga0207691_100428181 183
784 3300025940 Ga0207691_10204199 Ga0207691_102041992 183
785 3300025941 Ga0207711_10000002 Ga0207711_10000002453 183
786 3300025941 Ga0207711_10020955 Ga0207711_100209551 183
787 3300025941 Ga0207711_10202636 Ga0207711_102026362 183
788 3300025942 Ga0207689_10088833 Ga0207689_100888333 183
789 3300025942 Ga0207689_10272370 Ga0207689_102723702 183
790 3300025944 Ga0207661_10040111 Ga0207661_100401113 183
791 3300025944 Ga0207661_10297159 Ga0207661_102971592 183
792 3300025944 Ga0207661_10449209 Ga0207661_104492091 183
793 3300025949 Ga0207667_10000011 Ga0207667_10000011274 183
794 3300025949 Ga0207667_10002009 Ga0207667_100020096 183
795 3300025949 Ga0207667_10006070 Ga0207667_100060706 183
796 3300025949 Ga0207667_10025465 Ga0207667_100254657 183
797 3300025949 Ga0207667_10123623 Ga0207667_101236232 183
798 3300025949 Ga0207667_10603829 Ga0207667_106038292 183
799 3300025960 Ga0207651_10475629 Ga0207651_104756292 183
800 3300025960 Ga0207651_10677660 Ga0207651_106776602 183
801 3300025981 Ga0207640_10039961 Ga0207640_100399613 183
802 3300025986 Ga0207658_10018223 Ga0207658_100182235 183
803 3300025986 Ga0207658_10638931 Ga0207658_106389312 183
804 3300026023 Ga0207677_10008414 Ga0207677_100084146 183
805 3300026023 Ga0207677_10085528 Ga0207677_100855283 183
806 3300026023 Ga0207677_10136291 Ga0207677_101362911 183
807 3300026023 Ga0207677_10180702 Ga0207677_101807023 183
808 3300026035 Ga0207703_10039522 Ga0207703_100395224 183
809 3300026035 Ga0207703_10091378 Ga0207703_100913784 183
810 3300026035 Ga0207703_10459513 Ga0207703_104595132 183
811 3300026035 Ga0207703_10500424 Ga0207703_105004242 183
812 3300026035 Ga0207703_10671087 Ga0207703_106710872 183
813 3300026041 Ga0207639_10016682 Ga0207639_100166823 183
814 3300026041 Ga0207639_10073439 Ga0207639_100734392 183
815 3300026041 Ga0207639_10077621 Ga0207639_100776212 183
816 3300026041 Ga0207639_10137895 Ga0207639_101378952 183
817 3300026041 Ga0207639_10195891 Ga0207639_101958912 183
818 3300026041 Ga0207639_10353287 Ga0207639_103532871 183
819 3300026067 Ga0207678_10296442 Ga0207678_102964422 183
820 3300026078 Ga0207702_10000162 Ga0207702_1000016216 183
821 3300026078 Ga0207702_10000968 Ga0207702_1000096811 183
822 3300026078 Ga0207702_10132283 Ga0207702_101322833 183
823 3300026078 Ga0207702_10457169 Ga0207702_104571692 183
824 3300026088 Ga0207641_10057653 Ga0207641_100576533 183
825 3300026089 Ga0207648_10005188 Ga0207648_100051884 183
826 3300026089 Ga0207648_10036675 Ga0207648_100366753 183
827 3300026089 Ga0207648_10292990 Ga0207648_102929902 183
828 3300026089 Ga0207648_10589323 Ga0207648_105893231 183
829 3300026095 Ga0207676_10019578 Ga0207676_100195782 183
830 3300026095 Ga0207676_10709918 Ga0207676_107099181 183
831 3300026116 Ga0207674_10001803 Ga0207674_100018036 183
832 3300026116 Ga0207674_10024874 Ga0207674_100248746 183
833 3300026116 Ga0207674_10118532 Ga0207674_101185324 183
834 3300026116 Ga0207674_10134150 Ga0207674_101341502 183
835 3300026116 Ga0207674_10212751 Ga0207674_102127513 183
836 3300026116 Ga0207674_10247344 Ga0207674_102473442 183
837 3300026116 Ga0207674_10516724 Ga0207674_105167242 183
838 3300026118 Ga0207675_101446195 Ga0207675_1014461951 183
839 3300026121 Ga0207683_10009458 Ga0207683_100094584 183
840 3300026121 Ga0207683_10022706 Ga0207683_100227066 183
841 3300026121 Ga0207683_10036115 Ga0207683_100361153 183
842 3300026121 Ga0207683_10039431 Ga0207683_100394314 183
