F491549
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1197 | 410 | 1196 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0600274|Ga0501033_0600274_263_574 |
| Length | 103 |
| Sequence | MTRTTAPEETRMPVTVRIPAPLRPVTGGAAAVECAPGTVRELIDQLDAQHAGFRDRVMEDGSLRRFVNVFVAGEDVRFGEGIDTAVAEGQEVTILPAVAGGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 116 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 235 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 244 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 256 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 257 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 258 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 259 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 262 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 263 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 264 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 268 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 406 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 407 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 408 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.16 |
| Metatranscriptomes | 0.84 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.84 |
| Nodule | 0 |
| Rhizoplane | 9.61 |
| Rhizosphere | 84.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1054991 | 3300001977 | Bacteria | 564 |
| 2 | JGI24737J22298_10099373 | 3300001990 | Bacteria | 862 |
| 3 | JGI24743J22301_10042465 | 3300001991 | Bacteria | 915 |
| 4 | JGI24735J21928_10170162 | 3300002067 | Bacteria | 630 |
| 5 | JGI24738J21930_10009312 | 3300002075 | Bacteria | 2213 |
| 6 | JGI24738J21930_10086603 | 3300002075 | Bacteria | 659 |
| 7 | JGI24744J21845_10016965 | 3300002077 | Bacteria | 1448 |
| 8 | JGI24742J22300_10043580 | 3300002244 | Bacteria | 803 |
| 9 | JGI24751J29686_10066098 | 3300002459 | Bacteria | 744 |
| 10 | Ga0070658_10102750 | 3300005327 | Bacteria | 2364 |
| 11 | Ga0070658_10351889 | 3300005327 | Bacteria | 1261 |
| 12 | Ga0070658_10821046 | 3300005327 | Bacteria | 808 |
| 13 | Ga0070676_10068455 | 3300005328 | Bacteria | 2125 |
| 14 | Ga0070676_10699340 | 3300005328 | Bacteria | 740 |
| 15 | Ga0070683_100000404 | 3300005329 | Bacteria | 29752 |
| 16 | Ga0070683_100019785 | 3300005329 | Bacteria | 5984 |
| 17 | Ga0070683_100023077 | 3300005329 | Bacteria | 5564 |
| 18 | Ga0070683_100117182 | 3300005329 | Bacteria | 2515 |
| 19 | Ga0070677_10000008 | 3300005333 | Bacteria | 74027 |
| 20 | Ga0068869_100104382 | 3300005334 | Bacteria | 2148 |
| 21 | Ga0070666_10327087 | 3300005335 | Bacteria | 1094 |
| 22 | Ga0070680_100185990 | 3300005336 | Bacteria | 1750 |
| 23 | Ga0070680_100310840 | 3300005336 | Bacteria | 1337 |
| 24 | Ga0070682_100000075 | 3300005337 | Bacteria | 90547 |
| 25 | Ga0070682_100000090 | 3300005337 | Bacteria | 82642 |
| 26 | Ga0070682_100008571 | 3300005337 | Bacteria | 5771 |
| 27 | Ga0070682_100048176 | 3300005337 | Bacteria | 2653 |
| 28 | Ga0070682_101289527 | 3300005337 | Unclassified | 620 |
| 29 | Ga0068868_100000141 | 3300005338 | Bacteria | 46406 |
| 30 | Ga0068868_100002016 | 3300005338 | Bacteria | 13976 |
| 31 | Ga0068868_100013799 | 3300005338 | Bacteria | 5937 |
| 32 | Ga0068868_100018130 | 3300005338 | Bacteria | 5256 |
| 33 | Ga0068868_100021155 | 3300005338 | Bacteria | 4898 |
| 34 | Ga0068868_100552551 | 3300005338 | Bacteria | 1015 |
| 35 | Ga0070660_100044786 | 3300005339 | Bacteria | 3385 |
| 36 | Ga0070660_100889625 | 3300005339 | Bacteria | 751 |
| 37 | Ga0070689_100071687 | 3300005340 | Bacteria | 2707 |
| 38 | Ga0070689_100079065 | 3300005340 | Bacteria | 2579 |
| 39 | Ga0070689_100096525 | 3300005340 | Bacteria | 2337 |
| 40 | Ga0070689_100141479 | 3300005340 | Bacteria | 1935 |
| 41 | Ga0070689_100174120 | 3300005340 | Bacteria | 1745 |
| 42 | Ga0070691_10000044 | 3300005341 | Bacteria | 36029 |
| 43 | Ga0070691_10005099 | 3300005341 | Bacteria | 5968 |
| 44 | Ga0070691_10054340 | 3300005341 | Bacteria | 1917 |
| 45 | Ga0070691_10318388 | 3300005341 | Bacteria | 855 |
| 46 | Ga0070691_10519651 | 3300005341 | Bacteria | 691 |
| 47 | Ga0070691_10551001 | 3300005341 | Bacteria | 674 |
| 48 | Ga0070687_100024909 | 3300005343 | Bacteria | 2864 |
| 49 | Ga0070687_100876966 | 3300005343 | Bacteria | 642 |
| 50 | Ga0070661_100000099 | 3300005344 | Bacteria | 71115 |
| 51 | Ga0070661_100070438 | 3300005344 | Bacteria | 2572 |
| 52 | Ga0070661_100611646 | 3300005344 | Bacteria | 882 |
| 53 | Ga0070661_101199562 | 3300005344 | Bacteria | 635 |
| 54 | Ga0070692_10007789 | 3300005345 | Bacteria | 4745 |
| 55 | Ga0070692_10205169 | 3300005345 | Bacteria | 1157 |
| 56 | Ga0070668_100014733 | 3300005347 | Bacteria | 5843 |
| 57 | Ga0070668_100065770 | 3300005347 | Bacteria | 2812 |
| 58 | Ga0070668_100544309 | 3300005347 | Bacteria | 1010 |
| 59 | Ga0070668_101311660 | 3300005347 | Bacteria | 658 |
| 60 | Ga0070669_100278458 | 3300005353 | Bacteria | 1340 |
| 61 | Ga0070675_100000036 | 3300005354 | Bacteria | 85959 |
| 62 | Ga0070675_100044837 | 3300005354 | Bacteria | 3617 |
| 63 | Ga0070675_100676630 | 3300005354 | Bacteria | 939 |
| 64 | Ga0070671_100035755 | 3300005355 | Bacteria | 4115 |
| 65 | Ga0070671_100895212 | 3300005355 | Bacteria | 775 |
| 66 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 67 | Ga0070674_100012173 | 3300005356 | Bacteria | 5276 |
| 68 | Ga0070673_100006402 | 3300005364 | Bacteria | 7653 |
| 69 | Ga0070673_100041907 | 3300005364 | Bacteria | 3525 |
| 70 | Ga0070673_100112144 | 3300005364 | Bacteria | 2263 |
| 71 | Ga0070673_101879545 | 3300005364 | Bacteria | 568 |
| 72 | Ga0070688_100001169 | 3300005365 | Bacteria | 13067 |
| 73 | Ga0070688_100004292 | 3300005365 | Bacteria | 7413 |
| 74 | Ga0070688_100266693 | 3300005365 | Bacteria | 1225 |
| 75 | Ga0070688_100333987 | 3300005365 | Bacteria | 1105 |
| 76 | Ga0070688_100350515 | 3300005365 | Bacteria | 1081 |
| 77 | Ga0070659_100007424 | 3300005366 | Bacteria | 7963 |
| 78 | Ga0070659_100086823 | 3300005366 | Bacteria | 2504 |
| 79 | Ga0070667_100061212 | 3300005367 | Bacteria | 3187 |
| 80 | Ga0070667_100155517 | 3300005367 | Bacteria | 2011 |
| 81 | Ga0070667_100304295 | 3300005367 | Bacteria | 1436 |
| 82 | Ga0070667_100567593 | 3300005367 | Bacteria | 1044 |
| 83 | Ga0070709_10109003 | 3300005434 | Bacteria | 1858 |
| 84 | Ga0070714_100443749 | 3300005435 | Bacteria | 1232 |
| 85 | Ga0070713_100000380 | 3300005436 | Bacteria | 28361 |
| 86 | Ga0070701_10039651 | 3300005438 | Bacteria | 2391 |
| 87 | Ga0070701_10433121 | 3300005438 | Bacteria | 840 |
| 88 | Ga0070701_11076225 | 3300005438 | Bacteria | 565 |
| 89 | Ga0070711_100007421 | 3300005439 | Bacteria | 6669 |
| 90 | Ga0070711_100216272 | 3300005439 | Bacteria | 1487 |
| 91 | Ga0070705_100347488 | 3300005440 | Bacteria | 1080 |
| 92 | Ga0070705_100892697 | 3300005440 | Bacteria | 714 |
| 93 | Ga0070700_100005895 | 3300005441 | Bacteria | 6511 |
| 94 | Ga0070700_100019529 | 3300005441 | Bacteria | 3912 |
| 95 | Ga0070700_100659798 | 3300005441 | Bacteria | 827 |
| 96 | Ga0070700_100792305 | 3300005441 | Bacteria | 762 |
| 97 | Ga0070694_100207046 | 3300005444 | Bacteria | 1465 |
| 98 | Ga0070694_100428926 | 3300005444 | Bacteria | 1040 |
| 99 | Ga0070708_100236107 | 3300005445 | Bacteria | 1716 |
| 100 | Ga0070708_100342446 | 3300005445 | Bacteria | 1409 |
| 101 | Ga0070663_100001224 | 3300005455 | Bacteria | 14096 |
| 102 | Ga0070663_100022099 | 3300005455 | Bacteria | 4246 |
| 103 | Ga0070663_100064230 | 3300005455 | Bacteria | 2653 |
| 104 | Ga0070663_101584565 | 3300005455 | Bacteria | 584 |
| 105 | Ga0070663_101951450 | 3300005455 | Unclassified | 528 |
| 106 | Ga0070678_100022682 | 3300005456 | Bacteria | 4166 |
| 107 | Ga0070678_100026672 | 3300005456 | Bacteria | 3911 |
| 108 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 109 | Ga0070662_100040712 | 3300005457 | Bacteria | 3310 |
| 110 | Ga0070681_10306669 | 3300005458 | Bacteria | 1497 |
| 111 | Ga0070681_10691882 | 3300005458 | Bacteria | 935 |
| 112 | Ga0068867_100005480 | 3300005459 | Bacteria | 8981 |
| 113 | Ga0068867_100057996 | 3300005459 | Bacteria | 2869 |
| 114 | Ga0068867_100386900 | 3300005459 | Bacteria | 1176 |
| 115 | Ga0068867_100922860 | 3300005459 | Bacteria | 787 |
| 116 | Ga0070685_10000020 | 3300005466 | Bacteria | 104332 |
| 117 | Ga0070685_10000674 | 3300005466 | Bacteria | 18541 |
| 118 | Ga0070685_10015073 | 3300005466 | Bacteria | 4104 |
| 119 | Ga0070685_10049549 | 3300005466 | Bacteria | 2423 |
| 120 | Ga0070685_10227841 | 3300005466 | Bacteria | 1224 |
| 121 | Ga0070685_10362624 | 3300005466 | Bacteria | 994 |
| 122 | Ga0070679_100000369 | 3300005530 | Bacteria | 38264 |
| 123 | Ga0070679_102022938 | 3300005530 | Bacteria | 525 |
| 124 | Ga0070684_100014210 | 3300005535 | Bacteria | 6441 |
| 125 | Ga0070684_100043406 | 3300005535 | Bacteria | 3882 |
| 126 | Ga0070684_100052595 | 3300005535 | Bacteria | 3542 |
| 127 | Ga0070684_100068987 | 3300005535 | Bacteria | 3108 |
| 128 | Ga0070684_100245100 | 3300005535 | Bacteria | 1638 |
| 129 | Ga0070684_100259847 | 3300005535 | Bacteria | 1588 |
| 130 | Ga0070684_100664192 | 3300005535 | Bacteria | 971 |
| 131 | Ga0070684_102064302 | 3300005535 | Bacteria | 538 |
| 132 | Ga0068853_100041279 | 3300005539 | Bacteria | 3940 |
| 133 | Ga0068853_100078899 | 3300005539 | Bacteria | 2878 |
| 134 | Ga0068853_100118729 | 3300005539 | Bacteria | 2357 |
| 135 | Ga0068853_100156211 | 3300005539 | Bacteria | 2056 |
| 136 | Ga0068853_101702993 | 3300005539 | Bacteria | 611 |
| 137 | Ga0070672_100004196 | 3300005543 | Bacteria | 9414 |
| 138 | Ga0070686_100020467 | 3300005544 | Bacteria | 3915 |
| 139 | Ga0070686_100254198 | 3300005544 | Bacteria | 1285 |
| 140 | Ga0070686_100312424 | 3300005544 | Bacteria | 1169 |
| 141 | Ga0070695_100067435 | 3300005545 | Bacteria | 2334 |
| 142 | Ga0070695_101840612 | 3300005545 | Bacteria | 508 |
| 143 | Ga0070696_101977451 | 3300005546 | Bacteria | 506 |
| 144 | Ga0070693_100003731 | 3300005547 | Bacteria | 7127 |
| 145 | Ga0070693_100137476 | 3300005547 | Bacteria | 1534 |
| 146 | Ga0070693_100885293 | 3300005547 | Bacteria | 668 |
| 147 | Ga0070665_100000135 | 3300005548 | Bacteria | 138925 |
| 148 | Ga0070665_100132532 | 3300005548 | Bacteria | 2494 |
| 149 | Ga0070665_100452207 | 3300005548 | Bacteria | 1294 |
| 150 | Ga0070665_101265781 | 3300005548 | Bacteria | 748 |
| 151 | Ga0070704_100025392 | 3300005549 | Bacteria | 3901 |
| 152 | Ga0070704_100115774 | 3300005549 | Bacteria | 2049 |
| 153 | Ga0070704_100426534 | 3300005549 | Bacteria | 1137 |
| 154 | Ga0070704_100821048 | 3300005549 | Bacteria | 832 |
| 155 | Ga0068855_101242488 | 3300005563 | Bacteria | 773 |
| 156 | Ga0070664_100013275 | 3300005564 | Bacteria | 6709 |
| 157 | Ga0070664_100015019 | 3300005564 | Bacteria | 6321 |
| 158 | Ga0070664_100058703 | 3300005564 | Bacteria | 3273 |
| 159 | Ga0070664_100423367 | 3300005564 | Bacteria | 1220 |
| 160 | Ga0070664_101751829 | 3300005564 | Bacteria | 589 |
| 161 | Ga0068857_100079624 | 3300005577 | Bacteria | 2925 |
| 162 | Ga0068857_100142811 | 3300005577 | Bacteria | 2165 |
| 163 | Ga0068857_102037281 | 3300005577 | Bacteria | 563 |
| 164 | Ga0068854_100059914 | 3300005578 | Bacteria | 2752 |
| 165 | Ga0068854_100100662 | 3300005578 | Bacteria | 2166 |
| 166 | Ga0068856_100004032 | 3300005614 | Bacteria | 14706 |
| 167 | Ga0068856_100013553 | 3300005614 | Bacteria | 7892 |
| 168 | Ga0068856_100026571 | 3300005614 | Bacteria | 5645 |
| 169 | Ga0068856_100089785 | 3300005614 | Bacteria | 3056 |
| 170 | Ga0068856_100589393 | 3300005614 | Bacteria | 1133 |
| 171 | Ga0068856_100877220 | 3300005614 | Bacteria | 916 |
| 172 | Ga0070702_100021516 | 3300005615 | Bacteria | 3394 |
| 173 | Ga0070702_100082916 | 3300005615 | Bacteria | 1925 |
| 174 | Ga0070702_100114120 | 3300005615 | Bacteria | 1680 |
| 175 | Ga0070702_100430538 | 3300005615 | Bacteria | 952 |
| 176 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 177 | Ga0068852_100014610 | 3300005616 | Bacteria | 6053 |
| 178 | Ga0068852_100283099 | 3300005616 | Bacteria | 1599 |
| 179 | Ga0068852_102542207 | 3300005616 | Bacteria | 532 |
| 180 | Ga0068859_100058409 | 3300005617 | Bacteria | 3886 |
| 181 | Ga0068859_100864297 | 3300005617 | Bacteria | 990 |
| 182 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 183 | Ga0068864_100043739 | 3300005618 | Bacteria | 3836 |
| 184 | Ga0068864_100317711 | 3300005618 | Bacteria | 1462 |
| 185 | Ga0068866_10002177 | 3300005718 | Bacteria | 8157 |
| 186 | Ga0068866_10122127 | 3300005718 | Bacteria | 1469 |
| 187 | Ga0068866_10150533 | 3300005718 | Bacteria | 1347 |
| 188 | Ga0068861_100053456 | 3300005719 | Bacteria | 3073 |
| 189 | Ga0068861_100381342 | 3300005719 | Bacteria | 1246 |
| 190 | Ga0068861_101538303 | 3300005719 | Bacteria | 654 |
| 191 | Ga0068861_101667362 | 3300005719 | Bacteria | 630 |
| 192 | Ga0068861_102113983 | 3300005719 | Bacteria | 563 |
| 193 | Ga0068851_10001260 | 3300005834 | Bacteria | 11027 |
| 194 | Ga0068851_10058940 | 3300005834 | Bacteria | 1963 |
| 195 | Ga0068851_10186485 | 3300005834 | Bacteria | 1151 |
| 196 | Ga0068870_10591646 | 3300005840 | Bacteria | 753 |
| 197 | Ga0068870_10920843 | 3300005840 | Bacteria | 619 |
| 198 | Ga0068863_100000022 | 3300005841 | Bacteria | 188278 |
| 199 | Ga0068863_100181164 | 3300005841 | Bacteria | 2022 |
| 200 | Ga0068863_100295132 | 3300005841 | Bacteria | 1572 |
| 201 | Ga0068863_100537618 | 3300005841 | Bacteria | 1153 |
| 202 | Ga0068863_100832664 | 3300005841 | Bacteria | 921 |
| 203 | Ga0068863_101785515 | 3300005841 | Bacteria | 625 |
| 204 | Ga0068858_100000075 | 3300005842 | Bacteria | 104349 |
| 205 | Ga0068858_100004559 | 3300005842 | Bacteria | 13571 |
| 206 | Ga0068858_100065398 | 3300005842 | Bacteria | 3365 |
| 207 | Ga0068858_100492936 | 3300005842 | Bacteria | 1183 |
| 208 | Ga0068858_100723347 | 3300005842 | Bacteria | 969 |
| 209 | Ga0068860_100072334 | 3300005843 | Bacteria | 3277 |
| 210 | Ga0068860_101003527 | 3300005843 | Unclassified | 853 |
| 211 | Ga0068862_100106806 | 3300005844 | Bacteria | 2454 |
| 212 | Ga0068862_100624784 | 3300005844 | Bacteria | 1037 |
| 213 | Ga0068862_100716797 | 3300005844 | Bacteria | 970 |
| 214 | Ga0068862_101508091 | 3300005844 | Bacteria | 678 |
| 215 | Ga0081455_10052507 | 3300005937 | Bacteria | 3489 |
| 216 | Ga0081455_10125997 | 3300005937 | Bacteria | 2010 |
| 217 | Ga0081455_10133876 | 3300005937 | Bacteria | 1934 |
| 218 | Ga0081455_10292207 | 3300005937 | Bacteria | 1173 |
| 219 | Ga0081455_10721037 | 3300005937 | Bacteria | 633 |
| 220 | Ga0081538_10000141 | 3300005981 | Bacteria | 74085 |
| 221 | Ga0081538_10015536 | 3300005981 | Bacteria | 5886 |
| 222 | Ga0081540_1069557 | 3300005983 | Bacteria | 1635 |
| 223 | Ga0081540_1193796 | 3300005983 | Bacteria | 746 |
| 224 | Ga0075365_10000322 | 3300006038 | Bacteria | 16913 |
| 225 | Ga0075365_10002366 | 3300006038 | Bacteria | 9203 |
| 226 | Ga0075365_10004204 | 3300006038 | Bacteria | 7584 |
| 227 | Ga0075365_10289833 | 3300006038 | Bacteria | 1152 |
| 228 | Ga0075368_10214180 | 3300006042 | Bacteria | 817 |
| 229 | Ga0075368_10585306 | 3300006042 | Bacteria | 504 |
| 230 | Ga0075363_100000848 | 3300006048 | Bacteria | 10649 |
| 231 | Ga0075363_100026606 | 3300006048 | Bacteria | 2961 |
| 232 | Ga0075363_100125268 | 3300006048 | Bacteria | 1438 |
| 233 | Ga0075364_10143462 | 3300006051 | Bacteria | 1607 |
| 234 | Ga0075364_10177770 | 3300006051 | Bacteria | 1440 |
| 235 | Ga0075364_10590860 | 3300006051 | Unclassified | 759 |
| 236 | Ga0075364_10926558 | 3300006051 | Unclassified | 593 |
| 237 | Ga0075364_10978372 | 3300006051 | Bacteria | 575 |
| 238 | Ga0075364_11111047 | 3300006051 | Archaea | 536 |
| 239 | Ga0075432_10607487 | 3300006058 | Bacteria | 501 |
| 240 | Ga0070715_10018094 | 3300006163 | Bacteria | 2680 |
| 241 | Ga0070716_100023581 | 3300006173 | Bacteria | 3265 |
| 242 | Ga0070716_101146135 | 3300006173 | Bacteria | 622 |
| 243 | Ga0070712_100002890 | 3300006175 | Bacteria | 10656 |
| 244 | Ga0070712_100083938 | 3300006175 | Bacteria | 2314 |
| 245 | Ga0070712_100169040 | 3300006175 | Bacteria | 1695 |
| 246 | Ga0075367_10297748 | 3300006178 | Bacteria | 1015 |
| 247 | Ga0075367_10328756 | 3300006178 | Bacteria | 964 |
| 248 | Ga0075367_10570243 | 3300006178 | Unclassified | 719 |
| 249 | Ga0075367_10976436 | 3300006178 | Bacteria | 541 |
| 250 | Ga0075369_10251904 | 3300006186 | Bacteria | 820 |
| 251 | Ga0097621_100914617 | 3300006237 | Bacteria | 818 |
| 252 | Ga0097621_101457935 | 3300006237 | Bacteria | 649 |
| 253 | Ga0097621_102118254 | 3300006237 | Bacteria | 538 |
| 254 | Ga0068871_100651227 | 3300006358 | Bacteria | 962 |
| 255 | Ga0068871_100663723 | 3300006358 | Bacteria | 953 |
| 256 | Ga0075428_100449888 | 3300006844 | Bacteria | 1380 |
| 257 | Ga0075428_101442589 | 3300006844 | Bacteria | 722 |
| 258 | Ga0075430_100907047 | 3300006846 | Bacteria | 726 |
| 259 | Ga0075431_100000197 | 3300006847 | Bacteria | 44284 |
| 260 | Ga0075431_100394317 | 3300006847 | Bacteria | 1386 |
| 261 | Ga0075431_101071674 | 3300006847 | Unclassified | 771 |
| 262 | Ga0075433_10000897 | 3300006852 | Bacteria | 20988 |
| 263 | Ga0075433_10024940 | 3300006852 | Bacteria | 5052 |
| 264 | Ga0075433_10143670 | 3300006852 | Bacteria | 2121 |
| 265 | Ga0075433_11023957 | 3300006852 | Bacteria | 719 |
| 266 | Ga0075434_100008498 | 3300006871 | Bacteria | 9550 |
| 267 | Ga0075434_100027126 | 3300006871 | Bacteria | 5621 |
| 268 | Ga0075434_100043274 | 3300006871 | Bacteria | 4465 |
| 269 | Ga0075434_101321702 | 3300006871 | Bacteria | 732 |
| 270 | Ga0075429_100660723 | 3300006880 | Bacteria | 916 |
| 271 | Ga0075429_100922922 | 3300006880 | Bacteria | 764 |
| 272 | Ga0068865_100000082 | 3300006881 | Bacteria | 50913 |
| 273 | Ga0068865_100396217 | 3300006881 | Bacteria | 1130 |
| 274 | Ga0068865_101588750 | 3300006881 | Bacteria | 588 |
| 275 | Ga0068865_101602821 | 3300006881 | Bacteria | 585 |
| 276 | Ga0075436_100447812 | 3300006914 | Bacteria | 940 |
| 277 | Ga0075436_100503524 | 3300006914 | Bacteria | 886 |
| 278 | Ga0097620_100058406 | 3300006931 | Bacteria | 3886 |
| 279 | Ga0097620_100864181 | 3300006931 | Bacteria | 990 |
| 280 | Ga0075435_100079846 | 3300007076 | Bacteria | 2685 |
| 281 | Ga0075435_100091865 | 3300007076 | Bacteria | 2506 |
| 282 | Ga0075435_100516530 | 3300007076 | Bacteria | 1033 |
| 283 | Ga0075435_100869037 | 3300007076 | Bacteria | 786 |
| 284 | Ga0075435_101140549 | 3300007076 | Bacteria | 682 |
| 285 | Ga0105240_10511954 | 3300009093 | Bacteria | 1333 |
| 286 | Ga0105240_10928934 | 3300009093 | Bacteria | 934 |
| 287 | Ga0105240_11060168 | 3300009093 | Bacteria | 864 |
| 288 | Ga0111539_10024755 | 3300009094 | Bacteria | 7362 |
| 289 | Ga0111539_10025516 | 3300009094 | Bacteria | 7246 |
| 290 | Ga0111539_10026270 | 3300009094 | Bacteria | 7122 |
| 291 | Ga0111539_10743213 | 3300009094 | Bacteria | 1142 |
| 292 | Ga0111539_11648192 | 3300009094 | Bacteria | 744 |
| 293 | Ga0105245_10000278 | 3300009098 | Bacteria | 48473 |
| 294 | Ga0105245_10000415 | 3300009098 | Bacteria | 39764 |
| 295 | Ga0105245_10001311 | 3300009098 | Bacteria | 22474 |
| 296 | Ga0105245_10024888 | 3300009098 | Bacteria | 5261 |
| 297 | Ga0105245_10089688 | 3300009098 | Bacteria | 2827 |
| 298 | Ga0105245_10657460 | 3300009098 | Bacteria | 1079 |
| 299 | Ga0105245_11467468 | 3300009098 | Bacteria | 733 |
| 300 | Ga0105245_12556305 | 3300009098 | Bacteria | 564 |
| 301 | Ga0105247_10029264 | 3300009101 | Bacteria | 3337 |
| 302 | Ga0105247_10077162 | 3300009101 | Bacteria | 2093 |
| 303 | Ga0105247_10917529 | 3300009101 | Bacteria | 678 |
| 304 | Ga0105247_11404910 | 3300009101 | Bacteria | 565 |
| 305 | Ga0114129_10110402 | 3300009147 | Bacteria | 3796 |
| 306 | Ga0114129_10113126 | 3300009147 | Bacteria | 3743 |
| 307 | Ga0114129_10144653 | 3300009147 | Bacteria | 3257 |
| 308 | Ga0114129_10639270 | 3300009147 | Bacteria | 1374 |
| 309 | Ga0114129_11348365 | 3300009147 | Bacteria | 882 |
| 310 | Ga0114129_11853892 | 3300009147 | Bacteria | 732 |
| 311 | Ga0105243_10003503 | 3300009148 | Bacteria | 12673 |
| 312 | Ga0105243_10007118 | 3300009148 | Bacteria | 8605 |
