F491549

General Info

Members Datasets Scaffolds Average Seq Length
1197 410 1196 90

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0600274|Ga0501033_0600274_263_574
Length 103
Sequence MTRTTAPEETRMPVTVRIPAPLRPVTGGAAAVECAPGTVRELIDQLDAQHAGFRDRVMEDGSLRRFVNVFVAGEDVRFGEGIDTAVAEGQEVTILPAVAGGAR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
116 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
207 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
210 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
217 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
235 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
252 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
253 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
256 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
257 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
258 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
262 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
263 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
264 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
292 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
407 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
408 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.84
Nodule 0
Rhizoplane 9.61
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1054991 3300001977 Bacteria 564
2 JGI24737J22298_10099373 3300001990 Bacteria 862
3 JGI24743J22301_10042465 3300001991 Bacteria 915
4 JGI24735J21928_10170162 3300002067 Bacteria 630
5 JGI24738J21930_10009312 3300002075 Bacteria 2213
6 JGI24738J21930_10086603 3300002075 Bacteria 659
7 JGI24744J21845_10016965 3300002077 Bacteria 1448
8 JGI24742J22300_10043580 3300002244 Bacteria 803
9 JGI24751J29686_10066098 3300002459 Bacteria 744
10 Ga0070658_10102750 3300005327 Bacteria 2364
11 Ga0070658_10351889 3300005327 Bacteria 1261
12 Ga0070658_10821046 3300005327 Bacteria 808
13 Ga0070676_10068455 3300005328 Bacteria 2125
14 Ga0070676_10699340 3300005328 Bacteria 740
15 Ga0070683_100000404 3300005329 Bacteria 29752
16 Ga0070683_100019785 3300005329 Bacteria 5984
17 Ga0070683_100023077 3300005329 Bacteria 5564
18 Ga0070683_100117182 3300005329 Bacteria 2515
19 Ga0070677_10000008 3300005333 Bacteria 74027
20 Ga0068869_100104382 3300005334 Bacteria 2148
21 Ga0070666_10327087 3300005335 Bacteria 1094
22 Ga0070680_100185990 3300005336 Bacteria 1750
23 Ga0070680_100310840 3300005336 Bacteria 1337
24 Ga0070682_100000075 3300005337 Bacteria 90547
25 Ga0070682_100000090 3300005337 Bacteria 82642
26 Ga0070682_100008571 3300005337 Bacteria 5771
27 Ga0070682_100048176 3300005337 Bacteria 2653
28 Ga0070682_101289527 3300005337 Unclassified 620
29 Ga0068868_100000141 3300005338 Bacteria 46406
30 Ga0068868_100002016 3300005338 Bacteria 13976
31 Ga0068868_100013799 3300005338 Bacteria 5937
32 Ga0068868_100018130 3300005338 Bacteria 5256
33 Ga0068868_100021155 3300005338 Bacteria 4898
34 Ga0068868_100552551 3300005338 Bacteria 1015
35 Ga0070660_100044786 3300005339 Bacteria 3385
36 Ga0070660_100889625 3300005339 Bacteria 751
37 Ga0070689_100071687 3300005340 Bacteria 2707
38 Ga0070689_100079065 3300005340 Bacteria 2579
39 Ga0070689_100096525 3300005340 Bacteria 2337
40 Ga0070689_100141479 3300005340 Bacteria 1935
41 Ga0070689_100174120 3300005340 Bacteria 1745
42 Ga0070691_10000044 3300005341 Bacteria 36029
43 Ga0070691_10005099 3300005341 Bacteria 5968
44 Ga0070691_10054340 3300005341 Bacteria 1917
45 Ga0070691_10318388 3300005341 Bacteria 855
46 Ga0070691_10519651 3300005341 Bacteria 691
47 Ga0070691_10551001 3300005341 Bacteria 674
48 Ga0070687_100024909 3300005343 Bacteria 2864
49 Ga0070687_100876966 3300005343 Bacteria 642
50 Ga0070661_100000099 3300005344 Bacteria 71115
51 Ga0070661_100070438 3300005344 Bacteria 2572
52 Ga0070661_100611646 3300005344 Bacteria 882
53 Ga0070661_101199562 3300005344 Bacteria 635
54 Ga0070692_10007789 3300005345 Bacteria 4745
55 Ga0070692_10205169 3300005345 Bacteria 1157
56 Ga0070668_100014733 3300005347 Bacteria 5843
57 Ga0070668_100065770 3300005347 Bacteria 2812
58 Ga0070668_100544309 3300005347 Bacteria 1010
59 Ga0070668_101311660 3300005347 Bacteria 658
60 Ga0070669_100278458 3300005353 Bacteria 1340
61 Ga0070675_100000036 3300005354 Bacteria 85959
62 Ga0070675_100044837 3300005354 Bacteria 3617
63 Ga0070675_100676630 3300005354 Bacteria 939
64 Ga0070671_100035755 3300005355 Bacteria 4115
65 Ga0070671_100895212 3300005355 Bacteria 775
66 Ga0070674_100000012 3300005356 Bacteria 130773
67 Ga0070674_100012173 3300005356 Bacteria 5276
68 Ga0070673_100006402 3300005364 Bacteria 7653
69 Ga0070673_100041907 3300005364 Bacteria 3525
70 Ga0070673_100112144 3300005364 Bacteria 2263
71 Ga0070673_101879545 3300005364 Bacteria 568
72 Ga0070688_100001169 3300005365 Bacteria 13067
73 Ga0070688_100004292 3300005365 Bacteria 7413
74 Ga0070688_100266693 3300005365 Bacteria 1225
75 Ga0070688_100333987 3300005365 Bacteria 1105
76 Ga0070688_100350515 3300005365 Bacteria 1081
77 Ga0070659_100007424 3300005366 Bacteria 7963
78 Ga0070659_100086823 3300005366 Bacteria 2504
79 Ga0070667_100061212 3300005367 Bacteria 3187
80 Ga0070667_100155517 3300005367 Bacteria 2011
81 Ga0070667_100304295 3300005367 Bacteria 1436
82 Ga0070667_100567593 3300005367 Bacteria 1044
83 Ga0070709_10109003 3300005434 Bacteria 1858
84 Ga0070714_100443749 3300005435 Bacteria 1232
85 Ga0070713_100000380 3300005436 Bacteria 28361
86 Ga0070701_10039651 3300005438 Bacteria 2391
87 Ga0070701_10433121 3300005438 Bacteria 840
88 Ga0070701_11076225 3300005438 Bacteria 565
89 Ga0070711_100007421 3300005439 Bacteria 6669
90 Ga0070711_100216272 3300005439 Bacteria 1487
91 Ga0070705_100347488 3300005440 Bacteria 1080
92 Ga0070705_100892697 3300005440 Bacteria 714
93 Ga0070700_100005895 3300005441 Bacteria 6511
94 Ga0070700_100019529 3300005441 Bacteria 3912
95 Ga0070700_100659798 3300005441 Bacteria 827
96 Ga0070700_100792305 3300005441 Bacteria 762
97 Ga0070694_100207046 3300005444 Bacteria 1465
98 Ga0070694_100428926 3300005444 Bacteria 1040
99 Ga0070708_100236107 3300005445 Bacteria 1716
100 Ga0070708_100342446 3300005445 Bacteria 1409
101 Ga0070663_100001224 3300005455 Bacteria 14096
102 Ga0070663_100022099 3300005455 Bacteria 4246
103 Ga0070663_100064230 3300005455 Bacteria 2653
104 Ga0070663_101584565 3300005455 Bacteria 584
105 Ga0070663_101951450 3300005455 Unclassified 528
106 Ga0070678_100022682 3300005456 Bacteria 4166
107 Ga0070678_100026672 3300005456 Bacteria 3911
108 Ga0070662_100000002 3300005457 Bacteria 253208
109 Ga0070662_100040712 3300005457 Bacteria 3310
110 Ga0070681_10306669 3300005458 Bacteria 1497
111 Ga0070681_10691882 3300005458 Bacteria 935
112 Ga0068867_100005480 3300005459 Bacteria 8981
113 Ga0068867_100057996 3300005459 Bacteria 2869
114 Ga0068867_100386900 3300005459 Bacteria 1176
115 Ga0068867_100922860 3300005459 Bacteria 787
116 Ga0070685_10000020 3300005466 Bacteria 104332
117 Ga0070685_10000674 3300005466 Bacteria 18541
118 Ga0070685_10015073 3300005466 Bacteria 4104
119 Ga0070685_10049549 3300005466 Bacteria 2423
120 Ga0070685_10227841 3300005466 Bacteria 1224
121 Ga0070685_10362624 3300005466 Bacteria 994
122 Ga0070679_100000369 3300005530 Bacteria 38264
123 Ga0070679_102022938 3300005530 Bacteria 525
124 Ga0070684_100014210 3300005535 Bacteria 6441
125 Ga0070684_100043406 3300005535 Bacteria 3882
126 Ga0070684_100052595 3300005535 Bacteria 3542
127 Ga0070684_100068987 3300005535 Bacteria 3108
128 Ga0070684_100245100 3300005535 Bacteria 1638
129 Ga0070684_100259847 3300005535 Bacteria 1588
130 Ga0070684_100664192 3300005535 Bacteria 971
131 Ga0070684_102064302 3300005535 Bacteria 538
132 Ga0068853_100041279 3300005539 Bacteria 3940
133 Ga0068853_100078899 3300005539 Bacteria 2878
134 Ga0068853_100118729 3300005539 Bacteria 2357
135 Ga0068853_100156211 3300005539 Bacteria 2056
136 Ga0068853_101702993 3300005539 Bacteria 611
137 Ga0070672_100004196 3300005543 Bacteria 9414
138 Ga0070686_100020467 3300005544 Bacteria 3915
139 Ga0070686_100254198 3300005544 Bacteria 1285
140 Ga0070686_100312424 3300005544 Bacteria 1169
141 Ga0070695_100067435 3300005545 Bacteria 2334
142 Ga0070695_101840612 3300005545 Bacteria 508
143 Ga0070696_101977451 3300005546 Bacteria 506
144 Ga0070693_100003731 3300005547 Bacteria 7127
145 Ga0070693_100137476 3300005547 Bacteria 1534
146 Ga0070693_100885293 3300005547 Bacteria 668
147 Ga0070665_100000135 3300005548 Bacteria 138925
148 Ga0070665_100132532 3300005548 Bacteria 2494
149 Ga0070665_100452207 3300005548 Bacteria 1294
150 Ga0070665_101265781 3300005548 Bacteria 748
151 Ga0070704_100025392 3300005549 Bacteria 3901
152 Ga0070704_100115774 3300005549 Bacteria 2049
153 Ga0070704_100426534 3300005549 Bacteria 1137
154 Ga0070704_100821048 3300005549 Bacteria 832
155 Ga0068855_101242488 3300005563 Bacteria 773
156 Ga0070664_100013275 3300005564 Bacteria 6709
157 Ga0070664_100015019 3300005564 Bacteria 6321
158 Ga0070664_100058703 3300005564 Bacteria 3273
159 Ga0070664_100423367 3300005564 Bacteria 1220
160 Ga0070664_101751829 3300005564 Bacteria 589
161 Ga0068857_100079624 3300005577 Bacteria 2925
162 Ga0068857_100142811 3300005577 Bacteria 2165
163 Ga0068857_102037281 3300005577 Bacteria 563
164 Ga0068854_100059914 3300005578 Bacteria 2752
165 Ga0068854_100100662 3300005578 Bacteria 2166
166 Ga0068856_100004032 3300005614 Bacteria 14706
167 Ga0068856_100013553 3300005614 Bacteria 7892
168 Ga0068856_100026571 3300005614 Bacteria 5645
169 Ga0068856_100089785 3300005614 Bacteria 3056
170 Ga0068856_100589393 3300005614 Bacteria 1133
171 Ga0068856_100877220 3300005614 Bacteria 916
172 Ga0070702_100021516 3300005615 Bacteria 3394
173 Ga0070702_100082916 3300005615 Bacteria 1925
174 Ga0070702_100114120 3300005615 Bacteria 1680
175 Ga0070702_100430538 3300005615 Bacteria 952
176 Ga0068852_100000002 3300005616 Bacteria 268221
177 Ga0068852_100014610 3300005616 Bacteria 6053
178 Ga0068852_100283099 3300005616 Bacteria 1599
179 Ga0068852_102542207 3300005616 Bacteria 532
180 Ga0068859_100058409 3300005617 Bacteria 3886
181 Ga0068859_100864297 3300005617 Bacteria 990
182 Ga0068864_100000015 3300005618 Bacteria 303368
183 Ga0068864_100043739 3300005618 Bacteria 3836
184 Ga0068864_100317711 3300005618 Bacteria 1462
185 Ga0068866_10002177 3300005718 Bacteria 8157
186 Ga0068866_10122127 3300005718 Bacteria 1469
187 Ga0068866_10150533 3300005718 Bacteria 1347
188 Ga0068861_100053456 3300005719 Bacteria 3073
189 Ga0068861_100381342 3300005719 Bacteria 1246
190 Ga0068861_101538303 3300005719 Bacteria 654
191 Ga0068861_101667362 3300005719 Bacteria 630
192 Ga0068861_102113983 3300005719 Bacteria 563
193 Ga0068851_10001260 3300005834 Bacteria 11027
194 Ga0068851_10058940 3300005834 Bacteria 1963
195 Ga0068851_10186485 3300005834 Bacteria 1151
196 Ga0068870_10591646 3300005840 Bacteria 753
197 Ga0068870_10920843 3300005840 Bacteria 619
198 Ga0068863_100000022 3300005841 Bacteria 188278
199 Ga0068863_100181164 3300005841 Bacteria 2022
200 Ga0068863_100295132 3300005841 Bacteria 1572
201 Ga0068863_100537618 3300005841 Bacteria 1153
202 Ga0068863_100832664 3300005841 Bacteria 921
203 Ga0068863_101785515 3300005841 Bacteria 625
204 Ga0068858_100000075 3300005842 Bacteria 104349
205 Ga0068858_100004559 3300005842 Bacteria 13571
206 Ga0068858_100065398 3300005842 Bacteria 3365
207 Ga0068858_100492936 3300005842 Bacteria 1183
208 Ga0068858_100723347 3300005842 Bacteria 969
209 Ga0068860_100072334 3300005843 Bacteria 3277
210 Ga0068860_101003527 3300005843 Unclassified 853
211 Ga0068862_100106806 3300005844 Bacteria 2454
212 Ga0068862_100624784 3300005844 Bacteria 1037
213 Ga0068862_100716797 3300005844 Bacteria 970
214 Ga0068862_101508091 3300005844 Bacteria 678
215 Ga0081455_10052507 3300005937 Bacteria 3489
216 Ga0081455_10125997 3300005937 Bacteria 2010
217 Ga0081455_10133876 3300005937 Bacteria 1934
218 Ga0081455_10292207 3300005937 Bacteria 1173
219 Ga0081455_10721037 3300005937 Bacteria 633
220 Ga0081538_10000141 3300005981 Bacteria 74085
221 Ga0081538_10015536 3300005981 Bacteria 5886
222 Ga0081540_1069557 3300005983 Bacteria 1635
223 Ga0081540_1193796 3300005983 Bacteria 746
224 Ga0075365_10000322 3300006038 Bacteria 16913
225 Ga0075365_10002366 3300006038 Bacteria 9203
226 Ga0075365_10004204 3300006038 Bacteria 7584
227 Ga0075365_10289833 3300006038 Bacteria 1152
228 Ga0075368_10214180 3300006042 Bacteria 817
229 Ga0075368_10585306 3300006042 Bacteria 504
230 Ga0075363_100000848 3300006048 Bacteria 10649
231 Ga0075363_100026606 3300006048 Bacteria 2961
232 Ga0075363_100125268 3300006048 Bacteria 1438
233 Ga0075364_10143462 3300006051 Bacteria 1607
234 Ga0075364_10177770 3300006051 Bacteria 1440
235 Ga0075364_10590860 3300006051 Unclassified 759
236 Ga0075364_10926558 3300006051 Unclassified 593
237 Ga0075364_10978372 3300006051 Bacteria 575
238 Ga0075364_11111047 3300006051 Archaea 536
239 Ga0075432_10607487 3300006058 Bacteria 501
240 Ga0070715_10018094 3300006163 Bacteria 2680
241 Ga0070716_100023581 3300006173 Bacteria 3265
242 Ga0070716_101146135 3300006173 Bacteria 622
243 Ga0070712_100002890 3300006175 Bacteria 10656
244 Ga0070712_100083938 3300006175 Bacteria 2314
245 Ga0070712_100169040 3300006175 Bacteria 1695
246 Ga0075367_10297748 3300006178 Bacteria 1015
247 Ga0075367_10328756 3300006178 Bacteria 964
248 Ga0075367_10570243 3300006178 Unclassified 719
249 Ga0075367_10976436 3300006178 Bacteria 541
250 Ga0075369_10251904 3300006186 Bacteria 820
251 Ga0097621_100914617 3300006237 Bacteria 818
252 Ga0097621_101457935 3300006237 Bacteria 649
253 Ga0097621_102118254 3300006237 Bacteria 538
254 Ga0068871_100651227 3300006358 Bacteria 962
255 Ga0068871_100663723 3300006358 Bacteria 953
256 Ga0075428_100449888 3300006844 Bacteria 1380
257 Ga0075428_101442589 3300006844 Bacteria 722
258 Ga0075430_100907047 3300006846 Bacteria 726
259 Ga0075431_100000197 3300006847 Bacteria 44284
260 Ga0075431_100394317 3300006847 Bacteria 1386
261 Ga0075431_101071674 3300006847 Unclassified 771
262 Ga0075433_10000897 3300006852 Bacteria 20988
263 Ga0075433_10024940 3300006852 Bacteria 5052
264 Ga0075433_10143670 3300006852 Bacteria 2121
265 Ga0075433_11023957 3300006852 Bacteria 719
266 Ga0075434_100008498 3300006871 Bacteria 9550
267 Ga0075434_100027126 3300006871 Bacteria 5621
268 Ga0075434_100043274 3300006871 Bacteria 4465
269 Ga0075434_101321702 3300006871 Bacteria 732
270 Ga0075429_100660723 3300006880 Bacteria 916
271 Ga0075429_100922922 3300006880 Bacteria 764
272 Ga0068865_100000082 3300006881 Bacteria 50913
273 Ga0068865_100396217 3300006881 Bacteria 1130
274 Ga0068865_101588750 3300006881 Bacteria 588
275 Ga0068865_101602821 3300006881 Bacteria 585
276 Ga0075436_100447812 3300006914 Bacteria 940
277 Ga0075436_100503524 3300006914 Bacteria 886
278 Ga0097620_100058406 3300006931 Bacteria 3886
279 Ga0097620_100864181 3300006931 Bacteria 990
280 Ga0075435_100079846 3300007076 Bacteria 2685
281 Ga0075435_100091865 3300007076 Bacteria 2506
282 Ga0075435_100516530 3300007076 Bacteria 1033
283 Ga0075435_100869037 3300007076 Bacteria 786
284 Ga0075435_101140549 3300007076 Bacteria 682
285 Ga0105240_10511954 3300009093 Bacteria 1333
286 Ga0105240_10928934 3300009093 Bacteria 934
287 Ga0105240_11060168 3300009093 Bacteria 864
288 Ga0111539_10024755 3300009094 Bacteria 7362
289 Ga0111539_10025516 3300009094 Bacteria 7246
290 Ga0111539_10026270 3300009094 Bacteria 7122
291 Ga0111539_10743213 3300009094 Bacteria 1142
292 Ga0111539_11648192 3300009094 Bacteria 744
293 Ga0105245_10000278 3300009098 Bacteria 48473
294 Ga0105245_10000415 3300009098 Bacteria 39764
295 Ga0105245_10001311 3300009098 Bacteria 22474
296 Ga0105245_10024888 3300009098 Bacteria 5261
297 Ga0105245_10089688 3300009098 Bacteria 2827
298 Ga0105245_10657460 3300009098 Bacteria 1079
299 Ga0105245_11467468 3300009098 Bacteria 733
300 Ga0105245_12556305 3300009098 Bacteria 564
301 Ga0105247_10029264 3300009101 Bacteria 3337
302 Ga0105247_10077162 3300009101 Bacteria 2093
303 Ga0105247_10917529 3300009101 Bacteria 678
304 Ga0105247_11404910 3300009101 Bacteria 565
305 Ga0114129_10110402 3300009147 Bacteria 3796
306 Ga0114129_10113126 3300009147 Bacteria 3743
307 Ga0114129_10144653 3300009147 Bacteria 3257
308 Ga0114129_10639270 3300009147 Bacteria 1374
309 Ga0114129_11348365 3300009147 Bacteria 882
310 Ga0114129_11853892 3300009147 Bacteria 732
311 Ga0105243_10003503 3300009148 Bacteria 12673
312 Ga0105243_10007118 3300009148 Bacteria 8605
313 Ga0105243_10045660 3300009148 Bacteria 3444
314 Ga0105243_10342613 3300009148 Bacteria 1370
315 Ga0105243_11291863 3300009148 Bacteria 746