843 3300026121 Ga0207683_10314883 Ga0207683_103148832 183
844 3300026142 Ga0207698_10010897 Ga0207698_100108972 183
845 3300026142 Ga0207698_10126692 Ga0207698_101266922 183
846 3300026142 Ga0207698_10193483 Ga0207698_101934832 183
847 3300026142 Ga0207698_10248102 Ga0207698_102481022 183
848 3300026142 Ga0207698_10439059 Ga0207698_104390592 183
849 3300026142 Ga0207698_10535344 Ga0207698_105353442 183
850 3300028379 Ga0268266_10000727 Ga0268266_1000072721 183
851 3300028379 Ga0268266_10028641 Ga0268266_100286412 183
852 3300028379 Ga0268266_10043109 Ga0268266_100431094 183
853 3300028379 Ga0268266_10044647 Ga0268266_100446474 183
854 3300028379 Ga0268266_10074627 Ga0268266_100746273 183
855 3300028379 Ga0268266_10131540 Ga0268266_101315403 183
856 3300028379 Ga0268266_10446783 Ga0268266_104467831 183
857 3300028379 Ga0268266_10626965 Ga0268266_106269652 183
858 3300028380 Ga0268265_10270752 Ga0268265_102707521 183
859 3300028380 Ga0268265_10381203 Ga0268265_103812032 183
860 3300028381 Ga0268264_10100852 Ga0268264_101008522 183
861 3300028381 Ga0268264_10133970 Ga0268264_101339703 183
862 3300028573 Ga0265334_10005599 Ga0265334_100055995 183
863 3300028577 Ga0265318_10000015 Ga0265318_10000015103 183
864 3300028577 Ga0265318_10000872 Ga0265318_1000087211 183
865 3300028800 Ga0265338_10000005 Ga0265338_10000005457 183
866 3300028800 Ga0265338_10004191 Ga0265338_100041919 183
867 3300028800 Ga0265338_10018409 Ga0265338_100184096 183
868 3300028800 Ga0265338_10052693 Ga0265338_100526933 183
869 3300028800 Ga0265338_10108372 Ga0265338_101083723 183
870 3300031235 Ga0265330_10011357 Ga0265330_100113573 183
871 3300031235 Ga0265330_10030909 Ga0265330_100309093 183
872 3300031235 Ga0265330_10037460 Ga0265330_100374602 183
873 3300031235 Ga0265330_10071669 Ga0265330_100716692 183
874 3300031238 Ga0265332_10022558 Ga0265332_100225582 183
875 3300031238 Ga0265332_10118697 Ga0265332_101186972 183
876 3300031239 Ga0265328_10109533 Ga0265328_101095332 183
877 3300031239 Ga0265328_10153680 Ga0265328_101536801 183
878 3300031240 Ga0265320_10000561 Ga0265320_100005612 183
879 3300031241 Ga0265325_10000005 Ga0265325_1000000560 183
880 3300031241 Ga0265325_10000152 Ga0265325_1000015239 183
881 3300031241 Ga0265325_10000677 Ga0265325_1000067715 183
882 3300031241 Ga0265325_10002084 Ga0265325_100020846 183
883 3300031241 Ga0265325_10002415 Ga0265325_1000241513 183
884 3300031241 Ga0265325_10019652 Ga0265325_100196523 183
885 3300031241 Ga0265325_10026697 Ga0265325_100266971 183
886 3300031242 Ga0265329_10044151 Ga0265329_100441511 183
887 3300031247 Ga0265340_10037526 Ga0265340_100375261 183
888 3300031247 Ga0265340_10056824 Ga0265340_100568241 183
889 3300031247 Ga0265340_10162018 Ga0265340_101620182 183
890 3300031249 Ga0265339_10000502 Ga0265339_1000050220 183
891 3300031249 Ga0265339_10001940 Ga0265339_1000194014 183
892 3300031249 Ga0265339_10007789 Ga0265339_100077894 183
893 3300031249 Ga0265339_10019156 Ga0265339_100191564 183
894 3300031249 Ga0265339_10087047 Ga0265339_100870472 183
895 3300031249 Ga0265339_10186607 Ga0265339_101866072 183
896 3300031250 Ga0265331_10000003 Ga0265331_1000000366 183
897 3300031250 Ga0265331_10009003 Ga0265331_100090034 183
898 3300031250 Ga0265331_10009982 Ga0265331_100099826 183
899 3300031250 Ga0265331_10018685 Ga0265331_100186854 183
900 3300031250 Ga0265331_10039445 Ga0265331_100394452 183
901 3300031344 Ga0265316_10021107 Ga0265316_100211076 183