| 313 | Ga0105243_10045660 | 3300009148 | Bacteria | 3444 |
| 314 | Ga0105243_10342613 | 3300009148 | Bacteria | 1370 |
| 315 | Ga0105243_11291863 | 3300009148 | Bacteria | 746 |
| 316 | Ga0105243_12233372 | 3300009148 | Bacteria | 584 |
| 317 | Ga0105243_12606308 | 3300009148 | Bacteria | 545 |
| 318 | Ga0105241_10109322 | 3300009174 | Bacteria | 2211 |
| 319 | Ga0105241_10612538 | 3300009174 | Bacteria | 985 |
| 320 | Ga0105241_11035708 | 3300009174 | Unclassified | 770 |
| 321 | Ga0105242_10000603 | 3300009176 | Bacteria | 28175 |
| 322 | Ga0105242_10047166 | 3300009176 | Bacteria | 3498 |
| 323 | Ga0105242_10234609 | 3300009176 | Bacteria | 1646 |
| 324 | Ga0105242_10275850 | 3300009176 | Bacteria | 1525 |
| 325 | Ga0105242_11011285 | 3300009176 | Bacteria | 840 |
| 326 | Ga0105242_11918350 | 3300009176 | Archaea | 633 |
| 327 | Ga0105242_12122077 | 3300009176 | Unclassified | 606 |
| 328 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 329 | Ga0105248_10126507 | 3300009177 | Bacteria | 2882 |
| 330 | Ga0105248_10262577 | 3300009177 | Bacteria | 1944 |
| 331 | Ga0105248_12444049 | 3300009177 | Bacteria | 595 |
| 332 | Ga0105237_10193604 | 3300009545 | Bacteria | 2033 |
| 333 | Ga0105237_10271855 | 3300009545 | Bacteria | 1697 |
| 334 | Ga0105237_10354953 | 3300009545 | Bacteria | 1470 |
| 335 | Ga0105237_11169596 | 3300009545 | Bacteria | 776 |
| 336 | Ga0105238_10117153 | 3300009551 | Bacteria | 2644 |
| 337 | Ga0105238_10496599 | 3300009551 | Bacteria | 1221 |
| 338 | Ga0105249_10000143 | 3300009553 | Bacteria | 92539 |
| 339 | Ga0105249_10122179 | 3300009553 | Bacteria | 2476 |
| 340 | Ga0105249_10175569 | 3300009553 | Bacteria | 2081 |
| 341 | Ga0105249_10282388 | 3300009553 | Bacteria | 1659 |
| 342 | Ga0105249_10289714 | 3300009553 | Bacteria | 1638 |
| 343 | Ga0105249_10795883 | 3300009553 | Bacteria | 1009 |
| 344 | Ga0105249_10962415 | 3300009553 | Unclassified | 922 |
| 345 | Ga0105249_11389140 | 3300009553 | Bacteria | 774 |
| 346 | Ga0099796_10232412 | 3300010159 | Bacteria | 759 |
| 347 | Ga0105239_10003725 | 3300010375 | Bacteria | 18559 |
| 348 | Ga0105239_10221837 | 3300010375 | Bacteria | 2120 |
| 349 | Ga0105239_10578239 | 3300010375 | Bacteria | 1280 |
| 350 | Ga0105239_11087281 | 3300010375 | Bacteria | 920 |
| 351 | Ga0105239_11414763 | 3300010375 | Bacteria | 803 |
| 352 | Ga0105239_11461507 | 3300010375 | Bacteria | 790 |
| 353 | Ga0105239_12274669 | 3300010375 | Bacteria | 631 |
| 354 | Ga0105239_12358643 | 3300010375 | Bacteria | 619 |
| 355 | Ga0105239_13401416 | 3300010375 | Bacteria | 517 |
| 356 | Ga0105246_10037640 | 3300011119 | Bacteria | 3247 |
| 357 | Ga0105246_12076913 | 3300011119 | Bacteria | 550 |
| 358 | Ga0105246_12111193 | 3300011119 | Bacteria | 546 |
| 359 | Ga0157344_1006686 | 3300012476 | Bacteria | 751 |
| 360 | Ga0157342_1001537 | 3300012507 | Bacteria | 1735 |
| 361 | Ga0157373_10534281 | 3300013100 | Bacteria | 849 |
| 362 | Ga0157371_10125048 | 3300013102 | Bacteria | 1829 |
| 363 | Ga0157371_10769195 | 3300013102 | Bacteria | 724 |
| 364 | Ga0157371_11437258 | 3300013102 | Bacteria | 536 |
| 365 | Ga0157370_10149601 | 3300013104 | Bacteria | 2173 |
| 366 | Ga0157370_10151772 | 3300013104 | Bacteria | 2156 |
| 367 | Ga0157369_10000074 | 3300013105 | Bacteria | 136668 |
| 368 | Ga0157369_10808280 | 3300013105 | Bacteria | 963 |
| 369 | Ga0157374_10004880 | 3300013296 | Bacteria | 11252 |
| 370 | Ga0157374_10175786 | 3300013296 | Bacteria | 2090 |
| 371 | Ga0157378_10003241 | 3300013297 | Bacteria | 14481 |
| 372 | Ga0157378_10068068 | 3300013297 | Bacteria | 3192 |
| 373 | Ga0157378_10103191 | 3300013297 | Bacteria | 2605 |
| 374 | Ga0163162_10933622 | 3300013306 | Bacteria | 979 |
| 375 | Ga0163162_11095063 | 3300013306 | Bacteria | 902 |
| 376 | Ga0163162_12072284 | 3300013306 | Bacteria | 652 |
| 377 | Ga0163162_13480145 | 3300013306 | Bacteria | 501 |
| 378 | Ga0157372_10000053 | 3300013307 | Bacteria | 128824 |
| 379 | Ga0157372_10057521 | 3300013307 | Bacteria | 4347 |
| 380 | Ga0157372_10141100 | 3300013307 | Bacteria | 2776 |
| 381 | Ga0157372_11734160 | 3300013307 | Bacteria | 718 |
| 382 | Ga0157372_12641841 | 3300013307 | Bacteria | 576 |
| 383 | Ga0157375_10013296 | 3300013308 | Bacteria | 7320 |
| 384 | Ga0157375_10014036 | 3300013308 | Bacteria | 7145 |
| 385 | Ga0157375_10014814 | 3300013308 | Bacteria | 6966 |
| 386 | Ga0157375_10022190 | 3300013308 | Bacteria | 5841 |
| 387 | Ga0157375_10111493 | 3300013308 | Bacteria | 2835 |
| 388 | Ga0157375_10162776 | 3300013308 | Bacteria | 2374 |
| 389 | Ga0157375_10881008 | 3300013308 | Bacteria | 1040 |
| 390 | Ga0157375_13352272 | 3300013308 | Bacteria | 534 |
| 391 | Ga0163163_10204269 | 3300014325 | Bacteria | 2024 |
| 392 | Ga0163163_10220265 | 3300014325 | Bacteria | 1946 |
| 393 | Ga0163163_11958336 | 3300014325 | Bacteria | 646 |
| 394 | Ga0163163_13273731 | 3300014325 | Bacteria | 505 |
| 395 | Ga0157380_10000016 | 3300014326 | Bacteria | 126029 |
| 396 | Ga0157380_10002828 | 3300014326 | Bacteria | 11801 |
| 397 | Ga0157380_10116286 | 3300014326 | Bacteria | 2257 |
| 398 | Ga0157380_13512092 | 3300014326 | Bacteria | 502 |
| 399 | Ga0182008_10336097 | 3300014497 | Bacteria | 798 |
| 400 | Ga0157377_10039811 | 3300014745 | Bacteria | 2601 |
| 401 | Ga0157377_10439528 | 3300014745 | Bacteria | 898 |
| 402 | Ga0157377_10760733 | 3300014745 | Bacteria | 710 |
| 403 | Ga0157379_10006763 | 3300014968 | Bacteria | 9911 |
| 404 | Ga0157379_10400050 | 3300014968 | Bacteria | 1262 |
| 405 | Ga0157379_12271030 | 3300014968 | Bacteria | 540 |
| 406 | Ga0157379_12299167 | 3300014968 | Bacteria | 537 |
| 407 | Ga0157376_10127119 | 3300014969 | Bacteria | 2269 |
| 408 | Ga0157376_10169025 | 3300014969 | Bacteria | 1989 |
| 409 | Ga0157376_11220358 | 3300014969 | Bacteria | 780 |
| 410 | Ga0157376_11700456 | 3300014969 | Bacteria | 666 |
| 411 | Ga0157376_11879406 | 3300014969 | Bacteria | 635 |
| 412 | Ga0157376_12460768 | 3300014969 | Bacteria | 560 |
| 413 | Ga0163161_10000053 | 3300017792 | Bacteria | 117408 |
| 414 | Ga0163161_10154218 | 3300017792 | Bacteria | 1747 |
| 415 | Ga0163161_10225825 | 3300017792 | Bacteria | 1451 |
| 416 | Ga0163161_10359349 | 3300017792 | Bacteria | 1160 |
| 417 | Ga0163161_10908301 | 3300017792 | Bacteria | 746 |
| 418 | Ga0197907_11491576 | 3300020069 | Bacteria | 645 |
| 419 | Ga0206351_10306398 | 3300020077 | Bacteria | 580 |
| 420 | Ga0206352_10043259 | 3300020078 | Bacteria | 526 |
| 421 | Ga0206350_10480026 | 3300020080 | Bacteria | 565 |
| 422 | Ga0206354_10762690 | 3300020081 | Bacteria | 511 |
| 423 | Ga0206353_11374094 | 3300020082 | Bacteria | 546 |
| 424 | Ga0206353_11800342 | 3300020082 | Bacteria | 611 |
| 425 | Ga0224712_10040416 | 3300022467 | Bacteria | 1755 |
| 426 | Ga0224712_10214807 | 3300022467 | Bacteria | 878 |
| 427 | Ga0207697_10377732 | 3300025315 | Bacteria | 629 |
| 428 | Ga0207656_10000226 | 3300025321 | Bacteria | 20150 |
| 429 | Ga0207656_10007404 | 3300025321 | Bacteria | 3995 |
| 430 | Ga0207656_10093123 | 3300025321 | Bacteria | 1370 |
| 431 | Ga0207682_10010613 | 3300025893 | Bacteria | 3606 |
| 432 | Ga0207642_10000080 | 3300025899 | Bacteria | 25169 |
| 433 | Ga0207642_10005540 | 3300025899 | Bacteria | 4127 |
| 434 | Ga0207710_10019430 | 3300025900 | Bacteria | 2899 |
| 435 | Ga0207710_10600436 | 3300025900 | Bacteria | 575 |
| 436 | Ga0207688_10004162 | 3300025901 | Bacteria | 7882 |
| 437 | Ga0207688_10008563 | 3300025901 | Bacteria | 5568 |
| 438 | Ga0207688_10009259 | 3300025901 | Bacteria | 5369 |
| 439 | Ga0207680_10005908 | 3300025903 | Bacteria | 5879 |
| 440 | Ga0207680_10073801 | 3300025903 | Bacteria | 2122 |
| 441 | Ga0207647_10128345 | 3300025904 | Bacteria | 1491 |
| 442 | Ga0207685_10136019 | 3300025905 | Bacteria | 1096 |
| 443 | Ga0207645_10276812 | 3300025907 | Bacteria | 1114 |
| 444 | Ga0207643_10292299 | 3300025908 | Bacteria | 1012 |
| 445 | Ga0207643_10292617 | 3300025908 | Bacteria | 1012 |
| 446 | Ga0207643_10689263 | 3300025908 | Bacteria | 660 |
| 447 | Ga0207705_10080206 | 3300025909 | Bacteria | 2378 |
| 448 | Ga0207705_10300677 | 3300025909 | Bacteria | 1231 |
| 449 | Ga0207654_10336258 | 3300025911 | Bacteria | 1036 |
| 450 | Ga0207707_10096999 | 3300025912 | Bacteria | 2576 |
| 451 | Ga0207707_10590699 | 3300025912 | Bacteria | 940 |
| 452 | Ga0207695_10094013 | 3300025913 | Bacteria | 3006 |
| 453 | Ga0207695_10680249 | 3300025913 | Bacteria | 910 |
| 454 | Ga0207695_11115059 | 3300025913 | Bacteria | 669 |
| 455 | Ga0207671_10287266 | 3300025914 | Bacteria | 1298 |
| 456 | Ga0207671_11022210 | 3300025914 | Bacteria | 651 |
| 457 | Ga0207671_11095034 | 3300025914 | Bacteria | 626 |
| 458 | Ga0207671_11304137 | 3300025914 | Bacteria | 565 |
| 459 | Ga0207693_10013472 | 3300025915 | Bacteria | 6593 |
| 460 | Ga0207693_10014605 | 3300025915 | Bacteria | 6310 |
| 461 | Ga0207693_10314032 | 3300025915 | Bacteria | 1227 |
| 462 | Ga0207663_10021565 | 3300025916 | Bacteria | 3669 |
| 463 | Ga0207663_10816636 | 3300025916 | Bacteria | 743 |
| 464 | Ga0207660_11042254 | 3300025917 | Bacteria | 667 |
| 465 | Ga0207662_10254632 | 3300025918 | Bacteria | 1153 |
| 466 | Ga0207662_10863997 | 3300025918 | Bacteria | 639 |
| 467 | Ga0207657_10000636 | 3300025919 | Bacteria | 37227 |
| 468 | Ga0207657_10464617 | 3300025919 | Bacteria | 993 |
| 469 | Ga0207649_10000127 | 3300025920 | Bacteria | 64603 |
| 470 | Ga0207649_10021936 | 3300025920 | Bacteria | 3685 |
| 471 | Ga0207649_10510953 | 3300025920 | Bacteria | 915 |
| 472 | Ga0207649_11002915 | 3300025920 | Bacteria | 657 |
| 473 | Ga0207652_10000321 | 3300025921 | Bacteria | 49720 |
| 474 | Ga0207652_10495955 | 3300025921 | Bacteria | 1100 |
| 475 | Ga0207652_11731803 | 3300025921 | Bacteria | 530 |
| 476 | Ga0207694_10062887 | 3300025924 | Bacteria | 2890 |
| 477 | Ga0207694_10277806 | 3300025924 | Bacteria | 1375 |
| 478 | Ga0207694_10515897 | 3300025924 | Bacteria | 1001 |
| 479 | Ga0207650_10031298 | 3300025925 | Bacteria | 3841 |
| 480 | Ga0207650_11466038 | 3300025925 | Unclassified | 580 |
| 481 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 482 | Ga0207659_10153312 | 3300025926 | Bacteria | 1801 |
| 483 | Ga0207659_10480730 | 3300025926 | Bacteria | 1049 |
| 484 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 485 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 486 | Ga0207687_10000460 | 3300025927 | Bacteria | 27723 |
| 487 | Ga0207687_10011833 | 3300025927 | Bacteria | 5708 |
| 488 | Ga0207687_10017769 | 3300025927 | Bacteria | 4689 |
| 489 | Ga0207687_10049514 | 3300025927 | Bacteria | 2922 |
| 490 | Ga0207687_10592077 | 3300025927 | Bacteria | 934 |
| 491 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 492 | Ga0207664_10349734 | 3300025929 | Bacteria | 1308 |
| 493 | Ga0207644_10090484 | 3300025931 | Bacteria | 2280 |
| 494 | Ga0207644_10282981 | 3300025931 | Bacteria | 1332 |
| 495 | Ga0207690_10023856 | 3300025932 | Bacteria | 3825 |
| 496 | Ga0207690_10931749 | 3300025932 | Bacteria | 721 |
| 497 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 498 | Ga0207706_10007826 | 3300025933 | Bacteria | 9864 |
| 499 | Ga0207706_10090788 | 3300025933 | Bacteria | 2686 |
| 500 | Ga0207686_10000097 | 3300025934 | Bacteria | 72219 |
| 501 | Ga0207686_10035280 | 3300025934 | Bacteria | 3001 |
| 502 | Ga0207686_10085007 | 3300025934 | Bacteria | 2074 |
| 503 | Ga0207686_10136529 | 3300025934 | Bacteria | 1689 |
| 504 | Ga0207686_10320029 | 3300025934 | Bacteria | 1159 |
| 505 | Ga0207686_10987846 | 3300025934 | Bacteria | 683 |
| 506 | Ga0207686_11130594 | 3300025934 | Bacteria | 639 |
| 507 | Ga0207709_10005457 | 3300025935 | Bacteria | 7225 |
| 508 | Ga0207709_10005868 | 3300025935 | Bacteria | 6935 |
| 509 | Ga0207709_10177766 | 3300025935 | Bacteria | 1500 |
| 510 | Ga0207709_10387095 | 3300025935 | Bacteria | 1065 |
| 511 | Ga0207670_10020378 | 3300025936 | Bacteria | 4074 |
| 512 | Ga0207670_10142618 | 3300025936 | Bacteria | 1768 |
| 513 | Ga0207670_10148022 | 3300025936 | Bacteria | 1739 |
| 514 | Ga0207670_10840514 | 3300025936 | Bacteria | 766 |
| 515 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 516 | Ga0207669_10045981 | 3300025937 | Bacteria | 2576 |
| 517 | Ga0207669_10091576 | 3300025937 | Bacteria | 1981 |
| 518 | Ga0207669_10648256 | 3300025937 | Bacteria | 863 |
| 519 | Ga0207669_11752037 | 3300025937 | Bacteria | 531 |
| 520 | Ga0207704_10000184 | 3300025938 | Bacteria | 32775 |
| 521 | Ga0207704_10028503 | 3300025938 | Bacteria | 3099 |
| 522 | Ga0207704_10056024 | 3300025938 | Bacteria | 2412 |
| 523 | Ga0207704_10496717 | 3300025938 | Bacteria | 983 |
| 524 | Ga0207704_10599293 | 3300025938 | Bacteria | 902 |
| 525 | Ga0207665_10041438 | 3300025939 | Bacteria | 3075 |
| 526 | Ga0207665_10909089 | 3300025939 | Bacteria | 698 |
| 527 | Ga0207691_10029702 | 3300025940 | Bacteria | 5112 |
| 528 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 529 | Ga0207711_10207341 | 3300025941 | Bacteria | 1790 |
| 530 | Ga0207711_10691922 | 3300025941 | Bacteria | 951 |
| 531 | Ga0207711_11553970 | 3300025941 | Bacteria | 605 |
| 532 | Ga0207689_10103451 | 3300025942 | Bacteria | 2340 |
| 533 | Ga0207689_10299305 | 3300025942 | Bacteria | 1333 |
| 534 | Ga0207689_11176199 | 3300025942 | Bacteria | 646 |
| 535 | Ga0207661_10001690 | 3300025944 | Bacteria | 15057 |
| 536 | Ga0207661_10002110 | 3300025944 | Bacteria | 13678 |
| 537 | Ga0207661_10091283 | 3300025944 | Bacteria | 2537 |
| 538 | Ga0207661_10101297 | 3300025944 | Bacteria | 2419 |
| 539 | Ga0207661_10172483 | 3300025944 | Bacteria | 1883 |
| 540 | Ga0207661_10205492 | 3300025944 | Bacteria | 1733 |
| 541 | Ga0207661_10857542 | 3300025944 | Bacteria | 836 |
| 542 | Ga0207679_10059493 | 3300025945 | Bacteria | 2835 |
| 543 | Ga0207679_10150953 | 3300025945 | Bacteria | 1891 |
| 544 | Ga0207679_10513937 | 3300025945 | Bacteria | 1070 |
| 545 | Ga0207651_10013423 | 3300025960 | Bacteria | 4689 |
| 546 | Ga0207651_10016930 | 3300025960 | Bacteria | 4290 |
| 547 | Ga0207651_10849003 | 3300025960 | Bacteria | 811 |
| 548 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 549 | Ga0207712_10106609 | 3300025961 | Bacteria | 2093 |
| 550 | Ga0207712_10140778 | 3300025961 | Bacteria | 1851 |
| 551 | Ga0207712_10596379 | 3300025961 | Bacteria | 955 |
| 552 | Ga0207712_10641459 | 3300025961 | Unclassified | 922 |
| 553 | Ga0207712_11554369 | 3300025961 | Bacteria | 593 |
| 554 | Ga0207668_10008029 | 3300025972 | Bacteria | 6284 |
| 555 | Ga0207668_10696879 | 3300025972 | Bacteria | 892 |
| 556 | Ga0207668_10980130 | 3300025972 | Bacteria | 755 |
| 557 | Ga0207668_11122450 | 3300025972 | Bacteria | 705 |
| 558 | Ga0207640_10071795 | 3300025981 | Bacteria | 2333 |
| 559 | Ga0207640_10106767 | 3300025981 | Bacteria | 1976 |
| 560 | Ga0207640_10337120 | 3300025981 | Bacteria | 1206 |
| 561 | Ga0207658_10023672 | 3300025986 | Bacteria | 4289 |
| 562 | Ga0207658_10050389 | 3300025986 | Bacteria | 3064 |
| 563 | Ga0207658_10181291 | 3300025986 | Bacteria | 1743 |
| 564 | Ga0207658_10523750 | 3300025986 | Bacteria | 1058 |
| 565 | Ga0207677_10000284 | 3300026023 | Bacteria | 37886 |
| 566 | Ga0207677_10001038 | 3300026023 | Bacteria | 15272 |
| 567 | Ga0207677_10045723 | 3300026023 | Bacteria | 2925 |
| 568 | Ga0207677_11091726 | 3300026023 | Bacteria | 727 |
| 569 | Ga0207677_11560441 | 3300026023 | Bacteria | 611 |
| 570 | Ga0207677_11910282 | 3300026023 | Unclassified | 552 |
| 571 | Ga0207677_11989510 | 3300026023 | Bacteria | 540 |
| 572 | Ga0207703_10000088 | 3300026035 | Bacteria | 106080 |
| 573 | Ga0207703_10000287 | 3300026035 | Bacteria | 55757 |
| 574 | Ga0207703_10410402 | 3300026035 | Bacteria | 1258 |
| 575 | Ga0207703_11884876 | 3300026035 | Bacteria | 574 |
| 576 | Ga0207639_10005999 | 3300026041 | Bacteria | 8242 |
| 577 | Ga0207639_10035406 | 3300026041 | Bacteria | 3694 |
| 578 | Ga0207639_10693339 | 3300026041 | Bacteria | 944 |
| 579 | Ga0207678_10002224 | 3300026067 | Bacteria | 17527 |
| 580 | Ga0207678_10016375 | 3300026067 | Bacteria | 6509 |
| 581 | Ga0207678_10046785 | 3300026067 | Bacteria | 3742 |
| 582 | Ga0207678_10403060 | 3300026067 | Bacteria | 1184 |
| 583 | Ga0207678_10936036 | 3300026067 | Bacteria | 766 |
| 584 | Ga0207708_10009112 | 3300026075 | Bacteria | 7344 |
| 585 | Ga0207708_10014443 | 3300026075 | Bacteria | 5910 |
| 586 | Ga0207708_10227601 | 3300026075 | Bacteria | 1496 |
| 587 | Ga0207708_10571844 | 3300026075 | Bacteria | 955 |
| 588 | Ga0207708_10634317 | 3300026075 | Bacteria | 908 |
| 589 | Ga0207702_10000637 | 3300026078 | Bacteria | 38379 |
| 590 | Ga0207702_10014646 | 3300026078 | Bacteria | 6508 |
| 591 | Ga0207702_10047334 | 3300026078 | Bacteria | 3624 |
| 592 | Ga0207702_10055526 | 3300026078 | Bacteria | 3359 |
| 593 | Ga0207702_11847708 | 3300026078 | Bacteria | 596 |
| 594 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 595 | Ga0207641_10207691 | 3300026088 | Bacteria | 1809 |
| 596 | Ga0207641_10415730 | 3300026088 | Bacteria | 1294 |
| 597 | Ga0207641_10633330 | 3300026088 | Bacteria | 1049 |
| 598 | Ga0207641_10635275 | 3300026088 | Bacteria | 1048 |
| 599 | Ga0207641_11472097 | 3300026088 | Bacteria | 682 |
| 600 | Ga0207641_12064018 | 3300026088 | Unclassified | 571 |
| 601 | Ga0207648_10015345 | 3300026089 | Bacteria | 7048 |
| 602 | Ga0207648_10017486 | 3300026089 | Bacteria | 6522 |
| 603 | Ga0207648_11007247 | 3300026089 | Bacteria | 780 |
| 604 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 605 | Ga0207676_10060765 | 3300026095 | Bacteria | 2990 |
| 606 | Ga0207676_10357913 | 3300026095 | Bacteria | 1352 |
| 607 | Ga0207674_10102949 | 3300026116 | Bacteria | 2835 |
| 608 | Ga0207674_10149795 | 3300026116 | Bacteria | 2290 |
| 609 | Ga0207674_11638187 | 3300026116 | Bacteria | 612 |
| 610 | Ga0207675_100045437 | 3300026118 | Bacteria | 4103 |
| 611 | Ga0207675_100087507 | 3300026118 | Bacteria | 2926 |
| 612 | Ga0207683_10012982 | 3300026121 | Bacteria | 7113 |
| 613 | Ga0207683_10037324 | 3300026121 | Bacteria | 4230 |
| 614 | Ga0207683_10309590 | 3300026121 | Bacteria | 1446 |
| 615 | Ga0207683_10341117 | 3300026121 | Bacteria | 1374 |
| 616 | Ga0207683_10492637 | 3300026121 | Bacteria | 1132 |
| 617 | Ga0207683_10499214 | 3300026121 | Bacteria | 1124 |
| 618 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 619 | Ga0207698_10005530 | 3300026142 | Bacteria | 7819 |
| 620 | Ga0207698_10063263 | 3300026142 | Bacteria | 2895 |
| 621 | Ga0209813_10337831 | 3300027866 | Bacteria | 593 |
| 622 | Ga0207428_10264797 | 3300027907 | Bacteria | 1279 |
| 623 | Ga0207428_10290421 | 3300027907 | Bacteria | 1212 |
| 624 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 625 | Ga0268266_10001254 | 3300028379 | Bacteria | 31003 |
| 626 | Ga0268266_10059912 | 3300028379 | Bacteria | 3280 |
| 627 | Ga0268266_10465490 | 3300028379 | Bacteria | 1203 |
| 628 | Ga0268266_11304039 | 3300028379 | Bacteria | 701 |
| 629 | Ga0268265_10205244 | 3300028380 | Bacteria | 1713 |
| 630 | Ga0268265_10389931 | 3300028380 | Bacteria | 1284 |
| 631 | Ga0268265_12114974 | 3300028380 | Bacteria | 570 |
| 632 | Ga0268265_12333118 | 3300028380 | Bacteria | 542 |
| 633 | Ga0268264_10295170 | 3300028381 | Bacteria | 1524 |
| 634 | Ga0268264_11262797 | 3300028381 | Bacteria | 748 |
| 635 | Ga0268264_11735309 | 3300028381 | Bacteria | 635 |
| 636 | Ga0268264_12246106 | 3300028381 | Bacteria | 553 |
| 637 | Ga0265337_1000066 | 3300028556 | Bacteria | 48673 |
| 638 | Ga0265326_10000019 | 3300028558 | Bacteria | 137370 |
| 639 | Ga0265319_1000069 | 3300028563 | Bacteria | 82640 |
| 640 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 641 | Ga0265336_10002798 | 3300028666 | Bacteria | 7048 |
| 642 | Ga0265338_10158711 | 3300028800 | Bacteria | 1749 |
| 643 | Ga0265324_10000283 | 3300029957 | Bacteria | 37587 |
| 644 | Ga0265330_10288409 | 3300031235 | Bacteria | 691 |
| 645 | Ga0265332_10116314 | 3300031238 | Bacteria | 1124 |
| 646 | Ga0265328_10000737 | 3300031239 | Bacteria | 15188 |
| 647 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 648 | Ga0265329_10004312 | 3300031242 | Bacteria | 5950 |
| 649 | Ga0265339_10051838 | 3300031249 | Bacteria | 2237 |
| 650 | Ga0265331_10000858 | 3300031250 | Bacteria | 24739 |