316 Ga0105243_12233372 3300009148 Bacteria 584
317 Ga0105243_12606308 3300009148 Bacteria 545
318 Ga0105241_10109322 3300009174 Bacteria 2211
319 Ga0105241_10612538 3300009174 Bacteria 985
320 Ga0105241_11035708 3300009174 Unclassified 770
321 Ga0105242_10000603 3300009176 Bacteria 28175
322 Ga0105242_10047166 3300009176 Bacteria 3498
323 Ga0105242_10234609 3300009176 Bacteria 1646
324 Ga0105242_10275850 3300009176 Bacteria 1525
325 Ga0105242_11011285 3300009176 Bacteria 840
326 Ga0105242_11918350 3300009176 Archaea 633
327 Ga0105242_12122077 3300009176 Unclassified 606
328 Ga0105248_10000020 3300009177 Bacteria 284637
329 Ga0105248_10126507 3300009177 Bacteria 2882
330 Ga0105248_10262577 3300009177 Bacteria 1944
331 Ga0105248_12444049 3300009177 Bacteria 595
332 Ga0105237_10193604 3300009545 Bacteria 2033
333 Ga0105237_10271855 3300009545 Bacteria 1697
334 Ga0105237_10354953 3300009545 Bacteria 1470
335 Ga0105237_11169596 3300009545 Bacteria 776
336 Ga0105238_10117153 3300009551 Bacteria 2644
337 Ga0105238_10496599 3300009551 Bacteria 1221
338 Ga0105249_10000143 3300009553 Bacteria 92539
339 Ga0105249_10122179 3300009553 Bacteria 2476
340 Ga0105249_10175569 3300009553 Bacteria 2081
341 Ga0105249_10282388 3300009553 Bacteria 1659
342 Ga0105249_10289714 3300009553 Bacteria 1638
343 Ga0105249_10795883 3300009553 Bacteria 1009
344 Ga0105249_10962415 3300009553 Unclassified 922
345 Ga0105249_11389140 3300009553 Bacteria 774
346 Ga0099796_10232412 3300010159 Bacteria 759
347 Ga0105239_10003725 3300010375 Bacteria 18559
348 Ga0105239_10221837 3300010375 Bacteria 2120
349 Ga0105239_10578239 3300010375 Bacteria 1280
350 Ga0105239_11087281 3300010375 Bacteria 920
351 Ga0105239_11414763 3300010375 Bacteria 803
352 Ga0105239_11461507 3300010375 Bacteria 790
353 Ga0105239_12274669 3300010375 Bacteria 631
354 Ga0105239_12358643 3300010375 Bacteria 619
355 Ga0105239_13401416 3300010375 Bacteria 517
356 Ga0105246_10037640 3300011119 Bacteria 3247
357 Ga0105246_12076913 3300011119 Bacteria 550
358 Ga0105246_12111193 3300011119 Bacteria 546
359 Ga0157344_1006686 3300012476 Bacteria 751
360 Ga0157342_1001537 3300012507 Bacteria 1735
361 Ga0157373_10534281 3300013100 Bacteria 849
362 Ga0157371_10125048 3300013102 Bacteria 1829
363 Ga0157371_10769195 3300013102 Bacteria 724
364 Ga0157371_11437258 3300013102 Bacteria 536
365 Ga0157370_10149601 3300013104 Bacteria 2173
366 Ga0157370_10151772 3300013104 Bacteria 2156
367 Ga0157369_10000074 3300013105 Bacteria 136668
368 Ga0157369_10808280 3300013105 Bacteria 963
369 Ga0157374_10004880 3300013296 Bacteria 11252
370 Ga0157374_10175786 3300013296 Bacteria 2090
371 Ga0157378_10003241 3300013297 Bacteria 14481
372 Ga0157378_10068068 3300013297 Bacteria 3192
373 Ga0157378_10103191 3300013297 Bacteria 2605
374 Ga0163162_10933622 3300013306 Bacteria 979
375 Ga0163162_11095063 3300013306 Bacteria 902
376 Ga0163162_12072284 3300013306 Bacteria 652
377 Ga0163162_13480145 3300013306 Bacteria 501
378 Ga0157372_10000053 3300013307 Bacteria 128824
379 Ga0157372_10057521 3300013307 Bacteria 4347
380 Ga0157372_10141100 3300013307 Bacteria 2776
381 Ga0157372_11734160 3300013307 Bacteria 718
382 Ga0157372_12641841 3300013307 Bacteria 576
383 Ga0157375_10013296 3300013308 Bacteria 7320
384 Ga0157375_10014036 3300013308 Bacteria 7145
385 Ga0157375_10014814 3300013308 Bacteria 6966
386 Ga0157375_10022190 3300013308 Bacteria 5841
387 Ga0157375_10111493 3300013308 Bacteria 2835
388 Ga0157375_10162776 3300013308 Bacteria 2374
389 Ga0157375_10881008 3300013308 Bacteria 1040
390 Ga0157375_13352272 3300013308 Bacteria 534
391 Ga0163163_10204269 3300014325 Bacteria 2024
392 Ga0163163_10220265 3300014325 Bacteria 1946
393 Ga0163163_11958336 3300014325 Bacteria 646
394 Ga0163163_13273731 3300014325 Bacteria 505
395 Ga0157380_10000016 3300014326 Bacteria 126029
396 Ga0157380_10002828 3300014326 Bacteria 11801
397 Ga0157380_10116286 3300014326 Bacteria 2257
398 Ga0157380_13512092 3300014326 Bacteria 502
399 Ga0182008_10336097 3300014497 Bacteria 798
400 Ga0157377_10039811 3300014745 Bacteria 2601
401 Ga0157377_10439528 3300014745 Bacteria 898
402 Ga0157377_10760733 3300014745 Bacteria 710
403 Ga0157379_10006763 3300014968 Bacteria 9911
404 Ga0157379_10400050 3300014968 Bacteria 1262
405 Ga0157379_12271030 3300014968 Bacteria 540
406 Ga0157379_12299167 3300014968 Bacteria 537
407 Ga0157376_10127119 3300014969 Bacteria 2269
408 Ga0157376_10169025 3300014969 Bacteria 1989
409 Ga0157376_11220358 3300014969 Bacteria 780
410 Ga0157376_11700456 3300014969 Bacteria 666
411 Ga0157376_11879406 3300014969 Bacteria 635
412 Ga0157376_12460768 3300014969 Bacteria 560
413 Ga0163161_10000053 3300017792 Bacteria 117408
414 Ga0163161_10154218 3300017792 Bacteria 1747
415 Ga0163161_10225825 3300017792 Bacteria 1451
416 Ga0163161_10359349 3300017792 Bacteria 1160
417 Ga0163161_10908301 3300017792 Bacteria 746
418 Ga0197907_11491576 3300020069 Bacteria 645
419 Ga0206351_10306398 3300020077 Bacteria 580
420 Ga0206352_10043259 3300020078 Bacteria 526
421 Ga0206350_10480026 3300020080 Bacteria 565
422 Ga0206354_10762690 3300020081 Bacteria 511
423 Ga0206353_11374094 3300020082 Bacteria 546
424 Ga0206353_11800342 3300020082 Bacteria 611
425 Ga0224712_10040416 3300022467 Bacteria 1755
426 Ga0224712_10214807 3300022467 Bacteria 878
427 Ga0207697_10377732 3300025315 Bacteria 629
428 Ga0207656_10000226 3300025321 Bacteria 20150
429 Ga0207656_10007404 3300025321 Bacteria 3995
430 Ga0207656_10093123 3300025321 Bacteria 1370
431 Ga0207682_10010613 3300025893 Bacteria 3606
432 Ga0207642_10000080 3300025899 Bacteria 25169
433 Ga0207642_10005540 3300025899 Bacteria 4127
434 Ga0207710_10019430 3300025900 Bacteria 2899
435 Ga0207710_10600436 3300025900 Bacteria 575
436 Ga0207688_10004162 3300025901 Bacteria 7882
437 Ga0207688_10008563 3300025901 Bacteria 5568
438 Ga0207688_10009259 3300025901 Bacteria 5369
439 Ga0207680_10005908 3300025903 Bacteria 5879
440 Ga0207680_10073801 3300025903 Bacteria 2122
441 Ga0207647_10128345 3300025904 Bacteria 1491
442 Ga0207685_10136019 3300025905 Bacteria 1096
443 Ga0207645_10276812 3300025907 Bacteria 1114
444 Ga0207643_10292299 3300025908 Bacteria 1012
445 Ga0207643_10292617 3300025908 Bacteria 1012
446 Ga0207643_10689263 3300025908 Bacteria 660
447 Ga0207705_10080206 3300025909 Bacteria 2378
448 Ga0207705_10300677 3300025909 Bacteria 1231
449 Ga0207654_10336258 3300025911 Bacteria 1036
450 Ga0207707_10096999 3300025912 Bacteria 2576
451 Ga0207707_10590699 3300025912 Bacteria 940
452 Ga0207695_10094013 3300025913 Bacteria 3006
453 Ga0207695_10680249 3300025913 Bacteria 910
454 Ga0207695_11115059 3300025913 Bacteria 669
455 Ga0207671_10287266 3300025914 Bacteria 1298
456 Ga0207671_11022210 3300025914 Bacteria 651
457 Ga0207671_11095034 3300025914 Bacteria 626
458 Ga0207671_11304137 3300025914 Bacteria 565
459 Ga0207693_10013472 3300025915 Bacteria 6593
460 Ga0207693_10014605 3300025915 Bacteria 6310
461 Ga0207693_10314032 3300025915 Bacteria 1227
462 Ga0207663_10021565 3300025916 Bacteria 3669
463 Ga0207663_10816636 3300025916 Bacteria 743
464 Ga0207660_11042254 3300025917 Bacteria 667
465 Ga0207662_10254632 3300025918 Bacteria 1153
466 Ga0207662_10863997 3300025918 Bacteria 639
467 Ga0207657_10000636 3300025919 Bacteria 37227
468 Ga0207657_10464617 3300025919 Bacteria 993
469 Ga0207649_10000127 3300025920 Bacteria 64603
470 Ga0207649_10021936 3300025920 Bacteria 3685
471 Ga0207649_10510953 3300025920 Bacteria 915
472 Ga0207649_11002915 3300025920 Bacteria 657
473 Ga0207652_10000321 3300025921 Bacteria 49720
474 Ga0207652_10495955 3300025921 Bacteria 1100
475 Ga0207652_11731803 3300025921 Bacteria 530
476 Ga0207694_10062887 3300025924 Bacteria 2890
477 Ga0207694_10277806 3300025924 Bacteria 1375
478 Ga0207694_10515897 3300025924 Bacteria 1001
479 Ga0207650_10031298 3300025925 Bacteria 3841
480 Ga0207650_11466038 3300025925 Unclassified 580
481 Ga0207659_10000013 3300025926 Bacteria 172742
482 Ga0207659_10153312 3300025926 Bacteria 1801
483 Ga0207659_10480730 3300025926 Bacteria 1049
484 Ga0207687_10000032 3300025927 Bacteria 143196
485 Ga0207687_10000036 3300025927 Bacteria 121934
486 Ga0207687_10000460 3300025927 Bacteria 27723
487 Ga0207687_10011833 3300025927 Bacteria 5708
488 Ga0207687_10017769 3300025927 Bacteria 4689
489 Ga0207687_10049514 3300025927 Bacteria 2922
490 Ga0207687_10592077 3300025927 Bacteria 934
491 Ga0207700_10000033 3300025928 Bacteria 123113
492 Ga0207664_10349734 3300025929 Bacteria 1308
493 Ga0207644_10090484 3300025931 Bacteria 2280
494 Ga0207644_10282981 3300025931 Bacteria 1332
495 Ga0207690_10023856 3300025932 Bacteria 3825
496 Ga0207690_10931749 3300025932 Bacteria 721
497 Ga0207706_10000001 3300025933 Bacteria 423014
498 Ga0207706_10007826 3300025933 Bacteria 9864
499 Ga0207706_10090788 3300025933 Bacteria 2686
500 Ga0207686_10000097 3300025934 Bacteria 72219
501 Ga0207686_10035280 3300025934 Bacteria 3001
502 Ga0207686_10085007 3300025934 Bacteria 2074
503 Ga0207686_10136529 3300025934 Bacteria 1689
504 Ga0207686_10320029 3300025934 Bacteria 1159
505 Ga0207686_10987846 3300025934 Bacteria 683
506 Ga0207686_11130594 3300025934 Bacteria 639
507 Ga0207709_10005457 3300025935 Bacteria 7225
508 Ga0207709_10005868 3300025935 Bacteria 6935
509 Ga0207709_10177766 3300025935 Bacteria 1500
510 Ga0207709_10387095 3300025935 Bacteria 1065
511 Ga0207670_10020378 3300025936 Bacteria 4074
512 Ga0207670_10142618 3300025936 Bacteria 1768
513 Ga0207670_10148022 3300025936 Bacteria 1739
514 Ga0207670_10840514 3300025936 Bacteria 766
515 Ga0207669_10000017 3300025937 Bacteria 119878
516 Ga0207669_10045981 3300025937 Bacteria 2576
517 Ga0207669_10091576 3300025937 Bacteria 1981
518 Ga0207669_10648256 3300025937 Bacteria 863
519 Ga0207669_11752037 3300025937 Bacteria 531
520 Ga0207704_10000184 3300025938 Bacteria 32775
521 Ga0207704_10028503 3300025938 Bacteria 3099
522 Ga0207704_10056024 3300025938 Bacteria 2412
523 Ga0207704_10496717 3300025938 Bacteria 983
524 Ga0207704_10599293 3300025938 Bacteria 902
525 Ga0207665_10041438 3300025939 Bacteria 3075
526 Ga0207665_10909089 3300025939 Bacteria 698
527 Ga0207691_10029702 3300025940 Bacteria 5112
528 Ga0207711_10000006 3300025941 Bacteria 792692
529 Ga0207711_10207341 3300025941 Bacteria 1790
530 Ga0207711_10691922 3300025941 Bacteria 951
531 Ga0207711_11553970 3300025941 Bacteria 605
532 Ga0207689_10103451 3300025942 Bacteria 2340
533 Ga0207689_10299305 3300025942 Bacteria 1333
534 Ga0207689_11176199 3300025942 Bacteria 646
535 Ga0207661_10001690 3300025944 Bacteria 15057
536 Ga0207661_10002110 3300025944 Bacteria 13678
537 Ga0207661_10091283 3300025944 Bacteria 2537
538 Ga0207661_10101297 3300025944 Bacteria 2419
539 Ga0207661_10172483 3300025944 Bacteria 1883
540 Ga0207661_10205492 3300025944 Bacteria 1733
541 Ga0207661_10857542 3300025944 Bacteria 836
542 Ga0207679_10059493 3300025945 Bacteria 2835
543 Ga0207679_10150953 3300025945 Bacteria 1891
544 Ga0207679_10513937 3300025945 Bacteria 1070
545 Ga0207651_10013423 3300025960 Bacteria 4689
546 Ga0207651_10016930 3300025960 Bacteria 4290
547 Ga0207651_10849003 3300025960 Bacteria 811
548 Ga0207712_10000058 3300025961 Bacteria 140948
549 Ga0207712_10106609 3300025961 Bacteria 2093
550 Ga0207712_10140778 3300025961 Bacteria 1851
551 Ga0207712_10596379 3300025961 Bacteria 955
552 Ga0207712_10641459 3300025961 Unclassified 922
553 Ga0207712_11554369 3300025961 Bacteria 593
554 Ga0207668_10008029 3300025972 Bacteria 6284
555 Ga0207668_10696879 3300025972 Bacteria 892
556 Ga0207668_10980130 3300025972 Bacteria 755
557 Ga0207668_11122450 3300025972 Bacteria 705
558 Ga0207640_10071795 3300025981 Bacteria 2333
559 Ga0207640_10106767 3300025981 Bacteria 1976
560 Ga0207640_10337120 3300025981 Bacteria 1206
561 Ga0207658_10023672 3300025986 Bacteria 4289
562 Ga0207658_10050389 3300025986 Bacteria 3064
563 Ga0207658_10181291 3300025986 Bacteria 1743
564 Ga0207658_10523750 3300025986 Bacteria 1058
565 Ga0207677_10000284 3300026023 Bacteria 37886
566 Ga0207677_10001038 3300026023 Bacteria 15272
567 Ga0207677_10045723 3300026023 Bacteria 2925
568 Ga0207677_11091726 3300026023 Bacteria 727
569 Ga0207677_11560441 3300026023 Bacteria 611
570 Ga0207677_11910282 3300026023 Unclassified 552
571 Ga0207677_11989510 3300026023 Bacteria 540
572 Ga0207703_10000088 3300026035 Bacteria 106080
573 Ga0207703_10000287 3300026035 Bacteria 55757
574 Ga0207703_10410402 3300026035 Bacteria 1258
575 Ga0207703_11884876 3300026035 Bacteria 574
576 Ga0207639_10005999 3300026041 Bacteria 8242
577 Ga0207639_10035406 3300026041 Bacteria 3694
578 Ga0207639_10693339 3300026041 Bacteria 944
579 Ga0207678_10002224 3300026067 Bacteria 17527
580 Ga0207678_10016375 3300026067 Bacteria 6509
581 Ga0207678_10046785 3300026067 Bacteria 3742
582 Ga0207678_10403060 3300026067 Bacteria 1184
583 Ga0207678_10936036 3300026067 Bacteria 766
584 Ga0207708_10009112 3300026075 Bacteria 7344
585 Ga0207708_10014443 3300026075 Bacteria 5910
586 Ga0207708_10227601 3300026075 Bacteria 1496
587 Ga0207708_10571844 3300026075 Bacteria 955
588 Ga0207708_10634317 3300026075 Bacteria 908
589 Ga0207702_10000637 3300026078 Bacteria 38379
590 Ga0207702_10014646 3300026078 Bacteria 6508
591 Ga0207702_10047334 3300026078 Bacteria 3624
592 Ga0207702_10055526 3300026078 Bacteria 3359
593 Ga0207702_11847708 3300026078 Bacteria 596
594 Ga0207641_10000016 3300026088 Bacteria 307363
595 Ga0207641_10207691 3300026088 Bacteria 1809
596 Ga0207641_10415730 3300026088 Bacteria 1294
597 Ga0207641_10633330 3300026088 Bacteria 1049
598 Ga0207641_10635275 3300026088 Bacteria 1048
599 Ga0207641_11472097 3300026088 Bacteria 682
600 Ga0207641_12064018 3300026088 Unclassified 571
601 Ga0207648_10015345 3300026089 Bacteria 7048
602 Ga0207648_10017486 3300026089 Bacteria 6522
603 Ga0207648_11007247 3300026089 Bacteria 780
604 Ga0207676_10000018 3300026095 Bacteria 306375
605 Ga0207676_10060765 3300026095 Bacteria 2990
606 Ga0207676_10357913 3300026095 Bacteria 1352
607 Ga0207674_10102949 3300026116 Bacteria 2835
608 Ga0207674_10149795 3300026116 Bacteria 2290
609 Ga0207674_11638187 3300026116 Bacteria 612
610 Ga0207675_100045437 3300026118 Bacteria 4103
611 Ga0207675_100087507 3300026118 Bacteria 2926
612 Ga0207683_10012982 3300026121 Bacteria 7113
613 Ga0207683_10037324 3300026121 Bacteria 4230
614 Ga0207683_10309590 3300026121 Bacteria 1446
615 Ga0207683_10341117 3300026121 Bacteria 1374
616 Ga0207683_10492637 3300026121 Bacteria 1132
617 Ga0207683_10499214 3300026121 Bacteria 1124
618 Ga0207698_10000004 3300026142 Bacteria 313614
619 Ga0207698_10005530 3300026142 Bacteria 7819
620 Ga0207698_10063263 3300026142 Bacteria 2895
621 Ga0209813_10337831 3300027866 Bacteria 593
622 Ga0207428_10264797 3300027907 Bacteria 1279
623 Ga0207428_10290421 3300027907 Bacteria 1212
624 Ga0268266_10000056 3300028379 Bacteria 289176
625 Ga0268266_10001254 3300028379 Bacteria 31003
626 Ga0268266_10059912 3300028379 Bacteria 3280
627 Ga0268266_10465490 3300028379 Bacteria 1203
628 Ga0268266_11304039 3300028379 Bacteria 701
629 Ga0268265_10205244 3300028380 Bacteria 1713
630 Ga0268265_10389931 3300028380 Bacteria 1284
631 Ga0268265_12114974 3300028380 Bacteria 570
632 Ga0268265_12333118 3300028380 Bacteria 542
633 Ga0268264_10295170 3300028381 Bacteria 1524
634 Ga0268264_11262797 3300028381 Bacteria 748
635 Ga0268264_11735309 3300028381 Bacteria 635
636 Ga0268264_12246106 3300028381 Bacteria 553
637 Ga0265337_1000066 3300028556 Bacteria 48673
638 Ga0265326_10000019 3300028558 Bacteria 137370
639 Ga0265319_1000069 3300028563 Bacteria 82640
640 Ga0265322_10000011 3300028654 Bacteria 167597
641 Ga0265336_10002798 3300028666 Bacteria 7048
642 Ga0265338_10158711 3300028800 Bacteria 1749
643 Ga0265324_10000283 3300029957 Bacteria 37587
644 Ga0265330_10288409 3300031235 Bacteria 691
645 Ga0265332_10116314 3300031238 Bacteria 1124
646 Ga0265328_10000737 3300031239 Bacteria 15188
647 Ga0265320_10000011 3300031240 Bacteria 249534
648 Ga0265329_10004312 3300031242 Bacteria 5950
649 Ga0265339_10051838 3300031249 Bacteria 2237
650 Ga0265331_10000858 3300031250 Bacteria 24739
651 Ga0265327_10000015 3300031251 Bacteria 496677
652 Ga0265327_10065922 3300031251 Bacteria 1829
653 Ga0265316_10181978 3300031344 Bacteria 1564
654 Ga0307408_100120691 3300031548 Bacteria 2030
655 Ga0316575_10325157 3300031665 Bacteria 653
656 Ga0265314_10000640 3300031711 Bacteria 42944
657 Ga0265342_10231156 3300031712 Bacteria 993
658 Ga0316576_10368159 3300031727 Bacteria 1068
659 Ga0307405_10467687 3300031731 Bacteria 1004
660 Ga0307410_10345634 3300031852 Bacteria 1187
661 Ga0307406_10646326 3300031901 Bacteria 877