902 3300031344 Ga0265316_10105906 Ga0265316_101059063 183
903 3300031344 Ga0265316_10187611 Ga0265316_101876113 183
904 3300031344 Ga0265316_10474444 Ga0265316_104744441 183
905 3300031595 Ga0265313_10000482 Ga0265313_100004826 183
906 3300031595 Ga0265313_10000570 Ga0265313_1000057020 183
907 3300031595 Ga0265313_10002814 Ga0265313_100028146 183
908 3300031595 Ga0265313_10026643 Ga0265313_100266432 183
909 3300031595 Ga0265313_10045567 Ga0265313_100455671 183
910 3300031595 Ga0265313_10055647 Ga0265313_100556472 183
911 3300031595 Ga0265313_10074128 Ga0265313_100741282 183
912 3300031595 Ga0265313_10079792 Ga0265313_100797922 183
913 3300031711 Ga0265314_10001066 Ga0265314_1000106618 183
914 3300031711 Ga0265314_10004545 Ga0265314_1000454511 183
915 3300031711 Ga0265314_10023618 Ga0265314_100236185 183
916 3300031711 Ga0265314_10049532 Ga0265314_100495323 183
917 3300031711 Ga0265314_10054751 Ga0265314_100547512 183
918 3300031711 Ga0265314_10055351 Ga0265314_100553513 183
919 3300031711 Ga0265314_10221817 Ga0265314_102218172 183
920 3300031712 Ga0265342_10002934 Ga0265342_100029347 183
921 3300031712 Ga0265342_10021457 Ga0265342_100214571 183
922 3300031712 Ga0265342_10049352 Ga0265342_100493523 183
923 3300031712 Ga0265342_10076600 Ga0265342_100766003 183
924 3300031903 Ga0307407_10847211 Ga0307407_108472111 183
925 3300031995 Ga0307409_100975111 Ga0307409_1009751112 183
926 3300035083 Ga0373926_0029010 Ga0373926_0029010_580_1140 183
927 3300035084 Ga0373928_0022834 Ga0373928_0022834_448_1014 183
928 3300035091 Ga0373951_0027575 Ga0373951_0027575_146_712 183
929 3300035111 Ga0373923_0023853 Ga0373923_0023853_474_1034 183
930 3300035114 Ga0373939_0016746 Ga0373939_0016746_378_944 183
931 3300035119 Ga0373956_0102767 Ga0373956_0102767_440_1000 183
932 3300035242 Ga0373962_0144071 Ga0373962_0144071_79_645 183
933 3300035691 Ga0373931_0056582 Ga0373931_0056582_325_885 183
934 3300035692 Ga0373935_0214416 Ga0373935_0214416_593_1153 183
935 3300035692 Ga0373935_0226359 Ga0373935_0226359_89_649 183
936 3300035724 Ga0373933_0042520 Ga0373933_0042520_1694_2254 183
937 3300035725 Ga0373947_0053664 Ga0373947_0053664_816_1376 183
938 3300036401 Ga0373937_0013567 Ga0373937_0013567_1084_1644 183
939 3300036401 Ga0373937_0020864 Ga0373937_0020864_4785_5345 183
940 3300036401 Ga0373937_0021346 Ga0373937_0021346_1262_1822 183
941 3300036401 Ga0373937_0268496 Ga0373937_0268496_870_1430 183
942 3300036647 Ga0316582_0237154 Ga0316582_0237154_146_706 183
943 3300037068 Ga0373925_0341179 Ga0373925_0341179_518_1078 183
944 3300037312 Ga0395899_0084530 Ga0395899_0084530_348_908 183
945 3300037418 Ga0395900_0054045 Ga0395900_0054045_3374_3934 183
946 3300037418 Ga0395900_0057587 Ga0395900_0057587_225_785 183
947 3300037466 Ga0395898_0023177 Ga0395898_0023177_220_780 183
948 3300037466 Ga0395898_0034335 Ga0395898_0034335_3627_4187 183
949 3300037853 Ga0436364_0663275 Ga0436364_0663275_56818_57378 183
950 3300038443 Ga0395901_0016245 Ga0395901_0016245_5468_6028 183
951 3300038443 Ga0395901_0065872 Ga0395901_0065872_1280_1840 183
952 3300038443 Ga0395901_1237521 Ga0395901_1237521_40_600 183
953 3300039437 Ga0436365_0614371 Ga0436365_0614371_1337_1897 183
954 3300039437 Ga0436365_0927245 Ga0436365_0927245_717_1277 183
955 3300039437 Ga0436365_1452608 Ga0436365_1452608_52588_53148 183
956 3300039437 Ga0436365_1605052 Ga0436365_1605052_61_621 183
957 3300039438 Ga0436360_0692893 Ga0436360_0692893_141_701 183