| 651 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 652 | Ga0265327_10065922 | 3300031251 | Bacteria | 1829 |
| 653 | Ga0265316_10181978 | 3300031344 | Bacteria | 1564 |
| 654 | Ga0307408_100120691 | 3300031548 | Bacteria | 2030 |
| 655 | Ga0316575_10325157 | 3300031665 | Bacteria | 653 |
| 656 | Ga0265314_10000640 | 3300031711 | Bacteria | 42944 |
| 657 | Ga0265342_10231156 | 3300031712 | Bacteria | 993 |
| 658 | Ga0316576_10368159 | 3300031727 | Bacteria | 1068 |
| 659 | Ga0307405_10467687 | 3300031731 | Bacteria | 1004 |
| 660 | Ga0307410_10345634 | 3300031852 | Bacteria | 1187 |
| 661 | Ga0307406_10646326 | 3300031901 | Bacteria | 877 |
| 662 | Ga0307407_10494104 | 3300031903 | Bacteria | 896 |
| 663 | Ga0307409_100315072 | 3300031995 | Bacteria | 1462 |
| 664 | Ga0307409_100481919 | 3300031995 | Bacteria | 1204 |
| 665 | Ga0307409_102877382 | 3300031995 | Unclassified | 508 |
| 666 | Ga0307409_102975120 | 3300031995 | Bacteria | 500 |
| 667 | Ga0307416_100007153 | 3300032002 | Bacteria | 7060 |
| 668 | Ga0307416_101892543 | 3300032002 | Bacteria | 700 |
| 669 | Ga0307411_11610405 | 3300032005 | Bacteria | 599 |
| 670 | Ga0316583_10357425 | 3300032133 | Bacteria | 505 |
| 671 | Ga0316596_1073834 | 3300033541 | Bacteria | 914 |
| 672 | Ga0373953_0427738 | 3300035117 | Bacteria | 584 |
| 673 | Ga0373955_0207534 | 3300035172 | Bacteria | 1167 |
| 674 | Ga0373961_0334439 | 3300035241 | Bacteria | 568 |
| 675 | Ga0373962_0222017 | 3300035242 | Bacteria | 647 |
| 676 | Ga0316574_0084413 | 3300035398 | Bacteria | 2020 |
| 677 | Ga0316574_0233711 | 3300035398 | Bacteria | 1176 |
| 678 | Ga0316574_0710966 | 3300035398 | Bacteria | 616 |
| 679 | Ga0373933_0230983 | 3300035724 | Bacteria | 1188 |
| 680 | Ga0373937_0093812 | 3300036401 | Bacteria | 2783 |
| 681 | Ga0373937_0099240 | 3300036401 | Bacteria | 2701 |
| 682 | Ga0373937_0906547 | 3300036401 | Bacteria | 830 |
| 683 | Ga0316582_1061819 | 3300036647 | Bacteria | 552 |
| 684 | Ga0316584_0076334 | 3300036712 | Bacteria | 2511 |
| 685 | Ga0316584_0105111 | 3300036712 | Bacteria | 2113 |
| 686 | Ga0395899_0040970 | 3300037312 | Bacteria | 3463 |
| 687 | Ga0395899_0521791 | 3300037312 | Bacteria | 768 |
| 688 | Ga0395900_0047402 | 3300037418 | Bacteria | 4424 |
| 689 | Ga0395900_0193162 | 3300037418 | Bacteria | 2064 |
| 690 | Ga0395900_0451853 | 3300037418 | Bacteria | 1241 |
| 691 | Ga0395900_1270433 | 3300037418 | Bacteria | 651 |
| 692 | Ga0395900_1439792 | 3300037418 | Bacteria | 602 |
| 693 | Ga0395900_1652645 | 3300037418 | Bacteria | 552 |
| 694 | Ga0395898_0015116 | 3300037466 | Bacteria | 7923 |
| 695 | Ga0395898_0028975 | 3300037466 | Bacteria | 5549 |
| 696 | Ga0395898_0739748 | 3300037466 | Bacteria | 925 |
| 697 | Ga0395898_1648897 | 3300037466 | Archaea | 565 |
| 698 | Ga0395905_0058834 | 3300037471 | Bacteria | 3593 |
| 699 | Ga0395905_0271174 | 3300037471 | Bacteria | 1583 |
| 700 | Ga0436364_1436303 | 3300037853 | Bacteria | 575 |
| 701 | Ga0395901_0044882 | 3300038443 | Bacteria | 4584 |
| 702 | Ga0395901_0181831 | 3300038443 | Bacteria | 2205 |
| 703 | Ga0395901_0475111 | 3300038443 | Bacteria | 1276 |
| 704 | Ga0395901_0660183 | 3300038443 | Bacteria | 1048 |
| 705 | Ga0395901_1033616 | 3300038443 | Bacteria | 796 |
| 706 | Ga0395901_1548546 | 3300038443 | Bacteria | 618 |
| 707 | Ga0451787_712849 | 3300041441 | Bacteria | 585 |
| 708 | Ga0451800_1407260 | 3300041459 | Bacteria | 674 |
| 709 | Ga0451804_0577682 | 3300041463 | Bacteria | 838 |
| 710 | Ga0451804_0667066 | 3300041463 | Bacteria | 825 |
| 711 | Ga0451807_1152741 | 3300041486 | Bacteria | 1140 |
| 712 | Ga0451835_0727965 | 3300041492 | Bacteria | 520 |
| 713 | Ga0451839_0942696 | 3300041496 | Bacteria | 777 |
| 714 | Ga0451845_0014378 | 3300041501 | Bacteria | 612 |
| 715 | Ga0451845_0941955 | 3300041501 | Bacteria | 1201 |
| 716 | Ga0451849_0369994 | 3300041505 | Bacteria | 817 |
| 717 | Ga0451851_1115656 | 3300041507 | Bacteria | 684 |
| 718 | Ga0451853_0637403 | 3300041512 | Unclassified | 655 |
| 719 | Ga0451853_2136927 | 3300041512 | Bacteria | 4240 |
| 720 | Ga0451853_3163208 | 3300041512 | Bacteria | 658 |
| 721 | Ga0451853_3772225 | 3300041512 | Bacteria | 987 |
| 722 | Ga0450923_189473 | 3300042125 | Bacteria | 509 |
| 723 | Ga0450906_106260 | 3300042145 | Bacteria | 513 |
| 724 | Ga0439459_0009945 | 3300042438 | Bacteria | 1650 |
| 725 | Ga0439440_0176935 | 3300042993 | Bacteria | 623 |
| 726 | Ga0466965_0682609 | 3300044683 | Unclassified | 588 |
| 727 | Ga0466963_0000017 | 3300044694 | Bacteria | 58283 |
| 728 | Ga0466963_0237008 | 3300044694 | Bacteria | 1279 |
| 729 | Ga0466963_0465545 | 3300044694 | Bacteria | 892 |
| 730 | Ga0466964_0680097 | 3300044706 | Bacteria | 572 |
| 731 | Ga0466971_0590931 | 3300044719 | Bacteria | 553 |
| 732 | Ga0466957_0001414 | 3300044842 | Bacteria | 12517 |
| 733 | Ga0466957_0929659 | 3300044842 | Bacteria | 622 |
| 734 | Ga0466960_0604182 | 3300044901 | Bacteria | 651 |
| 735 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 736 | Ga0466967_0518478 | 3300045976 | Bacteria | 1171 |
| 737 | Ga0466967_0782900 | 3300045976 | Bacteria | 947 |
| 738 | Ga0466967_1023652 | 3300045976 | Bacteria | 822 |
| 739 | Ga0466967_1714555 | 3300045976 | Bacteria | 626 |
| 740 | Ga0466967_2343148 | 3300045976 | Bacteria | 529 |
| 741 | Ga0495592_0000607 | 3300046454 | Bacteria | 25304 |
| 742 | Ga0495603_0000286 | 3300046455 | Bacteria | 26902 |
| 743 | Ga0495603_0001350 | 3300046455 | Bacteria | 14245 |
| 744 | Ga0495603_0050651 | 3300046455 | Bacteria | 2469 |
| 745 | Ga0495629_0000245 | 3300046459 | Bacteria | 47272 |
| 746 | Ga0495629_0005286 | 3300046459 | Bacteria | 9650 |
| 747 | Ga0495629_0010859 | 3300046459 | Bacteria | 6622 |
| 748 | Ga0495629_1081189 | 3300046459 | Bacteria | 519 |
| 749 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 750 | Ga0495641_0009181 | 3300046461 | Bacteria | 5911 |
| 751 | Ga0495641_0031015 | 3300046461 | Bacteria | 2558 |
| 752 | Ga0495641_0409205 | 3300046461 | Bacteria | 616 |
| 753 | Ga0495651_0176727 | 3300046462 | Bacteria | 1515 |
| 754 | Ga0495651_0297780 | 3300046462 | Bacteria | 1083 |
| 755 | Ga0495653_0103405 | 3300046463 | Bacteria | 2060 |
| 756 | Ga0495653_0135879 | 3300046463 | Bacteria | 1735 |
| 757 | Ga0495653_0169316 | 3300046463 | Bacteria | 1509 |
| 758 | Ga0495653_0197448 | 3300046463 | Bacteria | 1368 |
| 759 | Ga0495653_0881077 | 3300046463 | Bacteria | 534 |
| 760 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 761 | Ga0495639_0236502 | 3300046475 | Bacteria | 901 |
| 762 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 763 | Ga0495664_0282300 | 3300046477 | Bacteria | 1003 |
| 764 | Ga0495584_0562469 | 3300046491 | Bacteria | 581 |
| 765 | Ga0495594_0109392 | 3300046499 | Bacteria | 1558 |
| 766 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 767 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 768 | Ga0495608_0023011 | 3300046511 | Bacteria | 4272 |
| 769 | Ga0495608_0038868 | 3300046511 | Bacteria | 3193 |
| 770 | Ga0495608_0399205 | 3300046511 | Bacteria | 841 |
| 771 | Ga0495608_0525028 | 3300046511 | Bacteria | 715 |
| 772 | Ga0495610_0041056 | 3300046512 | Bacteria | 2326 |
| 773 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 774 | Ga0495620_0000784 | 3300046515 | Bacteria | 19458 |
| 775 | Ga0495620_0072027 | 3300046515 | Bacteria | 1412 |
| 776 | Ga0495628_0000679 | 3300046516 | Bacteria | 31290 |
| 777 | Ga0495628_0031056 | 3300046516 | Bacteria | 4321 |
| 778 | Ga0495628_0074492 | 3300046516 | Bacteria | 2644 |
| 779 | Ga0495628_0098751 | 3300046516 | Bacteria | 2255 |
| 780 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 781 | Ga0495630_0003407 | 3300046517 | Bacteria | 11078 |
| 782 | Ga0495630_0069675 | 3300046517 | Bacteria | 2646 |
| 783 | Ga0495644_0001871 | 3300046523 | Bacteria | 8485 |
| 784 | Ga0495663_0100331 | 3300046525 | Bacteria | 953 |
| 785 | Ga0495652_0011995 | 3300046529 | Bacteria | 7834 |
| 786 | Ga0495652_0214350 | 3300046529 | Bacteria | 1451 |
| 787 | Ga0495640_0043829 | 3300046533 | Bacteria | 3113 |
| 788 | Ga0495640_0249307 | 3300046533 | Bacteria | 1112 |
| 789 | Ga0495640_0528033 | 3300046533 | Bacteria | 717 |
| 790 | Ga0495586_0086430 | 3300046535 | Bacteria | 1728 |
| 791 | Ga0495587_0827437 | 3300046536 | Bacteria | 505 |
| 792 | Ga0495645_0027447 | 3300046543 | Bacteria | 4137 |
| 793 | Ga0495645_0046873 | 3300046543 | Bacteria | 3150 |
| 794 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 795 | Ga0495656_0000465 | 3300046615 | Bacteria | 13215 |
| 796 | Ga0495656_0433451 | 3300046615 | Bacteria | 691 |
| 797 | Ga0495668_0223839 | 3300046616 | Bacteria | 1030 |
| 798 | Ga0495634_0000028 | 3300046642 | Bacteria | 114075 |
| 799 | Ga0495634_0001744 | 3300046642 | Bacteria | 18826 |
| 800 | Ga0495634_0105054 | 3300046642 | Bacteria | 1821 |
| 801 | Ga0495634_0128989 | 3300046642 | Bacteria | 1614 |
| 802 | Ga0495634_0386255 | 3300046642 | Bacteria | 834 |
| 803 | Ga0495635_0026499 | 3300046663 | Bacteria | 4033 |
| 804 | Ga0495635_0328011 | 3300046663 | Bacteria | 1024 |
| 805 | Ga0495661_0575247 | 3300046665 | Bacteria | 531 |
| 806 | Ga0495588_0000362 | 3300046674 | Bacteria | 28212 |
| 807 | Ga0495588_0226240 | 3300046674 | Bacteria | 987 |
| 808 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 809 | Ga0495657_0024829 | 3300046675 | Bacteria | 4263 |
| 810 | Ga0495599_0046673 | 3300046678 | Bacteria | 2716 |
| 811 | Ga0495646_0151250 | 3300046680 | Bacteria | 1291 |
| 812 | Ga0495646_0198191 | 3300046680 | Bacteria | 1095 |
| 813 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 814 | Ga0495647_0008133 | 3300046681 | Bacteria | 3524 |
| 815 | Ga0495647_0238325 | 3300046681 | Unclassified | 807 |
| 816 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 817 | Ga0495658_0060194 | 3300046683 | Bacteria | 2177 |
| 818 | Ga0495658_0295977 | 3300046683 | Bacteria | 1023 |
| 819 | Ga0495669_0000113 | 3300046684 | Bacteria | 52780 |
| 820 | Ga0495669_0399452 | 3300046684 | Bacteria | 666 |
| 821 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 822 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 823 | Ga0495613_0039372 | 3300046689 | Bacteria | 3505 |
| 824 | Ga0495624_0000417 | 3300046690 | Bacteria | 33743 |
| 825 | Ga0495624_0263454 | 3300046690 | Bacteria | 1041 |
| 826 | Ga0495624_0802842 | 3300046690 | Bacteria | 556 |
| 827 | Ga0495670_0006058 | 3300046691 | Bacteria | 5927 |
| 828 | Ga0495671_0459099 | 3300046692 | Bacteria | 609 |
| 829 | Ga0495600_0011717 | 3300046809 | Bacteria | 5472 |
| 830 | Ga0495600_0112106 | 3300046809 | Bacteria | 1776 |
| 831 | Ga0495600_0303642 | 3300046809 | Bacteria | 1006 |
| 832 | Ga0495581_0203413 | 3300047315 | Bacteria | 1158 |
| 833 | Ga0495581_0384812 | 3300047315 | Bacteria | 819 |
| 834 | Ga0495604_0000239 | 3300047317 | Bacteria | 49113 |
| 835 | Ga0495604_0001251 | 3300047317 | Bacteria | 20805 |
| 836 | Ga0495674_0247369 | 3300047319 | Bacteria | 1468 |
| 837 | Ga0495676_0000827 | 3300047321 | Bacteria | 25944 |
| 838 | Ga0495676_0002855 | 3300047321 | Bacteria | 15572 |
| 839 | Ga0495676_0012579 | 3300047321 | Bacteria | 7619 |
| 840 | Ga0495676_0028979 | 3300047321 | Bacteria | 4719 |
| 841 | Ga0495676_0117131 | 3300047321 | Bacteria | 1944 |
| 842 | Ga0495676_0231492 | 3300047321 | Bacteria | 1269 |
| 843 | Ga0495676_0280990 | 3300047321 | Bacteria | 1127 |
| 844 | Ga0495676_0912990 | 3300047321 | Bacteria | 562 |
| 845 | Ga0495680_0000143 | 3300047322 | Bacteria | 71946 |
| 846 | Ga0495680_0001430 | 3300047322 | Bacteria | 25733 |
| 847 | Ga0495680_0067314 | 3300047322 | Bacteria | 2738 |
| 848 | Ga0495675_0001421 | 3300047444 | Bacteria | 14505 |
| 849 | Ga0495673_0113592 | 3300047469 | Bacteria | 1080 |
| 850 | Ga0495684_0210310 | 3300047471 | Bacteria | 1431 |
| 851 | Ga0495684_1033764 | 3300047471 | Bacteria | 520 |
| 852 | Ga0495686_0270817 | 3300047472 | Bacteria | 947 |
| 853 | Ga0495593_0231268 | 3300047673 | Bacteria | 927 |
| 854 | Ga0495602_0001031 | 3300048088 | Bacteria | 27141 |
| 855 | Ga0495602_0156363 | 3300048088 | Bacteria | 1785 |
| 856 | Ga0495602_0271539 | 3300048088 | Bacteria | 1253 |
| 857 | Ga0495602_0614244 | 3300048088 | Bacteria | 746 |
| 858 | Ga0495602_1160562 | 3300048088 | Bacteria | 504 |
| 859 | Ga0495614_0012048 | 3300048089 | Bacteria | 3798 |
| 860 | Ga0495614_0257758 | 3300048089 | Bacteria | 799 |
| 861 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 862 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 863 | Ga0496100_0013391 | 3300048903 | Bacteria | 4728 |
| 864 | Ga0496100_0322156 | 3300048903 | Bacteria | 1161 |
| 865 | Ga0496100_0498137 | 3300048903 | Bacteria | 938 |
| 866 | Ga0496100_0701642 | 3300048903 | Bacteria | 790 |
| 867 | Ga0496100_1241638 | 3300048903 | Bacteria | 588 |
| 868 | Ga0496100_1366887 | 3300048903 | Bacteria | 559 |
| 869 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 870 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 871 | Ga0496101_0245701 | 3300048904 | Bacteria | 1393 |
| 872 | Ga0496101_0789118 | 3300048904 | Bacteria | 749 |
| 873 | Ga0496102_0000211 | 3300048905 | Bacteria | 77793 |
| 874 | Ga0496102_0045517 | 3300048905 | Bacteria | 3984 |
| 875 | Ga0496102_0235659 | 3300048905 | Bacteria | 1726 |
| 876 | Ga0496102_0639694 | 3300048905 | Unclassified | 987 |
| 877 | Ga0496102_1095013 | 3300048905 | Bacteria | 716 |
| 878 | Ga0496103_0000083 | 3300048906 | Bacteria | 108615 |
| 879 | Ga0496103_0006964 | 3300048906 | Bacteria | 6750 |
| 880 | Ga0496103_0223100 | 3300048906 | Bacteria | 1212 |
| 881 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 882 | Ga0496104_0000026 | 3300048907 | Bacteria | 210098 |
| 883 | Ga0496104_0000052 | 3300048907 | Bacteria | 137286 |
| 884 | Ga0496104_0000765 | 3300048907 | Bacteria | 27516 |
| 885 | Ga0496104_0017182 | 3300048907 | Bacteria | 6581 |
| 886 | Ga0496104_0028668 | 3300048907 | Bacteria | 5160 |
| 887 | Ga0496104_0317011 | 3300048907 | Bacteria | 1472 |
| 888 | Ga0496104_0666724 | 3300048907 | Bacteria | 949 |
| 889 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 890 | Ga0496105_0000030 | 3300048908 | Bacteria | 137325 |
| 891 | Ga0496105_0000409 | 3300048908 | Bacteria | 28168 |
| 892 | Ga0496105_0022580 | 3300048908 | Bacteria | 5096 |
| 893 | Ga0496105_0022858 | 3300048908 | Bacteria | 5068 |
| 894 | Ga0496105_0027673 | 3300048908 | Bacteria | 4634 |
| 895 | Ga0496105_0052093 | 3300048908 | Bacteria | 3379 |
| 896 | Ga0496105_0672496 | 3300048908 | Bacteria | 797 |
| 897 | Ga0496106_0000076 | 3300048909 | Bacteria | 79088 |
| 898 | Ga0496106_0000121 | 3300048909 | Bacteria | 59910 |
| 899 | Ga0496106_0004512 | 3300048909 | Bacteria | 10312 |
| 900 | Ga0496106_0012259 | 3300048909 | Bacteria | 6329 |
| 901 | Ga0496106_0031326 | 3300048909 | Bacteria | 3962 |
| 902 | Ga0496106_0072451 | 3300048909 | Bacteria | 2635 |
| 903 | Ga0496106_0286024 | 3300048909 | Bacteria | 1321 |
| 904 | Ga0496106_0357051 | 3300048909 | Bacteria | 1174 |
| 905 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 906 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 907 | Ga0496107_0016540 | 3300048910 | Bacteria | 5182 |
| 908 | Ga0496107_0032962 | 3300048910 | Bacteria | 3704 |
| 909 | Ga0496107_0041276 | 3300048910 | Bacteria | 3313 |
| 910 | Ga0496107_0072035 | 3300048910 | Bacteria | 2512 |
| 911 | Ga0496107_0089310 | 3300048910 | Bacteria | 2250 |
| 912 | Ga0496107_0481660 | 3300048910 | Bacteria | 921 |
| 913 | Ga0496107_0568796 | 3300048910 | Bacteria | 839 |
| 914 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 915 | Ga0496108_0000063 | 3300048911 | Bacteria | 118950 |
| 916 | Ga0496108_0003280 | 3300048911 | Bacteria | 12999 |
| 917 | Ga0496108_0005560 | 3300048911 | Bacteria | 10200 |
| 918 | Ga0496108_0015242 | 3300048911 | Bacteria | 6272 |
| 919 | Ga0496108_0054035 | 3300048911 | Bacteria | 3370 |
| 920 | Ga0496108_0113371 | 3300048911 | Bacteria | 2320 |
| 921 | Ga0496108_0185162 | 3300048911 | Bacteria | 1803 |
| 922 | Ga0496108_1648461 | 3300048911 | Bacteria | 529 |
| 923 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 924 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 925 | Ga0496109_0000348 | 3300048912 | Bacteria | 43133 |
| 926 | Ga0496109_0003361 | 3300048912 | Bacteria | 13379 |
| 927 | Ga0496109_0005652 | 3300048912 | Bacteria | 10461 |
| 928 | Ga0496109_0068649 | 3300048912 | Bacteria | 3249 |
| 929 | Ga0496109_0070649 | 3300048912 | Bacteria | 3204 |
| 930 | Ga0496109_0107331 | 3300048912 | Bacteria | 2593 |
| 931 | Ga0496109_0130860 | 3300048912 | Bacteria | 2342 |
| 932 | Ga0496109_0644781 | 3300048912 | Bacteria | 996 |
| 933 | Ga0496109_0831491 | 3300048912 | Bacteria | 861 |
| 934 | Ga0496110_0000183 | 3300048913 | Bacteria | 39196 |
| 935 | Ga0496110_0002164 | 3300048913 | Bacteria | 14666 |
| 936 | Ga0496110_0012481 | 3300048913 | Bacteria | 6986 |
| 937 | Ga0496110_0020894 | 3300048913 | Bacteria | 5531 |
| 938 | Ga0496110_0059269 | 3300048913 | Bacteria | 3374 |
| 939 | Ga0496110_0088109 | 3300048913 | Bacteria | 2772 |
| 940 | Ga0496110_0427934 | 3300048913 | Bacteria | 1207 |
| 941 | Ga0496111_0000006 | 3300048914 | Bacteria | 107643 |
| 942 | Ga0496111_0000044 | 3300048914 | Bacteria | 49014 |
| 943 | Ga0496111_0012021 | 3300048914 | Bacteria | 5851 |
| 944 | Ga0496111_0017776 | 3300048914 | Bacteria | 4918 |
| 945 | Ga0496111_0047291 | 3300048914 | Bacteria | 3098 |
| 946 | Ga0496111_0117841 | 3300048914 | Bacteria | 1959 |
| 947 | Ga0496111_0406139 | 3300048914 | Bacteria | 1006 |
| 948 | Ga0496111_0720627 | 3300048914 | Bacteria | 725 |
| 949 | Ga0496111_0987842 | 3300048914 | Bacteria | 604 |
| 950 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 951 | Ga0496112_0320767 | 3300048915 | Bacteria | 1493 |
| 952 | Ga0496112_0852429 | 3300048915 | Unclassified | 834 |
| 953 | Ga0496113_0038054 | 3300048916 | Bacteria | 3534 |
| 954 | Ga0496113_0052521 | 3300048916 | Bacteria | 3044 |
| 955 | Ga0496113_0072254 | 3300048916 | Bacteria | 2625 |
| 956 | Ga0496113_0153224 | 3300048916 | Bacteria | 1819 |
| 957 | Ga0496113_1451966 | 3300048916 | Bacteria | 530 |
| 958 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 959 | Ga0496114_0008849 | 3300048917 | Bacteria | 7979 |
| 960 | Ga0496114_0070615 | 3300048917 | Bacteria | 2934 |
| 961 | Ga0496114_0243025 | 3300048917 | Bacteria | 1583 |
| 962 | Ga0496114_0385840 | 3300048917 | Bacteria | 1240 |
| 963 | Ga0496114_0484440 | 3300048917 | Bacteria | 1094 |
| 964 | Ga0496114_0738916 | 3300048917 | Bacteria | 861 |
| 965 | Ga0496114_0747306 | 3300048917 | Bacteria | 855 |
| 966 | Ga0496114_1053735 | 3300048917 | Bacteria | 697 |
| 967 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 968 | Ga0496115_0000377 | 3300048918 | Bacteria | 36788 |
| 969 | Ga0496115_0014845 | 3300048918 | Bacteria | 5907 |
| 970 | Ga0496115_0058673 | 3300048918 | Bacteria | 3097 |
| 971 | Ga0496116_0000848 | 3300048919 | Bacteria | 38292 |
| 972 | Ga0496118_0081280 | 3300048921 | Bacteria | 2276 |
| 973 | Ga0496119_0006696 | 3300048922 | Bacteria | 10591 |
| 974 | Ga0496119_0074670 | 3300048922 | Bacteria | 1973 |
| 975 | Ga0496120_0020522 | 3300048923 | Bacteria | 4197 |
| 976 | Ga0496120_0201590 | 3300048923 | Bacteria | 963 |
| 977 | Ga0496120_0253122 | 3300048923 | Bacteria | 826 |
| 978 | Ga0496121_0019544 | 3300048924 | Bacteria | 6765 |
| 979 | Ga0496121_0037698 | 3300048924 | Bacteria | 4290 |
| 980 | Ga0496121_0061978 | 3300048924 | Bacteria | 3066 |
| 981 | Ga0496124_0051640 | 3300048927 | Bacteria | 3497 |
| 982 | Ga0496124_0854420 | 3300048927 | Bacteria | 557 |
| 983 | Ga0496125_0056109 | 3300048928 | Bacteria | 3202 |
| 984 | Ga0496125_0080795 | 3300048928 | Bacteria | 2486 |
| 985 | Ga0496125_0104445 | 3300048928 | Bacteria | 2075 |
| 986 | Ga0496126_0055061 | 3300048929 | Bacteria | 3600 |
| 987 | Ga0496126_0093953 | 3300048929 | Bacteria | 2632 |
| 988 | Ga0496126_0277289 | 3300048929 | Bacteria | 1390 |
| 989 | Ga0501031_0002175 | 3300049568 | Bacteria | 12379 |
| 990 | Ga0501031_0116828 | 3300049568 | Bacteria | 1743 |
| 991 | Ga0501031_0231236 | 3300049568 | Bacteria | 1203 |
| 992 | Ga0501032_0029241 | 3300049569 | Bacteria | 3783 |
| 993 | Ga0501032_1060851 | 3300049569 | Bacteria | 508 |