662 Ga0307407_10494104 3300031903 Bacteria 896
663 Ga0307409_100315072 3300031995 Bacteria 1462
664 Ga0307409_100481919 3300031995 Bacteria 1204
665 Ga0307409_102877382 3300031995 Unclassified 508
666 Ga0307409_102975120 3300031995 Bacteria 500
667 Ga0307416_100007153 3300032002 Bacteria 7060
668 Ga0307416_101892543 3300032002 Bacteria 700
669 Ga0307411_11610405 3300032005 Bacteria 599
670 Ga0316583_10357425 3300032133 Bacteria 505
671 Ga0316596_1073834 3300033541 Bacteria 914
672 Ga0373953_0427738 3300035117 Bacteria 584
673 Ga0373955_0207534 3300035172 Bacteria 1167
674 Ga0373961_0334439 3300035241 Bacteria 568
675 Ga0373962_0222017 3300035242 Bacteria 647
676 Ga0316574_0084413 3300035398 Bacteria 2020
677 Ga0316574_0233711 3300035398 Bacteria 1176
678 Ga0316574_0710966 3300035398 Bacteria 616
679 Ga0373933_0230983 3300035724 Bacteria 1188
680 Ga0373937_0093812 3300036401 Bacteria 2783
681 Ga0373937_0099240 3300036401 Bacteria 2701
682 Ga0373937_0906547 3300036401 Bacteria 830
683 Ga0316582_1061819 3300036647 Bacteria 552
684 Ga0316584_0076334 3300036712 Bacteria 2511
685 Ga0316584_0105111 3300036712 Bacteria 2113
686 Ga0395899_0040970 3300037312 Bacteria 3463
687 Ga0395899_0521791 3300037312 Bacteria 768
688 Ga0395900_0047402 3300037418 Bacteria 4424
689 Ga0395900_0193162 3300037418 Bacteria 2064
690 Ga0395900_0451853 3300037418 Bacteria 1241
691 Ga0395900_1270433 3300037418 Bacteria 651
692 Ga0395900_1439792 3300037418 Bacteria 602
693 Ga0395900_1652645 3300037418 Bacteria 552
694 Ga0395898_0015116 3300037466 Bacteria 7923
695 Ga0395898_0028975 3300037466 Bacteria 5549
696 Ga0395898_0739748 3300037466 Bacteria 925
697 Ga0395898_1648897 3300037466 Archaea 565
698 Ga0395905_0058834 3300037471 Bacteria 3593
699 Ga0395905_0271174 3300037471 Bacteria 1583
700 Ga0436364_1436303 3300037853 Bacteria 575
701 Ga0395901_0044882 3300038443 Bacteria 4584
702 Ga0395901_0181831 3300038443 Bacteria 2205
703 Ga0395901_0475111 3300038443 Bacteria 1276
704 Ga0395901_0660183 3300038443 Bacteria 1048
705 Ga0395901_1033616 3300038443 Bacteria 796
706 Ga0395901_1548546 3300038443 Bacteria 618
707 Ga0451787_712849 3300041441 Bacteria 585
708 Ga0451800_1407260 3300041459 Bacteria 674
709 Ga0451804_0577682 3300041463 Bacteria 838
710 Ga0451804_0667066 3300041463 Bacteria 825
711 Ga0451807_1152741 3300041486 Bacteria 1140
712 Ga0451835_0727965 3300041492 Bacteria 520
713 Ga0451839_0942696 3300041496 Bacteria 777
714 Ga0451845_0014378 3300041501 Bacteria 612
715 Ga0451845_0941955 3300041501 Bacteria 1201
716 Ga0451849_0369994 3300041505 Bacteria 817
717 Ga0451851_1115656 3300041507 Bacteria 684
718 Ga0451853_0637403 3300041512 Unclassified 655
719 Ga0451853_2136927 3300041512 Bacteria 4240
720 Ga0451853_3163208 3300041512 Bacteria 658
721 Ga0451853_3772225 3300041512 Bacteria 987
722 Ga0450923_189473 3300042125 Bacteria 509
723 Ga0450906_106260 3300042145 Bacteria 513
724 Ga0439459_0009945 3300042438 Bacteria 1650
725 Ga0439440_0176935 3300042993 Bacteria 623
726 Ga0466965_0682609 3300044683 Unclassified 588
727 Ga0466963_0000017 3300044694 Bacteria 58283
728 Ga0466963_0237008 3300044694 Bacteria 1279
729 Ga0466963_0465545 3300044694 Bacteria 892
730 Ga0466964_0680097 3300044706 Bacteria 572
731 Ga0466971_0590931 3300044719 Bacteria 553
732 Ga0466957_0001414 3300044842 Bacteria 12517
733 Ga0466957_0929659 3300044842 Bacteria 622
734 Ga0466960_0604182 3300044901 Bacteria 651
735 Ga0466967_0000001 3300045976 Bacteria 229823
736 Ga0466967_0518478 3300045976 Bacteria 1171
737 Ga0466967_0782900 3300045976 Bacteria 947
738 Ga0466967_1023652 3300045976 Bacteria 822
739 Ga0466967_1714555 3300045976 Bacteria 626
740 Ga0466967_2343148 3300045976 Bacteria 529
741 Ga0495592_0000607 3300046454 Bacteria 25304
742 Ga0495603_0000286 3300046455 Bacteria 26902
743 Ga0495603_0001350 3300046455 Bacteria 14245
744 Ga0495603_0050651 3300046455 Bacteria 2469
745 Ga0495629_0000245 3300046459 Bacteria 47272
746 Ga0495629_0005286 3300046459 Bacteria 9650
747 Ga0495629_0010859 3300046459 Bacteria 6622
748 Ga0495629_1081189 3300046459 Bacteria 519
749 Ga0495641_0000005 3300046461 Bacteria 206626
750 Ga0495641_0009181 3300046461 Bacteria 5911
751 Ga0495641_0031015 3300046461 Bacteria 2558
752 Ga0495641_0409205 3300046461 Bacteria 616
753 Ga0495651_0176727 3300046462 Bacteria 1515
754 Ga0495651_0297780 3300046462 Bacteria 1083
755 Ga0495653_0103405 3300046463 Bacteria 2060
756 Ga0495653_0135879 3300046463 Bacteria 1735
757 Ga0495653_0169316 3300046463 Bacteria 1509
758 Ga0495653_0197448 3300046463 Bacteria 1368
759 Ga0495653_0881077 3300046463 Bacteria 534
760 Ga0495582_0000001 3300046473 Bacteria 252434
761 Ga0495639_0236502 3300046475 Bacteria 901
762 Ga0495662_0000001 3300046476 Bacteria 179185
763 Ga0495664_0282300 3300046477 Bacteria 1003
764 Ga0495584_0562469 3300046491 Bacteria 581
765 Ga0495594_0109392 3300046499 Bacteria 1558
766 Ga0495606_0000040 3300046507 Bacteria 223500
767 Ga0495608_0000007 3300046511 Bacteria 313495
768 Ga0495608_0023011 3300046511 Bacteria 4272
769 Ga0495608_0038868 3300046511 Bacteria 3193
770 Ga0495608_0399205 3300046511 Bacteria 841
771 Ga0495608_0525028 3300046511 Bacteria 715
772 Ga0495610_0041056 3300046512 Bacteria 2326
773 Ga0495618_0000014 3300046514 Bacteria 163136
774 Ga0495620_0000784 3300046515 Bacteria 19458
775 Ga0495620_0072027 3300046515 Bacteria 1412
776 Ga0495628_0000679 3300046516 Bacteria 31290
777 Ga0495628_0031056 3300046516 Bacteria 4321
778 Ga0495628_0074492 3300046516 Bacteria 2644
779 Ga0495628_0098751 3300046516 Bacteria 2255
780 Ga0495630_0000014 3300046517 Bacteria 217229
781 Ga0495630_0003407 3300046517 Bacteria 11078
782 Ga0495630_0069675 3300046517 Bacteria 2646
783 Ga0495644_0001871 3300046523 Bacteria 8485
784 Ga0495663_0100331 3300046525 Bacteria 953
785 Ga0495652_0011995 3300046529 Bacteria 7834
786 Ga0495652_0214350 3300046529 Bacteria 1451
787 Ga0495640_0043829 3300046533 Bacteria 3113
788 Ga0495640_0249307 3300046533 Bacteria 1112
789 Ga0495640_0528033 3300046533 Bacteria 717
790 Ga0495586_0086430 3300046535 Bacteria 1728
791 Ga0495587_0827437 3300046536 Bacteria 505
792 Ga0495645_0027447 3300046543 Bacteria 4137
793 Ga0495645_0046873 3300046543 Bacteria 3150
794 Ga0495667_0000020 3300046559 Bacteria 180876
795 Ga0495656_0000465 3300046615 Bacteria 13215
796 Ga0495656_0433451 3300046615 Bacteria 691
797 Ga0495668_0223839 3300046616 Bacteria 1030
798 Ga0495634_0000028 3300046642 Bacteria 114075
799 Ga0495634_0001744 3300046642 Bacteria 18826
800 Ga0495634_0105054 3300046642 Bacteria 1821
801 Ga0495634_0128989 3300046642 Bacteria 1614
802 Ga0495634_0386255 3300046642 Bacteria 834
803 Ga0495635_0026499 3300046663 Bacteria 4033
804 Ga0495635_0328011 3300046663 Bacteria 1024
805 Ga0495661_0575247 3300046665 Bacteria 531
806 Ga0495588_0000362 3300046674 Bacteria 28212
807 Ga0495588_0226240 3300046674 Bacteria 987
808 Ga0495657_0000001 3300046675 Bacteria 445641
809 Ga0495657_0024829 3300046675 Bacteria 4263
810 Ga0495599_0046673 3300046678 Bacteria 2716
811 Ga0495646_0151250 3300046680 Bacteria 1291
812 Ga0495646_0198191 3300046680 Bacteria 1095
813 Ga0495647_0000001 3300046681 Bacteria 222371
814 Ga0495647_0008133 3300046681 Bacteria 3524
815 Ga0495647_0238325 3300046681 Unclassified 807
816 Ga0495658_0000002 3300046683 Bacteria 309651
817 Ga0495658_0060194 3300046683 Bacteria 2177
818 Ga0495658_0295977 3300046683 Bacteria 1023
819 Ga0495669_0000113 3300046684 Bacteria 52780
820 Ga0495669_0399452 3300046684 Bacteria 666
821 Ga0495613_0000005 3300046689 Bacteria 222558
822 Ga0495613_0000041 3300046689 Bacteria 130784
823 Ga0495613_0039372 3300046689 Bacteria 3505
824 Ga0495624_0000417 3300046690 Bacteria 33743
825 Ga0495624_0263454 3300046690 Bacteria 1041
826 Ga0495624_0802842 3300046690 Bacteria 556
827 Ga0495670_0006058 3300046691 Bacteria 5927
828 Ga0495671_0459099 3300046692 Bacteria 609
829 Ga0495600_0011717 3300046809 Bacteria 5472
830 Ga0495600_0112106 3300046809 Bacteria 1776
831 Ga0495600_0303642 3300046809 Bacteria 1006
832 Ga0495581_0203413 3300047315 Bacteria 1158
833 Ga0495581_0384812 3300047315 Bacteria 819
834 Ga0495604_0000239 3300047317 Bacteria 49113
835 Ga0495604_0001251 3300047317 Bacteria 20805
836 Ga0495674_0247369 3300047319 Bacteria 1468
837 Ga0495676_0000827 3300047321 Bacteria 25944
838 Ga0495676_0002855 3300047321 Bacteria 15572
839 Ga0495676_0012579 3300047321 Bacteria 7619
840 Ga0495676_0028979 3300047321 Bacteria 4719
841 Ga0495676_0117131 3300047321 Bacteria 1944
842 Ga0495676_0231492 3300047321 Bacteria 1269
843 Ga0495676_0280990 3300047321 Bacteria 1127
844 Ga0495676_0912990 3300047321 Bacteria 562
845 Ga0495680_0000143 3300047322 Bacteria 71946
846 Ga0495680_0001430 3300047322 Bacteria 25733
847 Ga0495680_0067314 3300047322 Bacteria 2738
848 Ga0495675_0001421 3300047444 Bacteria 14505
849 Ga0495673_0113592 3300047469 Bacteria 1080
850 Ga0495684_0210310 3300047471 Bacteria 1431
851 Ga0495684_1033764 3300047471 Bacteria 520
852 Ga0495686_0270817 3300047472 Bacteria 947
853 Ga0495593_0231268 3300047673 Bacteria 927
854 Ga0495602_0001031 3300048088 Bacteria 27141
855 Ga0495602_0156363 3300048088 Bacteria 1785
856 Ga0495602_0271539 3300048088 Bacteria 1253
857 Ga0495602_0614244 3300048088 Bacteria 746
858 Ga0495602_1160562 3300048088 Bacteria 504
859 Ga0495614_0012048 3300048089 Bacteria 3798
860 Ga0495614_0257758 3300048089 Bacteria 799
861 Ga0496100_0000001 3300048903 Bacteria 530179
862 Ga0496100_0000013 3300048903 Bacteria 177476
863 Ga0496100_0013391 3300048903 Bacteria 4728
864 Ga0496100_0322156 3300048903 Bacteria 1161
865 Ga0496100_0498137 3300048903 Bacteria 938
866 Ga0496100_0701642 3300048903 Bacteria 790
867 Ga0496100_1241638 3300048903 Bacteria 588
868 Ga0496100_1366887 3300048903 Bacteria 559
869 Ga0496101_0000004 3300048904 Bacteria 331599
870 Ga0496101_0000035 3300048904 Bacteria 177237
871 Ga0496101_0245701 3300048904 Bacteria 1393
872 Ga0496101_0789118 3300048904 Bacteria 749
873 Ga0496102_0000211 3300048905 Bacteria 77793
874 Ga0496102_0045517 3300048905 Bacteria 3984
875 Ga0496102_0235659 3300048905 Bacteria 1726
876 Ga0496102_0639694 3300048905 Unclassified 987
877 Ga0496102_1095013 3300048905 Bacteria 716
878 Ga0496103_0000083 3300048906 Bacteria 108615
879 Ga0496103_0006964 3300048906 Bacteria 6750
880 Ga0496103_0223100 3300048906 Bacteria 1212
881 Ga0496104_0000015 3300048907 Bacteria 374530
882 Ga0496104_0000026 3300048907 Bacteria 210098
883 Ga0496104_0000052 3300048907 Bacteria 137286
884 Ga0496104_0000765 3300048907 Bacteria 27516
885 Ga0496104_0017182 3300048907 Bacteria 6581
886 Ga0496104_0028668 3300048907 Bacteria 5160
887 Ga0496104_0317011 3300048907 Bacteria 1472
888 Ga0496104_0666724 3300048907 Bacteria 949
889 Ga0496105_0000004 3300048908 Bacteria 475798
890 Ga0496105_0000030 3300048908 Bacteria 137325
891 Ga0496105_0000409 3300048908 Bacteria 28168
892 Ga0496105_0022580 3300048908 Bacteria 5096
893 Ga0496105_0022858 3300048908 Bacteria 5068
894 Ga0496105_0027673 3300048908 Bacteria 4634
895 Ga0496105_0052093 3300048908 Bacteria 3379
896 Ga0496105_0672496 3300048908 Bacteria 797
897 Ga0496106_0000076 3300048909 Bacteria 79088
898 Ga0496106_0000121 3300048909 Bacteria 59910
899 Ga0496106_0004512 3300048909 Bacteria 10312
900 Ga0496106_0012259 3300048909 Bacteria 6329
901 Ga0496106_0031326 3300048909 Bacteria 3962
902 Ga0496106_0072451 3300048909 Bacteria 2635
903 Ga0496106_0286024 3300048909 Bacteria 1321
904 Ga0496106_0357051 3300048909 Bacteria 1174
905 Ga0496107_0000005 3300048910 Bacteria 281747
906 Ga0496107_0000020 3300048910 Bacteria 148990
907 Ga0496107_0016540 3300048910 Bacteria 5182
908 Ga0496107_0032962 3300048910 Bacteria 3704
909 Ga0496107_0041276 3300048910 Bacteria 3313
910 Ga0496107_0072035 3300048910 Bacteria 2512
911 Ga0496107_0089310 3300048910 Bacteria 2250
912 Ga0496107_0481660 3300048910 Bacteria 921
913 Ga0496107_0568796 3300048910 Bacteria 839
914 Ga0496108_0000006 3300048911 Bacteria 469473
915 Ga0496108_0000063 3300048911 Bacteria 118950
916 Ga0496108_0003280 3300048911 Bacteria 12999
917 Ga0496108_0005560 3300048911 Bacteria 10200
918 Ga0496108_0015242 3300048911 Bacteria 6272
919 Ga0496108_0054035 3300048911 Bacteria 3370
920 Ga0496108_0113371 3300048911 Bacteria 2320
921 Ga0496108_0185162 3300048911 Bacteria 1803
922 Ga0496108_1648461 3300048911 Bacteria 529
923 Ga0496109_0000009 3300048912 Bacteria 236561
924 Ga0496109_0000012 3300048912 Bacteria 229699
925 Ga0496109_0000348 3300048912 Bacteria 43133
926 Ga0496109_0003361 3300048912 Bacteria 13379
927 Ga0496109_0005652 3300048912 Bacteria 10461
928 Ga0496109_0068649 3300048912 Bacteria 3249
929 Ga0496109_0070649 3300048912 Bacteria 3204
930 Ga0496109_0107331 3300048912 Bacteria 2593
931 Ga0496109_0130860 3300048912 Bacteria 2342
932 Ga0496109_0644781 3300048912 Bacteria 996
933 Ga0496109_0831491 3300048912 Bacteria 861
934 Ga0496110_0000183 3300048913 Bacteria 39196
935 Ga0496110_0002164 3300048913 Bacteria 14666
936 Ga0496110_0012481 3300048913 Bacteria 6986
937 Ga0496110_0020894 3300048913 Bacteria 5531
938 Ga0496110_0059269 3300048913 Bacteria 3374
939 Ga0496110_0088109 3300048913 Bacteria 2772
940 Ga0496110_0427934 3300048913 Bacteria 1207
941 Ga0496111_0000006 3300048914 Bacteria 107643
942 Ga0496111_0000044 3300048914 Bacteria 49014
943 Ga0496111_0012021 3300048914 Bacteria 5851
944 Ga0496111_0017776 3300048914 Bacteria 4918
945 Ga0496111_0047291 3300048914 Bacteria 3098
946 Ga0496111_0117841 3300048914 Bacteria 1959
947 Ga0496111_0406139 3300048914 Bacteria 1006
948 Ga0496111_0720627 3300048914 Bacteria 725
949 Ga0496111_0987842 3300048914 Bacteria 604
950 Ga0496112_0000025 3300048915 Bacteria 146197
951 Ga0496112_0320767 3300048915 Bacteria 1493
952 Ga0496112_0852429 3300048915 Unclassified 834
953 Ga0496113_0038054 3300048916 Bacteria 3534
954 Ga0496113_0052521 3300048916 Bacteria 3044
955 Ga0496113_0072254 3300048916 Bacteria 2625
956 Ga0496113_0153224 3300048916 Bacteria 1819
957 Ga0496113_1451966 3300048916 Bacteria 530
958 Ga0496114_0000039 3300048917 Bacteria 138486
959 Ga0496114_0008849 3300048917 Bacteria 7979
960 Ga0496114_0070615 3300048917 Bacteria 2934
961 Ga0496114_0243025 3300048917 Bacteria 1583
962 Ga0496114_0385840 3300048917 Bacteria 1240
963 Ga0496114_0484440 3300048917 Bacteria 1094
964 Ga0496114_0738916 3300048917 Bacteria 861
965 Ga0496114_0747306 3300048917 Bacteria 855
966 Ga0496114_1053735 3300048917 Bacteria 697
967 Ga0496115_0000011 3300048918 Bacteria 222529
968 Ga0496115_0000377 3300048918 Bacteria 36788
969 Ga0496115_0014845 3300048918 Bacteria 5907
970 Ga0496115_0058673 3300048918 Bacteria 3097
971 Ga0496116_0000848 3300048919 Bacteria 38292
972 Ga0496118_0081280 3300048921 Bacteria 2276
973 Ga0496119_0006696 3300048922 Bacteria 10591
974 Ga0496119_0074670 3300048922 Bacteria 1973
975 Ga0496120_0020522 3300048923 Bacteria 4197
976 Ga0496120_0201590 3300048923 Bacteria 963
977 Ga0496120_0253122 3300048923 Bacteria 826
978 Ga0496121_0019544 3300048924 Bacteria 6765
979 Ga0496121_0037698 3300048924 Bacteria 4290
980 Ga0496121_0061978 3300048924 Bacteria 3066
981 Ga0496124_0051640 3300048927 Bacteria 3497
982 Ga0496124_0854420 3300048927 Bacteria 557
983 Ga0496125_0056109 3300048928 Bacteria 3202
984 Ga0496125_0080795 3300048928 Bacteria 2486
985 Ga0496125_0104445 3300048928 Bacteria 2075
986 Ga0496126_0055061 3300048929 Bacteria 3600
987 Ga0496126_0093953 3300048929 Bacteria 2632
988 Ga0496126_0277289 3300048929 Bacteria 1390
989 Ga0501031_0002175 3300049568 Bacteria 12379
990 Ga0501031_0116828 3300049568 Bacteria 1743
991 Ga0501031_0231236 3300049568 Bacteria 1203
992 Ga0501032_0029241 3300049569 Bacteria 3783
993 Ga0501032_1060851 3300049569 Bacteria 508
994 Ga0501033_0003689 3300049570 Bacteria 12454
995 Ga0501033_0600274 3300049570 Bacteria 755
996 Ga0501034_0060242 3300049571 Bacteria 3813
997 Ga0501034_0846348 3300049571 Bacteria 805
998 Ga0501034_1296104 3300049571 Bacteria 605
999 Ga0501036_0054251 3300049572 Bacteria 3394
1000 Ga0501036_0472846 3300049572 Bacteria 1044
1001 Ga0501036_0778303 3300049572 Bacteria 789
1002 Ga0501036_0883511 3300049572 Bacteria 734
1003 Ga0501037_0002926 3300049573 Bacteria 12385
1004 Ga0501038_0005058 3300049574 Bacteria 12248
1005 Ga0501038_0356257 3300049574 Bacteria 1139
1006 Ga0501038_0506083 3300049574 Bacteria 923
1007 Ga0501039_0136070 3300049575 Bacteria 1929
1008 Ga0501039_0511325 3300049575 Bacteria 943
1009 Ga0501040_0061674 3300049576 Bacteria 2579
1010 Ga0501040_0310184 3300049576 Bacteria 1128
1011 Ga0501040_0454371 3300049576 Bacteria 922
1012 Ga0501040_0476131 3300049576 Bacteria 899
1013 Ga0501040_0480873 3300049576 Bacteria 895