958 3300039447 Ga0436361_0936313 Ga0436361_0936313_417_977 183
959 3300039450 Ga0436363_0301167 Ga0436363_0301167_5337_5897 183
960 3300039450 Ga0436363_1705146 Ga0436363_1705146_16_576 183
961 3300039453 Ga0436362_0275172 Ga0436362_0275172_79_639 183
962 3300041413 Ga0439465_0094628 Ga0439465_0094628_10_570 183
963 3300041452 Ga0451793_1380469 Ga0451793_1380469_1346_1906 183
964 3300044842 Ga0466957_0908882 Ga0466957_0908882_36_596 183
965 3300046462 Ga0495651_0182713 Ga0495651_0182713_380_940 183
966 3300046462 Ga0495651_0499681 Ga0495651_0499681_38_598 183
967 3300046472 Ga0495580_0036356 Ga0495580_0036356_2735_3295 183
968 3300046477 Ga0495664_0050052 Ga0495664_0050052_1226_1786 183
969 3300046477 Ga0495664_0195513 Ga0495664_0195513_28_588 183
970 3300046492 Ga0495585_0126074 Ga0495585_0126074_733_1293 183
971 3300046507 Ga0495606_0101767 Ga0495606_0101767_423_983 183
972 3300046507 Ga0495606_0189771 Ga0495606_0189771_571_1131 183
973 3300046517 Ga0495630_0325260 Ga0495630_0325260_317_877 183
974 3300046524 Ga0495648_0158654 Ga0495648_0158654_506_1066 183
975 3300046529 Ga0495652_0020474 Ga0495652_0020474_5114_5674 183
976 3300046529 Ga0495652_0046154 Ga0495652_0046154_158_718 183
977 3300046530 Ga0495654_0120222 Ga0495654_0120222_423_983 183
978 3300046538 Ga0495609_0049525 Ga0495609_0049525_659_1219 183
979 3300046539 Ga0495621_0111769 Ga0495621_0111769_64_624 183
980 3300046543 Ga0495645_0005420 Ga0495645_0005420_888_1448 183
981 3300046543 Ga0495645_0210510 Ga0495645_0210510_315_875 183
982 3300046557 Ga0495622_0006812 Ga0495622_0006812_275_835 183
983 3300046559 Ga0495667_0184719 Ga0495667_0184719_140_700 183
984 3300046615 Ga0495656_0400355 Ga0495656_0400355_100_660 183
985 3300046648 Ga0495611_0123408 Ga0495611_0123408_215_775 183
986 3300046660 Ga0495625_0377789 Ga0495625_0377789_171_731 183
987 3300046660 Ga0495625_0398831 Ga0495625_0398831_92_652 183
988 3300046665 Ga0495661_0225139 Ga0495661_0225139_287_847 183
989 3300046678 Ga0495599_0311481 Ga0495599_0311481_152_712 183
990 3300046681 Ga0495647_0380959 Ga0495647_0380959_74_634 183
991 3300046684 Ga0495669_0174976 Ga0495669_0174976_133_693 183
992 3300046692 Ga0495671_0104887 Ga0495671_0104887_219_779 183
993 3300046809 Ga0495600_0176460 Ga0495600_0176460_607_1173 183
994 3300046809 Ga0495600_0232828 Ga0495600_0232828_251_811 183
995 3300047320 Ga0495672_0180190 Ga0495672_0180190_150_710 183
996 3300047444 Ga0495675_0085347 Ga0495675_0085347_1080_1640 183
997 3300047472 Ga0495686_0177102 Ga0495686_0177102_267_833 183
998 3300048088 Ga0495602_0094173 Ga0495602_0094173_1042_1602 183
999 3300048088 Ga0495602_0167787 Ga0495602_0167787_551_1111 183
1000 3300048904 Ga0496101_0759572 Ga0496101_0759572_161_721 183
1001 3300048910 Ga0496107_0784063 Ga0496107_0784063_109_669 183
1002 3300048914 Ga0496111_0609148 Ga0496111_0609148_91_651 183
1003 3300048918 Ga0496115_0609756 Ga0496115_0609756_210_770 183
1004 3300048924 Ga0496121_0001453 Ga0496121_0001453_22763_23323 183
1005 3300048929 Ga0496126_0000382 Ga0496126_0000382_41790_42350 183
1006 3300048929 Ga0496126_0181034 Ga0496126_0181034_135_695 183
1007 3300049460 Ga0495682_0002697 Ga0495682_0002697_3168_3728 183
1008 3300049460 Ga0495682_0069490 Ga0495682_0069490_376_936 183
1009 3300049568 Ga0501031_0013123 Ga0501031_0013123_223_798 183
1010 3300049568 Ga0501031_0187276 Ga0501031_0187276_662_1222 183
1011 3300049569 Ga0501032_0002879 Ga0501032_0002879_8276_8851 183