| 994 | Ga0501033_0003689 | 3300049570 | Bacteria | 12454 |
| 995 | Ga0501033_0600274 | 3300049570 | Bacteria | 755 |
| 996 | Ga0501034_0060242 | 3300049571 | Bacteria | 3813 |
| 997 | Ga0501034_0846348 | 3300049571 | Bacteria | 805 |
| 998 | Ga0501034_1296104 | 3300049571 | Bacteria | 605 |
| 999 | Ga0501036_0054251 | 3300049572 | Bacteria | 3394 |
| 1000 | Ga0501036_0472846 | 3300049572 | Bacteria | 1044 |
| 1001 | Ga0501036_0778303 | 3300049572 | Bacteria | 789 |
| 1002 | Ga0501036_0883511 | 3300049572 | Bacteria | 734 |
| 1003 | Ga0501037_0002926 | 3300049573 | Bacteria | 12385 |
| 1004 | Ga0501038_0005058 | 3300049574 | Bacteria | 12248 |
| 1005 | Ga0501038_0356257 | 3300049574 | Bacteria | 1139 |
| 1006 | Ga0501038_0506083 | 3300049574 | Bacteria | 923 |
| 1007 | Ga0501039_0136070 | 3300049575 | Bacteria | 1929 |
| 1008 | Ga0501039_0511325 | 3300049575 | Bacteria | 943 |
| 1009 | Ga0501040_0061674 | 3300049576 | Bacteria | 2579 |
| 1010 | Ga0501040_0310184 | 3300049576 | Bacteria | 1128 |
| 1011 | Ga0501040_0454371 | 3300049576 | Bacteria | 922 |
| 1012 | Ga0501040_0476131 | 3300049576 | Bacteria | 899 |
| 1013 | Ga0501040_0480873 | 3300049576 | Bacteria | 895 |
| 1014 | Ga0501041_0273970 | 3300049577 | Bacteria | 1062 |
| 1015 | Ga0501041_0444395 | 3300049577 | Bacteria | 823 |
| 1016 | Ga0501041_0489910 | 3300049577 | Bacteria | 782 |
| 1017 | Ga0501041_0599604 | 3300049577 | Bacteria | 703 |
| 1018 | Ga0501042_0012872 | 3300049578 | Bacteria | 5681 |
| 1019 | Ga0501042_0308826 | 3300049578 | Bacteria | 1143 |
| 1020 | Ga0501042_0578302 | 3300049578 | Bacteria | 817 |
| 1021 | Ga0501042_0648213 | 3300049578 | Bacteria | 768 |
| 1022 | Ga0501042_0783642 | 3300049578 | Bacteria | 694 |
| 1023 | Ga0501043_0012332 | 3300049579 | Bacteria | 6682 |
| 1024 | Ga0501043_0122982 | 3300049579 | Bacteria | 2035 |
| 1025 | Ga0501043_1334412 | 3300049579 | Bacteria | 500 |
| 1026 | Ga0501046_0004559 | 3300049580 | Bacteria | 12539 |
| 1027 | Ga0501046_0979029 | 3300049580 | Bacteria | 588 |
| 1028 | Ga0501047_0004952 | 3300049581 | Bacteria | 12510 |
| 1029 | Ga0501047_0036469 | 3300049581 | Bacteria | 4752 |
| 1030 | Ga0501047_0073899 | 3300049581 | Bacteria | 3282 |
| 1031 | Ga0501047_0239337 | 3300049581 | Bacteria | 1666 |
| 1032 | Ga0501047_0341399 | 3300049581 | Bacteria | 1335 |
| 1033 | Ga0501047_0439594 | 3300049581 | Bacteria | 1134 |
| 1034 | Ga0501047_0749317 | 3300049581 | Bacteria | 793 |
| 1035 | Ga0501047_1080050 | 3300049581 | Bacteria | 616 |
| 1036 | Ga0501048_0003128 | 3300049582 | Bacteria | 12640 |
| 1037 | Ga0501048_0806070 | 3300049582 | Bacteria | 675 |
| 1038 | Ga0501067_0058076 | 3300049583 | Bacteria | 2143 |
| 1039 | Ga0501067_0195064 | 3300049583 | Bacteria | 1128 |
| 1040 | Ga0501067_0479181 | 3300049583 | Bacteria | 696 |
| 1041 | Ga0501068_0002345 | 3300049584 | Bacteria | 10082 |
| 1042 | Ga0501068_0419741 | 3300049584 | Bacteria | 864 |
| 1043 | Ga0501068_0811080 | 3300049584 | Bacteria | 614 |
| 1044 | Ga0501069_0004919 | 3300049585 | Bacteria | 6926 |
| 1045 | Ga0501069_0076677 | 3300049585 | Bacteria | 1879 |
| 1046 | Ga0501069_0285522 | 3300049585 | Bacteria | 966 |
| 1047 | Ga0501069_0597746 | 3300049585 | Bacteria | 662 |
| 1048 | Ga0501069_0663541 | 3300049585 | Bacteria | 628 |
| 1049 | Ga0501070_0004064 | 3300049586 | Bacteria | 12575 |
| 1050 | Ga0501070_0052975 | 3300049586 | Bacteria | 3367 |
| 1051 | Ga0501070_0112042 | 3300049586 | Bacteria | 2255 |
| 1052 | Ga0501070_0285402 | 3300049586 | Bacteria | 1346 |
| 1053 | Ga0501070_0508727 | 3300049586 | Bacteria | 967 |
| 1054 | Ga0501070_0741122 | 3300049586 | Bacteria | 775 |
| 1055 | Ga0501071_0144925 | 3300049587 | Bacteria | 1770 |
| 1056 | Ga0501071_0581455 | 3300049587 | Bacteria | 861 |
| 1057 | Ga0501071_0760788 | 3300049587 | Bacteria | 746 |
| 1058 | Ga0501071_1248169 | 3300049587 | Bacteria | 574 |
| 1059 | Ga0501071_1492584 | 3300049587 | Bacteria | 522 |
| 1060 | Ga0501072_0017464 | 3300049588 | Bacteria | 5513 |
| 1061 | Ga0501072_0262480 | 3300049588 | Bacteria | 1375 |
| 1062 | Ga0501072_0420609 | 3300049588 | Bacteria | 1059 |
| 1063 | Ga0501072_0439029 | 3300049588 | Bacteria | 1034 |
| 1064 | Ga0501072_0484498 | 3300049588 | Bacteria | 978 |
| 1065 | Ga0501072_1025716 | 3300049588 | Bacteria | 643 |
| 1066 | Ga0501073_0013576 | 3300049589 | Bacteria | 5924 |
| 1067 | Ga0501073_0168325 | 3300049589 | Bacteria | 1517 |
| 1068 | Ga0501073_0923848 | 3300049589 | Bacteria | 601 |
| 1069 | Ga0501074_0013977 | 3300049590 | Bacteria | 5835 |
| 1070 | Ga0501074_0018921 | 3300049590 | Bacteria | 5002 |
| 1071 | Ga0501074_0119985 | 3300049590 | Bacteria | 1880 |
| 1072 | Ga0501074_1192026 | 3300049590 | Bacteria | 534 |
| 1073 | Ga0501075_0044891 | 3300049591 | Bacteria | 3315 |
| 1074 | Ga0501075_0197282 | 3300049591 | Bacteria | 1535 |
| 1075 | Ga0501075_0347161 | 3300049591 | Bacteria | 1131 |
| 1076 | Ga0501076_0165288 | 3300049592 | Bacteria | 1804 |
| 1077 | Ga0501076_0533234 | 3300049592 | Bacteria | 968 |
| 1078 | Ga0501076_0773037 | 3300049592 | Bacteria | 792 |
| 1079 | Ga0501076_1203947 | 3300049592 | Bacteria | 623 |
| 1080 | Ga0501077_0116673 | 3300049593 | Bacteria | 1692 |
| 1081 | Ga0501077_0163550 | 3300049593 | Bacteria | 1413 |
| 1082 | Ga0501077_0166667 | 3300049593 | Bacteria | 1399 |
| 1083 | Ga0501079_0012033 | 3300049741 | Bacteria | 6603 |
| 1084 | Ga0501079_0175584 | 3300049741 | Bacteria | 1671 |
| 1085 | Ga0501079_0355754 | 3300049741 | Bacteria | 1147 |
| 1086 | Ga0501080_0015300 | 3300049742 | Bacteria | 7073 |
| 1087 | Ga0501080_0030783 | 3300049742 | Bacteria | 5000 |
| 1088 | Ga0501080_1744556 | 3300049742 | Bacteria | 524 |
| 1089 | Ga0501081_0261497 | 3300049743 | Bacteria | 1265 |
| 1090 | Ga0501081_0458392 | 3300049743 | Bacteria | 948 |
| 1091 | Ga0501083_0002614 | 3300049744 | Bacteria | 12402 |
| 1092 | Ga0501083_0080795 | 3300049744 | Bacteria | 2155 |
| 1093 | Ga0501083_0533664 | 3300049744 | Bacteria | 764 |
| 1094 | Ga0501083_0845170 | 3300049744 | Bacteria | 596 |
| 1095 | Ga0501035_0005116 | 3300049822 | Bacteria | 12420 |
| 1096 | Ga0501035_0137851 | 3300049822 | Bacteria | 2123 |
| 1097 | Ga0501044_0006919 | 3300049823 | Bacteria | 12483 |
| 1098 | Ga0501044_0128972 | 3300049823 | Bacteria | 2524 |
| 1099 | Ga0501044_0193833 | 3300049823 | Bacteria | 1993 |
| 1100 | Ga0501044_0478439 | 3300049823 | Bacteria | 1149 |
| 1101 | Ga0501044_0541717 | 3300049823 | Bacteria | 1062 |
| 1102 | Ga0501045_0388877 | 3300049824 | Bacteria | 1038 |
| 1103 | Ga0501045_0447533 | 3300049824 | Bacteria | 960 |
| 1104 | Ga0501045_0473108 | 3300049824 | Bacteria | 931 |
| 1105 | Ga0501045_0842390 | 3300049824 | Bacteria | 675 |
| 1106 | nmdc:mga03n38_49138_c1 | 3300050490 | Bacteria | 1874 |
| 1107 | nmdc:mga03n38_617731_c1 | 3300050490 | Bacteria | 619 |
| 1108 | nmdc:mga00v17_156003_c1 | 3300050491 | Bacteria | 1468 |
| 1109 | nmdc:mga00v17_16288_c1 | 3300050491 | Bacteria | 4191 |
| 1110 | nmdc:mga00v17_224122_c1 | 3300050491 | Bacteria | 1218 |
| 1111 | nmdc:mga00v17_466076_c1 | 3300050491 | Bacteria | 820 |
| 1112 | nmdc:mga00v17_779565_c1 | 3300050491 | Unclassified | 610 |
| 1113 | nmdc:mga00v17_888749_c1 | 3300050491 | Bacteria | 564 |
| 1114 | nmdc:mga00v17_920239_c1 | 3300050491 | Bacteria | 553 |
| 1115 | nmdc:mga00v17_964283_c1 | 3300050491 | Bacteria | 538 |
| 1116 | nmdc:mga0yw44_127432_c1 | 3300050492 | Bacteria | 1645 |
| 1117 | nmdc:mga0yw44_362973_c1 | 3300050492 | Bacteria | 976 |
| 1118 | nmdc:mga0yw44_37019_c1 | 3300050492 | Bacteria | 2120 |
| 1119 | nmdc:mga0yw44_589_c1 | 3300050492 | Bacteria | 13169 |
| 1120 | nmdc:mga0yw44_675_c1 | 3300050492 | Bacteria | 12442 |
| 1121 | nmdc:mga0yw44_8725_c1 | 3300050492 | Bacteria | 5071 |
| 1122 | nmdc:mga0yw44_939551_c1 | 3300050492 | Bacteria | 586 |
| 1123 | nmdc:mga06z11_94621_c1 | 3300050494 | Bacteria | 1628 |
| 1124 | nmdc:mga04h51_373446_c1 | 3300050495 | Bacteria | 593 |
| 1125 | nmdc:mga05p37_104196_c1 | 3300050507 | Bacteria | 3490 |
| 1126 | nmdc:mga05p37_264955_c1 | 3300050507 | Bacteria | 2055 |
| 1127 | nmdc:mga05p37_265689_c1 | 3300050507 | Bacteria | 2052 |
| 1128 | nmdc:mga05p37_573885_c1 | 3300050507 | Bacteria | 1279 |
| 1129 | nmdc:mga09592_791912_c1 | 3300050508 | Bacteria | 802 |
| 1130 | nmdc:mga0qj67_429735_c1 | 3300050509 | Bacteria | 1064 |
| 1131 | nmdc:mga0qj67_901433_c1 | 3300050509 | Bacteria | 697 |
| 1132 | nmdc:mga06r32_1039450_c1 | 3300050510 | Unclassified | 770 |
| 1133 | nmdc:mga06r32_1149952_c1 | 3300050510 | Bacteria | 724 |
| 1134 | nmdc:mga06r32_232932_c1 | 3300050510 | Bacteria | 1830 |
| 1135 | nmdc:mga06r32_274139_c1 | 3300050510 | Bacteria | 1674 |
| 1136 | nmdc:mga06r32_30761_c1 | 3300050510 | Bacteria | 5038 |
| 1137 | nmdc:mga08y16_1082708_c1 | 3300050511 | Bacteria | 777 |
| 1138 | nmdc:mga08y16_18776_c1 | 3300050511 | Bacteria | 7284 |
| 1139 | nmdc:mga08y16_216105_c1 | 3300050511 | Bacteria | 1985 |
| 1140 | nmdc:mga08y16_53460_c1 | 3300050511 | Bacteria | 4223 |
| 1141 | nmdc:mga0n895_11763_c1 | 3300050512 | Bacteria | 7823 |
| 1142 | nmdc:mga0n895_257834_c1 | 3300050512 | Bacteria | 1770 |
| 1143 | nmdc:mga0n895_960240_c1 | 3300050512 | Bacteria | 838 |
| 1144 | nmdc:mga0rr50_1504144_c1 | 3300050513 | Bacteria | 569 |
| 1145 | nmdc:mga0rr50_493066_c1 | 3300050513 | Bacteria | 1041 |
| 1146 | nmdc:mga0rr50_52783_c1 | 3300050513 | Bacteria | 3022 |
| 1147 | nmdc:mga08x19_127889_c1 | 3300050514 | Bacteria | 1707 |
| 1148 | nmdc:mga08x19_591136_c1 | 3300050514 | Bacteria | 786 |
| 1149 | nmdc:mga0a205_1200945_c1 | 3300050515 | Bacteria | 606 |
| 1150 | nmdc:mga0a205_15449_c1 | 3300050515 | Bacteria | 7136 |
| 1151 | nmdc:mga0a205_162660_c1 | 3300050515 | Bacteria | 2128 |
| 1152 | nmdc:mga0a205_53_c2 | 3300050515 | Bacteria | 54696 |
| 1153 | Ga0495601_0000060 | 3300053077 | Bacteria | 60600 |
| 1154 | Ga0495601_0029935 | 3300053077 | Bacteria | 3380 |
| 1155 | Ga0495601_0059708 | 3300053077 | Bacteria | 2419 |
| 1156 | Ga0495601_0080854 | 3300053077 | Bacteria | 2085 |
| 1157 | Ga0495601_0190542 | 3300053077 | Bacteria | 1340 |
| 1158 | Ga0495601_0380882 | 3300053077 | Bacteria | 916 |
| 1159 | Ga0495612_0000210 | 3300053078 | Bacteria | 24800 |
| 1160 | Ga0495612_0003362 | 3300053078 | Bacteria | 6629 |
| 1161 | Ga0495612_0003484 | 3300053078 | Bacteria | 6518 |
| 1162 | Ga0495612_0038634 | 3300053078 | Bacteria | 1940 |
| 1163 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 1164 | Ga0495655_0117794 | 3300053083 | Bacteria | 805 |
| 1165 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 1166 | Ga0495595_0000045 | 3300053084 | Bacteria | 63054 |
| 1167 | Ga0495595_0335600 | 3300053084 | Bacteria | 762 |
| 1168 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 1169 | Ga0495619_0000095 | 3300053085 | Bacteria | 66204 |
| 1170 | Ga0495619_0000102 | 3300053085 | Bacteria | 64345 |
| 1171 | Ga0495619_0000155 | 3300053085 | Bacteria | 50682 |
| 1172 | Ga0495619_0000320 | 3300053085 | Bacteria | 33623 |
| 1173 | Ga0495619_0006754 | 3300053085 | Bacteria | 7259 |
| 1174 | Ga0495619_0036802 | 3300053085 | Bacteria | 3188 |
| 1175 | Ga0495619_0058401 | 3300053085 | Bacteria | 2561 |
| 1176 | Ga0495619_0967005 | 3300053085 | Bacteria | 571 |
| 1177 | Ga0500566_0001093 | 3300053094 | Bacteria | 15689 |
| 1178 | Ga0500566_0264729 | 3300053094 | Bacteria | 828 |
| 1179 | Ga0500595_040810 | 3300053119 | Bacteria | 1494 |
| 1180 | Ga0500595_061022 | 3300053119 | Bacteria | 1139 |
| 1181 | Ga0500614_001424 | 3300053123 | Bacteria | 5734 |
| 1182 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 1183 | Ga0501084_0110493 | 3300054114 | Bacteria | 2310 |
| 1184 | Ga0501084_0141490 | 3300054114 | Bacteria | 2026 |
| 1185 | Ga0501084_0163151 | 3300054114 | Bacteria | 1880 |
| 1186 | Ga0501084_0382295 | 3300054114 | Bacteria | 1190 |
| 1187 | Ga0501084_0905945 | 3300054114 | Bacteria | 742 |
| 1188 | Ga0501084_1058013 | 3300054114 | Bacteria | 682 |
| 1189 | Ga0501084_1404693 | 3300054114 | Bacteria | 585 |
| 1190 | Ga0501084_1598320 | 3300054114 | Bacteria | 545 |
| 1191 | Ga0501082_0044987 | 3300060353 | Bacteria | 3807 |
| 1192 | Ga0501082_0857311 | 3300060353 | Bacteria | 795 |
| 1193 | Ga0501082_1323183 | 3300060353 | Bacteria | 629 |
| 1194 | Ga0530510_0020050 | 3300061734 | Bacteria | 4754 |
| 1195 | Ga0530510_0473044 | 3300061734 | Bacteria | 949 |
| 1196 | Ga0530510_0789843 | 3300061734 | Bacteria | 724 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005535 | Ga0070684_102064302 | Ga0070684_1020643021 | 83 |
| 2 | 3300005577 | Ga0068857_102037281 | Ga0068857_1020372812 | 83 |
| 3 | 3300006051 | Ga0075364_10143462 | Ga0075364_101434622 | 83 |
| 4 | 3300006051 | Ga0075364_11111047 | Ga0075364_111110471 | 83 |
| 5 | 3300006178 | Ga0075367_10328756 | Ga0075367_103287562 | 83 |
| 6 | 3300026116 | Ga0207674_11638187 | Ga0207674_116381871 | 83 |
| 7 | 3300031548 | Ga0307408_100120691 | Ga0307408_1001206912 | 83 |
| 8 | 3300031901 | Ga0307406_10646326 | Ga0307406_106463262 | 83 |
| 9 | 3300031995 | Ga0307409_100481919 | Ga0307409_1004819192 | 83 |
| 10 | 3300032002 | Ga0307416_101892543 | Ga0307416_1018925431 | 83 |
| 11 | 3300032005 | Ga0307411_11610405 | Ga0307411_116104051 | 83 |
| 12 | 3300042125 | Ga0450923_189473 | Ga0450923_189473_130_402 | 83 |
| 13 | 3300042145 | Ga0450906_106260 | Ga0450906_106260_218_490 | 83 |
| 14 | 3300050491 | nmdc:mga00v17_224122_c1 | nmdc:mga00v17_224122_c1_709_984 | 83 |
| 15 | 3300050491 | nmdc:mga00v17_466076_c1 | nmdc:mga00v17_466076_c1_215_490 | 83 |
| 16 | 3300050492 | nmdc:mga0yw44_127432_c1 | nmdc:mga0yw44_127432_c1_327_602 | 83 |
| 17 | 3300050494 | nmdc:mga06z11_94621_c1 | nmdc:mga06z11_94621_c1_1269_1544 | 83 |
| 18 | 3300005544 | Ga0070686_100312424 | Ga0070686_1003124242 | 84 |
| 19 | 3300005548 | Ga0070665_100452207 | Ga0070665_1004522072 | 84 |
| 20 | 3300005719 | Ga0068861_102113983 | Ga0068861_1021139832 | 84 |
| 21 | 3300006048 | Ga0075363_100125268 | Ga0075363_1001252682 | 84 |
| 22 | 3300006051 | Ga0075364_10926558 | Ga0075364_109265582 | 84 |
| 23 | 3300006178 | Ga0075367_10570243 | Ga0075367_105702432 | 84 |
| 24 | 3300009176 | Ga0105242_12122077 | Ga0105242_121220772 | 84 |
| 25 | 3300025934 | Ga0207686_10320029 | Ga0207686_103200292 | 84 |
| 26 | 3300025937 | Ga0207669_10648256 | Ga0207669_106482562 | 84 |
| 27 | 3300026121 | Ga0207683_10309590 | Ga0207683_103095902 | 84 |
| 28 | 3300048905 | Ga0496102_0235659 | Ga0496102_0235659_969_1241 | 84 |
| 29 | 3300050490 | nmdc:mga03n38_49138_c1 | nmdc:mga03n38_49138_c1_571_843 | 84 |
| 30 | 3300050491 | nmdc:mga00v17_779565_c1 | nmdc:mga00v17_779565_c1_82_354 | 84 |
| 31 | 3300001977 | JGI24746J21847_1054991 | JGI24746J21847_10549911 | 90 |
| 32 | 3300001990 | JGI24737J22298_10099373 | JGI24737J22298_100993732 | 90 |
| 33 | 3300001991 | JGI24743J22301_10042465 | JGI24743J22301_100424652 | 90 |
| 34 | 3300002067 | JGI24735J21928_10170162 | JGI24735J21928_101701622 | 90 |
| 35 | 3300002075 | JGI24738J21930_10009312 | JGI24738J21930_100093123 | 90 |
| 36 | 3300002075 | JGI24738J21930_10086603 | JGI24738J21930_100866031 | 90 |
| 37 | 3300002077 | JGI24744J21845_10016965 | JGI24744J21845_100169651 | 90 |
| 38 | 3300002244 | JGI24742J22300_10043580 | JGI24742J22300_100435802 | 90 |
| 39 | 3300002459 | JGI24751J29686_10066098 | JGI24751J29686_100660982 | 90 |
| 40 | 3300005327 | Ga0070658_10102750 | Ga0070658_101027503 | 90 |
| 41 | 3300005327 | Ga0070658_10351889 | Ga0070658_103518892 | 90 |
| 42 | 3300005327 | Ga0070658_10821046 | Ga0070658_108210462 | 90 |
| 43 | 3300005328 | Ga0070676_10068455 | Ga0070676_100684553 | 90 |
| 44 | 3300005328 | Ga0070676_10699340 | Ga0070676_106993402 | 90 |
| 45 | 3300005329 | Ga0070683_100000404 | Ga0070683_10000040419 | 90 |
| 46 | 3300005329 | Ga0070683_100019785 | Ga0070683_1000197854 | 90 |
| 47 | 3300005329 | Ga0070683_100023077 | Ga0070683_1000230774 | 90 |
| 48 | 3300005329 | Ga0070683_100117182 | Ga0070683_1001171823 | 90 |
| 49 | 3300005333 | Ga0070677_10000008 | Ga0070677_1000000875 | 90 |
| 50 | 3300005334 | Ga0068869_100104382 | Ga0068869_1001043823 | 90 |
| 51 | 3300005335 | Ga0070666_10327087 | Ga0070666_103270871 | 90 |
| 52 | 3300005336 | Ga0070680_100185990 | Ga0070680_1001859902 | 90 |
| 53 | 3300005336 | Ga0070680_100310840 | Ga0070680_1003108401 | 90 |
| 54 | 3300005337 | Ga0070682_100000075 | Ga0070682_1000000753 | 90 |
| 55 | 3300005337 | Ga0070682_100000090 | Ga0070682_1000000903 | 90 |
| 56 | 3300005337 | Ga0070682_100008571 | Ga0070682_1000085716 | 90 |
| 57 | 3300005337 | Ga0070682_100048176 | Ga0070682_1000481762 | 90 |
| 58 | 3300005337 | Ga0070682_101289527 | Ga0070682_1012895272 | 90 |
| 59 | 3300005338 | Ga0068868_100000141 | Ga0068868_10000014141 | 90 |
| 60 | 3300005338 | Ga0068868_100002016 | Ga0068868_10000201613 | 90 |
| 61 | 3300005338 | Ga0068868_100013799 | Ga0068868_1000137995 | 90 |
| 62 | 3300005338 | Ga0068868_100018130 | Ga0068868_1000181303 | 90 |
| 63 | 3300005338 | Ga0068868_100021155 | Ga0068868_1000211555 | 90 |
| 64 | 3300005338 | Ga0068868_100552551 | Ga0068868_1005525512 | 90 |
| 65 | 3300005339 | Ga0070660_100044786 | Ga0070660_1000447863 | 90 |
| 66 | 3300005339 | Ga0070660_100889625 | Ga0070660_1008896252 | 90 |
| 67 | 3300005340 | Ga0070689_100071687 | Ga0070689_1000716873 | 90 |
| 68 | 3300005340 | Ga0070689_100079065 | Ga0070689_1000790653 | 90 |
| 69 | 3300005340 | Ga0070689_100096525 | Ga0070689_1000965252 | 90 |
| 70 | 3300005340 | Ga0070689_100141479 | Ga0070689_1001414792 | 90 |
| 71 | 3300005340 | Ga0070689_100174120 | Ga0070689_1001741203 | 90 |
| 72 | 3300005341 | Ga0070691_10000044 | Ga0070691_1000004410 | 90 |
| 73 | 3300005341 | Ga0070691_10005099 | Ga0070691_100050992 | 90 |
| 74 | 3300005341 | Ga0070691_10054340 | Ga0070691_100543403 | 90 |
| 75 | 3300005341 | Ga0070691_10318388 | Ga0070691_103183882 | 90 |
| 76 | 3300005341 | Ga0070691_10519651 | Ga0070691_105196511 | 90 |
| 77 | 3300005341 | Ga0070691_10551001 | Ga0070691_105510012 | 90 |
| 78 | 3300005343 | Ga0070687_100024909 | Ga0070687_1000249094 | 90 |
| 79 | 3300005343 | Ga0070687_100876966 | Ga0070687_1008769661 | 90 |
| 80 | 3300005344 | Ga0070661_100000099 | Ga0070661_10000009911 | 90 |
| 81 | 3300005344 | Ga0070661_100070438 | Ga0070661_1000704382 | 90 |
| 82 | 3300005344 | Ga0070661_100611646 | Ga0070661_1006116462 | 90 |
| 83 | 3300005344 | Ga0070661_101199562 | Ga0070661_1011995622 | 90 |
| 84 | 3300005345 | Ga0070692_10007789 | Ga0070692_100077896 | 90 |
| 85 | 3300005345 | Ga0070692_10205169 | Ga0070692_102051691 | 90 |
| 86 | 3300005347 | Ga0070668_100014733 | Ga0070668_1000147336 | 90 |
| 87 | 3300005347 | Ga0070668_100065770 | Ga0070668_1000657702 | 90 |
| 88 | 3300005347 | Ga0070668_100544309 | Ga0070668_1005443092 | 90 |
| 89 | 3300005347 | Ga0070668_101311660 | Ga0070668_1013116601 | 90 |
| 90 | 3300005353 | Ga0070669_100278458 | Ga0070669_1002784582 | 90 |
| 91 | 3300005354 | Ga0070675_100000036 | Ga0070675_10000003673 | 90 |
| 92 | 3300005354 | Ga0070675_100044837 | Ga0070675_1000448373 | 90 |
| 93 | 3300005354 | Ga0070675_100676630 | Ga0070675_1006766302 | 90 |
| 94 | 3300005355 | Ga0070671_100035755 | Ga0070671_1000357554 | 90 |
| 95 | 3300005355 | Ga0070671_100895212 | Ga0070671_1008952122 | 90 |
| 96 | 3300005356 | Ga0070674_100000012 | Ga0070674_10000001234 | 90 |
| 97 | 3300005356 | Ga0070674_100012173 | Ga0070674_1000121732 | 90 |
| 98 | 3300005364 | Ga0070673_100006402 | Ga0070673_1000064027 | 90 |
| 99 | 3300005364 | Ga0070673_100041907 | Ga0070673_1000419073 | 90 |
| 100 | 3300005364 | Ga0070673_100112144 | Ga0070673_1001121442 | 90 |
| 101 | 3300005364 | Ga0070673_101879545 | Ga0070673_1018795452 | 90 |
| 102 | 3300005365 | Ga0070688_100001169 | Ga0070688_1000011693 | 90 |
| 103 | 3300005365 | Ga0070688_100004292 | Ga0070688_10000429210 | 90 |
| 104 | 3300005365 | Ga0070688_100266693 | Ga0070688_1002666932 | 90 |
| 105 | 3300005365 | Ga0070688_100333987 | Ga0070688_1003339872 | 90 |
| 106 | 3300005365 | Ga0070688_100350515 | Ga0070688_1003505152 | 90 |
| 107 | 3300005366 | Ga0070659_100007424 | Ga0070659_1000074245 | 90 |
| 108 | 3300005366 | Ga0070659_100086823 | Ga0070659_1000868235 | 90 |
| 109 | 3300005367 | Ga0070667_100061212 | Ga0070667_1000612122 | 90 |