1014 Ga0501041_0273970 3300049577 Bacteria 1062
1015 Ga0501041_0444395 3300049577 Bacteria 823
1016 Ga0501041_0489910 3300049577 Bacteria 782
1017 Ga0501041_0599604 3300049577 Bacteria 703
1018 Ga0501042_0012872 3300049578 Bacteria 5681
1019 Ga0501042_0308826 3300049578 Bacteria 1143
1020 Ga0501042_0578302 3300049578 Bacteria 817
1021 Ga0501042_0648213 3300049578 Bacteria 768
1022 Ga0501042_0783642 3300049578 Bacteria 694
1023 Ga0501043_0012332 3300049579 Bacteria 6682
1024 Ga0501043_0122982 3300049579 Bacteria 2035
1025 Ga0501043_1334412 3300049579 Bacteria 500
1026 Ga0501046_0004559 3300049580 Bacteria 12539
1027 Ga0501046_0979029 3300049580 Bacteria 588
1028 Ga0501047_0004952 3300049581 Bacteria 12510
1029 Ga0501047_0036469 3300049581 Bacteria 4752
1030 Ga0501047_0073899 3300049581 Bacteria 3282
1031 Ga0501047_0239337 3300049581 Bacteria 1666
1032 Ga0501047_0341399 3300049581 Bacteria 1335
1033 Ga0501047_0439594 3300049581 Bacteria 1134
1034 Ga0501047_0749317 3300049581 Bacteria 793
1035 Ga0501047_1080050 3300049581 Bacteria 616
1036 Ga0501048_0003128 3300049582 Bacteria 12640
1037 Ga0501048_0806070 3300049582 Bacteria 675
1038 Ga0501067_0058076 3300049583 Bacteria 2143
1039 Ga0501067_0195064 3300049583 Bacteria 1128
1040 Ga0501067_0479181 3300049583 Bacteria 696
1041 Ga0501068_0002345 3300049584 Bacteria 10082
1042 Ga0501068_0419741 3300049584 Bacteria 864
1043 Ga0501068_0811080 3300049584 Bacteria 614
1044 Ga0501069_0004919 3300049585 Bacteria 6926
1045 Ga0501069_0076677 3300049585 Bacteria 1879
1046 Ga0501069_0285522 3300049585 Bacteria 966
1047 Ga0501069_0597746 3300049585 Bacteria 662
1048 Ga0501069_0663541 3300049585 Bacteria 628
1049 Ga0501070_0004064 3300049586 Bacteria 12575
1050 Ga0501070_0052975 3300049586 Bacteria 3367
1051 Ga0501070_0112042 3300049586 Bacteria 2255
1052 Ga0501070_0285402 3300049586 Bacteria 1346
1053 Ga0501070_0508727 3300049586 Bacteria 967
1054 Ga0501070_0741122 3300049586 Bacteria 775
1055 Ga0501071_0144925 3300049587 Bacteria 1770
1056 Ga0501071_0581455 3300049587 Bacteria 861
1057 Ga0501071_0760788 3300049587 Bacteria 746
1058 Ga0501071_1248169 3300049587 Bacteria 574
1059 Ga0501071_1492584 3300049587 Bacteria 522
1060 Ga0501072_0017464 3300049588 Bacteria 5513
1061 Ga0501072_0262480 3300049588 Bacteria 1375
1062 Ga0501072_0420609 3300049588 Bacteria 1059
1063 Ga0501072_0439029 3300049588 Bacteria 1034
1064 Ga0501072_0484498 3300049588 Bacteria 978
1065 Ga0501072_1025716 3300049588 Bacteria 643
1066 Ga0501073_0013576 3300049589 Bacteria 5924
1067 Ga0501073_0168325 3300049589 Bacteria 1517
1068 Ga0501073_0923848 3300049589 Bacteria 601
1069 Ga0501074_0013977 3300049590 Bacteria 5835
1070 Ga0501074_0018921 3300049590 Bacteria 5002
1071 Ga0501074_0119985 3300049590 Bacteria 1880
1072 Ga0501074_1192026 3300049590 Bacteria 534
1073 Ga0501075_0044891 3300049591 Bacteria 3315
1074 Ga0501075_0197282 3300049591 Bacteria 1535
1075 Ga0501075_0347161 3300049591 Bacteria 1131
1076 Ga0501076_0165288 3300049592 Bacteria 1804
1077 Ga0501076_0533234 3300049592 Bacteria 968
1078 Ga0501076_0773037 3300049592 Bacteria 792
1079 Ga0501076_1203947 3300049592 Bacteria 623
1080 Ga0501077_0116673 3300049593 Bacteria 1692
1081 Ga0501077_0163550 3300049593 Bacteria 1413
1082 Ga0501077_0166667 3300049593 Bacteria 1399
1083 Ga0501079_0012033 3300049741 Bacteria 6603
1084 Ga0501079_0175584 3300049741 Bacteria 1671
1085 Ga0501079_0355754 3300049741 Bacteria 1147
1086 Ga0501080_0015300 3300049742 Bacteria 7073
1087 Ga0501080_0030783 3300049742 Bacteria 5000
1088 Ga0501080_1744556 3300049742 Bacteria 524
1089 Ga0501081_0261497 3300049743 Bacteria 1265
1090 Ga0501081_0458392 3300049743 Bacteria 948
1091 Ga0501083_0002614 3300049744 Bacteria 12402
1092 Ga0501083_0080795 3300049744 Bacteria 2155
1093 Ga0501083_0533664 3300049744 Bacteria 764
1094 Ga0501083_0845170 3300049744 Bacteria 596
1095 Ga0501035_0005116 3300049822 Bacteria 12420
1096 Ga0501035_0137851 3300049822 Bacteria 2123
1097 Ga0501044_0006919 3300049823 Bacteria 12483
1098 Ga0501044_0128972 3300049823 Bacteria 2524
1099 Ga0501044_0193833 3300049823 Bacteria 1993
1100 Ga0501044_0478439 3300049823 Bacteria 1149
1101 Ga0501044_0541717 3300049823 Bacteria 1062
1102 Ga0501045_0388877 3300049824 Bacteria 1038
1103 Ga0501045_0447533 3300049824 Bacteria 960
1104 Ga0501045_0473108 3300049824 Bacteria 931
1105 Ga0501045_0842390 3300049824 Bacteria 675
1106 nmdc:mga03n38_49138_c1 3300050490 Bacteria 1874
1107 nmdc:mga03n38_617731_c1 3300050490 Bacteria 619
1108 nmdc:mga00v17_156003_c1 3300050491 Bacteria 1468
1109 nmdc:mga00v17_16288_c1 3300050491 Bacteria 4191
1110 nmdc:mga00v17_224122_c1 3300050491 Bacteria 1218
1111 nmdc:mga00v17_466076_c1 3300050491 Bacteria 820
1112 nmdc:mga00v17_779565_c1 3300050491 Unclassified 610
1113 nmdc:mga00v17_888749_c1 3300050491 Bacteria 564
1114 nmdc:mga00v17_920239_c1 3300050491 Bacteria 553
1115 nmdc:mga00v17_964283_c1 3300050491 Bacteria 538
1116 nmdc:mga0yw44_127432_c1 3300050492 Bacteria 1645
1117 nmdc:mga0yw44_362973_c1 3300050492 Bacteria 976
1118 nmdc:mga0yw44_37019_c1 3300050492 Bacteria 2120
1119 nmdc:mga0yw44_589_c1 3300050492 Bacteria 13169
1120 nmdc:mga0yw44_675_c1 3300050492 Bacteria 12442
1121 nmdc:mga0yw44_8725_c1 3300050492 Bacteria 5071
1122 nmdc:mga0yw44_939551_c1 3300050492 Bacteria 586
1123 nmdc:mga06z11_94621_c1 3300050494 Bacteria 1628
1124 nmdc:mga04h51_373446_c1 3300050495 Bacteria 593
1125 nmdc:mga05p37_104196_c1 3300050507 Bacteria 3490
1126 nmdc:mga05p37_264955_c1 3300050507 Bacteria 2055
1127 nmdc:mga05p37_265689_c1 3300050507 Bacteria 2052
1128 nmdc:mga05p37_573885_c1 3300050507 Bacteria 1279
1129 nmdc:mga09592_791912_c1 3300050508 Bacteria 802
1130 nmdc:mga0qj67_429735_c1 3300050509 Bacteria 1064
1131 nmdc:mga0qj67_901433_c1 3300050509 Bacteria 697
1132 nmdc:mga06r32_1039450_c1 3300050510 Unclassified 770
1133 nmdc:mga06r32_1149952_c1 3300050510 Bacteria 724
1134 nmdc:mga06r32_232932_c1 3300050510 Bacteria 1830
1135 nmdc:mga06r32_274139_c1 3300050510 Bacteria 1674
1136 nmdc:mga06r32_30761_c1 3300050510 Bacteria 5038
1137 nmdc:mga08y16_1082708_c1 3300050511 Bacteria 777
1138 nmdc:mga08y16_18776_c1 3300050511 Bacteria 7284
1139 nmdc:mga08y16_216105_c1 3300050511 Bacteria 1985
1140 nmdc:mga08y16_53460_c1 3300050511 Bacteria 4223
1141 nmdc:mga0n895_11763_c1 3300050512 Bacteria 7823
1142 nmdc:mga0n895_257834_c1 3300050512 Bacteria 1770
1143 nmdc:mga0n895_960240_c1 3300050512 Bacteria 838
1144 nmdc:mga0rr50_1504144_c1 3300050513 Bacteria 569
1145 nmdc:mga0rr50_493066_c1 3300050513 Bacteria 1041
1146 nmdc:mga0rr50_52783_c1 3300050513 Bacteria 3022
1147 nmdc:mga08x19_127889_c1 3300050514 Bacteria 1707
1148 nmdc:mga08x19_591136_c1 3300050514 Bacteria 786
1149 nmdc:mga0a205_1200945_c1 3300050515 Bacteria 606
1150 nmdc:mga0a205_15449_c1 3300050515 Bacteria 7136
1151 nmdc:mga0a205_162660_c1 3300050515 Bacteria 2128
1152 nmdc:mga0a205_53_c2 3300050515 Bacteria 54696
1153 Ga0495601_0000060 3300053077 Bacteria 60600
1154 Ga0495601_0029935 3300053077 Bacteria 3380
1155 Ga0495601_0059708 3300053077 Bacteria 2419
1156 Ga0495601_0080854 3300053077 Bacteria 2085
1157 Ga0495601_0190542 3300053077 Bacteria 1340
1158 Ga0495601_0380882 3300053077 Bacteria 916
1159 Ga0495612_0000210 3300053078 Bacteria 24800
1160 Ga0495612_0003362 3300053078 Bacteria 6629
1161 Ga0495612_0003484 3300053078 Bacteria 6518
1162 Ga0495612_0038634 3300053078 Bacteria 1940
1163 Ga0495655_0000002 3300053083 Bacteria 312752
1164 Ga0495655_0117794 3300053083 Bacteria 805
1165 Ga0495595_0000002 3300053084 Bacteria 445641
1166 Ga0495595_0000045 3300053084 Bacteria 63054
1167 Ga0495595_0335600 3300053084 Bacteria 762
1168 Ga0495619_0000008 3300053085 Bacteria 305999
1169 Ga0495619_0000095 3300053085 Bacteria 66204
1170 Ga0495619_0000102 3300053085 Bacteria 64345
1171 Ga0495619_0000155 3300053085 Bacteria 50682
1172 Ga0495619_0000320 3300053085 Bacteria 33623
1173 Ga0495619_0006754 3300053085 Bacteria 7259
1174 Ga0495619_0036802 3300053085 Bacteria 3188
1175 Ga0495619_0058401 3300053085 Bacteria 2561
1176 Ga0495619_0967005 3300053085 Bacteria 571
1177 Ga0500566_0001093 3300053094 Bacteria 15689
1178 Ga0500566_0264729 3300053094 Bacteria 828
1179 Ga0500595_040810 3300053119 Bacteria 1494
1180 Ga0500595_061022 3300053119 Bacteria 1139
1181 Ga0500614_001424 3300053123 Bacteria 5734
1182 Ga0500628_000001 3300053129 Bacteria 564074
1183 Ga0501084_0110493 3300054114 Bacteria 2310
1184 Ga0501084_0141490 3300054114 Bacteria 2026
1185 Ga0501084_0163151 3300054114 Bacteria 1880
1186 Ga0501084_0382295 3300054114 Bacteria 1190
1187 Ga0501084_0905945 3300054114 Bacteria 742
1188 Ga0501084_1058013 3300054114 Bacteria 682
1189 Ga0501084_1404693 3300054114 Bacteria 585
1190 Ga0501084_1598320 3300054114 Bacteria 545
1191 Ga0501082_0044987 3300060353 Bacteria 3807
1192 Ga0501082_0857311 3300060353 Bacteria 795
1193 Ga0501082_1323183 3300060353 Bacteria 629
1194 Ga0530510_0020050 3300061734 Bacteria 4754
1195 Ga0530510_0473044 3300061734 Bacteria 949
1196 Ga0530510_0789843 3300061734 Bacteria 724

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_102064302 Ga0070684_1020643021 83
2 3300005577 Ga0068857_102037281 Ga0068857_1020372812 83
3 3300006051 Ga0075364_10143462 Ga0075364_101434622 83
4 3300006051 Ga0075364_11111047 Ga0075364_111110471 83
5 3300006178 Ga0075367_10328756 Ga0075367_103287562 83
6 3300026116 Ga0207674_11638187 Ga0207674_116381871 83
7 3300031548 Ga0307408_100120691 Ga0307408_1001206912 83
8 3300031901 Ga0307406_10646326 Ga0307406_106463262 83
9 3300031995 Ga0307409_100481919 Ga0307409_1004819192 83
10 3300032002 Ga0307416_101892543 Ga0307416_1018925431 83
11 3300032005 Ga0307411_11610405 Ga0307411_116104051 83
12 3300042125 Ga0450923_189473 Ga0450923_189473_130_402 83
13 3300042145 Ga0450906_106260 Ga0450906_106260_218_490 83
14 3300050491 nmdc:mga00v17_224122_c1 nmdc:mga00v17_224122_c1_709_984 83
15 3300050491 nmdc:mga00v17_466076_c1 nmdc:mga00v17_466076_c1_215_490 83
16 3300050492 nmdc:mga0yw44_127432_c1 nmdc:mga0yw44_127432_c1_327_602 83
17 3300050494 nmdc:mga06z11_94621_c1 nmdc:mga06z11_94621_c1_1269_1544 83
18 3300005544 Ga0070686_100312424 Ga0070686_1003124242 84
19 3300005548 Ga0070665_100452207 Ga0070665_1004522072 84
20 3300005719 Ga0068861_102113983 Ga0068861_1021139832 84
21 3300006048 Ga0075363_100125268 Ga0075363_1001252682 84
22 3300006051 Ga0075364_10926558 Ga0075364_109265582 84
23 3300006178 Ga0075367_10570243 Ga0075367_105702432 84
24 3300009176 Ga0105242_12122077 Ga0105242_121220772 84
25 3300025934 Ga0207686_10320029 Ga0207686_103200292 84
26 3300025937 Ga0207669_10648256 Ga0207669_106482562 84
27 3300026121 Ga0207683_10309590 Ga0207683_103095902 84
28 3300048905 Ga0496102_0235659 Ga0496102_0235659_969_1241 84
29 3300050490 nmdc:mga03n38_49138_c1 nmdc:mga03n38_49138_c1_571_843 84
30 3300050491 nmdc:mga00v17_779565_c1 nmdc:mga00v17_779565_c1_82_354 84
31 3300001977 JGI24746J21847_1054991 JGI24746J21847_10549911 90
32 3300001990 JGI24737J22298_10099373 JGI24737J22298_100993732 90
33 3300001991 JGI24743J22301_10042465 JGI24743J22301_100424652 90
34 3300002067 JGI24735J21928_10170162 JGI24735J21928_101701622 90
35 3300002075 JGI24738J21930_10009312 JGI24738J21930_100093123 90
36 3300002075 JGI24738J21930_10086603 JGI24738J21930_100866031 90
37 3300002077 JGI24744J21845_10016965 JGI24744J21845_100169651 90
38 3300002244 JGI24742J22300_10043580 JGI24742J22300_100435802 90
39 3300002459 JGI24751J29686_10066098 JGI24751J29686_100660982 90
40 3300005327 Ga0070658_10102750 Ga0070658_101027503 90
41 3300005327 Ga0070658_10351889 Ga0070658_103518892 90
42 3300005327 Ga0070658_10821046 Ga0070658_108210462 90
43 3300005328 Ga0070676_10068455 Ga0070676_100684553 90
44 3300005328 Ga0070676_10699340 Ga0070676_106993402 90
45 3300005329 Ga0070683_100000404 Ga0070683_10000040419 90
46 3300005329 Ga0070683_100019785 Ga0070683_1000197854 90
47 3300005329 Ga0070683_100023077 Ga0070683_1000230774 90
48 3300005329 Ga0070683_100117182 Ga0070683_1001171823 90
49 3300005333 Ga0070677_10000008 Ga0070677_1000000875 90
50 3300005334 Ga0068869_100104382 Ga0068869_1001043823 90
51 3300005335 Ga0070666_10327087 Ga0070666_103270871 90
52 3300005336 Ga0070680_100185990 Ga0070680_1001859902 90
53 3300005336 Ga0070680_100310840 Ga0070680_1003108401 90
54 3300005337 Ga0070682_100000075 Ga0070682_1000000753 90
55 3300005337 Ga0070682_100000090 Ga0070682_1000000903 90
56 3300005337 Ga0070682_100008571 Ga0070682_1000085716 90
57 3300005337 Ga0070682_100048176 Ga0070682_1000481762 90
58 3300005337 Ga0070682_101289527 Ga0070682_1012895272 90
59 3300005338 Ga0068868_100000141 Ga0068868_10000014141 90
60 3300005338 Ga0068868_100002016 Ga0068868_10000201613 90
61 3300005338 Ga0068868_100013799 Ga0068868_1000137995 90
62 3300005338 Ga0068868_100018130 Ga0068868_1000181303 90
63 3300005338 Ga0068868_100021155 Ga0068868_1000211555 90
64 3300005338 Ga0068868_100552551 Ga0068868_1005525512 90
65 3300005339 Ga0070660_100044786 Ga0070660_1000447863 90
66 3300005339 Ga0070660_100889625 Ga0070660_1008896252 90
67 3300005340 Ga0070689_100071687 Ga0070689_1000716873 90
68 3300005340 Ga0070689_100079065 Ga0070689_1000790653 90
69 3300005340 Ga0070689_100096525 Ga0070689_1000965252 90
70 3300005340 Ga0070689_100141479 Ga0070689_1001414792 90
71 3300005340 Ga0070689_100174120 Ga0070689_1001741203 90
72 3300005341 Ga0070691_10000044 Ga0070691_1000004410 90
73 3300005341 Ga0070691_10005099 Ga0070691_100050992 90
74 3300005341 Ga0070691_10054340 Ga0070691_100543403 90
75 3300005341 Ga0070691_10318388 Ga0070691_103183882 90
76 3300005341 Ga0070691_10519651 Ga0070691_105196511 90
77 3300005341 Ga0070691_10551001 Ga0070691_105510012 90
78 3300005343 Ga0070687_100024909 Ga0070687_1000249094 90
79 3300005343 Ga0070687_100876966 Ga0070687_1008769661 90
80 3300005344 Ga0070661_100000099 Ga0070661_10000009911 90
81 3300005344 Ga0070661_100070438 Ga0070661_1000704382 90
82 3300005344 Ga0070661_100611646 Ga0070661_1006116462 90
83 3300005344 Ga0070661_101199562 Ga0070661_1011995622 90
84 3300005345 Ga0070692_10007789 Ga0070692_100077896 90
85 3300005345 Ga0070692_10205169 Ga0070692_102051691 90
86 3300005347 Ga0070668_100014733 Ga0070668_1000147336 90
87 3300005347 Ga0070668_100065770 Ga0070668_1000657702 90
88 3300005347 Ga0070668_100544309 Ga0070668_1005443092 90
89 3300005347 Ga0070668_101311660 Ga0070668_1013116601 90
90 3300005353 Ga0070669_100278458 Ga0070669_1002784582 90
91 3300005354 Ga0070675_100000036 Ga0070675_10000003673 90
92 3300005354 Ga0070675_100044837 Ga0070675_1000448373 90
93 3300005354 Ga0070675_100676630 Ga0070675_1006766302 90
94 3300005355 Ga0070671_100035755 Ga0070671_1000357554 90
95 3300005355 Ga0070671_100895212 Ga0070671_1008952122 90
96 3300005356 Ga0070674_100000012 Ga0070674_10000001234 90
97 3300005356 Ga0070674_100012173 Ga0070674_1000121732 90
98 3300005364 Ga0070673_100006402 Ga0070673_1000064027 90
99 3300005364 Ga0070673_100041907 Ga0070673_1000419073 90
100 3300005364 Ga0070673_100112144 Ga0070673_1001121442 90
101 3300005364 Ga0070673_101879545 Ga0070673_1018795452 90
102 3300005365 Ga0070688_100001169 Ga0070688_1000011693 90
103 3300005365 Ga0070688_100004292 Ga0070688_10000429210 90
104 3300005365 Ga0070688_100266693 Ga0070688_1002666932 90
105 3300005365 Ga0070688_100333987 Ga0070688_1003339872 90
106 3300005365 Ga0070688_100350515 Ga0070688_1003505152 90
107 3300005366 Ga0070659_100007424 Ga0070659_1000074245 90
108 3300005366 Ga0070659_100086823 Ga0070659_1000868235 90
109 3300005367 Ga0070667_100061212 Ga0070667_1000612122 90
110 3300005367 Ga0070667_100155517 Ga0070667_1001555172 90
111 3300005367 Ga0070667_100304295 Ga0070667_1003042952 90
112 3300005367 Ga0070667_100567593 Ga0070667_1005675932 90
113 3300005434 Ga0070709_10109003 Ga0070709_101090032 90
114 3300005435 Ga0070714_100443749 Ga0070714_1004437492 90
115 3300005436 Ga0070713_100000380 Ga0070713_1000003804 90
116 3300005438 Ga0070701_10039651 Ga0070701_100396513 90
117 3300005438 Ga0070701_10433121 Ga0070701_104331212 90
118 3300005438 Ga0070701_11076225 Ga0070701_110762252 90
119 3300005439 Ga0070711_100007421 Ga0070711_1000074215 90
120 3300005439 Ga0070711_100216272 Ga0070711_1002162722 90
121 3300005440 Ga0070705_100347488 Ga0070705_1003474881 90
122 3300005440 Ga0070705_100892697 Ga0070705_1008926972 90
123 3300005441 Ga0070700_100005895 Ga0070700_1000058956 90
124 3300005441 Ga0070700_100019529 Ga0070700_1000195293 90
125 3300005441 Ga0070700_100659798 Ga0070700_1006597981 90
126 3300005441 Ga0070700_100792305 Ga0070700_1007923051 90
127 3300005444 Ga0070694_100207046 Ga0070694_1002070462 90
128 3300005444 Ga0070694_100428926 Ga0070694_1004289263 90