1012 3300049569 Ga0501032_0172421 Ga0501032_0172421_109_669 183
1013 3300049569 Ga0501032_0189848 Ga0501032_0189848_616_1176 183
1014 3300049570 Ga0501033_0010846 Ga0501033_0010846_1112_1672 183
1015 3300049570 Ga0501033_0017525 Ga0501033_0017525_3278_3838 183
1016 3300049570 Ga0501033_0022889 Ga0501033_0022889_1357_1932 183
1017 3300049570 Ga0501033_0037348 Ga0501033_0037348_922_1482 183
1018 3300049570 Ga0501033_0112221 Ga0501033_0112221_1303_1863 183
1019 3300049570 Ga0501033_0143427 Ga0501033_0143427_960_1520 183
1020 3300049570 Ga0501033_0206367 Ga0501033_0206367_559_1119 183
1021 3300049570 Ga0501033_0207890 Ga0501033_0207890_317_877 183
1022 3300049570 Ga0501033_0380446 Ga0501033_0380446_138_698 183
1023 3300049571 Ga0501034_0024746 Ga0501034_0024746_3389_3949 183
1024 3300049571 Ga0501034_0028875 Ga0501034_0028875_4597_5157 183
1025 3300049571 Ga0501034_0037159 Ga0501034_0037159_3009_3569 183
1026 3300049571 Ga0501034_0050752 Ga0501034_0050752_2329_2889 183
1027 3300049571 Ga0501034_0061665 Ga0501034_0061665_171_746 183
1028 3300049571 Ga0501034_0199220 Ga0501034_0199220_28_594 183
1029 3300049571 Ga0501034_0200241 Ga0501034_0200241_1162_1728 183
1030 3300049571 Ga0501034_0686318 Ga0501034_0686318_89_649 183
1031 3300049572 Ga0501036_0025013 Ga0501036_0025013_211_786 183
1032 3300049572 Ga0501036_0063277 Ga0501036_0063277_1755_2315 183
1033 3300049572 Ga0501036_0164352 Ga0501036_0164352_1278_1838 183
1034 3300049572 Ga0501036_0173519 Ga0501036_0173519_968_1528 183
1035 3300049572 Ga0501036_0280048 Ga0501036_0280048_611_1171 183
1036 3300049572 Ga0501036_0298255 Ga0501036_0298255_203_763 183
1037 3300049572 Ga0501036_0678094 Ga0501036_0678094_179_739 183
1038 3300049573 Ga0501037_0001908 Ga0501037_0001908_11915_12490 183
1039 3300049573 Ga0501037_0061859 Ga0501037_0061859_168_728 183
1040 3300049573 Ga0501037_0063198 Ga0501037_0063198_1306_1866 183
1041 3300049573 Ga0501037_0109154 Ga0501037_0109154_758_1318 183
1042 3300049573 Ga0501037_0307621 Ga0501037_0307621_526_1086 183
1043 3300049573 Ga0501037_0544375 Ga0501037_0544375_183_743 183
1044 3300049574 Ga0501038_0004396 Ga0501038_0004396_11676_12251 183
1045 3300049574 Ga0501038_0037442 Ga0501038_0037442_2107_2667 183
1046 3300049574 Ga0501038_0039711 Ga0501038_0039711_3316_3876 183
1047 3300049574 Ga0501038_0219310 Ga0501038_0219310_743_1303 183
1048 3300049575 Ga0501039_0001573 Ga0501039_0001573_3789_4364 183
1049 3300049575 Ga0501039_0170126 Ga0501039_0170126_68_628 183
1050 3300049575 Ga0501039_0273285 Ga0501039_0273285_745_1305 183
1051 3300049575 Ga0501039_0362359 Ga0501039_0362359_251_811 183
1052 3300049576 Ga0501040_0136817 Ga0501040_0136817_53_628 183
1053 3300049578 Ga0501042_0011142 Ga0501042_0011142_4511_5086 183
1054 3300049578 Ga0501042_0138532 Ga0501042_0138532_412_972 183
1055 3300049579 Ga0501043_0044199 Ga0501043_0044199_1249_1809 183
1056 3300049579 Ga0501043_0047734 Ga0501043_0047734_1279_1839 183
1057 3300049579 Ga0501043_0048058 Ga0501043_0048058_1674_2234 183
1058 3300049579 Ga0501043_0103614 Ga0501043_0103614_928_1488 183
1059 3300049579 Ga0501043_0163121 Ga0501043_0163121_715_1275 183
1060 3300049579 Ga0501043_0301665 Ga0501043_0301665_432_992 183
1061 3300049579 Ga0501043_0326996 Ga0501043_0326996_394_954 183
1062 3300049579 Ga0501043_0441265 Ga0501043_0441265_36_596 183
1063 3300049579 Ga0501043_0600199 Ga0501043_0600199_15_575 183
1064 3300049580 Ga0501046_0006278 Ga0501046_0006278_6079_6654 183