| 110 | 3300005367 | Ga0070667_100155517 | Ga0070667_1001555172 | 90 |
| 111 | 3300005367 | Ga0070667_100304295 | Ga0070667_1003042952 | 90 |
| 112 | 3300005367 | Ga0070667_100567593 | Ga0070667_1005675932 | 90 |
| 113 | 3300005434 | Ga0070709_10109003 | Ga0070709_101090032 | 90 |
| 114 | 3300005435 | Ga0070714_100443749 | Ga0070714_1004437492 | 90 |
| 115 | 3300005436 | Ga0070713_100000380 | Ga0070713_1000003804 | 90 |
| 116 | 3300005438 | Ga0070701_10039651 | Ga0070701_100396513 | 90 |
| 117 | 3300005438 | Ga0070701_10433121 | Ga0070701_104331212 | 90 |
| 118 | 3300005438 | Ga0070701_11076225 | Ga0070701_110762252 | 90 |
| 119 | 3300005439 | Ga0070711_100007421 | Ga0070711_1000074215 | 90 |
| 120 | 3300005439 | Ga0070711_100216272 | Ga0070711_1002162722 | 90 |
| 121 | 3300005440 | Ga0070705_100347488 | Ga0070705_1003474881 | 90 |
| 122 | 3300005440 | Ga0070705_100892697 | Ga0070705_1008926972 | 90 |
| 123 | 3300005441 | Ga0070700_100005895 | Ga0070700_1000058956 | 90 |
| 124 | 3300005441 | Ga0070700_100019529 | Ga0070700_1000195293 | 90 |
| 125 | 3300005441 | Ga0070700_100659798 | Ga0070700_1006597981 | 90 |
| 126 | 3300005441 | Ga0070700_100792305 | Ga0070700_1007923051 | 90 |
| 127 | 3300005444 | Ga0070694_100207046 | Ga0070694_1002070462 | 90 |
| 128 | 3300005444 | Ga0070694_100428926 | Ga0070694_1004289263 | 90 |
| 129 | 3300005445 | Ga0070708_100236107 | Ga0070708_1002361072 | 90 |
| 130 | 3300005445 | Ga0070708_100342446 | Ga0070708_1003424462 | 90 |
| 131 | 3300005455 | Ga0070663_100001224 | Ga0070663_10000122416 | 90 |
| 132 | 3300005455 | Ga0070663_100022099 | Ga0070663_1000220994 | 90 |
| 133 | 3300005455 | Ga0070663_100064230 | Ga0070663_1000642304 | 90 |
| 134 | 3300005455 | Ga0070663_101584565 | Ga0070663_1015845652 | 90 |
| 135 | 3300005455 | Ga0070663_101951450 | Ga0070663_1019514501 | 90 |
| 136 | 3300005456 | Ga0070678_100022682 | Ga0070678_1000226826 | 90 |
| 137 | 3300005456 | Ga0070678_100026672 | Ga0070678_1000266725 | 90 |
| 138 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002229 | 90 |
| 139 | 3300005457 | Ga0070662_100040712 | Ga0070662_1000407122 | 90 |
| 140 | 3300005458 | Ga0070681_10306669 | Ga0070681_103066692 | 90 |
| 141 | 3300005458 | Ga0070681_10691882 | Ga0070681_106918822 | 90 |
| 142 | 3300005459 | Ga0068867_100005480 | Ga0068867_1000054809 | 90 |
| 143 | 3300005459 | Ga0068867_100057996 | Ga0068867_1000579962 | 90 |
| 144 | 3300005459 | Ga0068867_100386900 | Ga0068867_1003869002 | 90 |
| 145 | 3300005459 | Ga0068867_100922860 | Ga0068867_1009228601 | 90 |
| 146 | 3300005466 | Ga0070685_10000020 | Ga0070685_1000002076 | 90 |
| 147 | 3300005466 | Ga0070685_10000674 | Ga0070685_100006749 | 90 |
| 148 | 3300005466 | Ga0070685_10015073 | Ga0070685_100150732 | 90 |
| 149 | 3300005466 | Ga0070685_10049549 | Ga0070685_100495492 | 90 |
| 150 | 3300005466 | Ga0070685_10227841 | Ga0070685_102278412 | 90 |
| 151 | 3300005466 | Ga0070685_10362624 | Ga0070685_103626242 | 90 |
| 152 | 3300005530 | Ga0070679_100000369 | Ga0070679_10000036936 | 90 |
| 153 | 3300005530 | Ga0070679_102022938 | Ga0070679_1020229381 | 90 |
| 154 | 3300005535 | Ga0070684_100014210 | Ga0070684_1000142105 | 90 |
| 155 | 3300005535 | Ga0070684_100043406 | Ga0070684_1000434062 | 90 |
| 156 | 3300005535 | Ga0070684_100052595 | Ga0070684_1000525952 | 90 |
| 157 | 3300005535 | Ga0070684_100068987 | Ga0070684_1000689873 | 90 |
| 158 | 3300005535 | Ga0070684_100245100 | Ga0070684_1002451002 | 90 |
| 159 | 3300005535 | Ga0070684_100259847 | Ga0070684_1002598472 | 90 |
| 160 | 3300005535 | Ga0070684_100664192 | Ga0070684_1006641922 | 90 |
| 161 | 3300005539 | Ga0068853_100041279 | Ga0068853_1000412792 | 90 |
| 162 | 3300005539 | Ga0068853_100078899 | Ga0068853_1000788992 | 90 |
| 163 | 3300005539 | Ga0068853_100118729 | Ga0068853_1001187292 | 90 |
| 164 | 3300005539 | Ga0068853_100156211 | Ga0068853_1001562112 | 90 |
| 165 | 3300005539 | Ga0068853_101702993 | Ga0068853_1017029932 | 90 |
| 166 | 3300005543 | Ga0070672_100004196 | Ga0070672_1000041966 | 90 |
| 167 | 3300005544 | Ga0070686_100020467 | Ga0070686_1000204672 | 90 |
| 168 | 3300005544 | Ga0070686_100254198 | Ga0070686_1002541981 | 90 |
| 169 | 3300005545 | Ga0070695_100067435 | Ga0070695_1000674353 | 90 |
| 170 | 3300005545 | Ga0070695_101840612 | Ga0070695_1018406122 | 90 |
| 171 | 3300005546 | Ga0070696_101977451 | Ga0070696_1019774511 | 90 |
| 172 | 3300005547 | Ga0070693_100003731 | Ga0070693_1000037317 | 90 |
| 173 | 3300005547 | Ga0070693_100137476 | Ga0070693_1001374762 | 90 |
| 174 | 3300005547 | Ga0070693_100885293 | Ga0070693_1008852931 | 90 |
| 175 | 3300005548 | Ga0070665_100000135 | Ga0070665_10000013523 | 90 |
| 176 | 3300005548 | Ga0070665_100132532 | Ga0070665_1001325323 | 90 |
| 177 | 3300005548 | Ga0070665_101265781 | Ga0070665_1012657812 | 90 |
| 178 | 3300005549 | Ga0070704_100025392 | Ga0070704_1000253922 | 90 |
| 179 | 3300005549 | Ga0070704_100115774 | Ga0070704_1001157743 | 90 |
| 180 | 3300005549 | Ga0070704_100426534 | Ga0070704_1004265342 | 90 |
| 181 | 3300005549 | Ga0070704_100821048 | Ga0070704_1008210481 | 90 |
| 182 | 3300005563 | Ga0068855_101242488 | Ga0068855_1012424882 | 90 |
| 183 | 3300005564 | Ga0070664_100013275 | Ga0070664_1000132756 | 90 |
| 184 | 3300005564 | Ga0070664_100015019 | Ga0070664_1000150195 | 90 |
| 185 | 3300005564 | Ga0070664_100058703 | Ga0070664_1000587031 | 90 |
| 186 | 3300005564 | Ga0070664_100423367 | Ga0070664_1004233672 | 90 |
| 187 | 3300005564 | Ga0070664_101751829 | Ga0070664_1017518292 | 90 |
| 188 | 3300005577 | Ga0068857_100079624 | Ga0068857_1000796243 | 90 |
| 189 | 3300005577 | Ga0068857_100142811 | Ga0068857_1001428112 | 90 |
| 190 | 3300005578 | Ga0068854_100059914 | Ga0068854_1000599143 | 90 |
| 191 | 3300005578 | Ga0068854_100100662 | Ga0068854_1001006622 | 90 |
| 192 | 3300005614 | Ga0068856_100004032 | Ga0068856_1000040324 | 90 |
| 193 | 3300005614 | Ga0068856_100013553 | Ga0068856_1000135533 | 90 |
| 194 | 3300005614 | Ga0068856_100026571 | Ga0068856_1000265713 | 90 |
| 195 | 3300005614 | Ga0068856_100089785 | Ga0068856_1000897852 | 90 |
| 196 | 3300005614 | Ga0068856_100589393 | Ga0068856_1005893932 | 90 |
| 197 | 3300005614 | Ga0068856_100877220 | Ga0068856_1008772202 | 90 |
| 198 | 3300005615 | Ga0070702_100021516 | Ga0070702_1000215164 | 90 |
| 199 | 3300005615 | Ga0070702_100082916 | Ga0070702_1000829162 | 90 |
| 200 | 3300005615 | Ga0070702_100114120 | Ga0070702_1001141202 | 90 |
| 201 | 3300005615 | Ga0070702_100430538 | Ga0070702_1004305382 | 90 |
| 202 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002249 | 90 |
| 203 | 3300005616 | Ga0068852_100014610 | Ga0068852_1000146107 | 90 |
| 204 | 3300005616 | Ga0068852_100283099 | Ga0068852_1002830992 | 90 |
| 205 | 3300005616 | Ga0068852_102542207 | Ga0068852_1025422071 | 90 |
| 206 | 3300005617 | Ga0068859_100058409 | Ga0068859_1000584092 | 90 |
| 207 | 3300005617 | Ga0068859_100864297 | Ga0068859_1008642972 | 90 |
| 208 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015199 | 90 |
| 209 | 3300005618 | Ga0068864_100043739 | Ga0068864_1000437394 | 90 |
| 210 | 3300005618 | Ga0068864_100317711 | Ga0068864_1003177112 | 90 |
| 211 | 3300005718 | Ga0068866_10002177 | Ga0068866_100021773 | 90 |
| 212 | 3300005718 | Ga0068866_10122127 | Ga0068866_101221272 | 90 |
| 213 | 3300005718 | Ga0068866_10150533 | Ga0068866_101505333 | 90 |
| 214 | 3300005719 | Ga0068861_100053456 | Ga0068861_1000534564 | 90 |
| 215 | 3300005719 | Ga0068861_100381342 | Ga0068861_1003813422 | 90 |
| 216 | 3300005719 | Ga0068861_101538303 | Ga0068861_1015383031 | 90 |
| 217 | 3300005719 | Ga0068861_101667362 | Ga0068861_1016673621 | 90 |
| 218 | 3300005834 | Ga0068851_10001260 | Ga0068851_100012604 | 90 |
| 219 | 3300005834 | Ga0068851_10058940 | Ga0068851_100589402 | 90 |
| 220 | 3300005834 | Ga0068851_10186485 | Ga0068851_101864852 | 90 |
| 221 | 3300005840 | Ga0068870_10591646 | Ga0068870_105916462 | 90 |
| 222 | 3300005840 | Ga0068870_10920843 | Ga0068870_109208432 | 90 |
| 223 | 3300005841 | Ga0068863_100000022 | Ga0068863_10000002271 | 90 |
| 224 | 3300005841 | Ga0068863_100181164 | Ga0068863_1001811642 | 90 |
| 225 | 3300005841 | Ga0068863_100295132 | Ga0068863_1002951322 | 90 |
| 226 | 3300005841 | Ga0068863_100537618 | Ga0068863_1005376182 | 90 |
| 227 | 3300005841 | Ga0068863_100832664 | Ga0068863_1008326642 | 90 |
| 228 | 3300005841 | Ga0068863_101785515 | Ga0068863_1017855151 | 90 |
| 229 | 3300005842 | Ga0068858_100000075 | Ga0068858_1000000753 | 90 |
| 230 | 3300005842 | Ga0068858_100004559 | Ga0068858_10000455915 | 90 |
| 231 | 3300005842 | Ga0068858_100065398 | Ga0068858_1000653983 | 90 |
| 232 | 3300005842 | Ga0068858_100492936 | Ga0068858_1004929362 | 90 |
| 233 | 3300005842 | Ga0068858_100723347 | Ga0068858_1007233472 | 90 |
| 234 | 3300005843 | Ga0068860_100072334 | Ga0068860_1000723344 | 90 |
| 235 | 3300005843 | Ga0068860_101003527 | Ga0068860_1010035272 | 90 |
| 236 | 3300005844 | Ga0068862_100106806 | Ga0068862_1001068061 | 90 |
| 237 | 3300005844 | Ga0068862_100624784 | Ga0068862_1006247842 | 90 |
| 238 | 3300005844 | Ga0068862_100716797 | Ga0068862_1007167972 | 90 |
| 239 | 3300005844 | Ga0068862_101508091 | Ga0068862_1015080912 | 90 |
| 240 | 3300005937 | Ga0081455_10052507 | Ga0081455_100525075 | 90 |
| 241 | 3300005937 | Ga0081455_10125997 | Ga0081455_101259972 | 90 |
| 242 | 3300005937 | Ga0081455_10133876 | Ga0081455_101338762 | 90 |
| 243 | 3300005937 | Ga0081455_10292207 | Ga0081455_102922073 | 90 |
| 244 | 3300005937 | Ga0081455_10721037 | Ga0081455_107210372 | 90 |
| 245 | 3300005981 | Ga0081538_10000141 | Ga0081538_100001413 | 90 |
| 246 | 3300005981 | Ga0081538_10015536 | Ga0081538_1001553611 | 90 |
| 247 | 3300005983 | Ga0081540_1069557 | Ga0081540_10695572 | 90 |
| 248 | 3300005983 | Ga0081540_1193796 | Ga0081540_11937962 | 90 |
| 249 | 3300006038 | Ga0075365_10000322 | Ga0075365_100003226 | 90 |
| 250 | 3300006038 | Ga0075365_10002366 | Ga0075365_100023664 | 90 |
| 251 | 3300006038 | Ga0075365_10004204 | Ga0075365_100042043 | 90 |
| 252 | 3300006038 | Ga0075365_10289833 | Ga0075365_102898332 | 90 |
| 253 | 3300006042 | Ga0075368_10214180 | Ga0075368_102141802 | 90 |
| 254 | 3300006042 | Ga0075368_10585306 | Ga0075368_105853061 | 90 |
| 255 | 3300006048 | Ga0075363_100000848 | Ga0075363_1000008482 | 90 |
| 256 | 3300006048 | Ga0075363_100026606 | Ga0075363_1000266063 | 90 |
| 257 | 3300006051 | Ga0075364_10177770 | Ga0075364_101777703 | 90 |
| 258 | 3300006051 | Ga0075364_10590860 | Ga0075364_105908602 | 90 |
| 259 | 3300006051 | Ga0075364_10978372 | Ga0075364_109783721 | 90 |
| 260 | 3300006058 | Ga0075432_10607487 | Ga0075432_106074871 | 90 |
| 261 | 3300006163 | Ga0070715_10018094 | Ga0070715_100180943 | 90 |
| 262 | 3300006173 | Ga0070716_100023581 | Ga0070716_1000235811 | 90 |
| 263 | 3300006173 | Ga0070716_101146135 | Ga0070716_1011461352 | 90 |
| 264 | 3300006175 | Ga0070712_100002890 | Ga0070712_10000289012 | 90 |
| 265 | 3300006175 | Ga0070712_100083938 | Ga0070712_1000839383 | 90 |
| 266 | 3300006175 | Ga0070712_100169040 | Ga0070712_1001690402 | 90 |
| 267 | 3300006178 | Ga0075367_10297748 | Ga0075367_102977482 | 90 |
| 268 | 3300006178 | Ga0075367_10976436 | Ga0075367_109764361 | 90 |
| 269 | 3300006186 | Ga0075369_10251904 | Ga0075369_102519042 | 90 |
| 270 | 3300006237 | Ga0097621_100914617 | Ga0097621_1009146172 | 90 |
| 271 | 3300006237 | Ga0097621_101457935 | Ga0097621_1014579352 | 90 |
| 272 | 3300006237 | Ga0097621_102118254 | Ga0097621_1021182541 | 90 |
| 273 | 3300006358 | Ga0068871_100651227 | Ga0068871_1006512272 | 90 |
| 274 | 3300006358 | Ga0068871_100663723 | Ga0068871_1006637231 | 90 |
| 275 | 3300006844 | Ga0075428_100449888 | Ga0075428_1004498882 | 90 |
| 276 | 3300006844 | Ga0075428_101442589 | Ga0075428_1014425892 | 90 |
| 277 | 3300006846 | Ga0075430_100907047 | Ga0075430_1009070472 | 90 |
| 278 | 3300006847 | Ga0075431_100000197 | Ga0075431_10000019730 | 90 |
| 279 | 3300006847 | Ga0075431_100394317 | Ga0075431_1003943173 | 90 |
| 280 | 3300006847 | Ga0075431_101071674 | Ga0075431_1010716742 | 90 |
| 281 | 3300006852 | Ga0075433_10000897 | Ga0075433_1000089711 | 90 |
| 282 | 3300006852 | Ga0075433_10024940 | Ga0075433_100249406 | 90 |
| 283 | 3300006852 | Ga0075433_10143670 | Ga0075433_101436702 | 90 |
| 284 | 3300006852 | Ga0075433_11023957 | Ga0075433_110239571 | 90 |
| 285 | 3300006871 | Ga0075434_100008498 | Ga0075434_1000084987 | 90 |
| 286 | 3300006871 | Ga0075434_100027126 | Ga0075434_1000271262 | 90 |
| 287 | 3300006871 | Ga0075434_100043274 | Ga0075434_1000432744 | 90 |
| 288 | 3300006871 | Ga0075434_101321702 | Ga0075434_1013217022 | 90 |
| 289 | 3300006880 | Ga0075429_100660723 | Ga0075429_1006607232 | 90 |
| 290 | 3300006880 | Ga0075429_100922922 | Ga0075429_1009229222 | 90 |
| 291 | 3300006881 | Ga0068865_100000082 | Ga0068865_10000008229 | 90 |
| 292 | 3300006881 | Ga0068865_100396217 | Ga0068865_1003962172 | 90 |
| 293 | 3300006881 | Ga0068865_101588750 | Ga0068865_1015887502 | 90 |
| 294 | 3300006881 | Ga0068865_101602821 | Ga0068865_1016028212 | 90 |
| 295 | 3300006914 | Ga0075436_100447812 | Ga0075436_1004478122 | 90 |
| 296 | 3300006914 | Ga0075436_100503524 | Ga0075436_1005035242 | 90 |
| 297 | 3300006931 | Ga0097620_100058406 | Ga0097620_1000584062 | 90 |
| 298 | 3300006931 | Ga0097620_100864181 | Ga0097620_1008641812 | 90 |
| 299 | 3300007076 | Ga0075435_100079846 | Ga0075435_1000798462 | 90 |
| 300 | 3300007076 | Ga0075435_100091865 | Ga0075435_1000918653 | 90 |
| 301 | 3300007076 | Ga0075435_100516530 | Ga0075435_1005165302 | 90 |
| 302 | 3300007076 | Ga0075435_100869037 | Ga0075435_1008690372 | 90 |
| 303 | 3300007076 | Ga0075435_101140549 | Ga0075435_1011405491 | 90 |
| 304 | 3300009093 | Ga0105240_10511954 | Ga0105240_105119542 | 90 |
| 305 | 3300009093 | Ga0105240_10928934 | Ga0105240_109289342 | 90 |
| 306 | 3300009093 | Ga0105240_11060168 | Ga0105240_110601682 | 90 |
| 307 | 3300009094 | Ga0111539_10024755 | Ga0111539_100247552 | 90 |
| 308 | 3300009094 | Ga0111539_10025516 | Ga0111539_1002551610 | 90 |
| 309 | 3300009094 | Ga0111539_10026270 | Ga0111539_100262705 | 90 |
| 310 | 3300009094 | Ga0111539_10743213 | Ga0111539_107432132 | 90 |
| 311 | 3300009094 | Ga0111539_11648192 | Ga0111539_116481921 | 90 |
| 312 | 3300009098 | Ga0105245_10000278 | Ga0105245_1000027811 | 90 |
| 313 | 3300009098 | Ga0105245_10000415 | Ga0105245_100004158 | 90 |
| 314 | 3300009098 | Ga0105245_10001311 | Ga0105245_1000131121 | 90 |
| 315 | 3300009098 | Ga0105245_10024888 | Ga0105245_100248883 | 90 |
| 316 | 3300009098 | Ga0105245_10089688 | Ga0105245_100896882 | 90 |
| 317 | 3300009098 | Ga0105245_10657460 | Ga0105245_106574602 | 90 |
| 318 | 3300009098 | Ga0105245_11467468 | Ga0105245_114674682 | 90 |
| 319 | 3300009098 | Ga0105245_12556305 | Ga0105245_125563052 | 90 |
| 320 | 3300009101 | Ga0105247_10029264 | Ga0105247_100292642 | 90 |
| 321 | 3300009101 | Ga0105247_10077162 | Ga0105247_100771623 | 90 |
| 322 | 3300009101 | Ga0105247_10917529 | Ga0105247_109175292 | 90 |
| 323 | 3300009101 | Ga0105247_11404910 | Ga0105247_114049102 | 90 |
| 324 | 3300009147 | Ga0114129_10110402 | Ga0114129_101104023 | 90 |
| 325 | 3300009147 | Ga0114129_10110402 | Ga0114129_101104026 | 90 |
| 326 | 3300009147 | Ga0114129_10113126 | Ga0114129_101131265 | 90 |
| 327 | 3300009147 | Ga0114129_10144653 | Ga0114129_101446532 | 90 |
| 328 | 3300009147 | Ga0114129_10639270 | Ga0114129_106392702 | 90 |
| 329 | 3300009147 | Ga0114129_11348365 | Ga0114129_113483653 | 90 |
| 330 | 3300009147 | Ga0114129_11853892 | Ga0114129_118538922 | 90 |
| 331 | 3300009148 | Ga0105243_10003503 | Ga0105243_1000350313 | 90 |
| 332 | 3300009148 | Ga0105243_10007118 | Ga0105243_100071187 | 90 |
| 333 | 3300009148 | Ga0105243_10045660 | Ga0105243_100456603 | 90 |
| 334 | 3300009148 | Ga0105243_10342613 | Ga0105243_103426132 | 90 |
| 335 | 3300009148 | Ga0105243_11291863 | Ga0105243_112918632 | 90 |
| 336 | 3300009148 | Ga0105243_12233372 | Ga0105243_122333722 | 90 |
| 337 | 3300009148 | Ga0105243_12606308 | Ga0105243_126063081 | 90 |
| 338 | 3300009174 | Ga0105241_10109322 | Ga0105241_101093222 | 90 |
| 339 | 3300009174 | Ga0105241_10612538 | Ga0105241_106125382 | 90 |
| 340 | 3300009174 | Ga0105241_11035708 | Ga0105241_110357082 | 90 |
| 341 | 3300009176 | Ga0105242_10000603 | Ga0105242_100006032 | 90 |
| 342 | 3300009176 | Ga0105242_10047166 | Ga0105242_100471663 | 90 |
| 343 | 3300009176 | Ga0105242_10234609 | Ga0105242_102346092 | 90 |
| 344 | 3300009176 | Ga0105242_10275850 | Ga0105242_102758502 | 90 |
| 345 | 3300009176 | Ga0105242_11011285 | Ga0105242_110112852 | 90 |
| 346 | 3300009176 | Ga0105242_11918350 | Ga0105242_119183502 | 90 |
| 347 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020122 | 90 |
| 348 | 3300009177 | Ga0105248_10126507 | Ga0105248_101265072 | 90 |
| 349 | 3300009177 | Ga0105248_10262577 | Ga0105248_102625772 | 90 |
| 350 | 3300009177 | Ga0105248_12444049 | Ga0105248_124440492 | 90 |
| 351 | 3300009545 | Ga0105237_10193604 | Ga0105237_101936042 | 90 |
| 352 | 3300009545 | Ga0105237_10271855 | Ga0105237_102718552 | 90 |
| 353 | 3300009545 | Ga0105237_10354953 | Ga0105237_103549532 | 90 |
| 354 | 3300009545 | Ga0105237_11169596 | Ga0105237_111695962 | 90 |
| 355 | 3300009551 | Ga0105238_10117153 | Ga0105238_101171532 | 90 |
| 356 | 3300009551 | Ga0105238_10496599 | Ga0105238_104965992 | 90 |
| 357 | 3300009553 | Ga0105249_10000143 | Ga0105249_1000014370 | 90 |
| 358 | 3300009553 | Ga0105249_10122179 | Ga0105249_101221792 | 90 |
| 359 | 3300009553 | Ga0105249_10175569 | Ga0105249_101755692 | 90 |
| 360 | 3300009553 | Ga0105249_10282388 | Ga0105249_102823883 | 90 |
| 361 | 3300009553 | Ga0105249_10289714 | Ga0105249_102897142 | 90 |
| 362 | 3300009553 | Ga0105249_10795883 | Ga0105249_107958832 | 90 |
| 363 | 3300009553 | Ga0105249_10962415 | Ga0105249_109624152 | 90 |
| 364 | 3300009553 | Ga0105249_11389140 | Ga0105249_113891402 | 90 |
| 365 | 3300010159 | Ga0099796_10232412 | Ga0099796_102324122 | 90 |
| 366 | 3300010375 | Ga0105239_10003725 | Ga0105239_1000372521 | 90 |
| 367 | 3300010375 | Ga0105239_10221837 | Ga0105239_102218373 | 90 |
| 368 | 3300010375 | Ga0105239_10578239 | Ga0105239_105782391 | 90 |
| 369 | 3300010375 | Ga0105239_11087281 | Ga0105239_110872813 | 90 |
| 370 | 3300010375 | Ga0105239_11414763 | Ga0105239_114147632 | 90 |
| 371 | 3300010375 | Ga0105239_11461507 | Ga0105239_114615072 | 90 |
| 372 | 3300010375 | Ga0105239_12274669 | Ga0105239_122746691 | 90 |
| 373 | 3300010375 | Ga0105239_12358643 | Ga0105239_123586432 | 90 |
| 374 | 3300010375 | Ga0105239_13401416 | Ga0105239_134014161 | 90 |
| 375 | 3300011119 | Ga0105246_10037640 | Ga0105246_100376402 | 90 |
| 376 | 3300011119 | Ga0105246_12076913 | Ga0105246_120769131 | 90 |
| 377 | 3300011119 | Ga0105246_12111193 | Ga0105246_121111931 | 90 |
| 378 | 3300012476 | Ga0157344_1006686 | Ga0157344_10066862 | 90 |
| 379 | 3300012507 | Ga0157342_1001537 | Ga0157342_10015372 | 90 |
| 380 | 3300013100 | Ga0157373_10534281 | Ga0157373_105342812 | 90 |
| 381 | 3300013102 | Ga0157371_10125048 | Ga0157371_101250482 | 90 |
| 382 | 3300013102 | Ga0157371_10769195 | Ga0157371_107691952 | 90 |
| 383 | 3300013102 | Ga0157371_11437258 | Ga0157371_114372581 | 90 |
| 384 | 3300013104 | Ga0157370_10149601 | Ga0157370_101496012 | 90 |
| 385 | 3300013104 | Ga0157370_10151772 | Ga0157370_101517723 | 90 |
| 386 | 3300013105 | Ga0157369_10000074 | Ga0157369_1000007430 | 90 |
| 387 | 3300013105 | Ga0157369_10808280 | Ga0157369_108082802 | 90 |
| 388 | 3300013296 | Ga0157374_10004880 | Ga0157374_100048809 | 90 |
| 389 | 3300013296 | Ga0157374_10175786 | Ga0157374_101757861 | 90 |
| 390 | 3300013297 | Ga0157378_10003241 | Ga0157378_100032415 | 90 |
| 391 | 3300013297 | Ga0157378_10068068 | Ga0157378_100680683 | 90 |
| 392 | 3300013297 | Ga0157378_10103191 | Ga0157378_101031912 | 90 |
| 393 | 3300013306 | Ga0163162_10933622 | Ga0163162_109336222 | 90 |
| 394 | 3300013306 | Ga0163162_11095063 | Ga0163162_110950631 | 90 |
| 395 | 3300013306 | Ga0163162_12072284 | Ga0163162_120722842 | 90 |
| 396 | 3300013306 | Ga0163162_13480145 | Ga0163162_134801452 | 90 |
| 397 | 3300013307 | Ga0157372_10000053 | Ga0157372_1000005325 | 90 |