129 3300005445 Ga0070708_100236107 Ga0070708_1002361072 90
130 3300005445 Ga0070708_100342446 Ga0070708_1003424462 90
131 3300005455 Ga0070663_100001224 Ga0070663_10000122416 90
132 3300005455 Ga0070663_100022099 Ga0070663_1000220994 90
133 3300005455 Ga0070663_100064230 Ga0070663_1000642304 90
134 3300005455 Ga0070663_101584565 Ga0070663_1015845652 90
135 3300005455 Ga0070663_101951450 Ga0070663_1019514501 90
136 3300005456 Ga0070678_100022682 Ga0070678_1000226826 90
137 3300005456 Ga0070678_100026672 Ga0070678_1000266725 90
138 3300005457 Ga0070662_100000002 Ga0070662_100000002229 90
139 3300005457 Ga0070662_100040712 Ga0070662_1000407122 90
140 3300005458 Ga0070681_10306669 Ga0070681_103066692 90
141 3300005458 Ga0070681_10691882 Ga0070681_106918822 90
142 3300005459 Ga0068867_100005480 Ga0068867_1000054809 90
143 3300005459 Ga0068867_100057996 Ga0068867_1000579962 90
144 3300005459 Ga0068867_100386900 Ga0068867_1003869002 90
145 3300005459 Ga0068867_100922860 Ga0068867_1009228601 90
146 3300005466 Ga0070685_10000020 Ga0070685_1000002076 90
147 3300005466 Ga0070685_10000674 Ga0070685_100006749 90
148 3300005466 Ga0070685_10015073 Ga0070685_100150732 90
149 3300005466 Ga0070685_10049549 Ga0070685_100495492 90
150 3300005466 Ga0070685_10227841 Ga0070685_102278412 90
151 3300005466 Ga0070685_10362624 Ga0070685_103626242 90
152 3300005530 Ga0070679_100000369 Ga0070679_10000036936 90
153 3300005530 Ga0070679_102022938 Ga0070679_1020229381 90
154 3300005535 Ga0070684_100014210 Ga0070684_1000142105 90
155 3300005535 Ga0070684_100043406 Ga0070684_1000434062 90
156 3300005535 Ga0070684_100052595 Ga0070684_1000525952 90
157 3300005535 Ga0070684_100068987 Ga0070684_1000689873 90
158 3300005535 Ga0070684_100245100 Ga0070684_1002451002 90
159 3300005535 Ga0070684_100259847 Ga0070684_1002598472 90
160 3300005535 Ga0070684_100664192 Ga0070684_1006641922 90
161 3300005539 Ga0068853_100041279 Ga0068853_1000412792 90
162 3300005539 Ga0068853_100078899 Ga0068853_1000788992 90
163 3300005539 Ga0068853_100118729 Ga0068853_1001187292 90
164 3300005539 Ga0068853_100156211 Ga0068853_1001562112 90
165 3300005539 Ga0068853_101702993 Ga0068853_1017029932 90
166 3300005543 Ga0070672_100004196 Ga0070672_1000041966 90
167 3300005544 Ga0070686_100020467 Ga0070686_1000204672 90
168 3300005544 Ga0070686_100254198 Ga0070686_1002541981 90
169 3300005545 Ga0070695_100067435 Ga0070695_1000674353 90
170 3300005545 Ga0070695_101840612 Ga0070695_1018406122 90
171 3300005546 Ga0070696_101977451 Ga0070696_1019774511 90
172 3300005547 Ga0070693_100003731 Ga0070693_1000037317 90
173 3300005547 Ga0070693_100137476 Ga0070693_1001374762 90
174 3300005547 Ga0070693_100885293 Ga0070693_1008852931 90
175 3300005548 Ga0070665_100000135 Ga0070665_10000013523 90
176 3300005548 Ga0070665_100132532 Ga0070665_1001325323 90
177 3300005548 Ga0070665_101265781 Ga0070665_1012657812 90
178 3300005549 Ga0070704_100025392 Ga0070704_1000253922 90
179 3300005549 Ga0070704_100115774 Ga0070704_1001157743 90
180 3300005549 Ga0070704_100426534 Ga0070704_1004265342 90
181 3300005549 Ga0070704_100821048 Ga0070704_1008210481 90
182 3300005563 Ga0068855_101242488 Ga0068855_1012424882 90
183 3300005564 Ga0070664_100013275 Ga0070664_1000132756 90
184 3300005564 Ga0070664_100015019 Ga0070664_1000150195 90
185 3300005564 Ga0070664_100058703 Ga0070664_1000587031 90
186 3300005564 Ga0070664_100423367 Ga0070664_1004233672 90
187 3300005564 Ga0070664_101751829 Ga0070664_1017518292 90
188 3300005577 Ga0068857_100079624 Ga0068857_1000796243 90
189 3300005577 Ga0068857_100142811 Ga0068857_1001428112 90
190 3300005578 Ga0068854_100059914 Ga0068854_1000599143 90
191 3300005578 Ga0068854_100100662 Ga0068854_1001006622 90
192 3300005614 Ga0068856_100004032 Ga0068856_1000040324 90
193 3300005614 Ga0068856_100013553 Ga0068856_1000135533 90
194 3300005614 Ga0068856_100026571 Ga0068856_1000265713 90
195 3300005614 Ga0068856_100089785 Ga0068856_1000897852 90
196 3300005614 Ga0068856_100589393 Ga0068856_1005893932 90
197 3300005614 Ga0068856_100877220 Ga0068856_1008772202 90
198 3300005615 Ga0070702_100021516 Ga0070702_1000215164 90
199 3300005615 Ga0070702_100082916 Ga0070702_1000829162 90
200 3300005615 Ga0070702_100114120 Ga0070702_1001141202 90
201 3300005615 Ga0070702_100430538 Ga0070702_1004305382 90
202 3300005616 Ga0068852_100000002 Ga0068852_100000002249 90
203 3300005616 Ga0068852_100014610 Ga0068852_1000146107 90
204 3300005616 Ga0068852_100283099 Ga0068852_1002830992 90
205 3300005616 Ga0068852_102542207 Ga0068852_1025422071 90
206 3300005617 Ga0068859_100058409 Ga0068859_1000584092 90
207 3300005617 Ga0068859_100864297 Ga0068859_1008642972 90
208 3300005618 Ga0068864_100000015 Ga0068864_100000015199 90
209 3300005618 Ga0068864_100043739 Ga0068864_1000437394 90
210 3300005618 Ga0068864_100317711 Ga0068864_1003177112 90
211 3300005718 Ga0068866_10002177 Ga0068866_100021773 90
212 3300005718 Ga0068866_10122127 Ga0068866_101221272 90
213 3300005718 Ga0068866_10150533 Ga0068866_101505333 90
214 3300005719 Ga0068861_100053456 Ga0068861_1000534564 90
215 3300005719 Ga0068861_100381342 Ga0068861_1003813422 90
216 3300005719 Ga0068861_101538303 Ga0068861_1015383031 90
217 3300005719 Ga0068861_101667362 Ga0068861_1016673621 90
218 3300005834 Ga0068851_10001260 Ga0068851_100012604 90
219 3300005834 Ga0068851_10058940 Ga0068851_100589402 90
220 3300005834 Ga0068851_10186485 Ga0068851_101864852 90
221 3300005840 Ga0068870_10591646 Ga0068870_105916462 90
222 3300005840 Ga0068870_10920843 Ga0068870_109208432 90
223 3300005841 Ga0068863_100000022 Ga0068863_10000002271 90
224 3300005841 Ga0068863_100181164 Ga0068863_1001811642 90
225 3300005841 Ga0068863_100295132 Ga0068863_1002951322 90
226 3300005841 Ga0068863_100537618 Ga0068863_1005376182 90
227 3300005841 Ga0068863_100832664 Ga0068863_1008326642 90
228 3300005841 Ga0068863_101785515 Ga0068863_1017855151 90
229 3300005842 Ga0068858_100000075 Ga0068858_1000000753 90
230 3300005842 Ga0068858_100004559 Ga0068858_10000455915 90
231 3300005842 Ga0068858_100065398 Ga0068858_1000653983 90
232 3300005842 Ga0068858_100492936 Ga0068858_1004929362 90
233 3300005842 Ga0068858_100723347 Ga0068858_1007233472 90
234 3300005843 Ga0068860_100072334 Ga0068860_1000723344 90
235 3300005843 Ga0068860_101003527 Ga0068860_1010035272 90
236 3300005844 Ga0068862_100106806 Ga0068862_1001068061 90
237 3300005844 Ga0068862_100624784 Ga0068862_1006247842 90
238 3300005844 Ga0068862_100716797 Ga0068862_1007167972 90
239 3300005844 Ga0068862_101508091 Ga0068862_1015080912 90
240 3300005937 Ga0081455_10052507 Ga0081455_100525075 90
241 3300005937 Ga0081455_10125997 Ga0081455_101259972 90
242 3300005937 Ga0081455_10133876 Ga0081455_101338762 90
243 3300005937 Ga0081455_10292207 Ga0081455_102922073 90
244 3300005937 Ga0081455_10721037 Ga0081455_107210372 90
245 3300005981 Ga0081538_10000141 Ga0081538_100001413 90
246 3300005981 Ga0081538_10015536 Ga0081538_1001553611 90
247 3300005983 Ga0081540_1069557 Ga0081540_10695572 90
248 3300005983 Ga0081540_1193796 Ga0081540_11937962 90
249 3300006038 Ga0075365_10000322 Ga0075365_100003226 90
250 3300006038 Ga0075365_10002366 Ga0075365_100023664 90
251 3300006038 Ga0075365_10004204 Ga0075365_100042043 90
252 3300006038 Ga0075365_10289833 Ga0075365_102898332 90
253 3300006042 Ga0075368_10214180 Ga0075368_102141802 90
254 3300006042 Ga0075368_10585306 Ga0075368_105853061 90
255 3300006048 Ga0075363_100000848 Ga0075363_1000008482 90
256 3300006048 Ga0075363_100026606 Ga0075363_1000266063 90
257 3300006051 Ga0075364_10177770 Ga0075364_101777703 90
258 3300006051 Ga0075364_10590860 Ga0075364_105908602 90
259 3300006051 Ga0075364_10978372 Ga0075364_109783721 90
260 3300006058 Ga0075432_10607487 Ga0075432_106074871 90
261 3300006163 Ga0070715_10018094 Ga0070715_100180943 90
262 3300006173 Ga0070716_100023581 Ga0070716_1000235811 90
263 3300006173 Ga0070716_101146135 Ga0070716_1011461352 90
264 3300006175 Ga0070712_100002890 Ga0070712_10000289012 90
265 3300006175 Ga0070712_100083938 Ga0070712_1000839383 90
266 3300006175 Ga0070712_100169040 Ga0070712_1001690402 90
267 3300006178 Ga0075367_10297748 Ga0075367_102977482 90
268 3300006178 Ga0075367_10976436 Ga0075367_109764361 90
269 3300006186 Ga0075369_10251904 Ga0075369_102519042 90
270 3300006237 Ga0097621_100914617 Ga0097621_1009146172 90
271 3300006237 Ga0097621_101457935 Ga0097621_1014579352 90
272 3300006237 Ga0097621_102118254 Ga0097621_1021182541 90
273 3300006358 Ga0068871_100651227 Ga0068871_1006512272 90
274 3300006358 Ga0068871_100663723 Ga0068871_1006637231 90
275 3300006844 Ga0075428_100449888 Ga0075428_1004498882 90
276 3300006844 Ga0075428_101442589 Ga0075428_1014425892 90
277 3300006846 Ga0075430_100907047 Ga0075430_1009070472 90
278 3300006847 Ga0075431_100000197 Ga0075431_10000019730 90
279 3300006847 Ga0075431_100394317 Ga0075431_1003943173 90
280 3300006847 Ga0075431_101071674 Ga0075431_1010716742 90
281 3300006852 Ga0075433_10000897 Ga0075433_1000089711 90
282 3300006852 Ga0075433_10024940 Ga0075433_100249406 90
283 3300006852 Ga0075433_10143670 Ga0075433_101436702 90
284 3300006852 Ga0075433_11023957 Ga0075433_110239571 90
285 3300006871 Ga0075434_100008498 Ga0075434_1000084987 90
286 3300006871 Ga0075434_100027126 Ga0075434_1000271262 90
287 3300006871 Ga0075434_100043274 Ga0075434_1000432744 90
288 3300006871 Ga0075434_101321702 Ga0075434_1013217022 90
289 3300006880 Ga0075429_100660723 Ga0075429_1006607232 90
290 3300006880 Ga0075429_100922922 Ga0075429_1009229222 90
291 3300006881 Ga0068865_100000082 Ga0068865_10000008229 90
292 3300006881 Ga0068865_100396217 Ga0068865_1003962172 90
293 3300006881 Ga0068865_101588750 Ga0068865_1015887502 90
294 3300006881 Ga0068865_101602821 Ga0068865_1016028212 90
295 3300006914 Ga0075436_100447812 Ga0075436_1004478122 90
296 3300006914 Ga0075436_100503524 Ga0075436_1005035242 90
297 3300006931 Ga0097620_100058406 Ga0097620_1000584062 90
298 3300006931 Ga0097620_100864181 Ga0097620_1008641812 90
299 3300007076 Ga0075435_100079846 Ga0075435_1000798462 90
300 3300007076 Ga0075435_100091865 Ga0075435_1000918653 90
301 3300007076 Ga0075435_100516530 Ga0075435_1005165302 90
302 3300007076 Ga0075435_100869037 Ga0075435_1008690372 90
303 3300007076 Ga0075435_101140549 Ga0075435_1011405491 90
304 3300009093 Ga0105240_10511954 Ga0105240_105119542 90
305 3300009093 Ga0105240_10928934 Ga0105240_109289342 90
306 3300009093 Ga0105240_11060168 Ga0105240_110601682 90
307 3300009094 Ga0111539_10024755 Ga0111539_100247552 90
308 3300009094 Ga0111539_10025516 Ga0111539_1002551610 90
309 3300009094 Ga0111539_10026270 Ga0111539_100262705 90
310 3300009094 Ga0111539_10743213 Ga0111539_107432132 90
311 3300009094 Ga0111539_11648192 Ga0111539_116481921 90
312 3300009098 Ga0105245_10000278 Ga0105245_1000027811 90
313 3300009098 Ga0105245_10000415 Ga0105245_100004158 90
314 3300009098 Ga0105245_10001311 Ga0105245_1000131121 90
315 3300009098 Ga0105245_10024888 Ga0105245_100248883 90
316 3300009098 Ga0105245_10089688 Ga0105245_100896882 90
317 3300009098 Ga0105245_10657460 Ga0105245_106574602 90
318 3300009098 Ga0105245_11467468 Ga0105245_114674682 90
319 3300009098 Ga0105245_12556305 Ga0105245_125563052 90
320 3300009101 Ga0105247_10029264 Ga0105247_100292642 90
321 3300009101 Ga0105247_10077162 Ga0105247_100771623 90
322 3300009101 Ga0105247_10917529 Ga0105247_109175292 90
323 3300009101 Ga0105247_11404910 Ga0105247_114049102 90
324 3300009147 Ga0114129_10110402 Ga0114129_101104023 90
325 3300009147 Ga0114129_10110402 Ga0114129_101104026 90
326 3300009147 Ga0114129_10113126 Ga0114129_101131265 90
327 3300009147 Ga0114129_10144653 Ga0114129_101446532 90
328 3300009147 Ga0114129_10639270 Ga0114129_106392702 90
329 3300009147 Ga0114129_11348365 Ga0114129_113483653 90
330 3300009147 Ga0114129_11853892 Ga0114129_118538922 90
331 3300009148 Ga0105243_10003503 Ga0105243_1000350313 90
332 3300009148 Ga0105243_10007118 Ga0105243_100071187 90
333 3300009148 Ga0105243_10045660 Ga0105243_100456603 90
334 3300009148 Ga0105243_10342613 Ga0105243_103426132 90
335 3300009148 Ga0105243_11291863 Ga0105243_112918632 90
336 3300009148 Ga0105243_12233372 Ga0105243_122333722 90
337 3300009148 Ga0105243_12606308 Ga0105243_126063081 90
338 3300009174 Ga0105241_10109322 Ga0105241_101093222 90
339 3300009174 Ga0105241_10612538 Ga0105241_106125382 90
340 3300009174 Ga0105241_11035708 Ga0105241_110357082 90
341 3300009176 Ga0105242_10000603 Ga0105242_100006032 90
342 3300009176 Ga0105242_10047166 Ga0105242_100471663 90
343 3300009176 Ga0105242_10234609 Ga0105242_102346092 90
344 3300009176 Ga0105242_10275850 Ga0105242_102758502 90
345 3300009176 Ga0105242_11011285 Ga0105242_110112852 90
346 3300009176 Ga0105242_11918350 Ga0105242_119183502 90
347 3300009177 Ga0105248_10000020 Ga0105248_10000020122 90
348 3300009177 Ga0105248_10126507 Ga0105248_101265072 90
349 3300009177 Ga0105248_10262577 Ga0105248_102625772 90
350 3300009177 Ga0105248_12444049 Ga0105248_124440492 90
351 3300009545 Ga0105237_10193604 Ga0105237_101936042 90
352 3300009545 Ga0105237_10271855 Ga0105237_102718552 90
353 3300009545 Ga0105237_10354953 Ga0105237_103549532 90
354 3300009545 Ga0105237_11169596 Ga0105237_111695962 90
355 3300009551 Ga0105238_10117153 Ga0105238_101171532 90
356 3300009551 Ga0105238_10496599 Ga0105238_104965992 90
357 3300009553 Ga0105249_10000143 Ga0105249_1000014370 90
358 3300009553 Ga0105249_10122179 Ga0105249_101221792 90
359 3300009553 Ga0105249_10175569 Ga0105249_101755692 90
360 3300009553 Ga0105249_10282388 Ga0105249_102823883 90
361 3300009553 Ga0105249_10289714 Ga0105249_102897142 90
362 3300009553 Ga0105249_10795883 Ga0105249_107958832 90
363 3300009553 Ga0105249_10962415 Ga0105249_109624152 90
364 3300009553 Ga0105249_11389140 Ga0105249_113891402 90
365 3300010159 Ga0099796_10232412 Ga0099796_102324122 90
366 3300010375 Ga0105239_10003725 Ga0105239_1000372521 90
367 3300010375 Ga0105239_10221837 Ga0105239_102218373 90
368 3300010375 Ga0105239_10578239 Ga0105239_105782391 90
369 3300010375 Ga0105239_11087281 Ga0105239_110872813 90
370 3300010375 Ga0105239_11414763 Ga0105239_114147632 90
371 3300010375 Ga0105239_11461507 Ga0105239_114615072 90
372 3300010375 Ga0105239_12274669 Ga0105239_122746691 90
373 3300010375 Ga0105239_12358643 Ga0105239_123586432 90
374 3300010375 Ga0105239_13401416 Ga0105239_134014161 90
375 3300011119 Ga0105246_10037640 Ga0105246_100376402 90
376 3300011119 Ga0105246_12076913 Ga0105246_120769131 90
377 3300011119 Ga0105246_12111193 Ga0105246_121111931 90
378 3300012476 Ga0157344_1006686 Ga0157344_10066862 90
379 3300012507 Ga0157342_1001537 Ga0157342_10015372 90
380 3300013100 Ga0157373_10534281 Ga0157373_105342812 90
381 3300013102 Ga0157371_10125048 Ga0157371_101250482 90
382 3300013102 Ga0157371_10769195 Ga0157371_107691952 90
383 3300013102 Ga0157371_11437258 Ga0157371_114372581 90
384 3300013104 Ga0157370_10149601 Ga0157370_101496012 90
385 3300013104 Ga0157370_10151772 Ga0157370_101517723 90
386 3300013105 Ga0157369_10000074 Ga0157369_1000007430 90
387 3300013105 Ga0157369_10808280 Ga0157369_108082802 90
388 3300013296 Ga0157374_10004880 Ga0157374_100048809 90
389 3300013296 Ga0157374_10175786 Ga0157374_101757861 90
390 3300013297 Ga0157378_10003241 Ga0157378_100032415 90
391 3300013297 Ga0157378_10068068 Ga0157378_100680683 90
392 3300013297 Ga0157378_10103191 Ga0157378_101031912 90
393 3300013306 Ga0163162_10933622 Ga0163162_109336222 90
394 3300013306 Ga0163162_11095063 Ga0163162_110950631 90
395 3300013306 Ga0163162_12072284 Ga0163162_120722842 90
396 3300013306 Ga0163162_13480145 Ga0163162_134801452 90
397 3300013307 Ga0157372_10000053 Ga0157372_1000005325 90
398 3300013307 Ga0157372_10057521 Ga0157372_100575213 90
399 3300013307 Ga0157372_10141100 Ga0157372_101411003 90
400 3300013307 Ga0157372_11734160 Ga0157372_117341602 90
401 3300013307 Ga0157372_12641841 Ga0157372_126418412 90
402 3300013308 Ga0157375_10013296 Ga0157375_100132967 90
403 3300013308 Ga0157375_10014036 Ga0157375_100140363 90
404 3300013308 Ga0157375_10014814 Ga0157375_100148146 90
405 3300013308 Ga0157375_10022190 Ga0157375_100221903 90
406 3300013308 Ga0157375_10111493 Ga0157375_101114933 90
407 3300013308 Ga0157375_10162776 Ga0157375_101627762 90
408 3300013308 Ga0157375_10881008 Ga0157375_108810082 90
409 3300013308 Ga0157375_13352272 Ga0157375_133522722 90
410 3300014325 Ga0163163_10204269 Ga0163163_102042692 90
411 3300014325 Ga0163163_10220265 Ga0163163_102202653 90
412 3300014325 Ga0163163_11958336 Ga0163163_119583361 90
413 3300014325 Ga0163163_13273731 Ga0163163_132737312 90
414 3300014326 Ga0157380_10000016 Ga0157380_10000016103 90