1065 3300049580 Ga0501046_0022323 Ga0501046_0022323_2569_3129 183
1066 3300049580 Ga0501046_0070115 Ga0501046_0070115_1569_2129 183
1067 3300049580 Ga0501046_0232626 Ga0501046_0232626_419_979 183
1068 3300049580 Ga0501046_0464146 Ga0501046_0464146_303_863 183
1069 3300049581 Ga0501047_0000350 Ga0501047_0000350_39784_40344 183
1070 3300049581 Ga0501047_0007287 Ga0501047_0007287_2480_3040 183
1071 3300049581 Ga0501047_0010032 Ga0501047_0010032_6727_7287 183
1072 3300049581 Ga0501047_0014477 Ga0501047_0014477_3761_4336 183
1073 3300049581 Ga0501047_0031326 Ga0501047_0031326_2250_2810 183
1074 3300049581 Ga0501047_0040472 Ga0501047_0040472_1812_2372 183
1075 3300049581 Ga0501047_0042551 Ga0501047_0042551_2938_3498 183
1076 3300049581 Ga0501047_0051089 Ga0501047_0051089_1184_1744 183
1077 3300049581 Ga0501047_0098142 Ga0501047_0098142_1273_1833 183
1078 3300049581 Ga0501047_0191966 Ga0501047_0191966_1178_1738 183
1079 3300049581 Ga0501047_0291916 Ga0501047_0291916_781_1341 183
1080 3300049581 Ga0501047_0384712 Ga0501047_0384712_17_577 183
1081 3300049582 Ga0501048_0003926 Ga0501048_0003926_4586_5161 183
1082 3300049583 Ga0501067_0001121 Ga0501067_0001121_9479_10039 183
1083 3300049583 Ga0501067_0003131 Ga0501067_0003131_4315_4890 183
1084 3300049583 Ga0501067_0179524 Ga0501067_0179524_323_883 183
1085 3300049584 Ga0501068_0086933 Ga0501068_0086933_1338_1913 183
1086 3300049584 Ga0501068_0102015 Ga0501068_0102015_1185_1745 183
1087 3300049585 Ga0501069_0009173 Ga0501069_0009173_1847_2407 183
1088 3300049585 Ga0501069_0352436 Ga0501069_0352436_10_585 183
1089 3300049586 Ga0501070_0002559 Ga0501070_0002559_3761_4336 183
1090 3300049586 Ga0501070_0016697 Ga0501070_0016697_982_1542 183
1091 3300049586 Ga0501070_0020814 Ga0501070_0020814_3235_3795 183
1092 3300049586 Ga0501070_0250203 Ga0501070_0250203_449_1009 183
1093 3300049586 Ga0501070_0267641 Ga0501070_0267641_338_898 183
1094 3300049586 Ga0501070_0500798 Ga0501070_0500798_274_834 183
1095 3300049588 Ga0501072_0085057 Ga0501072_0085057_10_570 183
1096 3300049589 Ga0501073_0000802 Ga0501073_0000802_12957_13532 183
1097 3300049589 Ga0501073_0052816 Ga0501073_0052816_1287_1847 183
1098 3300049589 Ga0501073_0086727 Ga0501073_0086727_1424_1984 183
1099 3300049589 Ga0501073_0196632 Ga0501073_0196632_448_1008 183
1100 3300049589 Ga0501073_0220696 Ga0501073_0220696_378_938 183
1101 3300049589 Ga0501073_0388685 Ga0501073_0388685_81_641 183
1102 3300049590 Ga0501074_0000138 Ga0501074_0000138_16877_17452 183
1103 3300049590 Ga0501074_0269797 Ga0501074_0269797_478_1038 183
1104 3300049592 Ga0501076_0174028 Ga0501076_0174028_95_655 183
1105 3300049741 Ga0501079_0007294 Ga0501079_0007294_4608_5168 183
1106 3300049741 Ga0501079_0034048 Ga0501079_0034048_2950_3510 183
1107 3300049742 Ga0501080_0008063 Ga0501080_0008063_3038_3613 183
1108 3300049742 Ga0501080_0043004 Ga0501080_0043004_3084_3644 183
1109 3300049742 Ga0501080_0135809 Ga0501080_0135809_1285_1845 183
1110 3300049742 Ga0501080_0235095 Ga0501080_0235095_164_724 183
1111 3300049742 Ga0501080_0270235 Ga0501080_0270235_586_1146 183
1112 3300049742 Ga0501080_0535621 Ga0501080_0535621_126_686 183
1113 3300049742 Ga0501080_0565136 Ga0501080_0565136_286_846 183
1114 3300049742 Ga0501080_0899462 Ga0501080_0899462_153_713 183
1115 3300049744 Ga0501083_0011493 Ga0501083_0011493_1560_2120 183
1116 3300049744 Ga0501083_0013979 Ga0501083_0013979_1233_1808 183
1117 3300049822 Ga0501035_0006141 Ga0501035_0006141_10471_11031 183
1118 3300049822 Ga0501035_0012091 Ga0501035_0012091_6537_7097 183
1119 3300049822 Ga0501035_0017376 Ga0501035_0017376_3038_3613 183
1120 3300049822 Ga0501035_0028741 Ga0501035_0028741_4190_4750 183
1121 3300049822 Ga0501035_0093049 Ga0501035_0093049_1860_2420 183
1122 3300049822 Ga0501035_0140601 Ga0501035_0140601_917_1477 183
1123 3300049822 Ga0501035_0202359 Ga0501035_0202359_150_710 183
1124 3300049822 Ga0501035_0260713 Ga0501035_0260713_899_1459 183
1125 3300049822 Ga0501035_0348031 Ga0501035_0348031_397_957 183
1126 3300049822 Ga0501035_0744250 Ga0501035_0744250_25_585 183
1127 3300049822 Ga0501035_0948049 Ga0501035_0948049_16_576 183
1128 3300049823 Ga0501044_0011515 Ga0501044_0011515_351_911 183
1129 3300049823 Ga0501044_0030091 Ga0501044_0030091_2380_2940 183
1130 3300049823 Ga0501044_0032482 Ga0501044_0032482_3236_3796 183
1131 3300049823 Ga0501044_0034767 Ga0501044_0034767_2065_2640 183
1132 3300049823 Ga0501044_0037156 Ga0501044_0037156_2577_3137 183
1133 3300049823 Ga0501044_0049845 Ga0501044_0049845_2404_2964 183
1134 3300049823 Ga0501044_0117640 Ga0501044_0117640_1919_2479 183
1135 3300049823 Ga0501044_0119373 Ga0501044_0119373_1179_1739 183
1136 3300049823 Ga0501044_0750484 Ga0501044_0750484_262_822 183
1137 3300049824 Ga0501045_0017987 Ga0501045_0017987_2778_3353 183
1138 3300050489 nmdc:mga03683_162589_c1 nmdc:mga03683_162589_c1_244_804 183
1139 3300050496 nmdc:mga07m45_268286_c1 nmdc:mga07m45_268286_c1_389_949 183
1140 3300050512 nmdc:mga0n895_300949_c1 nmdc:mga0n895_300949_c1_997_1557 183
1141 3300050513 nmdc:mga0rr50_215713_c1 nmdc:mga0rr50_215713_c1_317_877 183
1142 3300050514 nmdc:mga08x19_2099_c1 nmdc:mga08x19_2099_c1_5779_6339 183
1143 3300050514 nmdc:mga08x19_394_c1 nmdc:mga08x19_394_c1_13887_14447 183
1144 3300053087 Ga0500643_000003 Ga0500643_000003_505578_506138 183
1145 3300053088 Ga0500644_0169748 Ga0500644_0169748_114_674 183
1146 3300053096 Ga0500641_0103602 Ga0500641_0103602_501_1061 183
1147 3300053116 Ga0500592_007559 Ga0500592_007559_498_1058 183
1148 3300053119 Ga0500595_000573 Ga0500595_000573_15272_15832 183
1149 3300053119 Ga0500595_012715 Ga0500595_012715_424_984 183
1150 3300053119 Ga0500595_021796 Ga0500595_021796_1417_1977 183
1151 3300053133 Ga0500655_006821 Ga0500655_006821_751_1311 183
1152 3300053133 Ga0500655_039624 Ga0500655_039624_206_766 183
1153 3300053136 Ga0500559_0029710 Ga0500559_0029710_1134_1694 183
1154 3300053139 Ga0500568_0070385 Ga0500568_0070385_364_930 183
1155 3300053139 Ga0500568_0109710 Ga0500568_0109710_180_740 183
1156 3300053140 Ga0500573_0000008 Ga0500573_0000008_168401_168961 183
1157 3300053151 Ga0500604_0056627 Ga0500604_0056627_424_984 183
1158 3300053158 Ga0500627_0074816 Ga0500627_0074816_315_875 183
1159 3300053163 Ga0500639_055717 Ga0500639_055717_339_899 183
1160 3300053727 Ga0500611_057157 Ga0500611_057157_139_699 183
1161 3300053727 Ga0500611_141558 Ga0500611_141558_44_604 183
1162 3300054114 Ga0501084_0000017 Ga0501084_0000017_15447_16007 183
1163 3300054114 Ga0501084_0001765 Ga0501084_0001765_4015_4590 183
1164 3300054114 Ga0501084_0005496 Ga0501084_0005496_6333_6893 183
1165 3300060353 Ga0501082_0009503 Ga0501082_0009503_5949_6524 183
1166 3300060353 Ga0501082_0111544 Ga0501082_0111544_585_1145 183
1167 3300060353 Ga0501082_0444301 Ga0501082_0444301_473_1033 183
1168 3300001977 JGI24746J21847_1015012 JGI24746J21847_10150122 184
1169 3300002067 JGI24735J21928_10062511 JGI24735J21928_100625112 184