| 398 | 3300013307 | Ga0157372_10057521 | Ga0157372_100575213 | 90 |
| 399 | 3300013307 | Ga0157372_10141100 | Ga0157372_101411003 | 90 |
| 400 | 3300013307 | Ga0157372_11734160 | Ga0157372_117341602 | 90 |
| 401 | 3300013307 | Ga0157372_12641841 | Ga0157372_126418412 | 90 |
| 402 | 3300013308 | Ga0157375_10013296 | Ga0157375_100132967 | 90 |
| 403 | 3300013308 | Ga0157375_10014036 | Ga0157375_100140363 | 90 |
| 404 | 3300013308 | Ga0157375_10014814 | Ga0157375_100148146 | 90 |
| 405 | 3300013308 | Ga0157375_10022190 | Ga0157375_100221903 | 90 |
| 406 | 3300013308 | Ga0157375_10111493 | Ga0157375_101114933 | 90 |
| 407 | 3300013308 | Ga0157375_10162776 | Ga0157375_101627762 | 90 |
| 408 | 3300013308 | Ga0157375_10881008 | Ga0157375_108810082 | 90 |
| 409 | 3300013308 | Ga0157375_13352272 | Ga0157375_133522722 | 90 |
| 410 | 3300014325 | Ga0163163_10204269 | Ga0163163_102042692 | 90 |
| 411 | 3300014325 | Ga0163163_10220265 | Ga0163163_102202653 | 90 |
| 412 | 3300014325 | Ga0163163_11958336 | Ga0163163_119583361 | 90 |
| 413 | 3300014325 | Ga0163163_13273731 | Ga0163163_132737312 | 90 |
| 414 | 3300014326 | Ga0157380_10000016 | Ga0157380_10000016103 | 90 |
| 415 | 3300014326 | Ga0157380_10002828 | Ga0157380_1000282815 | 90 |
| 416 | 3300014326 | Ga0157380_10116286 | Ga0157380_101162862 | 90 |
| 417 | 3300014326 | Ga0157380_13512092 | Ga0157380_135120921 | 90 |
| 418 | 3300014497 | Ga0182008_10336097 | Ga0182008_103360971 | 90 |
| 419 | 3300014745 | Ga0157377_10039811 | Ga0157377_100398112 | 90 |
| 420 | 3300014745 | Ga0157377_10439528 | Ga0157377_104395282 | 90 |
| 421 | 3300014745 | Ga0157377_10760733 | Ga0157377_107607332 | 90 |
| 422 | 3300014968 | Ga0157379_10006763 | Ga0157379_100067633 | 90 |
| 423 | 3300014968 | Ga0157379_10400050 | Ga0157379_104000502 | 90 |
| 424 | 3300014968 | Ga0157379_12271030 | Ga0157379_122710301 | 90 |
| 425 | 3300014968 | Ga0157379_12299167 | Ga0157379_122991672 | 90 |
| 426 | 3300014969 | Ga0157376_10127119 | Ga0157376_101271193 | 90 |
| 427 | 3300014969 | Ga0157376_10169025 | Ga0157376_101690252 | 90 |
| 428 | 3300014969 | Ga0157376_11220358 | Ga0157376_112203582 | 90 |
| 429 | 3300014969 | Ga0157376_11700456 | Ga0157376_117004562 | 90 |
| 430 | 3300014969 | Ga0157376_11879406 | Ga0157376_118794062 | 90 |
| 431 | 3300014969 | Ga0157376_12460768 | Ga0157376_124607682 | 90 |
| 432 | 3300017792 | Ga0163161_10000053 | Ga0163161_10000053119 | 90 |
| 433 | 3300017792 | Ga0163161_10154218 | Ga0163161_101542182 | 90 |
| 434 | 3300017792 | Ga0163161_10225825 | Ga0163161_102258252 | 90 |
| 435 | 3300017792 | Ga0163161_10359349 | Ga0163161_103593492 | 90 |
| 436 | 3300017792 | Ga0163161_10908301 | Ga0163161_109083012 | 90 |
| 437 | 3300020069 | Ga0197907_11491576 | Ga0197907_114915761 | 90 |
| 438 | 3300020077 | Ga0206351_10306398 | Ga0206351_103063982 | 90 |
| 439 | 3300020078 | Ga0206352_10043259 | Ga0206352_100432591 | 90 |
| 440 | 3300020080 | Ga0206350_10480026 | Ga0206350_104800262 | 90 |
| 441 | 3300020081 | Ga0206354_10762690 | Ga0206354_107626902 | 90 |
| 442 | 3300020082 | Ga0206353_11374094 | Ga0206353_113740941 | 90 |
| 443 | 3300020082 | Ga0206353_11800342 | Ga0206353_118003421 | 90 |
| 444 | 3300022467 | Ga0224712_10040416 | Ga0224712_100404162 | 90 |
| 445 | 3300022467 | Ga0224712_10214807 | Ga0224712_102148071 | 90 |
| 446 | 3300025315 | Ga0207697_10377732 | Ga0207697_103777322 | 90 |
| 447 | 3300025321 | Ga0207656_10000226 | Ga0207656_1000022611 | 90 |
| 448 | 3300025321 | Ga0207656_10007404 | Ga0207656_100074044 | 90 |
| 449 | 3300025321 | Ga0207656_10093123 | Ga0207656_100931232 | 90 |
| 450 | 3300025893 | Ga0207682_10010613 | Ga0207682_100106134 | 90 |
| 451 | 3300025899 | Ga0207642_10000080 | Ga0207642_1000008012 | 90 |
| 452 | 3300025899 | Ga0207642_10005540 | Ga0207642_100055406 | 90 |
| 453 | 3300025900 | Ga0207710_10019430 | Ga0207710_100194302 | 90 |
| 454 | 3300025900 | Ga0207710_10600436 | Ga0207710_106004362 | 90 |
| 455 | 3300025901 | Ga0207688_10004162 | Ga0207688_100041624 | 90 |
| 456 | 3300025901 | Ga0207688_10008563 | Ga0207688_100085636 | 90 |
| 457 | 3300025901 | Ga0207688_10009259 | Ga0207688_100092593 | 90 |
| 458 | 3300025903 | Ga0207680_10005908 | Ga0207680_100059086 | 90 |
| 459 | 3300025903 | Ga0207680_10073801 | Ga0207680_100738012 | 90 |
| 460 | 3300025904 | Ga0207647_10128345 | Ga0207647_101283452 | 90 |
| 461 | 3300025905 | Ga0207685_10136019 | Ga0207685_101360192 | 90 |
| 462 | 3300025907 | Ga0207645_10276812 | Ga0207645_102768122 | 90 |
| 463 | 3300025908 | Ga0207643_10292299 | Ga0207643_102922992 | 90 |
| 464 | 3300025908 | Ga0207643_10292617 | Ga0207643_102926172 | 90 |
| 465 | 3300025908 | Ga0207643_10689263 | Ga0207643_106892632 | 90 |
| 466 | 3300025909 | Ga0207705_10080206 | Ga0207705_100802063 | 90 |
| 467 | 3300025909 | Ga0207705_10300677 | Ga0207705_103006772 | 90 |
| 468 | 3300025911 | Ga0207654_10336258 | Ga0207654_103362582 | 90 |
| 469 | 3300025912 | Ga0207707_10096999 | Ga0207707_100969992 | 90 |
| 470 | 3300025912 | Ga0207707_10590699 | Ga0207707_105906992 | 90 |
| 471 | 3300025913 | Ga0207695_10094013 | Ga0207695_100940132 | 90 |
| 472 | 3300025913 | Ga0207695_10680249 | Ga0207695_106802492 | 90 |
| 473 | 3300025913 | Ga0207695_11115059 | Ga0207695_111150591 | 90 |
| 474 | 3300025914 | Ga0207671_10287266 | Ga0207671_102872662 | 90 |
| 475 | 3300025914 | Ga0207671_11022210 | Ga0207671_110222101 | 90 |
| 476 | 3300025914 | Ga0207671_11095034 | Ga0207671_110950342 | 90 |
| 477 | 3300025914 | Ga0207671_11304137 | Ga0207671_113041371 | 90 |
| 478 | 3300025915 | Ga0207693_10013472 | Ga0207693_100134723 | 90 |
| 479 | 3300025915 | Ga0207693_10014605 | Ga0207693_100146056 | 90 |
| 480 | 3300025915 | Ga0207693_10314032 | Ga0207693_103140322 | 90 |
| 481 | 3300025916 | Ga0207663_10021565 | Ga0207663_100215653 | 90 |
| 482 | 3300025916 | Ga0207663_10816636 | Ga0207663_108166361 | 90 |
| 483 | 3300025917 | Ga0207660_11042254 | Ga0207660_110422542 | 90 |
| 484 | 3300025918 | Ga0207662_10254632 | Ga0207662_102546322 | 90 |
| 485 | 3300025918 | Ga0207662_10863997 | Ga0207662_108639972 | 90 |
| 486 | 3300025919 | Ga0207657_10000636 | Ga0207657_1000063631 | 90 |
| 487 | 3300025919 | Ga0207657_10464617 | Ga0207657_104646172 | 90 |
| 488 | 3300025920 | Ga0207649_10000127 | Ga0207649_1000012760 | 90 |
| 489 | 3300025920 | Ga0207649_10021936 | Ga0207649_100219363 | 90 |
| 490 | 3300025920 | Ga0207649_10510953 | Ga0207649_105109532 | 90 |
| 491 | 3300025920 | Ga0207649_11002915 | Ga0207649_110029152 | 90 |
| 492 | 3300025921 | Ga0207652_10000321 | Ga0207652_1000032135 | 90 |
| 493 | 3300025921 | Ga0207652_10495955 | Ga0207652_104959552 | 90 |
| 494 | 3300025921 | Ga0207652_11731803 | Ga0207652_117318031 | 90 |
| 495 | 3300025924 | Ga0207694_10062887 | Ga0207694_100628873 | 90 |
| 496 | 3300025924 | Ga0207694_10277806 | Ga0207694_102778062 | 90 |
| 497 | 3300025924 | Ga0207694_10515897 | Ga0207694_105158971 | 90 |
| 498 | 3300025925 | Ga0207650_10031298 | Ga0207650_100312985 | 90 |
| 499 | 3300025925 | Ga0207650_11466038 | Ga0207650_114660381 | 90 |
| 500 | 3300025926 | Ga0207659_10000013 | Ga0207659_1000001387 | 90 |
| 501 | 3300025926 | Ga0207659_10153312 | Ga0207659_101533123 | 90 |
| 502 | 3300025926 | Ga0207659_10480730 | Ga0207659_104807302 | 90 |
| 503 | 3300025927 | Ga0207687_10000032 | Ga0207687_1000003220 | 90 |
| 504 | 3300025927 | Ga0207687_10000036 | Ga0207687_10000036120 | 90 |
| 505 | 3300025927 | Ga0207687_10000460 | Ga0207687_100004605 | 90 |
| 506 | 3300025927 | Ga0207687_10011833 | Ga0207687_100118336 | 90 |
| 507 | 3300025927 | Ga0207687_10017769 | Ga0207687_100177694 | 90 |
| 508 | 3300025927 | Ga0207687_10049514 | Ga0207687_100495141 | 90 |
| 509 | 3300025927 | Ga0207687_10592077 | Ga0207687_105920772 | 90 |
| 510 | 3300025928 | Ga0207700_10000033 | Ga0207700_1000003326 | 90 |
| 511 | 3300025929 | Ga0207664_10349734 | Ga0207664_103497342 | 90 |
| 512 | 3300025931 | Ga0207644_10090484 | Ga0207644_100904843 | 90 |
| 513 | 3300025931 | Ga0207644_10282981 | Ga0207644_102829813 | 90 |
| 514 | 3300025932 | Ga0207690_10023856 | Ga0207690_100238562 | 90 |
| 515 | 3300025932 | Ga0207690_10931749 | Ga0207690_109317491 | 90 |
| 516 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001410 | 90 |
| 517 | 3300025933 | Ga0207706_10007826 | Ga0207706_100078262 | 90 |
| 518 | 3300025933 | Ga0207706_10090788 | Ga0207706_100907881 | 90 |
| 519 | 3300025934 | Ga0207686_10000097 | Ga0207686_1000009716 | 90 |
| 520 | 3300025934 | Ga0207686_10035280 | Ga0207686_100352802 | 90 |
| 521 | 3300025934 | Ga0207686_10085007 | Ga0207686_100850072 | 90 |
| 522 | 3300025934 | Ga0207686_10136529 | Ga0207686_101365293 | 90 |
| 523 | 3300025934 | Ga0207686_10987846 | Ga0207686_109878462 | 90 |
| 524 | 3300025934 | Ga0207686_11130594 | Ga0207686_111305942 | 90 |
| 525 | 3300025935 | Ga0207709_10005457 | Ga0207709_100054573 | 90 |
| 526 | 3300025935 | Ga0207709_10005868 | Ga0207709_100058688 | 90 |
| 527 | 3300025935 | Ga0207709_10177766 | Ga0207709_101777663 | 90 |
| 528 | 3300025935 | Ga0207709_10387095 | Ga0207709_103870952 | 90 |
| 529 | 3300025936 | Ga0207670_10020378 | Ga0207670_100203783 | 90 |
| 530 | 3300025936 | Ga0207670_10142618 | Ga0207670_101426182 | 90 |
| 531 | 3300025936 | Ga0207670_10148022 | Ga0207670_101480222 | 90 |
| 532 | 3300025936 | Ga0207670_10840514 | Ga0207670_108405142 | 90 |
| 533 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001719 | 90 |
| 534 | 3300025937 | Ga0207669_10045981 | Ga0207669_100459812 | 90 |
| 535 | 3300025937 | Ga0207669_10091576 | Ga0207669_100915762 | 90 |
| 536 | 3300025937 | Ga0207669_11752037 | Ga0207669_117520371 | 90 |
| 537 | 3300025938 | Ga0207704_10000184 | Ga0207704_1000018423 | 90 |
| 538 | 3300025938 | Ga0207704_10028503 | Ga0207704_100285034 | 90 |
| 539 | 3300025938 | Ga0207704_10056024 | Ga0207704_100560242 | 90 |
| 540 | 3300025938 | Ga0207704_10496717 | Ga0207704_104967171 | 90 |
| 541 | 3300025938 | Ga0207704_10599293 | Ga0207704_105992932 | 90 |
| 542 | 3300025939 | Ga0207665_10041438 | Ga0207665_100414383 | 90 |
| 543 | 3300025939 | Ga0207665_10909089 | Ga0207665_109090892 | 90 |
| 544 | 3300025940 | Ga0207691_10029702 | Ga0207691_100297023 | 90 |
| 545 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006254 | 90 |
| 546 | 3300025941 | Ga0207711_10207341 | Ga0207711_102073413 | 90 |
| 547 | 3300025941 | Ga0207711_10691922 | Ga0207711_106919221 | 90 |
| 548 | 3300025941 | Ga0207711_11553970 | Ga0207711_115539702 | 90 |
| 549 | 3300025942 | Ga0207689_10103451 | Ga0207689_101034513 | 90 |
| 550 | 3300025942 | Ga0207689_10299305 | Ga0207689_102993052 | 90 |
| 551 | 3300025942 | Ga0207689_11176199 | Ga0207689_111761992 | 90 |
| 552 | 3300025944 | Ga0207661_10001690 | Ga0207661_100016904 | 90 |
| 553 | 3300025944 | Ga0207661_10002110 | Ga0207661_100021109 | 90 |
| 554 | 3300025944 | Ga0207661_10091283 | Ga0207661_100912833 | 90 |
| 555 | 3300025944 | Ga0207661_10101297 | Ga0207661_101012972 | 90 |
| 556 | 3300025944 | Ga0207661_10172483 | Ga0207661_101724833 | 90 |
| 557 | 3300025944 | Ga0207661_10205492 | Ga0207661_102054922 | 90 |
| 558 | 3300025944 | Ga0207661_10857542 | Ga0207661_108575422 | 90 |
| 559 | 3300025945 | Ga0207679_10059493 | Ga0207679_100594933 | 90 |
| 560 | 3300025945 | Ga0207679_10150953 | Ga0207679_101509533 | 90 |
| 561 | 3300025945 | Ga0207679_10513937 | Ga0207679_105139371 | 90 |
| 562 | 3300025960 | Ga0207651_10013423 | Ga0207651_100134232 | 90 |
| 563 | 3300025960 | Ga0207651_10016930 | Ga0207651_100169302 | 90 |
| 564 | 3300025960 | Ga0207651_10849003 | Ga0207651_108490032 | 90 |
| 565 | 3300025961 | Ga0207712_10000058 | Ga0207712_10000058120 | 90 |
| 566 | 3300025961 | Ga0207712_10106609 | Ga0207712_101066092 | 90 |
| 567 | 3300025961 | Ga0207712_10140778 | Ga0207712_101407782 | 90 |
| 568 | 3300025961 | Ga0207712_10596379 | Ga0207712_105963792 | 90 |
| 569 | 3300025961 | Ga0207712_10641459 | Ga0207712_106414592 | 90 |
| 570 | 3300025961 | Ga0207712_11554369 | Ga0207712_115543692 | 90 |
| 571 | 3300025972 | Ga0207668_10008029 | Ga0207668_100080293 | 90 |
| 572 | 3300025972 | Ga0207668_10696879 | Ga0207668_106968792 | 90 |
| 573 | 3300025972 | Ga0207668_10980130 | Ga0207668_109801302 | 90 |
| 574 | 3300025972 | Ga0207668_11122450 | Ga0207668_111224501 | 90 |
| 575 | 3300025981 | Ga0207640_10071795 | Ga0207640_100717952 | 90 |
| 576 | 3300025981 | Ga0207640_10106767 | Ga0207640_101067672 | 90 |
| 577 | 3300025981 | Ga0207640_10337120 | Ga0207640_103371202 | 90 |
| 578 | 3300025986 | Ga0207658_10023672 | Ga0207658_100236723 | 90 |
| 579 | 3300025986 | Ga0207658_10050389 | Ga0207658_100503895 | 90 |
| 580 | 3300025986 | Ga0207658_10181291 | Ga0207658_101812912 | 90 |
| 581 | 3300025986 | Ga0207658_10523750 | Ga0207658_105237502 | 90 |
| 582 | 3300026023 | Ga0207677_10000284 | Ga0207677_100002843 | 90 |
| 583 | 3300026023 | Ga0207677_10001038 | Ga0207677_1000103812 | 90 |
| 584 | 3300026023 | Ga0207677_10045723 | Ga0207677_100457232 | 90 |
| 585 | 3300026023 | Ga0207677_11091726 | Ga0207677_110917261 | 90 |
| 586 | 3300026023 | Ga0207677_11560441 | Ga0207677_115604412 | 90 |
| 587 | 3300026023 | Ga0207677_11910282 | Ga0207677_119102822 | 90 |
| 588 | 3300026023 | Ga0207677_11989510 | Ga0207677_119895102 | 90 |
| 589 | 3300026035 | Ga0207703_10000088 | Ga0207703_100000883 | 90 |
| 590 | 3300026035 | Ga0207703_10000287 | Ga0207703_1000028755 | 90 |
| 591 | 3300026035 | Ga0207703_10410402 | Ga0207703_104104022 | 90 |
| 592 | 3300026035 | Ga0207703_11884876 | Ga0207703_118848761 | 90 |
| 593 | 3300026041 | Ga0207639_10005999 | Ga0207639_100059995 | 90 |
| 594 | 3300026041 | Ga0207639_10035406 | Ga0207639_100354063 | 90 |
| 595 | 3300026041 | Ga0207639_10693339 | Ga0207639_106933392 | 90 |
| 596 | 3300026067 | Ga0207678_10002224 | Ga0207678_100022249 | 90 |
| 597 | 3300026067 | Ga0207678_10016375 | Ga0207678_100163752 | 90 |
| 598 | 3300026067 | Ga0207678_10046785 | Ga0207678_100467854 | 90 |
| 599 | 3300026067 | Ga0207678_10403060 | Ga0207678_104030602 | 90 |
| 600 | 3300026067 | Ga0207678_10936036 | Ga0207678_109360362 | 90 |
| 601 | 3300026075 | Ga0207708_10009112 | Ga0207708_100091127 | 90 |
| 602 | 3300026075 | Ga0207708_10014443 | Ga0207708_100144436 | 90 |
| 603 | 3300026075 | Ga0207708_10227601 | Ga0207708_102276013 | 90 |
| 604 | 3300026075 | Ga0207708_10571844 | Ga0207708_105718442 | 90 |
| 605 | 3300026075 | Ga0207708_10634317 | Ga0207708_106343172 | 90 |
| 606 | 3300026078 | Ga0207702_10000637 | Ga0207702_1000063715 | 90 |
| 607 | 3300026078 | Ga0207702_10014646 | Ga0207702_100146463 | 90 |
| 608 | 3300026078 | Ga0207702_10047334 | Ga0207702_100473343 | 90 |
| 609 | 3300026078 | Ga0207702_10055526 | Ga0207702_100555264 | 90 |
| 610 | 3300026078 | Ga0207702_11847708 | Ga0207702_118477082 | 90 |
| 611 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016192 | 90 |
| 612 | 3300026088 | Ga0207641_10207691 | Ga0207641_102076912 | 90 |
| 613 | 3300026088 | Ga0207641_10415730 | Ga0207641_104157302 | 90 |
| 614 | 3300026088 | Ga0207641_10633330 | Ga0207641_106333302 | 90 |
| 615 | 3300026088 | Ga0207641_10635275 | Ga0207641_106352752 | 90 |
| 616 | 3300026088 | Ga0207641_11472097 | Ga0207641_114720971 | 90 |
| 617 | 3300026088 | Ga0207641_12064018 | Ga0207641_120640181 | 90 |
| 618 | 3300026089 | Ga0207648_10015345 | Ga0207648_100153452 | 90 |
| 619 | 3300026089 | Ga0207648_10017486 | Ga0207648_100174862 | 90 |
| 620 | 3300026089 | Ga0207648_11007247 | Ga0207648_110072471 | 90 |
| 621 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018101 | 90 |
| 622 | 3300026095 | Ga0207676_10060765 | Ga0207676_100607652 | 90 |
| 623 | 3300026095 | Ga0207676_10357913 | Ga0207676_103579132 | 90 |
| 624 | 3300026116 | Ga0207674_10102949 | Ga0207674_101029493 | 90 |
| 625 | 3300026116 | Ga0207674_10149795 | Ga0207674_101497953 | 90 |
| 626 | 3300026118 | Ga0207675_100045437 | Ga0207675_1000454372 | 90 |
| 627 | 3300026118 | Ga0207675_100087507 | Ga0207675_1000875072 | 90 |
| 628 | 3300026121 | Ga0207683_10012982 | Ga0207683_100129829 | 90 |
| 629 | 3300026121 | Ga0207683_10037324 | Ga0207683_100373247 | 90 |
| 630 | 3300026121 | Ga0207683_10341117 | Ga0207683_103411173 | 90 |
| 631 | 3300026121 | Ga0207683_10492637 | Ga0207683_104926372 | 90 |
| 632 | 3300026121 | Ga0207683_10499214 | Ga0207683_104992142 | 90 |
| 633 | 3300026142 | Ga0207698_10000004 | Ga0207698_1000000436 | 90 |
| 634 | 3300026142 | Ga0207698_10005530 | Ga0207698_100055306 | 90 |
| 635 | 3300026142 | Ga0207698_10063263 | Ga0207698_100632633 | 90 |
| 636 | 3300027866 | Ga0209813_10337831 | Ga0209813_103378312 | 90 |
| 637 | 3300027907 | Ga0207428_10264797 | Ga0207428_102647972 | 90 |
| 638 | 3300027907 | Ga0207428_10290421 | Ga0207428_102904212 | 90 |
| 639 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056172 | 90 |
| 640 | 3300028379 | Ga0268266_10001254 | Ga0268266_1000125430 | 90 |
| 641 | 3300028379 | Ga0268266_10059912 | Ga0268266_100599121 | 90 |
| 642 | 3300028379 | Ga0268266_10465490 | Ga0268266_104654902 | 90 |
| 643 | 3300028379 | Ga0268266_11304039 | Ga0268266_113040392 | 90 |
| 644 | 3300028380 | Ga0268265_10205244 | Ga0268265_102052442 | 90 |
| 645 | 3300028380 | Ga0268265_10389931 | Ga0268265_103899312 | 90 |
| 646 | 3300028380 | Ga0268265_12114974 | Ga0268265_121149742 | 90 |
| 647 | 3300028380 | Ga0268265_12333118 | Ga0268265_123331182 | 90 |
| 648 | 3300028381 | Ga0268264_10295170 | Ga0268264_102951702 | 90 |
| 649 | 3300028381 | Ga0268264_11262797 | Ga0268264_112627972 | 90 |
| 650 | 3300028381 | Ga0268264_11735309 | Ga0268264_117353092 | 90 |
| 651 | 3300028381 | Ga0268264_12246106 | Ga0268264_122461062 | 90 |
| 652 | 3300028556 | Ga0265337_1000066 | Ga0265337_100006621 | 90 |
| 653 | 3300028558 | Ga0265326_10000019 | Ga0265326_10000019141 | 90 |
| 654 | 3300028563 | Ga0265319_1000069 | Ga0265319_100006913 | 90 |
| 655 | 3300028654 | Ga0265322_10000011 | Ga0265322_10000011141 | 90 |
| 656 | 3300028666 | Ga0265336_10002798 | Ga0265336_100027982 | 90 |
| 657 | 3300028800 | Ga0265338_10158711 | Ga0265338_101587112 | 90 |
| 658 | 3300029957 | Ga0265324_10000283 | Ga0265324_1000028323 | 90 |
| 659 | 3300031235 | Ga0265330_10288409 | Ga0265330_102884092 | 90 |
| 660 | 3300031238 | Ga0265332_10116314 | Ga0265332_101163141 | 90 |
| 661 | 3300031239 | Ga0265328_10000737 | Ga0265328_1000073714 | 90 |
| 662 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011141 | 90 |
| 663 | 3300031242 | Ga0265329_10004312 | Ga0265329_100043122 | 90 |
| 664 | 3300031249 | Ga0265339_10051838 | Ga0265339_100518382 | 90 |
| 665 | 3300031250 | Ga0265331_10000858 | Ga0265331_1000085819 | 90 |
| 666 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015249 | 90 |
| 667 | 3300031251 | Ga0265327_10065922 | Ga0265327_100659222 | 90 |
| 668 | 3300031344 | Ga0265316_10181978 | Ga0265316_101819782 | 90 |
| 669 | 3300031665 | Ga0316575_10325157 | Ga0316575_103251572 | 90 |
| 670 | 3300031711 | Ga0265314_10000640 | Ga0265314_1000064036 | 90 |
| 671 | 3300031712 | Ga0265342_10231156 | Ga0265342_102311562 | 90 |
| 672 | 3300031727 | Ga0316576_10368159 | Ga0316576_103681592 | 90 |
| 673 | 3300031731 | Ga0307405_10467687 | Ga0307405_104676872 | 90 |
| 674 | 3300031852 | Ga0307410_10345634 | Ga0307410_103456342 | 90 |
| 675 | 3300031903 | Ga0307407_10494104 | Ga0307407_104941041 | 90 |
| 676 | 3300031995 | Ga0307409_100315072 | Ga0307409_1003150722 | 90 |
| 677 | 3300031995 | Ga0307409_102877382 | Ga0307409_1028773822 | 90 |
| 678 | 3300031995 | Ga0307409_102975120 | Ga0307409_1029751202 | 90 |
| 679 | 3300032002 | Ga0307416_100007153 | Ga0307416_1000071532 | 90 |
| 680 | 3300032133 | Ga0316583_10357425 | Ga0316583_103574251 | 90 |
| 681 | 3300033541 | Ga0316596_1073834 | Ga0316596_10738341 | 90 |
| 682 | 3300035117 | Ga0373953_0427738 | Ga0373953_0427738_194_469 | 90 |
| 683 | 3300035172 | Ga0373955_0207534 | Ga0373955_0207534_667_939 | 90 |
| 684 | 3300035241 | Ga0373961_0334439 | Ga0373961_0334439_65_337 | 90 |
| 685 | 3300035242 | Ga0373962_0222017 | Ga0373962_0222017_30_302 | 90 |
| 686 | 3300035398 | Ga0316574_0084413 | Ga0316574_0084413_169_441 | 90 |
| 687 | 3300035398 | Ga0316574_0233711 | Ga0316574_0233711_320_595 | 90 |
| 688 | 3300035398 | Ga0316574_0710966 | Ga0316574_0710966_135_407 | 90 |