415 3300014326 Ga0157380_10002828 Ga0157380_1000282815 90
416 3300014326 Ga0157380_10116286 Ga0157380_101162862 90
417 3300014326 Ga0157380_13512092 Ga0157380_135120921 90
418 3300014497 Ga0182008_10336097 Ga0182008_103360971 90
419 3300014745 Ga0157377_10039811 Ga0157377_100398112 90
420 3300014745 Ga0157377_10439528 Ga0157377_104395282 90
421 3300014745 Ga0157377_10760733 Ga0157377_107607332 90
422 3300014968 Ga0157379_10006763 Ga0157379_100067633 90
423 3300014968 Ga0157379_10400050 Ga0157379_104000502 90
424 3300014968 Ga0157379_12271030 Ga0157379_122710301 90
425 3300014968 Ga0157379_12299167 Ga0157379_122991672 90
426 3300014969 Ga0157376_10127119 Ga0157376_101271193 90
427 3300014969 Ga0157376_10169025 Ga0157376_101690252 90
428 3300014969 Ga0157376_11220358 Ga0157376_112203582 90
429 3300014969 Ga0157376_11700456 Ga0157376_117004562 90
430 3300014969 Ga0157376_11879406 Ga0157376_118794062 90
431 3300014969 Ga0157376_12460768 Ga0157376_124607682 90
432 3300017792 Ga0163161_10000053 Ga0163161_10000053119 90
433 3300017792 Ga0163161_10154218 Ga0163161_101542182 90
434 3300017792 Ga0163161_10225825 Ga0163161_102258252 90
435 3300017792 Ga0163161_10359349 Ga0163161_103593492 90
436 3300017792 Ga0163161_10908301 Ga0163161_109083012 90
437 3300020069 Ga0197907_11491576 Ga0197907_114915761 90
438 3300020077 Ga0206351_10306398 Ga0206351_103063982 90
439 3300020078 Ga0206352_10043259 Ga0206352_100432591 90
440 3300020080 Ga0206350_10480026 Ga0206350_104800262 90
441 3300020081 Ga0206354_10762690 Ga0206354_107626902 90
442 3300020082 Ga0206353_11374094 Ga0206353_113740941 90
443 3300020082 Ga0206353_11800342 Ga0206353_118003421 90
444 3300022467 Ga0224712_10040416 Ga0224712_100404162 90
445 3300022467 Ga0224712_10214807 Ga0224712_102148071 90
446 3300025315 Ga0207697_10377732 Ga0207697_103777322 90
447 3300025321 Ga0207656_10000226 Ga0207656_1000022611 90
448 3300025321 Ga0207656_10007404 Ga0207656_100074044 90
449 3300025321 Ga0207656_10093123 Ga0207656_100931232 90
450 3300025893 Ga0207682_10010613 Ga0207682_100106134 90
451 3300025899 Ga0207642_10000080 Ga0207642_1000008012 90
452 3300025899 Ga0207642_10005540 Ga0207642_100055406 90
453 3300025900 Ga0207710_10019430 Ga0207710_100194302 90
454 3300025900 Ga0207710_10600436 Ga0207710_106004362 90
455 3300025901 Ga0207688_10004162 Ga0207688_100041624 90
456 3300025901 Ga0207688_10008563 Ga0207688_100085636 90
457 3300025901 Ga0207688_10009259 Ga0207688_100092593 90
458 3300025903 Ga0207680_10005908 Ga0207680_100059086 90
459 3300025903 Ga0207680_10073801 Ga0207680_100738012 90
460 3300025904 Ga0207647_10128345 Ga0207647_101283452 90
461 3300025905 Ga0207685_10136019 Ga0207685_101360192 90
462 3300025907 Ga0207645_10276812 Ga0207645_102768122 90
463 3300025908 Ga0207643_10292299 Ga0207643_102922992 90
464 3300025908 Ga0207643_10292617 Ga0207643_102926172 90
465 3300025908 Ga0207643_10689263 Ga0207643_106892632 90
466 3300025909 Ga0207705_10080206 Ga0207705_100802063 90
467 3300025909 Ga0207705_10300677 Ga0207705_103006772 90
468 3300025911 Ga0207654_10336258 Ga0207654_103362582 90
469 3300025912 Ga0207707_10096999 Ga0207707_100969992 90
470 3300025912 Ga0207707_10590699 Ga0207707_105906992 90
471 3300025913 Ga0207695_10094013 Ga0207695_100940132 90
472 3300025913 Ga0207695_10680249 Ga0207695_106802492 90
473 3300025913 Ga0207695_11115059 Ga0207695_111150591 90
474 3300025914 Ga0207671_10287266 Ga0207671_102872662 90
475 3300025914 Ga0207671_11022210 Ga0207671_110222101 90
476 3300025914 Ga0207671_11095034 Ga0207671_110950342 90
477 3300025914 Ga0207671_11304137 Ga0207671_113041371 90
478 3300025915 Ga0207693_10013472 Ga0207693_100134723 90
479 3300025915 Ga0207693_10014605 Ga0207693_100146056 90
480 3300025915 Ga0207693_10314032 Ga0207693_103140322 90
481 3300025916 Ga0207663_10021565 Ga0207663_100215653 90
482 3300025916 Ga0207663_10816636 Ga0207663_108166361 90
483 3300025917 Ga0207660_11042254 Ga0207660_110422542 90
484 3300025918 Ga0207662_10254632 Ga0207662_102546322 90
485 3300025918 Ga0207662_10863997 Ga0207662_108639972 90
486 3300025919 Ga0207657_10000636 Ga0207657_1000063631 90
487 3300025919 Ga0207657_10464617 Ga0207657_104646172 90
488 3300025920 Ga0207649_10000127 Ga0207649_1000012760 90
489 3300025920 Ga0207649_10021936 Ga0207649_100219363 90
490 3300025920 Ga0207649_10510953 Ga0207649_105109532 90
491 3300025920 Ga0207649_11002915 Ga0207649_110029152 90
492 3300025921 Ga0207652_10000321 Ga0207652_1000032135 90
493 3300025921 Ga0207652_10495955 Ga0207652_104959552 90
494 3300025921 Ga0207652_11731803 Ga0207652_117318031 90
495 3300025924 Ga0207694_10062887 Ga0207694_100628873 90
496 3300025924 Ga0207694_10277806 Ga0207694_102778062 90
497 3300025924 Ga0207694_10515897 Ga0207694_105158971 90
498 3300025925 Ga0207650_10031298 Ga0207650_100312985 90
499 3300025925 Ga0207650_11466038 Ga0207650_114660381 90
500 3300025926 Ga0207659_10000013 Ga0207659_1000001387 90
501 3300025926 Ga0207659_10153312 Ga0207659_101533123 90
502 3300025926 Ga0207659_10480730 Ga0207659_104807302 90
503 3300025927 Ga0207687_10000032 Ga0207687_1000003220 90
504 3300025927 Ga0207687_10000036 Ga0207687_10000036120 90
505 3300025927 Ga0207687_10000460 Ga0207687_100004605 90
506 3300025927 Ga0207687_10011833 Ga0207687_100118336 90
507 3300025927 Ga0207687_10017769 Ga0207687_100177694 90
508 3300025927 Ga0207687_10049514 Ga0207687_100495141 90
509 3300025927 Ga0207687_10592077 Ga0207687_105920772 90
510 3300025928 Ga0207700_10000033 Ga0207700_1000003326 90
511 3300025929 Ga0207664_10349734 Ga0207664_103497342 90
512 3300025931 Ga0207644_10090484 Ga0207644_100904843 90
513 3300025931 Ga0207644_10282981 Ga0207644_102829813 90
514 3300025932 Ga0207690_10023856 Ga0207690_100238562 90
515 3300025932 Ga0207690_10931749 Ga0207690_109317491 90
516 3300025933 Ga0207706_10000001 Ga0207706_10000001410 90
517 3300025933 Ga0207706_10007826 Ga0207706_100078262 90
518 3300025933 Ga0207706_10090788 Ga0207706_100907881 90
519 3300025934 Ga0207686_10000097 Ga0207686_1000009716 90
520 3300025934 Ga0207686_10035280 Ga0207686_100352802 90
521 3300025934 Ga0207686_10085007 Ga0207686_100850072 90
522 3300025934 Ga0207686_10136529 Ga0207686_101365293 90
523 3300025934 Ga0207686_10987846 Ga0207686_109878462 90
524 3300025934 Ga0207686_11130594 Ga0207686_111305942 90
525 3300025935 Ga0207709_10005457 Ga0207709_100054573 90
526 3300025935 Ga0207709_10005868 Ga0207709_100058688 90
527 3300025935 Ga0207709_10177766 Ga0207709_101777663 90
528 3300025935 Ga0207709_10387095 Ga0207709_103870952 90
529 3300025936 Ga0207670_10020378 Ga0207670_100203783 90
530 3300025936 Ga0207670_10142618 Ga0207670_101426182 90
531 3300025936 Ga0207670_10148022 Ga0207670_101480222 90
532 3300025936 Ga0207670_10840514 Ga0207670_108405142 90
533 3300025937 Ga0207669_10000017 Ga0207669_1000001719 90
534 3300025937 Ga0207669_10045981 Ga0207669_100459812 90
535 3300025937 Ga0207669_10091576 Ga0207669_100915762 90
536 3300025937 Ga0207669_11752037 Ga0207669_117520371 90
537 3300025938 Ga0207704_10000184 Ga0207704_1000018423 90
538 3300025938 Ga0207704_10028503 Ga0207704_100285034 90
539 3300025938 Ga0207704_10056024 Ga0207704_100560242 90
540 3300025938 Ga0207704_10496717 Ga0207704_104967171 90
541 3300025938 Ga0207704_10599293 Ga0207704_105992932 90
542 3300025939 Ga0207665_10041438 Ga0207665_100414383 90
543 3300025939 Ga0207665_10909089 Ga0207665_109090892 90
544 3300025940 Ga0207691_10029702 Ga0207691_100297023 90
545 3300025941 Ga0207711_10000006 Ga0207711_10000006254 90
546 3300025941 Ga0207711_10207341 Ga0207711_102073413 90
547 3300025941 Ga0207711_10691922 Ga0207711_106919221 90
548 3300025941 Ga0207711_11553970 Ga0207711_115539702 90
549 3300025942 Ga0207689_10103451 Ga0207689_101034513 90
550 3300025942 Ga0207689_10299305 Ga0207689_102993052 90
551 3300025942 Ga0207689_11176199 Ga0207689_111761992 90
552 3300025944 Ga0207661_10001690 Ga0207661_100016904 90
553 3300025944 Ga0207661_10002110 Ga0207661_100021109 90
554 3300025944 Ga0207661_10091283 Ga0207661_100912833 90
555 3300025944 Ga0207661_10101297 Ga0207661_101012972 90
556 3300025944 Ga0207661_10172483 Ga0207661_101724833 90
557 3300025944 Ga0207661_10205492 Ga0207661_102054922 90
558 3300025944 Ga0207661_10857542 Ga0207661_108575422 90
559 3300025945 Ga0207679_10059493 Ga0207679_100594933 90
560 3300025945 Ga0207679_10150953 Ga0207679_101509533 90
561 3300025945 Ga0207679_10513937 Ga0207679_105139371 90
562 3300025960 Ga0207651_10013423 Ga0207651_100134232 90
563 3300025960 Ga0207651_10016930 Ga0207651_100169302 90
564 3300025960 Ga0207651_10849003 Ga0207651_108490032 90
565 3300025961 Ga0207712_10000058 Ga0207712_10000058120 90
566 3300025961 Ga0207712_10106609 Ga0207712_101066092 90
567 3300025961 Ga0207712_10140778 Ga0207712_101407782 90
568 3300025961 Ga0207712_10596379 Ga0207712_105963792 90
569 3300025961 Ga0207712_10641459 Ga0207712_106414592 90
570 3300025961 Ga0207712_11554369 Ga0207712_115543692 90
571 3300025972 Ga0207668_10008029 Ga0207668_100080293 90
572 3300025972 Ga0207668_10696879 Ga0207668_106968792 90
573 3300025972 Ga0207668_10980130 Ga0207668_109801302 90
574 3300025972 Ga0207668_11122450 Ga0207668_111224501 90
575 3300025981 Ga0207640_10071795 Ga0207640_100717952 90
576 3300025981 Ga0207640_10106767 Ga0207640_101067672 90
577 3300025981 Ga0207640_10337120 Ga0207640_103371202 90
578 3300025986 Ga0207658_10023672 Ga0207658_100236723 90
579 3300025986 Ga0207658_10050389 Ga0207658_100503895 90
580 3300025986 Ga0207658_10181291 Ga0207658_101812912 90
581 3300025986 Ga0207658_10523750 Ga0207658_105237502 90
582 3300026023 Ga0207677_10000284 Ga0207677_100002843 90
583 3300026023 Ga0207677_10001038 Ga0207677_1000103812 90
584 3300026023 Ga0207677_10045723 Ga0207677_100457232 90
585 3300026023 Ga0207677_11091726 Ga0207677_110917261 90
586 3300026023 Ga0207677_11560441 Ga0207677_115604412 90
587 3300026023 Ga0207677_11910282 Ga0207677_119102822 90
588 3300026023 Ga0207677_11989510 Ga0207677_119895102 90
589 3300026035 Ga0207703_10000088 Ga0207703_100000883 90
590 3300026035 Ga0207703_10000287 Ga0207703_1000028755 90
591 3300026035 Ga0207703_10410402 Ga0207703_104104022 90
592 3300026035 Ga0207703_11884876 Ga0207703_118848761 90
593 3300026041 Ga0207639_10005999 Ga0207639_100059995 90
594 3300026041 Ga0207639_10035406 Ga0207639_100354063 90
595 3300026041 Ga0207639_10693339 Ga0207639_106933392 90
596 3300026067 Ga0207678_10002224 Ga0207678_100022249 90
597 3300026067 Ga0207678_10016375 Ga0207678_100163752 90
598 3300026067 Ga0207678_10046785 Ga0207678_100467854 90
599 3300026067 Ga0207678_10403060 Ga0207678_104030602 90
600 3300026067 Ga0207678_10936036 Ga0207678_109360362 90
601 3300026075 Ga0207708_10009112 Ga0207708_100091127 90
602 3300026075 Ga0207708_10014443 Ga0207708_100144436 90
603 3300026075 Ga0207708_10227601 Ga0207708_102276013 90
604 3300026075 Ga0207708_10571844 Ga0207708_105718442 90
605 3300026075 Ga0207708_10634317 Ga0207708_106343172 90
606 3300026078 Ga0207702_10000637 Ga0207702_1000063715 90
607 3300026078 Ga0207702_10014646 Ga0207702_100146463 90
608 3300026078 Ga0207702_10047334 Ga0207702_100473343 90
609 3300026078 Ga0207702_10055526 Ga0207702_100555264 90
610 3300026078 Ga0207702_11847708 Ga0207702_118477082 90
611 3300026088 Ga0207641_10000016 Ga0207641_10000016192 90
612 3300026088 Ga0207641_10207691 Ga0207641_102076912 90
613 3300026088 Ga0207641_10415730 Ga0207641_104157302 90
614 3300026088 Ga0207641_10633330 Ga0207641_106333302 90
615 3300026088 Ga0207641_10635275 Ga0207641_106352752 90
616 3300026088 Ga0207641_11472097 Ga0207641_114720971 90
617 3300026088 Ga0207641_12064018 Ga0207641_120640181 90
618 3300026089 Ga0207648_10015345 Ga0207648_100153452 90
619 3300026089 Ga0207648_10017486 Ga0207648_100174862 90
620 3300026089 Ga0207648_11007247 Ga0207648_110072471 90
621 3300026095 Ga0207676_10000018 Ga0207676_10000018101 90
622 3300026095 Ga0207676_10060765 Ga0207676_100607652 90
623 3300026095 Ga0207676_10357913 Ga0207676_103579132 90
624 3300026116 Ga0207674_10102949 Ga0207674_101029493 90
625 3300026116 Ga0207674_10149795 Ga0207674_101497953 90
626 3300026118 Ga0207675_100045437 Ga0207675_1000454372 90
627 3300026118 Ga0207675_100087507 Ga0207675_1000875072 90
628 3300026121 Ga0207683_10012982 Ga0207683_100129829 90
629 3300026121 Ga0207683_10037324 Ga0207683_100373247 90
630 3300026121 Ga0207683_10341117 Ga0207683_103411173 90
631 3300026121 Ga0207683_10492637 Ga0207683_104926372 90
632 3300026121 Ga0207683_10499214 Ga0207683_104992142 90
633 3300026142 Ga0207698_10000004 Ga0207698_1000000436 90
634 3300026142 Ga0207698_10005530 Ga0207698_100055306 90
635 3300026142 Ga0207698_10063263 Ga0207698_100632633 90
636 3300027866 Ga0209813_10337831 Ga0209813_103378312 90
637 3300027907 Ga0207428_10264797 Ga0207428_102647972 90
638 3300027907 Ga0207428_10290421 Ga0207428_102904212 90
639 3300028379 Ga0268266_10000056 Ga0268266_10000056172 90
640 3300028379 Ga0268266_10001254 Ga0268266_1000125430 90
641 3300028379 Ga0268266_10059912 Ga0268266_100599121 90
642 3300028379 Ga0268266_10465490 Ga0268266_104654902 90
643 3300028379 Ga0268266_11304039 Ga0268266_113040392 90
644 3300028380 Ga0268265_10205244 Ga0268265_102052442 90
645 3300028380 Ga0268265_10389931 Ga0268265_103899312 90
646 3300028380 Ga0268265_12114974 Ga0268265_121149742 90
647 3300028380 Ga0268265_12333118 Ga0268265_123331182 90
648 3300028381 Ga0268264_10295170 Ga0268264_102951702 90
649 3300028381 Ga0268264_11262797 Ga0268264_112627972 90
650 3300028381 Ga0268264_11735309 Ga0268264_117353092 90
651 3300028381 Ga0268264_12246106 Ga0268264_122461062 90
652 3300028556 Ga0265337_1000066 Ga0265337_100006621 90
653 3300028558 Ga0265326_10000019 Ga0265326_10000019141 90
654 3300028563 Ga0265319_1000069 Ga0265319_100006913 90
655 3300028654 Ga0265322_10000011 Ga0265322_10000011141 90
656 3300028666 Ga0265336_10002798 Ga0265336_100027982 90
657 3300028800 Ga0265338_10158711 Ga0265338_101587112 90
658 3300029957 Ga0265324_10000283 Ga0265324_1000028323 90
659 3300031235 Ga0265330_10288409 Ga0265330_102884092 90
660 3300031238 Ga0265332_10116314 Ga0265332_101163141 90
661 3300031239 Ga0265328_10000737 Ga0265328_1000073714 90
662 3300031240 Ga0265320_10000011 Ga0265320_10000011141 90
663 3300031242 Ga0265329_10004312 Ga0265329_100043122 90
664 3300031249 Ga0265339_10051838 Ga0265339_100518382 90
665 3300031250 Ga0265331_10000858 Ga0265331_1000085819 90
666 3300031251 Ga0265327_10000015 Ga0265327_10000015249 90
667 3300031251 Ga0265327_10065922 Ga0265327_100659222 90
668 3300031344 Ga0265316_10181978 Ga0265316_101819782 90
669 3300031665 Ga0316575_10325157 Ga0316575_103251572 90
670 3300031711 Ga0265314_10000640 Ga0265314_1000064036 90
671 3300031712 Ga0265342_10231156 Ga0265342_102311562 90
672 3300031727 Ga0316576_10368159 Ga0316576_103681592 90
673 3300031731 Ga0307405_10467687 Ga0307405_104676872 90
674 3300031852 Ga0307410_10345634 Ga0307410_103456342 90
675 3300031903 Ga0307407_10494104 Ga0307407_104941041 90
676 3300031995 Ga0307409_100315072 Ga0307409_1003150722 90
677 3300031995 Ga0307409_102877382 Ga0307409_1028773822 90
678 3300031995 Ga0307409_102975120 Ga0307409_1029751202 90
679 3300032002 Ga0307416_100007153 Ga0307416_1000071532 90
680 3300032133 Ga0316583_10357425 Ga0316583_103574251 90
681 3300033541 Ga0316596_1073834 Ga0316596_10738341 90
682 3300035117 Ga0373953_0427738 Ga0373953_0427738_194_469 90
683 3300035172 Ga0373955_0207534 Ga0373955_0207534_667_939 90
684 3300035241 Ga0373961_0334439 Ga0373961_0334439_65_337 90
685 3300035242 Ga0373962_0222017 Ga0373962_0222017_30_302 90
686 3300035398 Ga0316574_0084413 Ga0316574_0084413_169_441 90
687 3300035398 Ga0316574_0233711 Ga0316574_0233711_320_595 90
688 3300035398 Ga0316574_0710966 Ga0316574_0710966_135_407 90
689 3300035724 Ga0373933_0230983 Ga0373933_0230983_535_807 90
690 3300036401 Ga0373937_0093812 Ga0373937_0093812_608_880 90
691 3300036401 Ga0373937_0099240 Ga0373937_0099240_845_1120 90
692 3300036401 Ga0373937_0906547 Ga0373937_0906547_425_697 90
693 3300036647 Ga0316582_1061819 Ga0316582_1061819_106_378 90
694 3300036712 Ga0316584_0076334 Ga0316584_0076334_1005_1277 90
695 3300036712 Ga0316584_0105111 Ga0316584_0105111_488_760 90
696 3300037312 Ga0395899_0040970 Ga0395899_0040970_787_1059 90
697 3300037312 Ga0395899_0521791 Ga0395899_0521791_221_493 90
698 3300037418 Ga0395900_0047402 Ga0395900_0047402_1628_1900 90
699 3300037418 Ga0395900_0193162 Ga0395900_0193162_67_339 90
700 3300037418 Ga0395900_0451853 Ga0395900_0451853_489_761 90
701 3300037418 Ga0395900_1270433 Ga0395900_1270433_10_282 90
702 3300037418 Ga0395900_1439792 Ga0395900_1439792_165_437 90
703 3300037418 Ga0395900_1652645 Ga0395900_1652645_125_397 90