1170 3300005288 Ga0065714_10053664 Ga0065714_100536641 184
1171 3300005295 Ga0065707_10282750 Ga0065707_102827502 184
1172 3300005327 Ga0070658_10013633 Ga0070658_100136334 184
1173 3300005327 Ga0070658_10023621 Ga0070658_100236214 184
1174 3300005329 Ga0070683_100010050 Ga0070683_1000100507 184
1175 3300005329 Ga0070683_100066429 Ga0070683_1000664293 184
1176 3300005329 Ga0070683_100568337 Ga0070683_1005683371 184
1177 3300005344 Ga0070661_100316152 Ga0070661_1003161522 184
1178 3300005344 Ga0070661_100569001 Ga0070661_1005690011 184
1179 3300005356 Ga0070674_100126575 Ga0070674_1001265753 184
1180 3300005467 Ga0070706_100194351 Ga0070706_1001943512 184
1181 3300005518 Ga0070699_100344019 Ga0070699_1003440191 184
1182 3300005536 Ga0070697_100655508 Ga0070697_1006555082 184
1183 3300005539 Ga0068853_100147450 Ga0068853_1001474502 184
1184 3300005614 Ga0068856_100099566 Ga0068856_1000995662 184
1185 3300005937 Ga0081455_10000349 Ga0081455_1000034910 184
1186 3300005985 Ga0081539_10216430 Ga0081539_102164302 184
1187 3300006028 Ga0070717_11300470 Ga0070717_113004701 184
1188 3300009147 Ga0114129_10544686 Ga0114129_105446862 184
1189 3300025909 Ga0207705_10046870 Ga0207705_100468702 184
1190 3300025936 Ga0207670_10335047 Ga0207670_103350472 184
1191 3300028800 Ga0265338_10008175 Ga0265338_1000817515 184
1192 3300031251 Ga0265327_10096734 Ga0265327_100967343 184
1193 3300032002 Ga0307416_100191990 Ga0307416_1001919902 184
1194 3300035112 Ga0373932_0013397 Ga0373932_0013397_33_599 184
1195 3300035241 Ga0373961_0219399 Ga0373961_0219399_111_665 184
1196 3300044694 Ga0466963_0313952 Ga0466963_0313952_385_939 184
1197 3300045976 Ga0466967_0096885 Ga0466967_0096885_1290_1844 184
1198 3300049573 Ga0501037_0426827 Ga0501037_0426827_45_608 184
1199 3300049763 Ga0501266_037571 Ga0501266_037571_48_602 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

40

203

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xxv-assembly1.cif.gz_C crystal structure of a computationally designed immunogen s2_1.2 in complex with its elicited antibody c57 0.9309 107 178
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.919 3 182
5mlc-assembly1.cif.gz_9 cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions 0.9144 105 184
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9066 3 184
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.9018 3 182
ID Description Score Start End Superfamily
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9802 33 107 3.30.1360.40
1wqhA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.977 108 182 1.10.132.20
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9756 108 177 1.10.132.20
af_B6TAV8_107_177_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9746 33 102 3.30.1360.40
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9711 33 107 3.30.1360.40
ID Description Score Start End GO Terms
AF-A0A542XGQ7-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9869 4 184 GO:0005737
GO:0006415
GO:0043023
AF-A0A3N4UPL0-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.986 1 184 GO:0002184
GO:0005829
GO:0043023
AF-A0A6N8VG30-F1-model_v4 deleted 0.9851 5 184
AF-A0A7W1BH89-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9839 1 184 GO:0002184
GO:0005829
GO:0043023
AF-B1XXJ2-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9835 2 184 GO:0002184
GO:0005829
GO:0043023

Feature Viewer

pLDDT pTM Quality
84.69 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map