| 689 | 3300035724 | Ga0373933_0230983 | Ga0373933_0230983_535_807 | 90 |
| 690 | 3300036401 | Ga0373937_0093812 | Ga0373937_0093812_608_880 | 90 |
| 691 | 3300036401 | Ga0373937_0099240 | Ga0373937_0099240_845_1120 | 90 |
| 692 | 3300036401 | Ga0373937_0906547 | Ga0373937_0906547_425_697 | 90 |
| 693 | 3300036647 | Ga0316582_1061819 | Ga0316582_1061819_106_378 | 90 |
| 694 | 3300036712 | Ga0316584_0076334 | Ga0316584_0076334_1005_1277 | 90 |
| 695 | 3300036712 | Ga0316584_0105111 | Ga0316584_0105111_488_760 | 90 |
| 696 | 3300037312 | Ga0395899_0040970 | Ga0395899_0040970_787_1059 | 90 |
| 697 | 3300037312 | Ga0395899_0521791 | Ga0395899_0521791_221_493 | 90 |
| 698 | 3300037418 | Ga0395900_0047402 | Ga0395900_0047402_1628_1900 | 90 |
| 699 | 3300037418 | Ga0395900_0193162 | Ga0395900_0193162_67_339 | 90 |
| 700 | 3300037418 | Ga0395900_0451853 | Ga0395900_0451853_489_761 | 90 |
| 701 | 3300037418 | Ga0395900_1270433 | Ga0395900_1270433_10_282 | 90 |
| 702 | 3300037418 | Ga0395900_1439792 | Ga0395900_1439792_165_437 | 90 |
| 703 | 3300037418 | Ga0395900_1652645 | Ga0395900_1652645_125_397 | 90 |
| 704 | 3300037466 | Ga0395898_0015116 | Ga0395898_0015116_3439_3711 | 90 |
| 705 | 3300037466 | Ga0395898_0028975 | Ga0395898_0028975_1645_1917 | 90 |
| 706 | 3300037466 | Ga0395898_0739748 | Ga0395898_0739748_200_472 | 90 |
| 707 | 3300037466 | Ga0395898_1648897 | Ga0395898_1648897_159_431 | 90 |
| 708 | 3300037471 | Ga0395905_0058834 | Ga0395905_0058834_183_455 | 90 |
| 709 | 3300037471 | Ga0395905_0271174 | Ga0395905_0271174_779_1051 | 90 |
| 710 | 3300037853 | Ga0436364_1436303 | Ga0436364_1436303_158_433 | 90 |
| 711 | 3300038443 | Ga0395901_0044882 | Ga0395901_0044882_1150_1422 | 90 |
| 712 | 3300038443 | Ga0395901_0181831 | Ga0395901_0181831_1037_1309 | 90 |
| 713 | 3300038443 | Ga0395901_0475111 | Ga0395901_0475111_941_1213 | 90 |
| 714 | 3300038443 | Ga0395901_0660183 | Ga0395901_0660183_764_1036 | 90 |
| 715 | 3300038443 | Ga0395901_1033616 | Ga0395901_1033616_65_337 | 90 |
| 716 | 3300038443 | Ga0395901_1548546 | Ga0395901_1548546_318_590 | 90 |
| 717 | 3300041441 | Ga0451787_712849 | Ga0451787_712849_238_513 | 90 |
| 718 | 3300041459 | Ga0451800_1407260 | Ga0451800_1407260_177_452 | 90 |
| 719 | 3300041463 | Ga0451804_0577682 | Ga0451804_0577682_80_352 | 90 |
| 720 | 3300041463 | Ga0451804_0667066 | Ga0451804_0667066_90_362 | 90 |
| 721 | 3300041486 | Ga0451807_1152741 | Ga0451807_1152741_704_976 | 90 |
| 722 | 3300041492 | Ga0451835_0727965 | Ga0451835_0727965_199_471 | 90 |
| 723 | 3300041496 | Ga0451839_0942696 | Ga0451839_0942696_133_405 | 90 |
| 724 | 3300041501 | Ga0451845_0014378 | Ga0451845_0014378_102_377 | 90 |
| 725 | 3300041501 | Ga0451845_0941955 | Ga0451845_0941955_222_494 | 90 |
| 726 | 3300041505 | Ga0451849_0369994 | Ga0451849_0369994_346_618 | 90 |
| 727 | 3300041507 | Ga0451851_1115656 | Ga0451851_1115656_320_595 | 90 |
| 728 | 3300041512 | Ga0451853_0637403 | Ga0451853_0637403_230_502 | 90 |
| 729 | 3300041512 | Ga0451853_2136927 | Ga0451853_2136927_1816_2088 | 90 |
| 730 | 3300041512 | Ga0451853_3163208 | Ga0451853_3163208_307_579 | 90 |
| 731 | 3300041512 | Ga0451853_3772225 | Ga0451853_3772225_329_601 | 90 |
| 732 | 3300042438 | Ga0439459_0009945 | Ga0439459_0009945_128_400 | 90 |
| 733 | 3300042993 | Ga0439440_0176935 | Ga0439440_0176935_28_300 | 90 |
| 734 | 3300044683 | Ga0466965_0682609 | Ga0466965_0682609_301_576 | 90 |
| 735 | 3300044694 | Ga0466963_0000017 | Ga0466963_0000017_25424_25696 | 90 |
| 736 | 3300044694 | Ga0466963_0237008 | Ga0466963_0237008_456_728 | 90 |
| 737 | 3300044694 | Ga0466963_0465545 | Ga0466963_0465545_311_583 | 90 |
| 738 | 3300044706 | Ga0466964_0680097 | Ga0466964_0680097_177_449 | 90 |
| 739 | 3300044719 | Ga0466971_0590931 | Ga0466971_0590931_56_328 | 90 |
| 740 | 3300044842 | Ga0466957_0001414 | Ga0466957_0001414_5321_5596 | 90 |
| 741 | 3300044842 | Ga0466957_0929659 | Ga0466957_0929659_222_494 | 90 |
| 742 | 3300044901 | Ga0466960_0604182 | Ga0466960_0604182_95_370 | 90 |
| 743 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_114836_115108 | 90 |
| 744 | 3300045976 | Ga0466967_0518478 | Ga0466967_0518478_413_688 | 90 |
| 745 | 3300045976 | Ga0466967_0782900 | Ga0466967_0782900_608_883 | 90 |
| 746 | 3300045976 | Ga0466967_1023652 | Ga0466967_1023652_60_335 | 90 |
| 747 | 3300045976 | Ga0466967_1714555 | Ga0466967_1714555_34_306 | 90 |
| 748 | 3300045976 | Ga0466967_2343148 | Ga0466967_2343148_204_476 | 90 |
| 749 | 3300046454 | Ga0495592_0000607 | Ga0495592_0000607_19252_19524 | 90 |
| 750 | 3300046455 | Ga0495603_0000286 | Ga0495603_0000286_16062_16334 | 90 |
| 751 | 3300046455 | Ga0495603_0001350 | Ga0495603_0001350_8356_8628 | 90 |
| 752 | 3300046455 | Ga0495603_0050651 | Ga0495603_0050651_1158_1430 | 90 |
| 753 | 3300046459 | Ga0495629_0000245 | Ga0495629_0000245_38716_38988 | 90 |
| 754 | 3300046459 | Ga0495629_0005286 | Ga0495629_0005286_4328_4600 | 90 |
| 755 | 3300046459 | Ga0495629_0010859 | Ga0495629_0010859_914_1186 | 90 |
| 756 | 3300046459 | Ga0495629_1081189 | Ga0495629_1081189_223_495 | 90 |
| 757 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_184015_184287 | 90 |
| 758 | 3300046461 | Ga0495641_0009181 | Ga0495641_0009181_1819_2091 | 90 |
| 759 | 3300046461 | Ga0495641_0031015 | Ga0495641_0031015_2185_2457 | 90 |
| 760 | 3300046461 | Ga0495641_0409205 | Ga0495641_0409205_296_568 | 90 |
| 761 | 3300046462 | Ga0495651_0176727 | Ga0495651_0176727_700_972 | 90 |
| 762 | 3300046462 | Ga0495651_0297780 | Ga0495651_0297780_255_527 | 90 |
| 763 | 3300046463 | Ga0495653_0103405 | Ga0495653_0103405_959_1231 | 90 |
| 764 | 3300046463 | Ga0495653_0135879 | Ga0495653_0135879_882_1157 | 90 |
| 765 | 3300046463 | Ga0495653_0169316 | Ga0495653_0169316_303_575 | 90 |
| 766 | 3300046463 | Ga0495653_0197448 | Ga0495653_0197448_494_766 | 90 |
| 767 | 3300046463 | Ga0495653_0881077 | Ga0495653_0881077_155_427 | 90 |
| 768 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_77390_77662 | 90 |
| 769 | 3300046475 | Ga0495639_0236502 | Ga0495639_0236502_324_596 | 90 |
| 770 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_20724_20996 | 90 |
| 771 | 3300046477 | Ga0495664_0282300 | Ga0495664_0282300_497_769 | 90 |
| 772 | 3300046491 | Ga0495584_0562469 | Ga0495584_0562469_67_339 | 90 |
| 773 | 3300046499 | Ga0495594_0109392 | Ga0495594_0109392_37_309 | 90 |
| 774 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_46761_47033 | 90 |
| 775 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_121908_122180 | 90 |
| 776 | 3300046511 | Ga0495608_0023011 | Ga0495608_0023011_2053_2325 | 90 |
| 777 | 3300046511 | Ga0495608_0038868 | Ga0495608_0038868_1881_2153 | 90 |
| 778 | 3300046511 | Ga0495608_0399205 | Ga0495608_0399205_268_543 | 90 |
| 779 | 3300046511 | Ga0495608_0525028 | Ga0495608_0525028_89_361 | 90 |
| 780 | 3300046512 | Ga0495610_0041056 | Ga0495610_0041056_1112_1384 | 90 |
| 781 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_114161_114433 | 90 |
| 782 | 3300046515 | Ga0495620_0000784 | Ga0495620_0000784_461_733 | 90 |
| 783 | 3300046515 | Ga0495620_0072027 | Ga0495620_0072027_242_517 | 90 |
| 784 | 3300046516 | Ga0495628_0000679 | Ga0495628_0000679_29136_29408 | 90 |
| 785 | 3300046516 | Ga0495628_0031056 | Ga0495628_0031056_2222_2494 | 90 |
| 786 | 3300046516 | Ga0495628_0074492 | Ga0495628_0074492_2051_2323 | 90 |
| 787 | 3300046516 | Ga0495628_0098751 | Ga0495628_0098751_1784_2056 | 90 |
| 788 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_188422_188694 | 90 |
| 789 | 3300046517 | Ga0495630_0003407 | Ga0495630_0003407_4517_4789 | 90 |
| 790 | 3300046517 | Ga0495630_0069675 | Ga0495630_0069675_1966_2238 | 90 |
| 791 | 3300046523 | Ga0495644_0001871 | Ga0495644_0001871_4374_4646 | 90 |
| 792 | 3300046525 | Ga0495663_0100331 | Ga0495663_0100331_245_517 | 90 |
| 793 | 3300046529 | Ga0495652_0011995 | Ga0495652_0011995_6613_6885 | 90 |
| 794 | 3300046529 | Ga0495652_0214350 | Ga0495652_0214350_1134_1406 | 90 |
| 795 | 3300046533 | Ga0495640_0043829 | Ga0495640_0043829_702_974 | 90 |
| 796 | 3300046533 | Ga0495640_0249307 | Ga0495640_0249307_702_974 | 90 |
| 797 | 3300046533 | Ga0495640_0528033 | Ga0495640_0528033_268_540 | 90 |
| 798 | 3300046535 | Ga0495586_0086430 | Ga0495586_0086430_582_854 | 90 |
| 799 | 3300046536 | Ga0495587_0827437 | Ga0495587_0827437_102_374 | 90 |
| 800 | 3300046543 | Ga0495645_0027447 | Ga0495645_0027447_780_1052 | 90 |
| 801 | 3300046543 | Ga0495645_0046873 | Ga0495645_0046873_2632_2904 | 90 |
| 802 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_66730_67002 | 90 |
| 803 | 3300046615 | Ga0495656_0000465 | Ga0495656_0000465_8376_8648 | 90 |
| 804 | 3300046615 | Ga0495656_0433451 | Ga0495656_0433451_34_312 | 90 |
| 805 | 3300046616 | Ga0495668_0223839 | Ga0495668_0223839_548_820 | 90 |
| 806 | 3300046642 | Ga0495634_0000028 | Ga0495634_0000028_9984_10256 | 90 |
| 807 | 3300046642 | Ga0495634_0001744 | Ga0495634_0001744_13186_13467 | 90 |
| 808 | 3300046642 | Ga0495634_0105054 | Ga0495634_0105054_1059_1331 | 90 |
| 809 | 3300046642 | Ga0495634_0128989 | Ga0495634_0128989_1321_1593 | 90 |
| 810 | 3300046642 | Ga0495634_0386255 | Ga0495634_0386255_423_695 | 90 |
| 811 | 3300046663 | Ga0495635_0026499 | Ga0495635_0026499_246_518 | 90 |
| 812 | 3300046663 | Ga0495635_0328011 | Ga0495635_0328011_692_967 | 90 |
| 813 | 3300046665 | Ga0495661_0575247 | Ga0495661_0575247_143_415 | 90 |
| 814 | 3300046674 | Ga0495588_0000362 | Ga0495588_0000362_20458_20730 | 90 |
| 815 | 3300046674 | Ga0495588_0226240 | Ga0495588_0226240_144_416 | 90 |
| 816 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_254054_254326 | 90 |
| 817 | 3300046675 | Ga0495657_0024829 | Ga0495657_0024829_3623_3895 | 90 |
| 818 | 3300046678 | Ga0495599_0046673 | Ga0495599_0046673_966_1238 | 90 |
| 819 | 3300046680 | Ga0495646_0151250 | Ga0495646_0151250_119_391 | 90 |
| 820 | 3300046680 | Ga0495646_0198191 | Ga0495646_0198191_191_466 | 90 |
| 821 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_109649_109921 | 90 |
| 822 | 3300046681 | Ga0495647_0008133 | Ga0495647_0008133_2572_2844 | 90 |
| 823 | 3300046681 | Ga0495647_0238325 | Ga0495647_0238325_332_607 | 90 |
| 824 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_200996_201268 | 90 |
| 825 | 3300046683 | Ga0495658_0060194 | Ga0495658_0060194_464_736 | 90 |
| 826 | 3300046683 | Ga0495658_0295977 | Ga0495658_0295977_703_978 | 90 |
| 827 | 3300046684 | Ga0495669_0000113 | Ga0495669_0000113_25938_26210 | 90 |
| 828 | 3300046684 | Ga0495669_0399452 | Ga0495669_0399452_137_409 | 90 |
| 829 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_101605_101877 | 90 |
| 830 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_60980_61252 | 90 |
| 831 | 3300046689 | Ga0495613_0039372 | Ga0495613_0039372_1398_1673 | 90 |
| 832 | 3300046690 | Ga0495624_0000417 | Ga0495624_0000417_22984_23256 | 90 |
| 833 | 3300046690 | Ga0495624_0263454 | Ga0495624_0263454_49_321 | 90 |
| 834 | 3300046690 | Ga0495624_0802842 | Ga0495624_0802842_162_434 | 90 |
| 835 | 3300046691 | Ga0495670_0006058 | Ga0495670_0006058_4146_4418 | 90 |
| 836 | 3300046692 | Ga0495671_0459099 | Ga0495671_0459099_92_364 | 90 |
| 837 | 3300046809 | Ga0495600_0011717 | Ga0495600_0011717_2010_2282 | 90 |
| 838 | 3300046809 | Ga0495600_0112106 | Ga0495600_0112106_712_987 | 90 |
| 839 | 3300046809 | Ga0495600_0303642 | Ga0495600_0303642_85_357 | 90 |
| 840 | 3300047315 | Ga0495581_0203413 | Ga0495581_0203413_64_336 | 90 |
| 841 | 3300047315 | Ga0495581_0384812 | Ga0495581_0384812_13_285 | 90 |
| 842 | 3300047317 | Ga0495604_0000239 | Ga0495604_0000239_4583_4855 | 90 |
| 843 | 3300047317 | Ga0495604_0001251 | Ga0495604_0001251_10827_11099 | 90 |
| 844 | 3300047319 | Ga0495674_0247369 | Ga0495674_0247369_389_661 | 90 |
| 845 | 3300047321 | Ga0495676_0000827 | Ga0495676_0000827_10459_10734 | 90 |
| 846 | 3300047321 | Ga0495676_0002855 | Ga0495676_0002855_13198_13470 | 90 |
| 847 | 3300047321 | Ga0495676_0012579 | Ga0495676_0012579_2047_2319 | 90 |
| 848 | 3300047321 | Ga0495676_0028979 | Ga0495676_0028979_3180_3452 | 90 |
| 849 | 3300047321 | Ga0495676_0117131 | Ga0495676_0117131_245_517 | 90 |
| 850 | 3300047321 | Ga0495676_0231492 | Ga0495676_0231492_773_1045 | 90 |
| 851 | 3300047321 | Ga0495676_0280990 | Ga0495676_0280990_754_1026 | 90 |
| 852 | 3300047321 | Ga0495676_0912990 | Ga0495676_0912990_150_422 | 90 |
| 853 | 3300047322 | Ga0495680_0000143 | Ga0495680_0000143_5696_5968 | 90 |
| 854 | 3300047322 | Ga0495680_0001430 | Ga0495680_0001430_6681_6953 | 90 |
| 855 | 3300047322 | Ga0495680_0067314 | Ga0495680_0067314_319_591 | 90 |
| 856 | 3300047444 | Ga0495675_0001421 | Ga0495675_0001421_5683_5955 | 90 |
| 857 | 3300047469 | Ga0495673_0113592 | Ga0495673_0113592_496_768 | 90 |
| 858 | 3300047471 | Ga0495684_0210310 | Ga0495684_0210310_189_461 | 90 |
| 859 | 3300047471 | Ga0495684_1033764 | Ga0495684_1033764_216_491 | 90 |
| 860 | 3300047472 | Ga0495686_0270817 | Ga0495686_0270817_99_371 | 90 |
| 861 | 3300047673 | Ga0495593_0231268 | Ga0495593_0231268_450_722 | 90 |
| 862 | 3300048088 | Ga0495602_0001031 | Ga0495602_0001031_14744_15016 | 90 |
| 863 | 3300048088 | Ga0495602_0156363 | Ga0495602_0156363_1010_1285 | 90 |
| 864 | 3300048088 | Ga0495602_0271539 | Ga0495602_0271539_327_599 | 90 |
| 865 | 3300048088 | Ga0495602_0614244 | Ga0495602_0614244_253_525 | 90 |
| 866 | 3300048088 | Ga0495602_1160562 | Ga0495602_1160562_90_362 | 90 |
| 867 | 3300048089 | Ga0495614_0012048 | Ga0495614_0012048_3219_3491 | 90 |
| 868 | 3300048089 | Ga0495614_0257758 | Ga0495614_0257758_371_643 | 90 |
| 869 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_424150_424425 | 90 |
| 870 | 3300048903 | Ga0496100_0000013 | Ga0496100_0000013_65317_65589 | 90 |
| 871 | 3300048903 | Ga0496100_0013391 | Ga0496100_0013391_2658_2930 | 90 |
| 872 | 3300048903 | Ga0496100_0322156 | Ga0496100_0322156_456_728 | 90 |
| 873 | 3300048903 | Ga0496100_0498137 | Ga0496100_0498137_270_542 | 90 |
| 874 | 3300048903 | Ga0496100_0701642 | Ga0496100_0701642_359_631 | 90 |
| 875 | 3300048903 | Ga0496100_1241638 | Ga0496100_1241638_272_544 | 90 |
| 876 | 3300048903 | Ga0496100_1366887 | Ga0496100_1366887_93_365 | 90 |
| 877 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_225502_225777 | 90 |
| 878 | 3300048904 | Ga0496101_0000035 | Ga0496101_0000035_65317_65589 | 90 |
| 879 | 3300048904 | Ga0496101_0245701 | Ga0496101_0245701_1005_1277 | 90 |
| 880 | 3300048904 | Ga0496101_0789118 | Ga0496101_0789118_200_472 | 90 |
| 881 | 3300048905 | Ga0496102_0000211 | Ga0496102_0000211_10019_10291 | 90 |
| 882 | 3300048905 | Ga0496102_0045517 | Ga0496102_0045517_1805_2077 | 90 |
| 883 | 3300048905 | Ga0496102_0639694 | Ga0496102_0639694_404_676 | 90 |
| 884 | 3300048905 | Ga0496102_1095013 | Ga0496102_1095013_184_456 | 90 |
| 885 | 3300048906 | Ga0496103_0000083 | Ga0496103_0000083_41439_41711 | 90 |
| 886 | 3300048906 | Ga0496103_0006964 | Ga0496103_0006964_3405_3677 | 90 |
| 887 | 3300048906 | Ga0496103_0223100 | Ga0496103_0223100_307_579 | 90 |
| 888 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_259821_260093 | 90 |
| 889 | 3300048907 | Ga0496104_0000026 | Ga0496104_0000026_61971_62246 | 90 |
| 890 | 3300048907 | Ga0496104_0000052 | Ga0496104_0000052_29319_29591 | 90 |
| 891 | 3300048907 | Ga0496104_0000765 | Ga0496104_0000765_27101_27373 | 90 |
| 892 | 3300048907 | Ga0496104_0017182 | Ga0496104_0017182_2132_2404 | 90 |
| 893 | 3300048907 | Ga0496104_0028668 | Ga0496104_0028668_1991_2263 | 90 |
| 894 | 3300048907 | Ga0496104_0317011 | Ga0496104_0317011_675_947 | 90 |
| 895 | 3300048907 | Ga0496104_0666724 | Ga0496104_0666724_646_918 | 90 |
| 896 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_215706_215978 | 90 |
| 897 | 3300048908 | Ga0496105_0000030 | Ga0496105_0000030_107735_108007 | 90 |
| 898 | 3300048908 | Ga0496105_0000409 | Ga0496105_0000409_14241_14513 | 90 |
| 899 | 3300048908 | Ga0496105_0022580 | Ga0496105_0022580_1760_2032 | 90 |
| 900 | 3300048908 | Ga0496105_0022858 | Ga0496105_0022858_4601_4873 | 90 |
| 901 | 3300048908 | Ga0496105_0027673 | Ga0496105_0027673_2744_3016 | 90 |
| 902 | 3300048908 | Ga0496105_0052093 | Ga0496105_0052093_2182_2454 | 90 |
| 903 | 3300048908 | Ga0496105_0672496 | Ga0496105_0672496_338_613 | 90 |
| 904 | 3300048909 | Ga0496106_0000076 | Ga0496106_0000076_21340_21615 | 90 |
| 905 | 3300048909 | Ga0496106_0000121 | Ga0496106_0000121_35218_35490 | 90 |
| 906 | 3300048909 | Ga0496106_0004512 | Ga0496106_0004512_6269_6541 | 90 |
| 907 | 3300048909 | Ga0496106_0012259 | Ga0496106_0012259_2369_2641 | 90 |
| 908 | 3300048909 | Ga0496106_0031326 | Ga0496106_0031326_1706_1978 | 90 |
| 909 | 3300048909 | Ga0496106_0072451 | Ga0496106_0072451_193_465 | 90 |
| 910 | 3300048909 | Ga0496106_0286024 | Ga0496106_0286024_554_826 | 90 |
| 911 | 3300048909 | Ga0496106_0357051 | Ga0496106_0357051_623_895 | 90 |
| 912 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_105823_106098 | 90 |
| 913 | 3300048910 | Ga0496107_0000020 | Ga0496107_0000020_36466_36738 | 90 |
| 914 | 3300048910 | Ga0496107_0016540 | Ga0496107_0016540_4256_4528 | 90 |
| 915 | 3300048910 | Ga0496107_0032962 | Ga0496107_0032962_1807_2079 | 90 |
| 916 | 3300048910 | Ga0496107_0041276 | Ga0496107_0041276_517_789 | 90 |
| 917 | 3300048910 | Ga0496107_0072035 | Ga0496107_0072035_2171_2443 | 90 |
| 918 | 3300048910 | Ga0496107_0089310 | Ga0496107_0089310_518_790 | 90 |
| 919 | 3300048910 | Ga0496107_0481660 | Ga0496107_0481660_497_769 | 90 |
| 920 | 3300048910 | Ga0496107_0568796 | Ga0496107_0568796_463_735 | 90 |
| 921 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_342711_342983 | 90 |
| 922 | 3300048911 | Ga0496108_0000063 | Ga0496108_0000063_89834_90106 | 90 |
| 923 | 3300048911 | Ga0496108_0003280 | Ga0496108_0003280_4649_4921 | 90 |
| 924 | 3300048911 | Ga0496108_0005560 | Ga0496108_0005560_8585_8857 | 90 |
| 925 | 3300048911 | Ga0496108_0015242 | Ga0496108_0015242_3830_4102 | 90 |
| 926 | 3300048911 | Ga0496108_0054035 | Ga0496108_0054035_2490_2762 | 90 |
| 927 | 3300048911 | Ga0496108_0113371 | Ga0496108_0113371_991_1263 | 90 |
| 928 | 3300048911 | Ga0496108_0185162 | Ga0496108_0185162_654_926 | 90 |
| 929 | 3300048911 | Ga0496108_1648461 | Ga0496108_1648461_30_305 | 90 |
| 930 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_109799_110071 | 90 |
| 931 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_22641_22913 | 90 |
| 932 | 3300048912 | Ga0496109_0000348 | Ga0496109_0000348_24294_24566 | 90 |
| 933 | 3300048912 | Ga0496109_0003361 | Ga0496109_0003361_10377_10649 | 90 |
| 934 | 3300048912 | Ga0496109_0005652 | Ga0496109_0005652_287_559 | 90 |
| 935 | 3300048912 | Ga0496109_0068649 | Ga0496109_0068649_1750_2022 | 90 |
| 936 | 3300048912 | Ga0496109_0070649 | Ga0496109_0070649_2509_2781 | 90 |
| 937 | 3300048912 | Ga0496109_0107331 | Ga0496109_0107331_2104_2376 | 90 |
| 938 | 3300048912 | Ga0496109_0130860 | Ga0496109_0130860_1515_1787 | 90 |
| 939 | 3300048912 | Ga0496109_0644781 | Ga0496109_0644781_442_717 | 90 |
| 940 | 3300048912 | Ga0496109_0831491 | Ga0496109_0831491_39_311 | 90 |
| 941 | 3300048913 | Ga0496110_0000183 | Ga0496110_0000183_31828_32103 | 90 |
| 942 | 3300048913 | Ga0496110_0002164 | Ga0496110_0002164_8769_9041 | 90 |
| 943 | 3300048913 | Ga0496110_0012481 | Ga0496110_0012481_6510_6782 | 90 |
| 944 | 3300048913 | Ga0496110_0020894 | Ga0496110_0020894_4393_4665 | 90 |
| 945 | 3300048913 | Ga0496110_0059269 | Ga0496110_0059269_1090_1362 | 90 |
| 946 | 3300048913 | Ga0496110_0088109 | Ga0496110_0088109_1554_1826 | 90 |
| 947 | 3300048913 | Ga0496110_0427934 | Ga0496110_0427934_18_290 | 90 |
| 948 | 3300048914 | Ga0496111_0000006 | Ga0496111_0000006_45398_45673 | 90 |
| 949 | 3300048914 | Ga0496111_0000044 | Ga0496111_0000044_32695_32967 | 90 |
| 950 | 3300048914 | Ga0496111_0012021 | Ga0496111_0012021_3303_3575 | 90 |
| 951 | 3300048914 | Ga0496111_0017776 | Ga0496111_0017776_918_1190 | 90 |
| 952 | 3300048914 | Ga0496111_0047291 | Ga0496111_0047291_318_590 | 90 |
| 953 | 3300048914 | Ga0496111_0117841 | Ga0496111_0117841_814_1086 | 90 |
| 954 | 3300048914 | Ga0496111_0406139 | Ga0496111_0406139_17_289 | 90 |
| 955 | 3300048914 | Ga0496111_0720627 | Ga0496111_0720627_252_524 | 90 |