704 3300037466 Ga0395898_0015116 Ga0395898_0015116_3439_3711 90
705 3300037466 Ga0395898_0028975 Ga0395898_0028975_1645_1917 90
706 3300037466 Ga0395898_0739748 Ga0395898_0739748_200_472 90
707 3300037466 Ga0395898_1648897 Ga0395898_1648897_159_431 90
708 3300037471 Ga0395905_0058834 Ga0395905_0058834_183_455 90
709 3300037471 Ga0395905_0271174 Ga0395905_0271174_779_1051 90
710 3300037853 Ga0436364_1436303 Ga0436364_1436303_158_433 90
711 3300038443 Ga0395901_0044882 Ga0395901_0044882_1150_1422 90
712 3300038443 Ga0395901_0181831 Ga0395901_0181831_1037_1309 90
713 3300038443 Ga0395901_0475111 Ga0395901_0475111_941_1213 90
714 3300038443 Ga0395901_0660183 Ga0395901_0660183_764_1036 90
715 3300038443 Ga0395901_1033616 Ga0395901_1033616_65_337 90
716 3300038443 Ga0395901_1548546 Ga0395901_1548546_318_590 90
717 3300041441 Ga0451787_712849 Ga0451787_712849_238_513 90
718 3300041459 Ga0451800_1407260 Ga0451800_1407260_177_452 90
719 3300041463 Ga0451804_0577682 Ga0451804_0577682_80_352 90
720 3300041463 Ga0451804_0667066 Ga0451804_0667066_90_362 90
721 3300041486 Ga0451807_1152741 Ga0451807_1152741_704_976 90
722 3300041492 Ga0451835_0727965 Ga0451835_0727965_199_471 90
723 3300041496 Ga0451839_0942696 Ga0451839_0942696_133_405 90
724 3300041501 Ga0451845_0014378 Ga0451845_0014378_102_377 90
725 3300041501 Ga0451845_0941955 Ga0451845_0941955_222_494 90
726 3300041505 Ga0451849_0369994 Ga0451849_0369994_346_618 90
727 3300041507 Ga0451851_1115656 Ga0451851_1115656_320_595 90
728 3300041512 Ga0451853_0637403 Ga0451853_0637403_230_502 90
729 3300041512 Ga0451853_2136927 Ga0451853_2136927_1816_2088 90
730 3300041512 Ga0451853_3163208 Ga0451853_3163208_307_579 90
731 3300041512 Ga0451853_3772225 Ga0451853_3772225_329_601 90
732 3300042438 Ga0439459_0009945 Ga0439459_0009945_128_400 90
733 3300042993 Ga0439440_0176935 Ga0439440_0176935_28_300 90
734 3300044683 Ga0466965_0682609 Ga0466965_0682609_301_576 90
735 3300044694 Ga0466963_0000017 Ga0466963_0000017_25424_25696 90
736 3300044694 Ga0466963_0237008 Ga0466963_0237008_456_728 90
737 3300044694 Ga0466963_0465545 Ga0466963_0465545_311_583 90
738 3300044706 Ga0466964_0680097 Ga0466964_0680097_177_449 90
739 3300044719 Ga0466971_0590931 Ga0466971_0590931_56_328 90
740 3300044842 Ga0466957_0001414 Ga0466957_0001414_5321_5596 90
741 3300044842 Ga0466957_0929659 Ga0466957_0929659_222_494 90
742 3300044901 Ga0466960_0604182 Ga0466960_0604182_95_370 90
743 3300045976 Ga0466967_0000001 Ga0466967_0000001_114836_115108 90
744 3300045976 Ga0466967_0518478 Ga0466967_0518478_413_688 90
745 3300045976 Ga0466967_0782900 Ga0466967_0782900_608_883 90
746 3300045976 Ga0466967_1023652 Ga0466967_1023652_60_335 90
747 3300045976 Ga0466967_1714555 Ga0466967_1714555_34_306 90
748 3300045976 Ga0466967_2343148 Ga0466967_2343148_204_476 90
749 3300046454 Ga0495592_0000607 Ga0495592_0000607_19252_19524 90
750 3300046455 Ga0495603_0000286 Ga0495603_0000286_16062_16334 90
751 3300046455 Ga0495603_0001350 Ga0495603_0001350_8356_8628 90
752 3300046455 Ga0495603_0050651 Ga0495603_0050651_1158_1430 90
753 3300046459 Ga0495629_0000245 Ga0495629_0000245_38716_38988 90
754 3300046459 Ga0495629_0005286 Ga0495629_0005286_4328_4600 90
755 3300046459 Ga0495629_0010859 Ga0495629_0010859_914_1186 90
756 3300046459 Ga0495629_1081189 Ga0495629_1081189_223_495 90
757 3300046461 Ga0495641_0000005 Ga0495641_0000005_184015_184287 90
758 3300046461 Ga0495641_0009181 Ga0495641_0009181_1819_2091 90
759 3300046461 Ga0495641_0031015 Ga0495641_0031015_2185_2457 90
760 3300046461 Ga0495641_0409205 Ga0495641_0409205_296_568 90
761 3300046462 Ga0495651_0176727 Ga0495651_0176727_700_972 90
762 3300046462 Ga0495651_0297780 Ga0495651_0297780_255_527 90
763 3300046463 Ga0495653_0103405 Ga0495653_0103405_959_1231 90
764 3300046463 Ga0495653_0135879 Ga0495653_0135879_882_1157 90
765 3300046463 Ga0495653_0169316 Ga0495653_0169316_303_575 90
766 3300046463 Ga0495653_0197448 Ga0495653_0197448_494_766 90
767 3300046463 Ga0495653_0881077 Ga0495653_0881077_155_427 90
768 3300046473 Ga0495582_0000001 Ga0495582_0000001_77390_77662 90
769 3300046475 Ga0495639_0236502 Ga0495639_0236502_324_596 90
770 3300046476 Ga0495662_0000001 Ga0495662_0000001_20724_20996 90
771 3300046477 Ga0495664_0282300 Ga0495664_0282300_497_769 90
772 3300046491 Ga0495584_0562469 Ga0495584_0562469_67_339 90
773 3300046499 Ga0495594_0109392 Ga0495594_0109392_37_309 90
774 3300046507 Ga0495606_0000040 Ga0495606_0000040_46761_47033 90
775 3300046511 Ga0495608_0000007 Ga0495608_0000007_121908_122180 90
776 3300046511 Ga0495608_0023011 Ga0495608_0023011_2053_2325 90
777 3300046511 Ga0495608_0038868 Ga0495608_0038868_1881_2153 90
778 3300046511 Ga0495608_0399205 Ga0495608_0399205_268_543 90
779 3300046511 Ga0495608_0525028 Ga0495608_0525028_89_361 90
780 3300046512 Ga0495610_0041056 Ga0495610_0041056_1112_1384 90
781 3300046514 Ga0495618_0000014 Ga0495618_0000014_114161_114433 90
782 3300046515 Ga0495620_0000784 Ga0495620_0000784_461_733 90
783 3300046515 Ga0495620_0072027 Ga0495620_0072027_242_517 90
784 3300046516 Ga0495628_0000679 Ga0495628_0000679_29136_29408 90
785 3300046516 Ga0495628_0031056 Ga0495628_0031056_2222_2494 90
786 3300046516 Ga0495628_0074492 Ga0495628_0074492_2051_2323 90
787 3300046516 Ga0495628_0098751 Ga0495628_0098751_1784_2056 90
788 3300046517 Ga0495630_0000014 Ga0495630_0000014_188422_188694 90
789 3300046517 Ga0495630_0003407 Ga0495630_0003407_4517_4789 90
790 3300046517 Ga0495630_0069675 Ga0495630_0069675_1966_2238 90
791 3300046523 Ga0495644_0001871 Ga0495644_0001871_4374_4646 90
792 3300046525 Ga0495663_0100331 Ga0495663_0100331_245_517 90
793 3300046529 Ga0495652_0011995 Ga0495652_0011995_6613_6885 90
794 3300046529 Ga0495652_0214350 Ga0495652_0214350_1134_1406 90
795 3300046533 Ga0495640_0043829 Ga0495640_0043829_702_974 90
796 3300046533 Ga0495640_0249307 Ga0495640_0249307_702_974 90
797 3300046533 Ga0495640_0528033 Ga0495640_0528033_268_540 90
798 3300046535 Ga0495586_0086430 Ga0495586_0086430_582_854 90
799 3300046536 Ga0495587_0827437 Ga0495587_0827437_102_374 90
800 3300046543 Ga0495645_0027447 Ga0495645_0027447_780_1052 90
801 3300046543 Ga0495645_0046873 Ga0495645_0046873_2632_2904 90
802 3300046559 Ga0495667_0000020 Ga0495667_0000020_66730_67002 90
803 3300046615 Ga0495656_0000465 Ga0495656_0000465_8376_8648 90
804 3300046615 Ga0495656_0433451 Ga0495656_0433451_34_312 90
805 3300046616 Ga0495668_0223839 Ga0495668_0223839_548_820 90
806 3300046642 Ga0495634_0000028 Ga0495634_0000028_9984_10256 90
807 3300046642 Ga0495634_0001744 Ga0495634_0001744_13186_13467 90
808 3300046642 Ga0495634_0105054 Ga0495634_0105054_1059_1331 90
809 3300046642 Ga0495634_0128989 Ga0495634_0128989_1321_1593 90
810 3300046642 Ga0495634_0386255 Ga0495634_0386255_423_695 90
811 3300046663 Ga0495635_0026499 Ga0495635_0026499_246_518 90
812 3300046663 Ga0495635_0328011 Ga0495635_0328011_692_967 90
813 3300046665 Ga0495661_0575247 Ga0495661_0575247_143_415 90
814 3300046674 Ga0495588_0000362 Ga0495588_0000362_20458_20730 90
815 3300046674 Ga0495588_0226240 Ga0495588_0226240_144_416 90
816 3300046675 Ga0495657_0000001 Ga0495657_0000001_254054_254326 90
817 3300046675 Ga0495657_0024829 Ga0495657_0024829_3623_3895 90
818 3300046678 Ga0495599_0046673 Ga0495599_0046673_966_1238 90
819 3300046680 Ga0495646_0151250 Ga0495646_0151250_119_391 90
820 3300046680 Ga0495646_0198191 Ga0495646_0198191_191_466 90
821 3300046681 Ga0495647_0000001 Ga0495647_0000001_109649_109921 90
822 3300046681 Ga0495647_0008133 Ga0495647_0008133_2572_2844 90
823 3300046681 Ga0495647_0238325 Ga0495647_0238325_332_607 90
824 3300046683 Ga0495658_0000002 Ga0495658_0000002_200996_201268 90
825 3300046683 Ga0495658_0060194 Ga0495658_0060194_464_736 90
826 3300046683 Ga0495658_0295977 Ga0495658_0295977_703_978 90
827 3300046684 Ga0495669_0000113 Ga0495669_0000113_25938_26210 90
828 3300046684 Ga0495669_0399452 Ga0495669_0399452_137_409 90
829 3300046689 Ga0495613_0000005 Ga0495613_0000005_101605_101877 90
830 3300046689 Ga0495613_0000041 Ga0495613_0000041_60980_61252 90
831 3300046689 Ga0495613_0039372 Ga0495613_0039372_1398_1673 90
832 3300046690 Ga0495624_0000417 Ga0495624_0000417_22984_23256 90
833 3300046690 Ga0495624_0263454 Ga0495624_0263454_49_321 90
834 3300046690 Ga0495624_0802842 Ga0495624_0802842_162_434 90
835 3300046691 Ga0495670_0006058 Ga0495670_0006058_4146_4418 90
836 3300046692 Ga0495671_0459099 Ga0495671_0459099_92_364 90
837 3300046809 Ga0495600_0011717 Ga0495600_0011717_2010_2282 90
838 3300046809 Ga0495600_0112106 Ga0495600_0112106_712_987 90
839 3300046809 Ga0495600_0303642 Ga0495600_0303642_85_357 90
840 3300047315 Ga0495581_0203413 Ga0495581_0203413_64_336 90
841 3300047315 Ga0495581_0384812 Ga0495581_0384812_13_285 90
842 3300047317 Ga0495604_0000239 Ga0495604_0000239_4583_4855 90
843 3300047317 Ga0495604_0001251 Ga0495604_0001251_10827_11099 90
844 3300047319 Ga0495674_0247369 Ga0495674_0247369_389_661 90
845 3300047321 Ga0495676_0000827 Ga0495676_0000827_10459_10734 90
846 3300047321 Ga0495676_0002855 Ga0495676_0002855_13198_13470 90
847 3300047321 Ga0495676_0012579 Ga0495676_0012579_2047_2319 90
848 3300047321 Ga0495676_0028979 Ga0495676_0028979_3180_3452 90
849 3300047321 Ga0495676_0117131 Ga0495676_0117131_245_517 90
850 3300047321 Ga0495676_0231492 Ga0495676_0231492_773_1045 90
851 3300047321 Ga0495676_0280990 Ga0495676_0280990_754_1026 90
852 3300047321 Ga0495676_0912990 Ga0495676_0912990_150_422 90
853 3300047322 Ga0495680_0000143 Ga0495680_0000143_5696_5968 90
854 3300047322 Ga0495680_0001430 Ga0495680_0001430_6681_6953 90
855 3300047322 Ga0495680_0067314 Ga0495680_0067314_319_591 90
856 3300047444 Ga0495675_0001421 Ga0495675_0001421_5683_5955 90
857 3300047469 Ga0495673_0113592 Ga0495673_0113592_496_768 90
858 3300047471 Ga0495684_0210310 Ga0495684_0210310_189_461 90
859 3300047471 Ga0495684_1033764 Ga0495684_1033764_216_491 90
860 3300047472 Ga0495686_0270817 Ga0495686_0270817_99_371 90
861 3300047673 Ga0495593_0231268 Ga0495593_0231268_450_722 90
862 3300048088 Ga0495602_0001031 Ga0495602_0001031_14744_15016 90
863 3300048088 Ga0495602_0156363 Ga0495602_0156363_1010_1285 90
864 3300048088 Ga0495602_0271539 Ga0495602_0271539_327_599 90
865 3300048088 Ga0495602_0614244 Ga0495602_0614244_253_525 90
866 3300048088 Ga0495602_1160562 Ga0495602_1160562_90_362 90
867 3300048089 Ga0495614_0012048 Ga0495614_0012048_3219_3491 90
868 3300048089 Ga0495614_0257758 Ga0495614_0257758_371_643 90
869 3300048903 Ga0496100_0000001 Ga0496100_0000001_424150_424425 90
870 3300048903 Ga0496100_0000013 Ga0496100_0000013_65317_65589 90
871 3300048903 Ga0496100_0013391 Ga0496100_0013391_2658_2930 90
872 3300048903 Ga0496100_0322156 Ga0496100_0322156_456_728 90
873 3300048903 Ga0496100_0498137 Ga0496100_0498137_270_542 90
874 3300048903 Ga0496100_0701642 Ga0496100_0701642_359_631 90
875 3300048903 Ga0496100_1241638 Ga0496100_1241638_272_544 90
876 3300048903 Ga0496100_1366887 Ga0496100_1366887_93_365 90
877 3300048904 Ga0496101_0000004 Ga0496101_0000004_225502_225777 90
878 3300048904 Ga0496101_0000035 Ga0496101_0000035_65317_65589 90
879 3300048904 Ga0496101_0245701 Ga0496101_0245701_1005_1277 90
880 3300048904 Ga0496101_0789118 Ga0496101_0789118_200_472 90
881 3300048905 Ga0496102_0000211 Ga0496102_0000211_10019_10291 90
882 3300048905 Ga0496102_0045517 Ga0496102_0045517_1805_2077 90
883 3300048905 Ga0496102_0639694 Ga0496102_0639694_404_676 90
884 3300048905 Ga0496102_1095013 Ga0496102_1095013_184_456 90
885 3300048906 Ga0496103_0000083 Ga0496103_0000083_41439_41711 90
886 3300048906 Ga0496103_0006964 Ga0496103_0006964_3405_3677 90
887 3300048906 Ga0496103_0223100 Ga0496103_0223100_307_579 90
888 3300048907 Ga0496104_0000015 Ga0496104_0000015_259821_260093 90
889 3300048907 Ga0496104_0000026 Ga0496104_0000026_61971_62246 90
890 3300048907 Ga0496104_0000052 Ga0496104_0000052_29319_29591 90
891 3300048907 Ga0496104_0000765 Ga0496104_0000765_27101_27373 90
892 3300048907 Ga0496104_0017182 Ga0496104_0017182_2132_2404 90
893 3300048907 Ga0496104_0028668 Ga0496104_0028668_1991_2263 90
894 3300048907 Ga0496104_0317011 Ga0496104_0317011_675_947 90
895 3300048907 Ga0496104_0666724 Ga0496104_0666724_646_918 90
896 3300048908 Ga0496105_0000004 Ga0496105_0000004_215706_215978 90
897 3300048908 Ga0496105_0000030 Ga0496105_0000030_107735_108007 90
898 3300048908 Ga0496105_0000409 Ga0496105_0000409_14241_14513 90
899 3300048908 Ga0496105_0022580 Ga0496105_0022580_1760_2032 90
900 3300048908 Ga0496105_0022858 Ga0496105_0022858_4601_4873 90
901 3300048908 Ga0496105_0027673 Ga0496105_0027673_2744_3016 90
902 3300048908 Ga0496105_0052093 Ga0496105_0052093_2182_2454 90
903 3300048908 Ga0496105_0672496 Ga0496105_0672496_338_613 90
904 3300048909 Ga0496106_0000076 Ga0496106_0000076_21340_21615 90
905 3300048909 Ga0496106_0000121 Ga0496106_0000121_35218_35490 90
906 3300048909 Ga0496106_0004512 Ga0496106_0004512_6269_6541 90
907 3300048909 Ga0496106_0012259 Ga0496106_0012259_2369_2641 90
908 3300048909 Ga0496106_0031326 Ga0496106_0031326_1706_1978 90
909 3300048909 Ga0496106_0072451 Ga0496106_0072451_193_465 90
910 3300048909 Ga0496106_0286024 Ga0496106_0286024_554_826 90
911 3300048909 Ga0496106_0357051 Ga0496106_0357051_623_895 90
912 3300048910 Ga0496107_0000005 Ga0496107_0000005_105823_106098 90
913 3300048910 Ga0496107_0000020 Ga0496107_0000020_36466_36738 90
914 3300048910 Ga0496107_0016540 Ga0496107_0016540_4256_4528 90
915 3300048910 Ga0496107_0032962 Ga0496107_0032962_1807_2079 90
916 3300048910 Ga0496107_0041276 Ga0496107_0041276_517_789 90
917 3300048910 Ga0496107_0072035 Ga0496107_0072035_2171_2443 90
918 3300048910 Ga0496107_0089310 Ga0496107_0089310_518_790 90
919 3300048910 Ga0496107_0481660 Ga0496107_0481660_497_769 90
920 3300048910 Ga0496107_0568796 Ga0496107_0568796_463_735 90
921 3300048911 Ga0496108_0000006 Ga0496108_0000006_342711_342983 90
922 3300048911 Ga0496108_0000063 Ga0496108_0000063_89834_90106 90
923 3300048911 Ga0496108_0003280 Ga0496108_0003280_4649_4921 90
924 3300048911 Ga0496108_0005560 Ga0496108_0005560_8585_8857 90
925 3300048911 Ga0496108_0015242 Ga0496108_0015242_3830_4102 90
926 3300048911 Ga0496108_0054035 Ga0496108_0054035_2490_2762 90
927 3300048911 Ga0496108_0113371 Ga0496108_0113371_991_1263 90
928 3300048911 Ga0496108_0185162 Ga0496108_0185162_654_926 90
929 3300048911 Ga0496108_1648461 Ga0496108_1648461_30_305 90
930 3300048912 Ga0496109_0000009 Ga0496109_0000009_109799_110071 90
931 3300048912 Ga0496109_0000012 Ga0496109_0000012_22641_22913 90
932 3300048912 Ga0496109_0000348 Ga0496109_0000348_24294_24566 90
933 3300048912 Ga0496109_0003361 Ga0496109_0003361_10377_10649 90
934 3300048912 Ga0496109_0005652 Ga0496109_0005652_287_559 90
935 3300048912 Ga0496109_0068649 Ga0496109_0068649_1750_2022 90
936 3300048912 Ga0496109_0070649 Ga0496109_0070649_2509_2781 90
937 3300048912 Ga0496109_0107331 Ga0496109_0107331_2104_2376 90
938 3300048912 Ga0496109_0130860 Ga0496109_0130860_1515_1787 90
939 3300048912 Ga0496109_0644781 Ga0496109_0644781_442_717 90
940 3300048912 Ga0496109_0831491 Ga0496109_0831491_39_311 90
941 3300048913 Ga0496110_0000183 Ga0496110_0000183_31828_32103 90
942 3300048913 Ga0496110_0002164 Ga0496110_0002164_8769_9041 90
943 3300048913 Ga0496110_0012481 Ga0496110_0012481_6510_6782 90
944 3300048913 Ga0496110_0020894 Ga0496110_0020894_4393_4665 90
945 3300048913 Ga0496110_0059269 Ga0496110_0059269_1090_1362 90
946 3300048913 Ga0496110_0088109 Ga0496110_0088109_1554_1826 90
947 3300048913 Ga0496110_0427934 Ga0496110_0427934_18_290 90
948 3300048914 Ga0496111_0000006 Ga0496111_0000006_45398_45673 90
949 3300048914 Ga0496111_0000044 Ga0496111_0000044_32695_32967 90
950 3300048914 Ga0496111_0012021 Ga0496111_0012021_3303_3575 90
951 3300048914 Ga0496111_0017776 Ga0496111_0017776_918_1190 90
952 3300048914 Ga0496111_0047291 Ga0496111_0047291_318_590 90
953 3300048914 Ga0496111_0117841 Ga0496111_0117841_814_1086 90
954 3300048914 Ga0496111_0406139 Ga0496111_0406139_17_289 90
955 3300048914 Ga0496111_0720627 Ga0496111_0720627_252_524 90
956 3300048914 Ga0496111_0987842 Ga0496111_0987842_231_512 90
957 3300048915 Ga0496112_0000025 Ga0496112_0000025_110671_110943 90
958 3300048915 Ga0496112_0320767 Ga0496112_0320767_1140_1412 90
959 3300048915 Ga0496112_0852429 Ga0496112_0852429_345_617 90
960 3300048916 Ga0496113_0038054 Ga0496113_0038054_1416_1688 90
961 3300048916 Ga0496113_0052521 Ga0496113_0052521_1992_2264 90
962 3300048916 Ga0496113_0072254 Ga0496113_0072254_732_1004 90
963 3300048916 Ga0496113_0153224 Ga0496113_0153224_1340_1612 90
964 3300048916 Ga0496113_1451966 Ga0496113_1451966_156_428 90
965 3300048917 Ga0496114_0000039 Ga0496114_0000039_30029_30301 90
966 3300048917 Ga0496114_0008849 Ga0496114_0008849_3869_4141 90
967 3300048917 Ga0496114_0070615 Ga0496114_0070615_1953_2225 90
968 3300048917 Ga0496114_0243025 Ga0496114_0243025_909_1181 90
969 3300048917 Ga0496114_0385840 Ga0496114_0385840_67_339 90
970 3300048917 Ga0496114_0484440 Ga0496114_0484440_708_980 90
971 3300048917 Ga0496114_0738916 Ga0496114_0738916_168_440 90
972 3300048917 Ga0496114_0747306 Ga0496114_0747306_47_319 90
973 3300048917 Ga0496114_1053735 Ga0496114_1053735_26_298 90
974 3300048918 Ga0496115_0000011 Ga0496115_0000011_104680_104952 90
975 3300048918 Ga0496115_0000377 Ga0496115_0000377_17812_18084 90
976 3300048918 Ga0496115_0014845 Ga0496115_0014845_3335_3607 90
977 3300048918 Ga0496115_0058673 Ga0496115_0058673_2325_2597 90
978 3300048919 Ga0496116_0000848 Ga0496116_0000848_12280_12552 90
979 3300048921 Ga0496118_0081280 Ga0496118_0081280_1968_2240 90
980 3300048922 Ga0496119_0006696 Ga0496119_0006696_10194_10466 90
981 3300048922 Ga0496119_0074670 Ga0496119_0074670_390_662 90
982 3300048923 Ga0496120_0020522 Ga0496120_0020522_3504_3776 90
983 3300048923 Ga0496120_0201590 Ga0496120_0201590_139_411 90
984 3300048923 Ga0496120_0253122 Ga0496120_0253122_493_765 90
985 3300048924 Ga0496121_0019544 Ga0496121_0019544_2061_2333 90
986 3300048924 Ga0496121_0037698 Ga0496121_0037698_1816_2088 90
987 3300048924 Ga0496121_0061978 Ga0496121_0061978_2208_2480 90
988 3300048927 Ga0496124_0051640 Ga0496124_0051640_502_774 90
989 3300048927 Ga0496124_0854420 Ga0496124_0854420_192_473 90
990 3300048928 Ga0496125_0056109 Ga0496125_0056109_1584_1856 90
991 3300048928 Ga0496125_0080795 Ga0496125_0080795_1746_2018 90
992 3300048928 Ga0496125_0104445 Ga0496125_0104445_1264_1536 90
993 3300048929 Ga0496126_0055061 Ga0496126_0055061_1419_1691 90
994 3300048929 Ga0496126_0093953 Ga0496126_0093953_933_1205 90
995 3300048929 Ga0496126_0277289 Ga0496126_0277289_596_868 90
996 3300049568 Ga0501031_0002175 Ga0501031_0002175_4716_4988 90
997 3300049568 Ga0501031_0116828 Ga0501031_0116828_1064_1336 90
998 3300049568 Ga0501031_0231236 Ga0501031_0231236_710_982 90
999 3300049569 Ga0501032_0029241 Ga0501032_0029241_2163_2435 90
1000 3300049569 Ga0501032_1060851 Ga0501032_1060851_71_352 90
1001 3300049570 Ga0501033_0003689 Ga0501033_0003689_4707_4979 90
1002 3300049570 Ga0501033_0600274 Ga0501033_0600274_263_574 90
1003 3300049571 Ga0501034_0060242 Ga0501034_0060242_1847_2119 90
1004 3300049571 Ga0501034_0846348 Ga0501034_0846348_84_356 90
1005 3300049571 Ga0501034_1296104 Ga0501034_1296104_285_557 90
1006 3300049572 Ga0501036_0054251 Ga0501036_0054251_2336_2608 90
1007 3300049572 Ga0501036_0472846 Ga0501036_0472846_716_988 90
1008 3300049572 Ga0501036_0778303 Ga0501036_0778303_36_308 90
1009 3300049572 Ga0501036_0883511 Ga0501036_0883511_348_659 90
1010 3300049573 Ga0501037_0002926 Ga0501037_0002926_4716_4988 90
1011 3300049574 Ga0501038_0005058 Ga0501038_0005058_4716_4988 90
1012 3300049574 Ga0501038_0356257 Ga0501038_0356257_607_879 90
1013 3300049574 Ga0501038_0506083 Ga0501038_0506083_333_644 90
1014 3300049575 Ga0501039_0136070 Ga0501039_0136070_1337_1609 90
1015 3300049575 Ga0501039_0511325 Ga0501039_0511325_607_918 90
1016 3300049576 Ga0501040_0061674 Ga0501040_0061674_518_790 90
1017 3300049576 Ga0501040_0310184 Ga0501040_0310184_49_327 90
1018 3300049576 Ga0501040_0454371 Ga0501040_0454371_142_414 90
1019 3300049576 Ga0501040_0476131 Ga0501040_0476131_155_466 90
1020 3300049576 Ga0501040_0480873 Ga0501040_0480873_241_513 90
1021 3300049577 Ga0501041_0273970 Ga0501041_0273970_609_887 90
1022 3300049577 Ga0501041_0444395 Ga0501041_0444395_309_581 90
1023 3300049577 Ga0501041_0489910 Ga0501041_0489910_283_594 90
1024 3300049577 Ga0501041_0599604 Ga0501041_0599604_394_675 90
1025 3300049578 Ga0501042_0012872 Ga0501042_0012872_3174_3446 90
1026 3300049578 Ga0501042_0308826 Ga0501042_0308826_567_839 90
1027 3300049578 Ga0501042_0578302 Ga0501042_0578302_394_666 90
1028 3300049578 Ga0501042_0648213 Ga0501042_0648213_184_495 90
1029 3300049578 Ga0501042_0783642 Ga0501042_0783642_284_556 90
1030 3300049579 Ga0501043_0012332 Ga0501043_0012332_4716_4988 90
1031 3300049579 Ga0501043_0122982 Ga0501043_0122982_428_700 90
1032 3300049579 Ga0501043_1334412 Ga0501043_1334412_73_384 90
1033 3300049580 Ga0501046_0004559 Ga0501046_0004559_7572_7844 90
1034 3300049580 Ga0501046_0979029 Ga0501046_0979029_300_578 90
1035 3300049581 Ga0501047_0004952 Ga0501047_0004952_7523_7795 90
1036 3300049581 Ga0501047_0036469 Ga0501047_0036469_801_1073 90
1037 3300049581 Ga0501047_0073899 Ga0501047_0073899_626_898 90
1038 3300049581 Ga0501047_0239337 Ga0501047_0239337_19_291 90
1039 3300049581 Ga0501047_0341399 Ga0501047_0341399_371_643 90
1040 3300049581 Ga0501047_0439594 Ga0501047_0439594_709_981 90
1041 3300049581 Ga0501047_0749317 Ga0501047_0749317_484_756 90
1042 3300049581 Ga0501047_1080050 Ga0501047_1080050_118_390 90
1043 3300049582 Ga0501048_0003128 Ga0501048_0003128_7449_7721 90
1044 3300049582 Ga0501048_0806070 Ga0501048_0806070_193_465 90
1045 3300049583 Ga0501067_0058076 Ga0501067_0058076_1744_2016 90
1046 3300049583 Ga0501067_0195064 Ga0501067_0195064_154_426 90
1047 3300049583 Ga0501067_0479181 Ga0501067_0479181_374_646 90
1048 3300049584 Ga0501068_0002345 Ga0501068_0002345_4454_4726 90
1049 3300049584 Ga0501068_0419741 Ga0501068_0419741_255_527 90
1050 3300049584 Ga0501068_0811080 Ga0501068_0811080_138_410 90
1051 3300049585 Ga0501069_0004919 Ga0501069_0004919_1959_2231 90
1052 3300049585 Ga0501069_0076677 Ga0501069_0076677_630_902 90
1053 3300049585 Ga0501069_0285522 Ga0501069_0285522_133_405 90
1054 3300049585 Ga0501069_0597746 Ga0501069_0597746_358_630 90
1055 3300049585 Ga0501069_0663541 Ga0501069_0663541_94_366 90
1056 3300049586 Ga0501070_0004064 Ga0501070_0004064_7588_7860 90
1057 3300049586 Ga0501070_0052975 Ga0501070_0052975_2141_2413 90
1058 3300049586 Ga0501070_0112042 Ga0501070_0112042_1598_1870 90
1059 3300049586 Ga0501070_0285402 Ga0501070_0285402_507_779 90
1060 3300049586 Ga0501070_0508727 Ga0501070_0508727_591_863 90
1061 3300049586 Ga0501070_0741122 Ga0501070_0741122_364_636 90
1062 3300049587 Ga0501071_0144925 Ga0501071_0144925_247_519 90
1063 3300049587 Ga0501071_0581455 Ga0501071_0581455_470_742 90
1064 3300049587 Ga0501071_0760788 Ga0501071_0760788_53_325 90
1065 3300049587 Ga0501071_1248169 Ga0501071_1248169_136_414 90
1066 3300049587 Ga0501071_1492584 Ga0501071_1492584_57_329 90
1067 3300049588 Ga0501072_0017464 Ga0501072_0017464_4674_4946 90
1068 3300049588 Ga0501072_0262480 Ga0501072_0262480_721_993 90
1069 3300049588 Ga0501072_0420609 Ga0501072_0420609_280_552 90
1070 3300049588 Ga0501072_0439029 Ga0501072_0439029_169_441 90
1071 3300049588 Ga0501072_0484498 Ga0501072_0484498_125_436 90
1072 3300049588 Ga0501072_1025716 Ga0501072_1025716_283_555 90
1073 3300049589 Ga0501073_0013576 Ga0501073_0013576_1010_1282 90
1074 3300049589 Ga0501073_0168325 Ga0501073_0168325_713_985 90
1075 3300049589 Ga0501073_0923848 Ga0501073_0923848_234_506 90
1076 3300049590 Ga0501074_0013977 Ga0501074_0013977_1037_1309 90
1077 3300049590 Ga0501074_0018921 Ga0501074_0018921_869_1141 90
1078 3300049590 Ga0501074_0119985 Ga0501074_0119985_709_981 90
1079 3300049590 Ga0501074_1192026 Ga0501074_1192026_145_426 90
1080 3300049591 Ga0501075_0044891 Ga0501075_0044891_2140_2412 90
1081 3300049591 Ga0501075_0197282 Ga0501075_0197282_1140_1451 90
1082 3300049591 Ga0501075_0347161 Ga0501075_0347161_332_613 90
1083 3300049592 Ga0501076_0165288 Ga0501076_0165288_643_915 90
1084 3300049592 Ga0501076_0533234 Ga0501076_0533234_494_766 90
1085 3300049592 Ga0501076_0773037 Ga0501076_0773037_164_475 90
1086 3300049592 Ga0501076_1203947 Ga0501076_1203947_280_552 90
1087 3300049593 Ga0501077_0116673 Ga0501077_0116673_139_450 90
1088 3300049593 Ga0501077_0163550 Ga0501077_0163550_459_731 90
1089 3300049593 Ga0501077_0166667 Ga0501077_0166667_169_441 90
1090 3300049741 Ga0501079_0012033 Ga0501079_0012033_1919_2191 90
1091 3300049741 Ga0501079_0175584 Ga0501079_0175584_986_1297 90
1092 3300049741 Ga0501079_0355754 Ga0501079_0355754_399_671 90
1093 3300049742 Ga0501080_0015300 Ga0501080_0015300_2149_2421 90
1094 3300049742 Ga0501080_0030783 Ga0501080_0030783_1638_1910 90
1095 3300049742 Ga0501080_1744556 Ga0501080_1744556_203_475 90
1096 3300049743 Ga0501081_0261497 Ga0501081_0261497_582_893 90
1097 3300049743 Ga0501081_0458392 Ga0501081_0458392_479_751 90
1098 3300049744 Ga0501083_0002614 Ga0501083_0002614_7425_7697 90
1099 3300049744 Ga0501083_0080795 Ga0501083_0080795_435_707 90
1100 3300049744 Ga0501083_0533664 Ga0501083_0533664_125_436 90
1101 3300049744 Ga0501083_0845170 Ga0501083_0845170_173_454 90
1102 3300049822 Ga0501035_0005116 Ga0501035_0005116_7433_7705 90
1103 3300049822 Ga0501035_0137851 Ga0501035_0137851_342_614 90
1104 3300049823 Ga0501044_0006919 Ga0501044_0006919_7496_7768 90
1105 3300049823 Ga0501044_0128972 Ga0501044_0128972_432_704 90
1106 3300049823 Ga0501044_0193833 Ga0501044_0193833_446_718 90
1107 3300049823 Ga0501044_0478439 Ga0501044_0478439_693_965 90
1108 3300049823 Ga0501044_0541717 Ga0501044_0541717_761_1033 90
1109 3300049824 Ga0501045_0388877 Ga0501045_0388877_170_451 90
1110 3300049824 Ga0501045_0447533 Ga0501045_0447533_156_428 90
1111 3300049824 Ga0501045_0473108 Ga0501045_0473108_201_473 90
1112 3300049824 Ga0501045_0842390 Ga0501045_0842390_130_402 90
1113 3300050490 nmdc:mga03n38_617731_c1 nmdc:mga03n38_617731_c1_317_589 90
1114 3300050491 nmdc:mga00v17_156003_c1 nmdc:mga00v17_156003_c1_992_1264 90
1115 3300050491 nmdc:mga00v17_16288_c1 nmdc:mga00v17_16288_c1_1165_1440 90
1116 3300050491 nmdc:mga00v17_888749_c1 nmdc:mga00v17_888749_c1_33_305 90
1117 3300050491 nmdc:mga00v17_920239_c1 nmdc:mga00v17_920239_c1_232_504 90
1118 3300050491 nmdc:mga00v17_964283_c1 nmdc:mga00v17_964283_c1_179_451 90
1119 3300050492 nmdc:mga0yw44_362973_c1 nmdc:mga0yw44_362973_c1_377_652 90
1120 3300050492 nmdc:mga0yw44_37019_c1 nmdc:mga0yw44_37019_c1_44_316 90
1121 3300050492 nmdc:mga0yw44_589_c1 nmdc:mga0yw44_589_c1_7067_7339 90
1122 3300050492 nmdc:mga0yw44_675_c1 nmdc:mga0yw44_675_c1_10850_11122 90
1123 3300050492 nmdc:mga0yw44_8725_c1 nmdc:mga0yw44_8725_c1_1533_1808 90
1124 3300050492 nmdc:mga0yw44_939551_c1 nmdc:mga0yw44_939551_c1_159_434 90
1125 3300050495 nmdc:mga04h51_373446_c1 nmdc:mga04h51_373446_c1_227_499 90
1126 3300050507 nmdc:mga05p37_104196_c1 nmdc:mga05p37_104196_c1_990_1268 90
1127 3300050507 nmdc:mga05p37_264955_c1 nmdc:mga05p37_264955_c1_1155_1433 90
1128 3300050507 nmdc:mga05p37_265689_c1 nmdc:mga05p37_265689_c1_1361_1633 90
1129 3300050507 nmdc:mga05p37_573885_c1 nmdc:mga05p37_573885_c1_80_352 90
1130 3300050508 nmdc:mga09592_791912_c1 nmdc:mga09592_791912_c1_363_635 90
1131 3300050509 nmdc:mga0qj67_429735_c1 nmdc:mga0qj67_429735_c1_717_989 90
1132 3300050509 nmdc:mga0qj67_901433_c1 nmdc:mga0qj67_901433_c1_17_289 90
1133 3300050510 nmdc:mga06r32_1039450_c1 nmdc:mga06r32_1039450_c1_400_672 90
1134 3300050510 nmdc:mga06r32_1149952_c1 nmdc:mga06r32_1149952_c1_236_508 90
1135 3300050510 nmdc:mga06r32_232932_c1 nmdc:mga06r32_232932_c1_341_613 90
1136 3300050510 nmdc:mga06r32_274139_c1 nmdc:mga06r32_274139_c1_315_593 90
1137 3300050510 nmdc:mga06r32_30761_c1 nmdc:mga06r32_30761_c1_3463_3735 90
1138 3300050511 nmdc:mga08y16_1082708_c1 nmdc:mga08y16_1082708_c1_33_305 90
1139 3300050511 nmdc:mga08y16_18776_c1 nmdc:mga08y16_18776_c1_6147_6419 90
1140 3300050511 nmdc:mga08y16_216105_c1 nmdc:mga08y16_216105_c1_716_994 90
1141 3300050511 nmdc:mga08y16_53460_c1 nmdc:mga08y16_53460_c1_2992_3264 90
1142 3300050512 nmdc:mga0n895_11763_c1 nmdc:mga0n895_11763_c1_3645_3917 90
1143 3300050512 nmdc:mga0n895_257834_c1 nmdc:mga0n895_257834_c1_1059_1331 90
1144 3300050512 nmdc:mga0n895_960240_c1 nmdc:mga0n895_960240_c1_109_381 90
1145 3300050513 nmdc:mga0rr50_1504144_c1 nmdc:mga0rr50_1504144_c1_109_381 90
1146 3300050513 nmdc:mga0rr50_493066_c1 nmdc:mga0rr50_493066_c1_543_815 90
1147 3300050513 nmdc:mga0rr50_52783_c1 nmdc:mga0rr50_52783_c1_671_943 90
1148 3300050514 nmdc:mga08x19_127889_c1 nmdc:mga08x19_127889_c1_1002_1274 90
1149 3300050514 nmdc:mga08x19_591136_c1 nmdc:mga08x19_591136_c1_324_596 90
1150 3300050515 nmdc:mga0a205_1200945_c1 nmdc:mga0a205_1200945_c1_98_373 90
1151 3300050515 nmdc:mga0a205_15449_c1 nmdc:mga0a205_15449_c1_4421_4693 90
1152 3300050515 nmdc:mga0a205_162660_c1 nmdc:mga0a205_162660_c1_1682_1954 90
1153 3300050515 nmdc:mga0a205_53_c2 nmdc:mga0a205_53_c2_9522_9794 90
1154 3300053077 Ga0495601_0000060 Ga0495601_0000060_31996_32268 90
1155 3300053077 Ga0495601_0029935 Ga0495601_0029935_1257_1529 90
1156 3300053077 Ga0495601_0059708 Ga0495601_0059708_1985_2257 90
1157 3300053077 Ga0495601_0080854 Ga0495601_0080854_797_1072 90
1158 3300053077 Ga0495601_0190542 Ga0495601_0190542_822_1094 90
1159 3300053077 Ga0495601_0380882 Ga0495601_0380882_294_566 90
1160 3300053078 Ga0495612_0000210 Ga0495612_0000210_7456_7728 90
1161 3300053078 Ga0495612_0003362 Ga0495612_0003362_4248_4520 90
1162 3300053078 Ga0495612_0003484 Ga0495612_0003484_1821_2093 90
1163 3300053078 Ga0495612_0038634 Ga0495612_0038634_486_758 90
1164 3300053083 Ga0495655_0000002 Ga0495655_0000002_200195_200467 90
1165 3300053083 Ga0495655_0117794 Ga0495655_0117794_16_288 90
1166 3300053084 Ga0495595_0000002 Ga0495595_0000002_191316_191588 90
1167 3300053084 Ga0495595_0000045 Ga0495595_0000045_22203_22475 90
1168 3300053084 Ga0495595_0335600 Ga0495595_0335600_376_648 90
1169 3300053085 Ga0495619_0000008 Ga0495619_0000008_192799_193071 90
1170 3300053085 Ga0495619_0000095 Ga0495619_0000095_8556_8828 90
1171 3300053085 Ga0495619_0000102 Ga0495619_0000102_48620_48892 90
1172 3300053085 Ga0495619_0000155 Ga0495619_0000155_41782_42057 90
1173 3300053085 Ga0495619_0000320 Ga0495619_0000320_15555_15830 90
1174 3300053085 Ga0495619_0006754 Ga0495619_0006754_1687_1962 90
1175 3300053085 Ga0495619_0036802 Ga0495619_0036802_1610_1882 90
1176 3300053085 Ga0495619_0058401 Ga0495619_0058401_360_635 90
1177 3300053085 Ga0495619_0967005 Ga0495619_0967005_82_363 90
1178 3300053094 Ga0500566_0001093 Ga0500566_0001093_9841_10113 90
1179 3300053094 Ga0500566_0264729 Ga0500566_0264729_26_298 90
1180 3300053119 Ga0500595_040810 Ga0500595_040810_895_1167 90
1181 3300053119 Ga0500595_061022 Ga0500595_061022_261_533 90
1182 3300053123 Ga0500614_001424 Ga0500614_001424_2914_3186 90
1183 3300053129 Ga0500628_000001 Ga0500628_000001_288864_289136 90
1184 3300054114 Ga0501084_0110493 Ga0501084_0110493_157_435 90
1185 3300054114 Ga0501084_0141490 Ga0501084_0141490_1495_1776 90
1186 3300054114 Ga0501084_0163151 Ga0501084_0163151_1022_1294 90
1187 3300054114 Ga0501084_0382295 Ga0501084_0382295_15_287 90
1188 3300054114 Ga0501084_0905945 Ga0501084_0905945_184_495 90
1189 3300054114 Ga0501084_1058013 Ga0501084_1058013_130_405 90
1190 3300054114 Ga0501084_1404693 Ga0501084_1404693_97_372 90
1191 3300054114 Ga0501084_1598320 Ga0501084_1598320_48_320 90
1192 3300060353 Ga0501082_0044987 Ga0501082_0044987_1254_1526 90
1193 3300060353 Ga0501082_0857311 Ga0501082_0857311_355_636 90
1194 3300060353 Ga0501082_1323183 Ga0501082_1323183_68_379 90
1195 3300061734 Ga0530510_0020050 Ga0530510_0020050_3824_4102 90
1196 3300061734 Ga0530510_0473044 Ga0530510_0473044_539_811 90
1197 3300061734 Ga0530510_0789843 Ga0530510_0789843_308_586 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

16

101

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9312 2 90
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9234 4 90
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9214 2 90
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8976 4 86
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8972 3 87
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9312 2 90 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9214 2 90 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8994 4 85 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8972 2 87 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8833 2 90 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A838PUQ2-F1-model_v4 MoaD/ThiS family protein 0.985 1 82
AF-A0A538C6W4-F1-model_v4 MoaD/ThiS family protein 0.9814 1 90
AF-A0A7W1LXI2-F1-model_v4 MoaD/ThiS family protein 0.9811 1 90
AF-A0A330LVM2-F1-model_v4 Putative adenylyltransferase/sulfurtransferase MoeZ (EC 2.7.7.-, EC 2.8.1.-) 0.979 1 90 GO:0004792
GO:0005524
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A7C5YAF4-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9774 1 81

Feature Viewer

pLDDT pTM Quality
90.24 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map