| 956 | 3300048914 | Ga0496111_0987842 | Ga0496111_0987842_231_512 | 90 |
| 957 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_110671_110943 | 90 |
| 958 | 3300048915 | Ga0496112_0320767 | Ga0496112_0320767_1140_1412 | 90 |
| 959 | 3300048915 | Ga0496112_0852429 | Ga0496112_0852429_345_617 | 90 |
| 960 | 3300048916 | Ga0496113_0038054 | Ga0496113_0038054_1416_1688 | 90 |
| 961 | 3300048916 | Ga0496113_0052521 | Ga0496113_0052521_1992_2264 | 90 |
| 962 | 3300048916 | Ga0496113_0072254 | Ga0496113_0072254_732_1004 | 90 |
| 963 | 3300048916 | Ga0496113_0153224 | Ga0496113_0153224_1340_1612 | 90 |
| 964 | 3300048916 | Ga0496113_1451966 | Ga0496113_1451966_156_428 | 90 |
| 965 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_30029_30301 | 90 |
| 966 | 3300048917 | Ga0496114_0008849 | Ga0496114_0008849_3869_4141 | 90 |
| 967 | 3300048917 | Ga0496114_0070615 | Ga0496114_0070615_1953_2225 | 90 |
| 968 | 3300048917 | Ga0496114_0243025 | Ga0496114_0243025_909_1181 | 90 |
| 969 | 3300048917 | Ga0496114_0385840 | Ga0496114_0385840_67_339 | 90 |
| 970 | 3300048917 | Ga0496114_0484440 | Ga0496114_0484440_708_980 | 90 |
| 971 | 3300048917 | Ga0496114_0738916 | Ga0496114_0738916_168_440 | 90 |
| 972 | 3300048917 | Ga0496114_0747306 | Ga0496114_0747306_47_319 | 90 |
| 973 | 3300048917 | Ga0496114_1053735 | Ga0496114_1053735_26_298 | 90 |
| 974 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_104680_104952 | 90 |
| 975 | 3300048918 | Ga0496115_0000377 | Ga0496115_0000377_17812_18084 | 90 |
| 976 | 3300048918 | Ga0496115_0014845 | Ga0496115_0014845_3335_3607 | 90 |
| 977 | 3300048918 | Ga0496115_0058673 | Ga0496115_0058673_2325_2597 | 90 |
| 978 | 3300048919 | Ga0496116_0000848 | Ga0496116_0000848_12280_12552 | 90 |
| 979 | 3300048921 | Ga0496118_0081280 | Ga0496118_0081280_1968_2240 | 90 |
| 980 | 3300048922 | Ga0496119_0006696 | Ga0496119_0006696_10194_10466 | 90 |
| 981 | 3300048922 | Ga0496119_0074670 | Ga0496119_0074670_390_662 | 90 |
| 982 | 3300048923 | Ga0496120_0020522 | Ga0496120_0020522_3504_3776 | 90 |
| 983 | 3300048923 | Ga0496120_0201590 | Ga0496120_0201590_139_411 | 90 |
| 984 | 3300048923 | Ga0496120_0253122 | Ga0496120_0253122_493_765 | 90 |
| 985 | 3300048924 | Ga0496121_0019544 | Ga0496121_0019544_2061_2333 | 90 |
| 986 | 3300048924 | Ga0496121_0037698 | Ga0496121_0037698_1816_2088 | 90 |
| 987 | 3300048924 | Ga0496121_0061978 | Ga0496121_0061978_2208_2480 | 90 |
| 988 | 3300048927 | Ga0496124_0051640 | Ga0496124_0051640_502_774 | 90 |
| 989 | 3300048927 | Ga0496124_0854420 | Ga0496124_0854420_192_473 | 90 |
| 990 | 3300048928 | Ga0496125_0056109 | Ga0496125_0056109_1584_1856 | 90 |
| 991 | 3300048928 | Ga0496125_0080795 | Ga0496125_0080795_1746_2018 | 90 |
| 992 | 3300048928 | Ga0496125_0104445 | Ga0496125_0104445_1264_1536 | 90 |
| 993 | 3300048929 | Ga0496126_0055061 | Ga0496126_0055061_1419_1691 | 90 |
| 994 | 3300048929 | Ga0496126_0093953 | Ga0496126_0093953_933_1205 | 90 |
| 995 | 3300048929 | Ga0496126_0277289 | Ga0496126_0277289_596_868 | 90 |
| 996 | 3300049568 | Ga0501031_0002175 | Ga0501031_0002175_4716_4988 | 90 |
| 997 | 3300049568 | Ga0501031_0116828 | Ga0501031_0116828_1064_1336 | 90 |
| 998 | 3300049568 | Ga0501031_0231236 | Ga0501031_0231236_710_982 | 90 |
| 999 | 3300049569 | Ga0501032_0029241 | Ga0501032_0029241_2163_2435 | 90 |
| 1000 | 3300049569 | Ga0501032_1060851 | Ga0501032_1060851_71_352 | 90 |
| 1001 | 3300049570 | Ga0501033_0003689 | Ga0501033_0003689_4707_4979 | 90 |
| 1002 | 3300049570 | Ga0501033_0600274 | Ga0501033_0600274_263_574 | 90 |
| 1003 | 3300049571 | Ga0501034_0060242 | Ga0501034_0060242_1847_2119 | 90 |
| 1004 | 3300049571 | Ga0501034_0846348 | Ga0501034_0846348_84_356 | 90 |
| 1005 | 3300049571 | Ga0501034_1296104 | Ga0501034_1296104_285_557 | 90 |
| 1006 | 3300049572 | Ga0501036_0054251 | Ga0501036_0054251_2336_2608 | 90 |
| 1007 | 3300049572 | Ga0501036_0472846 | Ga0501036_0472846_716_988 | 90 |
| 1008 | 3300049572 | Ga0501036_0778303 | Ga0501036_0778303_36_308 | 90 |
| 1009 | 3300049572 | Ga0501036_0883511 | Ga0501036_0883511_348_659 | 90 |
| 1010 | 3300049573 | Ga0501037_0002926 | Ga0501037_0002926_4716_4988 | 90 |
| 1011 | 3300049574 | Ga0501038_0005058 | Ga0501038_0005058_4716_4988 | 90 |
| 1012 | 3300049574 | Ga0501038_0356257 | Ga0501038_0356257_607_879 | 90 |
| 1013 | 3300049574 | Ga0501038_0506083 | Ga0501038_0506083_333_644 | 90 |
| 1014 | 3300049575 | Ga0501039_0136070 | Ga0501039_0136070_1337_1609 | 90 |
| 1015 | 3300049575 | Ga0501039_0511325 | Ga0501039_0511325_607_918 | 90 |
| 1016 | 3300049576 | Ga0501040_0061674 | Ga0501040_0061674_518_790 | 90 |
| 1017 | 3300049576 | Ga0501040_0310184 | Ga0501040_0310184_49_327 | 90 |
| 1018 | 3300049576 | Ga0501040_0454371 | Ga0501040_0454371_142_414 | 90 |
| 1019 | 3300049576 | Ga0501040_0476131 | Ga0501040_0476131_155_466 | 90 |
| 1020 | 3300049576 | Ga0501040_0480873 | Ga0501040_0480873_241_513 | 90 |
| 1021 | 3300049577 | Ga0501041_0273970 | Ga0501041_0273970_609_887 | 90 |
| 1022 | 3300049577 | Ga0501041_0444395 | Ga0501041_0444395_309_581 | 90 |
| 1023 | 3300049577 | Ga0501041_0489910 | Ga0501041_0489910_283_594 | 90 |
| 1024 | 3300049577 | Ga0501041_0599604 | Ga0501041_0599604_394_675 | 90 |
| 1025 | 3300049578 | Ga0501042_0012872 | Ga0501042_0012872_3174_3446 | 90 |
| 1026 | 3300049578 | Ga0501042_0308826 | Ga0501042_0308826_567_839 | 90 |
| 1027 | 3300049578 | Ga0501042_0578302 | Ga0501042_0578302_394_666 | 90 |
| 1028 | 3300049578 | Ga0501042_0648213 | Ga0501042_0648213_184_495 | 90 |
| 1029 | 3300049578 | Ga0501042_0783642 | Ga0501042_0783642_284_556 | 90 |
| 1030 | 3300049579 | Ga0501043_0012332 | Ga0501043_0012332_4716_4988 | 90 |
| 1031 | 3300049579 | Ga0501043_0122982 | Ga0501043_0122982_428_700 | 90 |
| 1032 | 3300049579 | Ga0501043_1334412 | Ga0501043_1334412_73_384 | 90 |
| 1033 | 3300049580 | Ga0501046_0004559 | Ga0501046_0004559_7572_7844 | 90 |
| 1034 | 3300049580 | Ga0501046_0979029 | Ga0501046_0979029_300_578 | 90 |
| 1035 | 3300049581 | Ga0501047_0004952 | Ga0501047_0004952_7523_7795 | 90 |
| 1036 | 3300049581 | Ga0501047_0036469 | Ga0501047_0036469_801_1073 | 90 |
| 1037 | 3300049581 | Ga0501047_0073899 | Ga0501047_0073899_626_898 | 90 |
| 1038 | 3300049581 | Ga0501047_0239337 | Ga0501047_0239337_19_291 | 90 |
| 1039 | 3300049581 | Ga0501047_0341399 | Ga0501047_0341399_371_643 | 90 |
| 1040 | 3300049581 | Ga0501047_0439594 | Ga0501047_0439594_709_981 | 90 |
| 1041 | 3300049581 | Ga0501047_0749317 | Ga0501047_0749317_484_756 | 90 |
| 1042 | 3300049581 | Ga0501047_1080050 | Ga0501047_1080050_118_390 | 90 |
| 1043 | 3300049582 | Ga0501048_0003128 | Ga0501048_0003128_7449_7721 | 90 |
| 1044 | 3300049582 | Ga0501048_0806070 | Ga0501048_0806070_193_465 | 90 |
| 1045 | 3300049583 | Ga0501067_0058076 | Ga0501067_0058076_1744_2016 | 90 |
| 1046 | 3300049583 | Ga0501067_0195064 | Ga0501067_0195064_154_426 | 90 |
| 1047 | 3300049583 | Ga0501067_0479181 | Ga0501067_0479181_374_646 | 90 |
| 1048 | 3300049584 | Ga0501068_0002345 | Ga0501068_0002345_4454_4726 | 90 |
| 1049 | 3300049584 | Ga0501068_0419741 | Ga0501068_0419741_255_527 | 90 |
| 1050 | 3300049584 | Ga0501068_0811080 | Ga0501068_0811080_138_410 | 90 |
| 1051 | 3300049585 | Ga0501069_0004919 | Ga0501069_0004919_1959_2231 | 90 |
| 1052 | 3300049585 | Ga0501069_0076677 | Ga0501069_0076677_630_902 | 90 |
| 1053 | 3300049585 | Ga0501069_0285522 | Ga0501069_0285522_133_405 | 90 |
| 1054 | 3300049585 | Ga0501069_0597746 | Ga0501069_0597746_358_630 | 90 |
| 1055 | 3300049585 | Ga0501069_0663541 | Ga0501069_0663541_94_366 | 90 |
| 1056 | 3300049586 | Ga0501070_0004064 | Ga0501070_0004064_7588_7860 | 90 |
| 1057 | 3300049586 | Ga0501070_0052975 | Ga0501070_0052975_2141_2413 | 90 |
| 1058 | 3300049586 | Ga0501070_0112042 | Ga0501070_0112042_1598_1870 | 90 |
| 1059 | 3300049586 | Ga0501070_0285402 | Ga0501070_0285402_507_779 | 90 |
| 1060 | 3300049586 | Ga0501070_0508727 | Ga0501070_0508727_591_863 | 90 |
| 1061 | 3300049586 | Ga0501070_0741122 | Ga0501070_0741122_364_636 | 90 |
| 1062 | 3300049587 | Ga0501071_0144925 | Ga0501071_0144925_247_519 | 90 |
| 1063 | 3300049587 | Ga0501071_0581455 | Ga0501071_0581455_470_742 | 90 |
| 1064 | 3300049587 | Ga0501071_0760788 | Ga0501071_0760788_53_325 | 90 |
| 1065 | 3300049587 | Ga0501071_1248169 | Ga0501071_1248169_136_414 | 90 |
| 1066 | 3300049587 | Ga0501071_1492584 | Ga0501071_1492584_57_329 | 90 |
| 1067 | 3300049588 | Ga0501072_0017464 | Ga0501072_0017464_4674_4946 | 90 |
| 1068 | 3300049588 | Ga0501072_0262480 | Ga0501072_0262480_721_993 | 90 |
| 1069 | 3300049588 | Ga0501072_0420609 | Ga0501072_0420609_280_552 | 90 |
| 1070 | 3300049588 | Ga0501072_0439029 | Ga0501072_0439029_169_441 | 90 |
| 1071 | 3300049588 | Ga0501072_0484498 | Ga0501072_0484498_125_436 | 90 |
| 1072 | 3300049588 | Ga0501072_1025716 | Ga0501072_1025716_283_555 | 90 |
| 1073 | 3300049589 | Ga0501073_0013576 | Ga0501073_0013576_1010_1282 | 90 |
| 1074 | 3300049589 | Ga0501073_0168325 | Ga0501073_0168325_713_985 | 90 |
| 1075 | 3300049589 | Ga0501073_0923848 | Ga0501073_0923848_234_506 | 90 |
| 1076 | 3300049590 | Ga0501074_0013977 | Ga0501074_0013977_1037_1309 | 90 |
| 1077 | 3300049590 | Ga0501074_0018921 | Ga0501074_0018921_869_1141 | 90 |
| 1078 | 3300049590 | Ga0501074_0119985 | Ga0501074_0119985_709_981 | 90 |
| 1079 | 3300049590 | Ga0501074_1192026 | Ga0501074_1192026_145_426 | 90 |
| 1080 | 3300049591 | Ga0501075_0044891 | Ga0501075_0044891_2140_2412 | 90 |
| 1081 | 3300049591 | Ga0501075_0197282 | Ga0501075_0197282_1140_1451 | 90 |
| 1082 | 3300049591 | Ga0501075_0347161 | Ga0501075_0347161_332_613 | 90 |
| 1083 | 3300049592 | Ga0501076_0165288 | Ga0501076_0165288_643_915 | 90 |
| 1084 | 3300049592 | Ga0501076_0533234 | Ga0501076_0533234_494_766 | 90 |
| 1085 | 3300049592 | Ga0501076_0773037 | Ga0501076_0773037_164_475 | 90 |
| 1086 | 3300049592 | Ga0501076_1203947 | Ga0501076_1203947_280_552 | 90 |
| 1087 | 3300049593 | Ga0501077_0116673 | Ga0501077_0116673_139_450 | 90 |
| 1088 | 3300049593 | Ga0501077_0163550 | Ga0501077_0163550_459_731 | 90 |
| 1089 | 3300049593 | Ga0501077_0166667 | Ga0501077_0166667_169_441 | 90 |
| 1090 | 3300049741 | Ga0501079_0012033 | Ga0501079_0012033_1919_2191 | 90 |
| 1091 | 3300049741 | Ga0501079_0175584 | Ga0501079_0175584_986_1297 | 90 |
| 1092 | 3300049741 | Ga0501079_0355754 | Ga0501079_0355754_399_671 | 90 |
| 1093 | 3300049742 | Ga0501080_0015300 | Ga0501080_0015300_2149_2421 | 90 |
| 1094 | 3300049742 | Ga0501080_0030783 | Ga0501080_0030783_1638_1910 | 90 |
| 1095 | 3300049742 | Ga0501080_1744556 | Ga0501080_1744556_203_475 | 90 |
| 1096 | 3300049743 | Ga0501081_0261497 | Ga0501081_0261497_582_893 | 90 |
| 1097 | 3300049743 | Ga0501081_0458392 | Ga0501081_0458392_479_751 | 90 |
| 1098 | 3300049744 | Ga0501083_0002614 | Ga0501083_0002614_7425_7697 | 90 |
| 1099 | 3300049744 | Ga0501083_0080795 | Ga0501083_0080795_435_707 | 90 |
| 1100 | 3300049744 | Ga0501083_0533664 | Ga0501083_0533664_125_436 | 90 |
| 1101 | 3300049744 | Ga0501083_0845170 | Ga0501083_0845170_173_454 | 90 |
| 1102 | 3300049822 | Ga0501035_0005116 | Ga0501035_0005116_7433_7705 | 90 |
| 1103 | 3300049822 | Ga0501035_0137851 | Ga0501035_0137851_342_614 | 90 |
| 1104 | 3300049823 | Ga0501044_0006919 | Ga0501044_0006919_7496_7768 | 90 |
| 1105 | 3300049823 | Ga0501044_0128972 | Ga0501044_0128972_432_704 | 90 |
| 1106 | 3300049823 | Ga0501044_0193833 | Ga0501044_0193833_446_718 | 90 |
| 1107 | 3300049823 | Ga0501044_0478439 | Ga0501044_0478439_693_965 | 90 |
| 1108 | 3300049823 | Ga0501044_0541717 | Ga0501044_0541717_761_1033 | 90 |
| 1109 | 3300049824 | Ga0501045_0388877 | Ga0501045_0388877_170_451 | 90 |
| 1110 | 3300049824 | Ga0501045_0447533 | Ga0501045_0447533_156_428 | 90 |
| 1111 | 3300049824 | Ga0501045_0473108 | Ga0501045_0473108_201_473 | 90 |
| 1112 | 3300049824 | Ga0501045_0842390 | Ga0501045_0842390_130_402 | 90 |
| 1113 | 3300050490 | nmdc:mga03n38_617731_c1 | nmdc:mga03n38_617731_c1_317_589 | 90 |
| 1114 | 3300050491 | nmdc:mga00v17_156003_c1 | nmdc:mga00v17_156003_c1_992_1264 | 90 |
| 1115 | 3300050491 | nmdc:mga00v17_16288_c1 | nmdc:mga00v17_16288_c1_1165_1440 | 90 |
| 1116 | 3300050491 | nmdc:mga00v17_888749_c1 | nmdc:mga00v17_888749_c1_33_305 | 90 |
| 1117 | 3300050491 | nmdc:mga00v17_920239_c1 | nmdc:mga00v17_920239_c1_232_504 | 90 |
| 1118 | 3300050491 | nmdc:mga00v17_964283_c1 | nmdc:mga00v17_964283_c1_179_451 | 90 |
| 1119 | 3300050492 | nmdc:mga0yw44_362973_c1 | nmdc:mga0yw44_362973_c1_377_652 | 90 |
| 1120 | 3300050492 | nmdc:mga0yw44_37019_c1 | nmdc:mga0yw44_37019_c1_44_316 | 90 |
| 1121 | 3300050492 | nmdc:mga0yw44_589_c1 | nmdc:mga0yw44_589_c1_7067_7339 | 90 |
| 1122 | 3300050492 | nmdc:mga0yw44_675_c1 | nmdc:mga0yw44_675_c1_10850_11122 | 90 |
| 1123 | 3300050492 | nmdc:mga0yw44_8725_c1 | nmdc:mga0yw44_8725_c1_1533_1808 | 90 |
| 1124 | 3300050492 | nmdc:mga0yw44_939551_c1 | nmdc:mga0yw44_939551_c1_159_434 | 90 |
| 1125 | 3300050495 | nmdc:mga04h51_373446_c1 | nmdc:mga04h51_373446_c1_227_499 | 90 |
| 1126 | 3300050507 | nmdc:mga05p37_104196_c1 | nmdc:mga05p37_104196_c1_990_1268 | 90 |
| 1127 | 3300050507 | nmdc:mga05p37_264955_c1 | nmdc:mga05p37_264955_c1_1155_1433 | 90 |
| 1128 | 3300050507 | nmdc:mga05p37_265689_c1 | nmdc:mga05p37_265689_c1_1361_1633 | 90 |
| 1129 | 3300050507 | nmdc:mga05p37_573885_c1 | nmdc:mga05p37_573885_c1_80_352 | 90 |
| 1130 | 3300050508 | nmdc:mga09592_791912_c1 | nmdc:mga09592_791912_c1_363_635 | 90 |
| 1131 | 3300050509 | nmdc:mga0qj67_429735_c1 | nmdc:mga0qj67_429735_c1_717_989 | 90 |
| 1132 | 3300050509 | nmdc:mga0qj67_901433_c1 | nmdc:mga0qj67_901433_c1_17_289 | 90 |
| 1133 | 3300050510 | nmdc:mga06r32_1039450_c1 | nmdc:mga06r32_1039450_c1_400_672 | 90 |
| 1134 | 3300050510 | nmdc:mga06r32_1149952_c1 | nmdc:mga06r32_1149952_c1_236_508 | 90 |
| 1135 | 3300050510 | nmdc:mga06r32_232932_c1 | nmdc:mga06r32_232932_c1_341_613 | 90 |
| 1136 | 3300050510 | nmdc:mga06r32_274139_c1 | nmdc:mga06r32_274139_c1_315_593 | 90 |
| 1137 | 3300050510 | nmdc:mga06r32_30761_c1 | nmdc:mga06r32_30761_c1_3463_3735 | 90 |
| 1138 | 3300050511 | nmdc:mga08y16_1082708_c1 | nmdc:mga08y16_1082708_c1_33_305 | 90 |
| 1139 | 3300050511 | nmdc:mga08y16_18776_c1 | nmdc:mga08y16_18776_c1_6147_6419 | 90 |
| 1140 | 3300050511 | nmdc:mga08y16_216105_c1 | nmdc:mga08y16_216105_c1_716_994 | 90 |
| 1141 | 3300050511 | nmdc:mga08y16_53460_c1 | nmdc:mga08y16_53460_c1_2992_3264 | 90 |
| 1142 | 3300050512 | nmdc:mga0n895_11763_c1 | nmdc:mga0n895_11763_c1_3645_3917 | 90 |
| 1143 | 3300050512 | nmdc:mga0n895_257834_c1 | nmdc:mga0n895_257834_c1_1059_1331 | 90 |
| 1144 | 3300050512 | nmdc:mga0n895_960240_c1 | nmdc:mga0n895_960240_c1_109_381 | 90 |
| 1145 | 3300050513 | nmdc:mga0rr50_1504144_c1 | nmdc:mga0rr50_1504144_c1_109_381 | 90 |
| 1146 | 3300050513 | nmdc:mga0rr50_493066_c1 | nmdc:mga0rr50_493066_c1_543_815 | 90 |
| 1147 | 3300050513 | nmdc:mga0rr50_52783_c1 | nmdc:mga0rr50_52783_c1_671_943 | 90 |
| 1148 | 3300050514 | nmdc:mga08x19_127889_c1 | nmdc:mga08x19_127889_c1_1002_1274 | 90 |
| 1149 | 3300050514 | nmdc:mga08x19_591136_c1 | nmdc:mga08x19_591136_c1_324_596 | 90 |
| 1150 | 3300050515 | nmdc:mga0a205_1200945_c1 | nmdc:mga0a205_1200945_c1_98_373 | 90 |
| 1151 | 3300050515 | nmdc:mga0a205_15449_c1 | nmdc:mga0a205_15449_c1_4421_4693 | 90 |
| 1152 | 3300050515 | nmdc:mga0a205_162660_c1 | nmdc:mga0a205_162660_c1_1682_1954 | 90 |
| 1153 | 3300050515 | nmdc:mga0a205_53_c2 | nmdc:mga0a205_53_c2_9522_9794 | 90 |
| 1154 | 3300053077 | Ga0495601_0000060 | Ga0495601_0000060_31996_32268 | 90 |
| 1155 | 3300053077 | Ga0495601_0029935 | Ga0495601_0029935_1257_1529 | 90 |
| 1156 | 3300053077 | Ga0495601_0059708 | Ga0495601_0059708_1985_2257 | 90 |
| 1157 | 3300053077 | Ga0495601_0080854 | Ga0495601_0080854_797_1072 | 90 |
| 1158 | 3300053077 | Ga0495601_0190542 | Ga0495601_0190542_822_1094 | 90 |
| 1159 | 3300053077 | Ga0495601_0380882 | Ga0495601_0380882_294_566 | 90 |
| 1160 | 3300053078 | Ga0495612_0000210 | Ga0495612_0000210_7456_7728 | 90 |
| 1161 | 3300053078 | Ga0495612_0003362 | Ga0495612_0003362_4248_4520 | 90 |
| 1162 | 3300053078 | Ga0495612_0003484 | Ga0495612_0003484_1821_2093 | 90 |
| 1163 | 3300053078 | Ga0495612_0038634 | Ga0495612_0038634_486_758 | 90 |
| 1164 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_200195_200467 | 90 |
| 1165 | 3300053083 | Ga0495655_0117794 | Ga0495655_0117794_16_288 | 90 |
| 1166 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_191316_191588 | 90 |
| 1167 | 3300053084 | Ga0495595_0000045 | Ga0495595_0000045_22203_22475 | 90 |
| 1168 | 3300053084 | Ga0495595_0335600 | Ga0495595_0335600_376_648 | 90 |
| 1169 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_192799_193071 | 90 |
| 1170 | 3300053085 | Ga0495619_0000095 | Ga0495619_0000095_8556_8828 | 90 |
| 1171 | 3300053085 | Ga0495619_0000102 | Ga0495619_0000102_48620_48892 | 90 |
| 1172 | 3300053085 | Ga0495619_0000155 | Ga0495619_0000155_41782_42057 | 90 |
| 1173 | 3300053085 | Ga0495619_0000320 | Ga0495619_0000320_15555_15830 | 90 |
| 1174 | 3300053085 | Ga0495619_0006754 | Ga0495619_0006754_1687_1962 | 90 |
| 1175 | 3300053085 | Ga0495619_0036802 | Ga0495619_0036802_1610_1882 | 90 |
| 1176 | 3300053085 | Ga0495619_0058401 | Ga0495619_0058401_360_635 | 90 |
| 1177 | 3300053085 | Ga0495619_0967005 | Ga0495619_0967005_82_363 | 90 |
| 1178 | 3300053094 | Ga0500566_0001093 | Ga0500566_0001093_9841_10113 | 90 |
| 1179 | 3300053094 | Ga0500566_0264729 | Ga0500566_0264729_26_298 | 90 |
| 1180 | 3300053119 | Ga0500595_040810 | Ga0500595_040810_895_1167 | 90 |
| 1181 | 3300053119 | Ga0500595_061022 | Ga0500595_061022_261_533 | 90 |
| 1182 | 3300053123 | Ga0500614_001424 | Ga0500614_001424_2914_3186 | 90 |
| 1183 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_288864_289136 | 90 |
| 1184 | 3300054114 | Ga0501084_0110493 | Ga0501084_0110493_157_435 | 90 |
| 1185 | 3300054114 | Ga0501084_0141490 | Ga0501084_0141490_1495_1776 | 90 |
| 1186 | 3300054114 | Ga0501084_0163151 | Ga0501084_0163151_1022_1294 | 90 |
| 1187 | 3300054114 | Ga0501084_0382295 | Ga0501084_0382295_15_287 | 90 |
| 1188 | 3300054114 | Ga0501084_0905945 | Ga0501084_0905945_184_495 | 90 |
| 1189 | 3300054114 | Ga0501084_1058013 | Ga0501084_1058013_130_405 | 90 |
| 1190 | 3300054114 | Ga0501084_1404693 | Ga0501084_1404693_97_372 | 90 |
| 1191 | 3300054114 | Ga0501084_1598320 | Ga0501084_1598320_48_320 | 90 |
| 1192 | 3300060353 | Ga0501082_0044987 | Ga0501082_0044987_1254_1526 | 90 |
| 1193 | 3300060353 | Ga0501082_0857311 | Ga0501082_0857311_355_636 | 90 |
| 1194 | 3300060353 | Ga0501082_1323183 | Ga0501082_1323183_68_379 | 90 |
| 1195 | 3300061734 | Ga0530510_0020050 | Ga0530510_0020050_3824_4102 | 90 |
| 1196 | 3300061734 | Ga0530510_0473044 | Ga0530510_0473044_539_811 | 90 |
| 1197 | 3300061734 | Ga0530510_0789843 | Ga0530510_0789843_308_586 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.9312 | 2 | 90 |
| 1v8c-assembly1.cif.gz_A | crystal structure of moad related protein from thermus thermophilus hb8 | 0.9234 | 4 | 90 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.9214 | 2 | 90 |
| 1v8c-assembly3.cif.gz_B | crystal structure of moad related protein from thermus thermophilus hb8 | 0.8976 | 4 | 86 |
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.8972 | 3 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9312 | 2 | 90 | 3.10.20.30 |
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9214 | 2 | 90 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8994 | 4 | 85 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8972 | 2 | 87 | 3.10.20.30 |
| 2l52A00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8833 | 2 | 90 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838PUQ2-F1-model_v4 | MoaD/ThiS family protein | 0.985 | 1 | 82 |
|
| AF-A0A538C6W4-F1-model_v4 | MoaD/ThiS family protein | 0.9814 | 1 | 90 |
|
| AF-A0A7W1LXI2-F1-model_v4 | MoaD/ThiS family protein | 0.9811 | 1 | 90 |
|
| AF-A0A330LVM2-F1-model_v4 | Putative adenylyltransferase/sulfurtransferase MoeZ (EC 2.7.7.-, EC 2.8.1.-) | 0.979 | 1 | 90 |
GO:0004792
GO:0005524 GO:0005829 GO:0008146 GO:0008641 GO:0016779 |
| AF-A0A7C5YAF4-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9774 | 1 | 81 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar