F491514
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1195 | 636 | 1012 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300021377|Ga0213874_10015808|Ga0213874_100158082 |
| Length | 157 |
| Sequence | MQIEYFQLIDRILDLNLEEKTITVEAQVPKQSTIFEGHFPGYPIMPGVLLIESMAQTSGWLLLALLKFERMPFLAAVKEAKMRGGFVPPGELLTIEASLVHEGSGYAITDARIKVGGTLRCNATITFRHVAFPSPHLREHMDAVAKRIGFPQQAFQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 19 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 20 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 21 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 22 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 23 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 24 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 25 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 26 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 27 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 28 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 29 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 30 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 31 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 32 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 33 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 34 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 35 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 36 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 37 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 38 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 39 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 40 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 41 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 44 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 45 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 48 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 49 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 50 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 51 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 52 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 56 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 57 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 58 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 59 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 60 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 61 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 62 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 63 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 64 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 65 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 66 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 67 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 70 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 71 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 72 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 73 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 74 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 75 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 76 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 77 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 78 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 79 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 80 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 81 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 82 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 83 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 84 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 85 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 86 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 87 | 2922368715 | |||
| 88 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 89 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 90 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 91 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 92 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 93 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 94 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 95 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 96 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 97 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 98 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 99 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 100 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 101 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 102 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 103 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 104 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 105 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 106 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 107 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 108 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 109 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 110 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 111 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 112 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 113 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 114 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 115 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 116 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 117 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 118 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 119 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 120 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 121 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 122 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 123 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 124 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 125 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 126 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 127 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 128 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 129 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 130 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 131 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 132 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 133 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 134 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 135 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 136 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 137 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 138 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 139 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 140 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 141 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 142 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 143 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 144 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 145 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 146 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 147 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 148 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 149 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 150 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 151 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 152 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 153 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 154 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 155 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 156 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 157 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 158 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 159 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 160 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 161 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 162 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 163 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 164 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 165 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 166 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 167 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 169 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 170 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 172 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 173 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 174 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 176 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 192 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 194 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 195 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 199 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 201 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 202 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 203 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 204 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 205 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 206 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 207 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 208 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 209 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 210 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 211 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 212 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 214 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 215 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 216 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 217 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 221 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 222 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 223 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 224 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 226 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 227 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 228 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 230 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 231 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 232 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 254 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 259 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 260 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 261 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 262 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 263 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 264 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 265 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 271 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 272 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 330 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 331 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 332 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 333 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 338 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 339 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 340 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 341 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 342 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 343 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 344 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 345 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 346 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 347 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 348 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 349 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 350 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 351 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 352 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 353 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 354 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 355 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 356 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 357 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 358 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 359 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 360 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 361 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 362 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 363 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 364 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 365 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 366 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 367 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 368 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 369 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 370 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 371 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 372 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 373 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 374 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 375 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 376 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 377 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 378 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 379 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 380 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 381 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 382 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 383 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 384 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 385 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 386 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 387 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 388 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 389 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 390 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 391 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 392 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 393 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 394 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 395 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 396 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 397 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 398 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 399 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 400 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 401 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 402 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 403 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 404 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 405 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 406 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 407 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 408 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 409 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 410 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 411 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 412 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 413 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 414 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 415 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 416 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 490 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 491 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 492 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 493 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 494 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 495 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 496 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 497 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 498 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 499 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 500 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 501 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 502 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 503 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 504 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 505 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 506 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 507 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 508 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 509 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 510 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 511 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 512 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 513 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 514 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 515 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 536 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 537 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 538 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 539 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 540 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 541 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 542 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 543 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 545 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 548 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 549 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 553 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 554 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 556 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 557 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 558 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 559 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 560 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 562 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 563 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 564 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 565 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 566 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 567 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 568 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 569 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 570 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 571 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 572 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 573 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 574 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 575 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 576 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 577 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 578 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 579 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 580 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 581 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 582 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 583 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 584 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 585 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 586 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 587 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 588 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 589 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 590 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 591 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 592 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 593 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 594 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 595 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 596 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 597 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 598 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 599 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 600 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 601 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 602 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 603 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 604 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 605 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 606 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 607 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 608 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 609 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 610 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 611 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 612 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 613 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 614 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 615 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 616 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 617 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 618 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 619 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 620 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 621 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 622 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 623 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 624 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 625 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 626 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 627 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 628 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 629 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 630 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 631 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 632 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 633 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 634 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 635 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 636 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.67 |
| Metatranscriptomes | 0.08 |
| Isolates | 15.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.74 |
| Nodule | 11.97 |
| Rhizoplane | 6.44 |
| Rhizosphere | 52.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1004015 | 3300003214 | Bacteria | 3346 |
| 2 | JGI25153J46596_10001910 | 3300003215 | Bacteria | 12359 |
| 3 | JGI25153J46596_10017357 | 3300003215 | Bacteria | 2838 |
| 4 | JGI25160J50197_1012180 | 3300003354 | Bacteria | 3004 |
| 5 | JGI25160J50197_1014115 | 3300003354 | Bacteria | 2687 |
| 6 | Ga0055539_1011018 | 3300003752 | Bacteria | 1117 |
| 7 | Ga0055525_1004569 | 3300003759 | Bacteria | 1188 |
| 8 | Ga0055542_1011971 | 3300003762 | Bacteria | 1516 |
| 9 | Ga0055529_1017403 | 3300003763 | Bacteria | 901 |
| 10 | Ga0055526_1027163 | 3300003771 | Bacteria | 1778 |
| 11 | Ga0055524_1022327 | 3300003775 | Bacteria | 2071 |
| 12 | Ga0055531_10021404 | 3300003794 | Bacteria | 2509 |
| 13 | Ga0055543_1020348 | 3300004625 | Bacteria | 1220 |
| 14 | Ga0065165_1001250 | 3300005262 | Bacteria | 28850 |
| 15 | Ga0065165_1029674 | 3300005262 | Bacteria | 1749 |
| 16 | Ga0065165_1083704 | 3300005262 | Bacteria | 823 |
| 17 | Ga0070658_10065051 | 3300005327 | Bacteria | 2975 |
| 18 | Ga0070658_10956154 | 3300005327 | Bacteria | 745 |
| 19 | Ga0070683_100507935 | 3300005329 | Bacteria | 1152 |
| 20 | Ga0070690_100293741 | 3300005330 | Bacteria | 1163 |
| 21 | Ga0070670_100115805 | 3300005331 | Bacteria | 2311 |
| 22 | Ga0070680_100037530 | 3300005336 | Bacteria | 3915 |
| 23 | Ga0070680_100182490 | 3300005336 | Bacteria | 1768 |
| 24 | Ga0070680_100390502 | 3300005336 | Bacteria | 1185 |
| 25 | Ga0070680_100868753 | 3300005336 | Bacteria | 778 |
| 26 | Ga0070682_101040068 | 3300005337 | Bacteria | 682 |
| 27 | Ga0068868_100289922 | 3300005338 | Bacteria | 1387 |
| 28 | Ga0070660_100063701 | 3300005339 | Bacteria | 2866 |
| 29 | Ga0070660_100242798 | 3300005339 | Bacteria | 1467 |
| 30 | Ga0070660_100362590 | 3300005339 | Bacteria | 1194 |
| 31 | Ga0070660_100475100 | 3300005339 | Bacteria | 1039 |
| 32 | Ga0070689_100118919 | 3300005340 | Bacteria | 2109 |
| 33 | Ga0070689_101101491 | 3300005340 | Bacteria | 710 |
| 34 | Ga0070691_10032104 | 3300005341 | Bacteria | 2466 |
| 35 | Ga0070661_100199740 | 3300005344 | Bacteria | 1527 |
| 36 | Ga0070661_100445586 | 3300005344 | Bacteria | 1029 |
| 37 | Ga0070668_100121121 | 3300005347 | Bacteria | 2091 |
| 38 | Ga0070668_100123332 | 3300005347 | Bacteria | 2073 |
| 39 | Ga0070671_100098494 | 3300005355 | Bacteria | 2453 |
| 40 | Ga0070688_100754461 | 3300005365 | Bacteria | 758 |
| 41 | Ga0070659_100023050 | 3300005366 | Bacteria | 4760 |
| 42 | Ga0070659_100484750 | 3300005366 | Bacteria | 1052 |
| 43 | Ga0070659_100686335 | 3300005366 | Bacteria | 885 |
| 44 | Ga0070659_100774739 | 3300005366 | Bacteria | 833 |
| 45 | Ga0070667_100308698 | 3300005367 | Bacteria | 1425 |
| 46 | Ga0070667_100658490 | 3300005367 | Bacteria | 967 |
| 47 | Ga0070709_10000751 | 3300005434 | Bacteria | 18320 |
| 48 | Ga0070709_10006118 | 3300005434 | Bacteria | 6547 |
| 49 | Ga0070714_100001123 | 3300005435 | Bacteria | 19235 |
| 50 | Ga0070714_100012709 | 3300005435 | Bacteria | 6725 |
| 51 | Ga0070714_100081809 | 3300005435 | Bacteria | 2812 |
| 52 | Ga0070714_100337867 | 3300005435 | Bacteria | 1412 |
| 53 | Ga0070714_100980869 | 3300005435 | Bacteria | 822 |
| 54 | Ga0070713_100000647 | 3300005436 | Bacteria | 22255 |
| 55 | Ga0070713_100006657 | 3300005436 | Bacteria | 8039 |
| 56 | Ga0070713_100181230 | 3300005436 | Bacteria | 1893 |
| 57 | Ga0070713_101389385 | 3300005436 | Bacteria | 681 |
| 58 | Ga0070710_10001077 | 3300005437 | Bacteria | 12915 |
| 59 | Ga0070710_10001287 | 3300005437 | Bacteria | 11902 |
| 60 | Ga0070711_100004377 | 3300005439 | Bacteria | 8321 |
| 61 | Ga0070711_100014618 | 3300005439 | Bacteria | 4947 |
| 62 | Ga0070663_100017304 | 3300005455 | Bacteria | 4703 |
| 63 | Ga0070663_100027716 | 3300005455 | Bacteria | 3849 |
| 64 | Ga0070663_100291995 | 3300005455 | Bacteria | 1302 |
| 65 | Ga0070663_100302288 | 3300005455 | Bacteria | 1281 |
| 66 | Ga0070663_100494689 | 3300005455 | Bacteria | 1014 |
| 67 | Ga0070663_100863507 | 3300005455 | Bacteria | 779 |
| 68 | Ga0070678_100110148 | 3300005456 | Bacteria | 2153 |
| 69 | Ga0070662_101050919 | 3300005457 | Bacteria | 698 |
| 70 | Ga0070681_10014556 | 3300005458 | Bacteria | 7827 |
| 71 | Ga0070681_10079676 | 3300005458 | Bacteria | 3231 |
| 72 | Ga0070681_10080405 | 3300005458 | Bacteria | 3215 |
| 73 | Ga0070681_10669455 | 3300005458 | Bacteria | 953 |
| 74 | Ga0070679_100013382 | 3300005530 | Bacteria | 7856 |
| 75 | Ga0070679_100082005 | 3300005530 | Bacteria | 3215 |
| 76 | Ga0070679_100085568 | 3300005530 | Bacteria | 3140 |
| 77 | Ga0070679_100215125 | 3300005530 | Bacteria | 1884 |
| 78 | Ga0070679_100476208 | 3300005530 | Bacteria | 1193 |
| 79 | Ga0070679_100745922 | 3300005530 | Bacteria | 922 |
| 80 | Ga0070679_100814556 | 3300005530 | Bacteria | 877 |
| 81 | Ga0070684_100018906 | 3300005535 | Bacteria | 5689 |
| 82 | Ga0070684_100045861 | 3300005535 | Bacteria | 3786 |
| 83 | Ga0070684_101536186 | 3300005535 | Bacteria | 628 |
| 84 | Ga0068853_100047159 | 3300005539 | Bacteria | 3697 |
| 85 | Ga0068853_100096401 | 3300005539 | Bacteria | 2610 |
| 86 | Ga0068853_100330422 | 3300005539 | Bacteria | 1414 |
| 87 | Ga0068853_100638239 | 3300005539 | Bacteria | 1013 |
| 88 | Ga0068853_101569545 | 3300005539 | Bacteria | 638 |
| 89 | Ga0070693_100061094 | 3300005547 | Bacteria | 2190 |
| 90 | Ga0070665_100233806 | 3300005548 | Bacteria | 1838 |
| 91 | Ga0070665_100409309 | 3300005548 | Bacteria | 1364 |
| 92 | Ga0070665_100455287 | 3300005548 | Bacteria | 1289 |
| 93 | Ga0070665_100474852 | 3300005548 | Bacteria | 1261 |
| 94 | Ga0070665_100800182 | 3300005548 | Bacteria | 956 |
| 95 | Ga0070704_100325569 | 3300005549 | Bacteria | 1289 |
| 96 | Ga0068855_100077895 | 3300005563 | Bacteria | 3846 |
| 97 | Ga0068855_100095252 | 3300005563 | Bacteria | 3431 |
| 98 | Ga0068855_100142669 | 3300005563 | Bacteria | 2728 |
| 99 | Ga0068855_100239930 | 3300005563 | Bacteria | 2026 |
| 100 | Ga0068855_101188570 | 3300005563 | Bacteria | 793 |
| 101 | Ga0068855_101382155 | 3300005563 | Bacteria | 726 |
| 102 | Ga0070664_100391379 | 3300005564 | Bacteria | 1270 |
| 103 | Ga0070664_101060853 | 3300005564 | Bacteria | 762 |
| 104 | Ga0068857_100214729 | 3300005577 | Bacteria | 1756 |
| 105 | Ga0068857_100279426 | 3300005577 | Bacteria | 1535 |
| 106 | Ga0068857_100604737 | 3300005577 | Bacteria | 1037 |
| 107 | Ga0068857_101132655 | 3300005577 | Bacteria | 756 |
| 108 | Ga0068857_101352488 | 3300005577 | Bacteria | 692 |
| 109 | Ga0068854_100249881 | 3300005578 | Bacteria | 1416 |
| 110 | Ga0068854_100583027 | 3300005578 | Bacteria | 952 |
| 111 | Ga0068856_100085960 | 3300005614 | Bacteria | 3125 |
| 112 | Ga0068856_100381119 | 3300005614 | Bacteria | 1429 |
| 113 | Ga0068856_100603986 | 3300005614 | Bacteria | 1118 |
| 114 | Ga0068856_101234211 | 3300005614 | Bacteria | 764 |
| 115 | Ga0068856_102284394 | 3300005614 | Bacteria | 549 |
| 116 | Ga0068852_100051692 | 3300005616 | Bacteria | 3528 |
| 117 | Ga0068852_100240316 | 3300005616 | Bacteria | 1730 |
| 118 | Ga0068852_100844000 | 3300005616 | Bacteria | 931 |
| 119 | Ga0068859_100721536 | 3300005617 | Bacteria | 1087 |
| 120 | Ga0068864_101123519 | 3300005618 | Bacteria | 783 |
| 121 | Ga0068866_10864738 | 3300005718 | Bacteria | 633 |
| 122 | Ga0068866_11218860 | 3300005718 | Bacteria | 544 |
| 123 | Ga0068851_10055902 | 3300005834 | Bacteria | 2012 |
| 124 | Ga0068863_100285454 | 3300005841 | Bacteria | 1600 |
| 125 | Ga0068863_100304776 | 3300005841 | Bacteria | 1546 |
| 126 | Ga0068863_101085821 | 3300005841 | Bacteria | 805 |
| 127 | Ga0068858_100120356 | 3300005842 | Bacteria | 2455 |
| 128 | Ga0068858_100707434 | 3300005842 | Bacteria | 980 |
| 129 | Ga0068862_100680894 | 3300005844 | Bacteria | 994 |
| 130 | Ga0081540_1004236 | 3300005983 | Bacteria | 11018 |
| 131 | Ga0081540_1010774 | 3300005983 | Bacteria | 6148 |
| 132 | Ga0070717_10000905 | 3300006028 | Bacteria | 19709 |
| 133 | Ga0070717_10004417 | 3300006028 | Bacteria | 10151 |
| 134 | Ga0070717_10678789 | 3300006028 | Bacteria | 935 |
| 135 | Ga0070717_11298683 | 3300006028 | Bacteria | 661 |
| 136 | Ga0075365_10007374 | 3300006038 | Bacteria | 6151 |
| 137 | Ga0075365_10027847 | 3300006038 | Bacteria | 3599 |
| 138 | Ga0075365_10031750 | 3300006038 | Bacteria | 3389 |
| 139 | Ga0075365_10171287 | 3300006038 | Bacteria | 1515 |
| 140 | Ga0075365_10471560 | 3300006038 | Bacteria | 887 |
| 141 | Ga0075365_10543526 | 3300006038 | Bacteria | 822 |
| 142 | Ga0075368_10000443 | 3300006042 | Bacteria | 12217 |
| 143 | Ga0075368_10007756 | 3300006042 | Bacteria | 3801 |
| 144 | Ga0075363_100027645 | 3300006048 | Bacteria | 2910 |
| 145 | Ga0075363_100094310 | 3300006048 | Bacteria | 1650 |
| 146 | Ga0075363_100121681 | 3300006048 | Bacteria | 1458 |
| 147 | Ga0075363_100244850 | 3300006048 | Bacteria | 1031 |
| 148 | Ga0075364_10058986 | 3300006051 | Bacteria | 2516 |
| 149 | Ga0075364_10236121 | 3300006051 | Bacteria | 1242 |
| 150 | Ga0070715_10000111 | 3300006163 | Bacteria | 20025 |
| 151 | Ga0070715_10117541 | 3300006163 | Bacteria | 1263 |
| 152 | Ga0070716_100008083 | 3300006173 | Bacteria | 5209 |
| 153 | Ga0070716_100021118 | 3300006173 | Bacteria | 3427 |
| 154 | Ga0070716_100023807 | 3300006173 | Bacteria | 3253 |
| 155 | Ga0070716_100357792 | 3300006173 | Bacteria | 1036 |
| 156 | Ga0070716_100537428 | 3300006173 | Bacteria | 869 |
| 157 | Ga0070716_100977719 | 3300006173 | Bacteria | 668 |
| 158 | Ga0070712_100109890 | 3300006175 | Bacteria | 2055 |
| 159 | Ga0070712_100699536 | 3300006175 | Bacteria | 864 |
| 160 | Ga0070712_100718820 | 3300006175 | Bacteria | 853 |
| 161 | Ga0070712_101032778 | 3300006175 | Bacteria | 712 |
| 162 | Ga0075362_10022013 | 3300006177 | Bacteria | 2681 |
| 163 | Ga0075362_10064656 | 3300006177 | Bacteria | 1660 |
| 164 | Ga0075362_10301813 | 3300006177 | Bacteria | 795 |
| 165 | Ga0075367_10010758 | 3300006178 | Bacteria | 4818 |
| 166 | Ga0075367_10088555 | 3300006178 | Bacteria | 1881 |
| 167 | Ga0075367_10441545 | 3300006178 | Bacteria | 824 |
| 168 | Ga0075369_10002023 | 3300006186 | Bacteria | 7141 |
| 169 | Ga0075369_10002445 | 3300006186 | Bacteria | 6624 |
| 170 | Ga0075369_10043109 | 3300006186 | Bacteria | 1935 |
| 171 | Ga0075369_10046711 | 3300006186 | Bacteria | 1865 |
| 172 | Ga0075369_10075978 | 3300006186 | Bacteria | 1484 |
| 173 | Ga0075369_10192580 | 3300006186 | Bacteria | 940 |
| 174 | Ga0075369_10249280 | 3300006186 | Bacteria | 824 |
| 175 | Ga0075366_10017661 | 3300006195 | Bacteria | 4109 |
| 176 | Ga0075366_10077932 | 3300006195 | Bacteria | 1978 |
| 177 | Ga0097621_100234175 | 3300006237 | Bacteria | 1604 |
| 178 | Ga0097621_100652607 | 3300006237 | Bacteria | 965 |
| 179 | Ga0075370_10036194 | 3300006353 | Bacteria | 2772 |
| 180 | Ga0075370_10120412 | 3300006353 | Bacteria | 1528 |
| 181 | Ga0075370_10162585 | 3300006353 | Bacteria | 1310 |
| 182 | Ga0075370_10311123 | 3300006353 | Bacteria | 937 |
| 183 | Ga0075434_100638582 | 3300006871 | Bacteria | 1083 |
| 184 | Ga0068865_101084785 | 3300006881 | Bacteria | 704 |
| 185 | Ga0097620_100721517 | 3300006931 | Bacteria | 1087 |
| 186 | Ga0099825_1035906 | 3300006941 | Bacteria | 1740 |
| 187 | Ga0099824_1010553 | 3300006942 | Bacteria | 10831 |
| 188 | Ga0099823_1084262 | 3300006944 | Bacteria | 1176 |
| 189 | Ga0105250_10081413 | 3300009092 | Bacteria | 1313 |
| 190 | Ga0105240_10006904 | 3300009093 | Bacteria | 16585 |
| 191 | Ga0105240_10160913 | 3300009093 | Bacteria | 2666 |
| 192 | Ga0105240_10620792 | 3300009093 | Bacteria | 1188 |
| 193 | Ga0105245_10510199 | 3300009098 | Bacteria | 1220 |
| 194 | Ga0105245_10560575 | 3300009098 | Bacteria | 1165 |
| 195 | Ga0105245_11254869 | 3300009098 | Bacteria | 789 |
| 196 | Ga0105247_10023906 | 3300009101 | Bacteria | 3682 |
| 197 | Ga0105247_10451341 | 3300009101 | Bacteria | 927 |
| 198 | Ga0105241_10054047 | 3300009174 | Bacteria | 3073 |
| 199 | Ga0105241_10255381 | 3300009174 | Bacteria | 1488 |
| 200 | Ga0105241_11034345 | 3300009174 | Bacteria | 770 |
| 201 | Ga0105248_10179647 | 3300009177 | Bacteria | 2385 |
| 202 | Ga0105237_10033149 | 3300009545 | Bacteria | 5233 |
| 203 | Ga0105237_10041832 | 3300009545 | Bacteria | 4621 |
| 204 | Ga0105237_10128536 | 3300009545 | Bacteria | 2528 |
| 205 | Ga0105237_10164160 | 3300009545 | Bacteria | 2220 |
| 206 | Ga0105238_10011980 | 3300009551 | Bacteria | 8735 |
| 207 | Ga0105238_10031278 | 3300009551 | Bacteria | 5418 |
| 208 | Ga0105238_10055394 | 3300009551 | Bacteria | 3980 |
| 209 | Ga0105238_10198783 | 3300009551 | Bacteria | 1980 |
| 210 | Ga0105238_10234582 | 3300009551 | Bacteria | 1812 |
| 211 | Ga0105238_10885933 | 3300009551 | Bacteria | 910 |
| 212 | Ga0105238_11333419 | 3300009551 | Bacteria | 744 |
| 213 | Ga0105249_11013040 | 3300009553 | Bacteria | 899 |
| 214 | Ga0105239_10105480 | 3300010375 | Bacteria | 3121 |
| 215 | Ga0105239_10249481 | 3300010375 | Bacteria | 1993 |
| 216 | Ga0105239_10669518 | 3300010375 | Bacteria | 1186 |
| 217 | Ga0105239_10712535 | 3300010375 | Bacteria | 1148 |
| 218 | Ga0105239_11050970 | 3300010375 | Bacteria | 937 |
| 219 | Ga0105239_11208625 | 3300010375 | Bacteria | 871 |
| 220 | Ga0105239_11273729 | 3300010375 | Bacteria | 848 |
| 221 | Ga0105239_11532657 | 3300010375 | Bacteria | 770 |
| 222 | Ga0105246_10003537 | 3300011119 | Bacteria | 9458 |
| 223 | Ga0105246_10131288 | 3300011119 | Bacteria | 1871 |
| 224 | Ga0105246_10712302 | 3300011119 | Bacteria | 881 |
| 225 | Ga0157373_10040070 | 3300013100 | Bacteria | 3352 |
| 226 | Ga0157373_10318958 | 3300013100 | Bacteria | 1105 |
| 227 | Ga0157371_10230752 | 3300013102 | Bacteria | 1330 |
| 228 | Ga0157371_10330650 | 3300013102 | Bacteria | 1107 |
| 229 | Ga0157370_10479215 | 3300013104 | Bacteria | 1143 |
| 230 | Ga0157370_10618516 | 3300013104 | Bacteria | 991 |
| 231 | Ga0157369_10026776 | 3300013105 | Bacteria | 6394 |
| 232 | Ga0157369_10066689 | 3300013105 | Bacteria | 3871 |
| 233 | Ga0157369_10102101 | 3300013105 | Bacteria | 3057 |
| 234 | Ga0157369_11301903 | 3300013105 | Bacteria | 741 |
| 235 | Ga0157374_10021982 | 3300013296 | Bacteria | 5684 |
| 236 | Ga0157374_10139860 | 3300013296 | Bacteria | 2349 |
| 237 | Ga0157374_10203998 | 3300013296 | Bacteria | 1937 |
| 238 | Ga0157374_10349504 | 3300013296 | Bacteria | 1469 |
| 239 | Ga0157378_10515208 | 3300013297 | Bacteria | 1197 |
| 240 | Ga0157378_10877904 | 3300013297 | Bacteria | 926 |
| 241 | Ga0163162_10179714 | 3300013306 | Bacteria | 2242 |
| 242 | Ga0157372_10683265 | 3300013307 | Bacteria | 1195 |
| 243 | Ga0157372_11210464 | 3300013307 | Bacteria | 873 |
| 244 | Ga0157372_11255550 | 3300013307 | Bacteria | 855 |
| 245 | Ga0157372_12020159 | 3300013307 | Bacteria | 662 |
| 246 | Ga0157375_10084779 | 3300013308 | Bacteria | 3218 |
| 247 | Ga0157375_11894807 | 3300013308 | Bacteria | 708 |
| 248 | Ga0163163_10000985 | 3300014325 | Bacteria | 24137 |
| 249 | Ga0163163_10385552 | 3300014325 | Bacteria | 1459 |
| 250 | Ga0182008_10339606 | 3300014497 | Bacteria | 794 |
| 251 | Ga0157377_10758235 | 3300014745 | Bacteria | 711 |
| 252 | Ga0157379_10276398 | 3300014968 | Bacteria | 1528 |
| 253 | Ga0157379_10435896 | 3300014968 | Bacteria | 1208 |
| 254 | Ga0157379_10448002 | 3300014968 | Bacteria | 1191 |
| 255 | Ga0157379_10609043 | 3300014968 | Bacteria | 1020 |
| 256 | Ga0157376_10040370 | 3300014969 | Bacteria | 3814 |
| 257 | Ga0154015_1294201 | 3300020610 | Bacteria | 620 |
| 258 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 259 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 260 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 261 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 262 | Ga0213874_10015808 | 3300021377 | Bacteria | 1997 |
| 263 | Ga0213876_10004192 | 3300021384 | Bacteria | 8083 |
| 264 | Ga0213876_10030041 | 3300021384 | Bacteria | 2865 |
| 265 | Ga0213875_10054161 | 3300021388 | Bacteria | 1879 |
| 266 | Ga0209563_106889 | 3300025230 | Bacteria | 1914 |
| 267 | Ga0209677_102534 | 3300025253 | Bacteria | 6765 |
| 268 | Ga0209677_102699 | 3300025253 | Bacteria | 6391 |
| 269 | Ga0209148_1000374 | 3300025254 | Bacteria | 54657 |
| 270 | Ga0209233_1001622 | 3300025261 | Bacteria | 8756 |
| 271 | Ga0209233_1004832 | 3300025261 | Bacteria | 4538 |
| 272 | Ga0209233_1005085 | 3300025261 | Bacteria | 4400 |
| 273 | Ga0209455_1001411 | 3300025272 | Bacteria | 10891 |
| 274 | Ga0209455_1003883 | 3300025272 | Bacteria | 5098 |
| 275 | Ga0209455_1007726 | 3300025272 | Bacteria | 2997 |
| 276 | Ga0209673_1023500 | 3300025273 | Bacteria | 2096 |
| 277 | Ga0209564_1011932 | 3300025295 | Bacteria | 3839 |
| 278 | Ga0209564_1012318 | 3300025295 | Bacteria | 3741 |
| 279 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 280 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 281 | Ga0209758_1001579 | 3300025297 | Bacteria | 26050 |
| 282 | Ga0209758_1002091 | 3300025297 | Bacteria | 21224 |
| 283 | Ga0209758_1022280 | 3300025297 | Bacteria | 2913 |
| 284 | Ga0209758_1061358 | 3300025297 | Bacteria | 1239 |
| 285 | Ga0209758_1085525 | 3300025297 | Bacteria | 939 |
| 286 | Ga0209256_1008086 | 3300025299 | Bacteria | 4968 |
| 287 | Ga0209256_1044051 | 3300025299 | Bacteria | 1116 |
| 288 | Ga0207426_1000238 | 3300025302 | Bacteria | 124393 |
| 289 | Ga0207426_1000726 | 3300025302 | Bacteria | 37826 |
| 290 | Ga0207426_1023270 | 3300025302 | Bacteria | 2115 |
| 291 | Ga0209257_1004927 | 3300025304 | Bacteria | 9810 |
| 292 | Ga0207697_10104704 | 3300025315 | Bacteria | 1208 |
| 293 | Ga0207656_10088167 | 3300025321 | Bacteria | 1404 |
| 294 | Ga0207692_10000175 | 3300025898 | Bacteria | 20519 |
| 295 | Ga0207692_10009115 | 3300025898 | Bacteria | 4131 |
| 296 | Ga0207692_10520812 | 3300025898 | Bacteria | 757 |
| 297 | Ga0207642_10642159 | 3300025899 | Bacteria | 664 |
| 298 | Ga0207710_10014704 | 3300025900 | Bacteria | 3303 |
| 299 | Ga0207710_10045700 | 3300025900 | Bacteria | 1953 |
| 300 | Ga0207688_10049337 | 3300025901 | Bacteria | 2353 |
| 301 | Ga0207680_10118806 | 3300025903 | Bacteria | 1726 |
| 302 | Ga0207647_10017311 | 3300025904 | Bacteria | 4900 |
| 303 | Ga0207685_10000929 | 3300025905 | Bacteria | 5596 |
| 304 | Ga0207685_10053246 | 3300025905 | Bacteria | 1571 |
| 305 | Ga0207699_10001765 | 3300025906 | Bacteria | 10215 |
| 306 | Ga0207699_10007395 | 3300025906 | Bacteria | 5373 |
| 307 | Ga0207699_10551535 | 3300025906 | Bacteria | 836 |
| 308 | Ga0207699_10652675 | 3300025906 | Bacteria | 768 |
| 309 | Ga0207705_10040079 | 3300025909 | Bacteria | 3358 |
| 310 | Ga0207654_10006042 | 3300025911 | Bacteria | 6088 |
| 311 | Ga0207654_10076895 | 3300025911 | Bacteria | 1999 |
| 312 | Ga0207654_10376771 | 3300025911 | Bacteria | 982 |
| 313 | Ga0207654_10550224 | 3300025911 | Bacteria | 820 |
| 314 | Ga0207654_10600107 | 3300025911 | Bacteria | 785 |
| 315 | Ga0207707_10000950 | 3300025912 | Bacteria | 27902 |
| 316 | Ga0207707_10016441 | 3300025912 | Bacteria | 6453 |
| 317 | Ga0207707_10808533 | 3300025912 | Bacteria | 781 |
| 318 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 319 | Ga0207695_10378658 | 3300025913 | Bacteria | 1301 |
| 320 | Ga0207695_10562427 | 3300025913 | Bacteria | 1022 |
| 321 | Ga0207671_10008090 | 3300025914 | Bacteria | 8979 |
| 322 | Ga0207671_10223291 | 3300025914 | Bacteria | 1476 |
| 323 | Ga0207671_10579322 | 3300025914 | Bacteria | 895 |
| 324 | Ga0207671_10662976 | 3300025914 | Bacteria | 831 |
| 325 | Ga0207671_10730992 | 3300025914 | Bacteria | 787 |
| 326 | Ga0207693_10004043 | 3300025915 | Bacteria | 12466 |
| 327 | Ga0207693_10041091 | 3300025915 | Bacteria | 3642 |
| 328 | Ga0207693_10086662 | 3300025915 | Bacteria | 2454 |
| 329 | Ga0207663_10000098 | 3300025916 | Bacteria | 41171 |
| 330 | Ga0207660_10048368 | 3300025917 | Bacteria | 3009 |
| 331 | Ga0207660_10080030 | 3300025917 | Bacteria | 2398 |
| 332 | Ga0207660_10126458 | 3300025917 | Bacteria | 1941 |
| 333 | Ga0207657_10098593 | 3300025919 | Bacteria | 2428 |
| 334 | Ga0207657_10129475 | 3300025919 | Bacteria | 2070 |
| 335 | Ga0207657_10389938 | 3300025919 | Bacteria | 1096 |
| 336 | Ga0207657_10414033 | 3300025919 | Bacteria | 1060 |
| 337 | Ga0207649_10113640 | 3300025920 | Bacteria | 1814 |
| 338 | Ga0207652_10069917 | 3300025921 | Bacteria | 3048 |
| 339 | Ga0207652_10322037 | 3300025921 | Bacteria | 1396 |
| 340 | Ga0207652_10403559 | 3300025921 | Bacteria | 1233 |
| 341 | Ga0207694_10170993 | 3300025924 | Bacteria | 1759 |
| 342 | Ga0207694_10531547 | 3300025924 | Bacteria | 986 |
| 343 | Ga0207694_10608083 | 3300025924 | Bacteria | 919 |
| 344 | Ga0207694_10694587 | 3300025924 | Bacteria | 858 |
| 345 | Ga0207650_10334566 | 3300025925 | Bacteria | 1242 |
| 346 | Ga0207687_10531731 | 3300025927 | Bacteria | 984 |
| 347 | Ga0207687_10544863 | 3300025927 | Bacteria | 973 |
| 348 | Ga0207687_10971448 | 3300025927 | Bacteria | 728 |
| 349 | Ga0207700_10001663 | 3300025928 | Bacteria | 12623 |
| 350 | Ga0207700_10188064 | 3300025928 | Bacteria | 1734 |
| 351 | Ga0207700_10673494 | 3300025928 | Bacteria | 923 |
| 352 | Ga0207700_10774064 | 3300025928 | Bacteria | 858 |
| 353 | Ga0207664_10007161 | 3300025929 | Bacteria | 7734 |
| 354 | Ga0207664_10066454 | 3300025929 | Bacteria | 2890 |
| 355 | Ga0207664_10282165 | 3300025929 | Bacteria | 1457 |
| 356 | Ga0207664_10297754 | 3300025929 | Bacteria | 1419 |
| 357 | Ga0207664_10776891 | 3300025929 | Bacteria | 862 |
| 358 | Ga0207644_10189698 | 3300025931 | Bacteria | 1615 |
| 359 | Ga0207690_10623132 | 3300025932 | Bacteria | 882 |
| 360 | Ga0207706_10037062 | 3300025933 | Bacteria | 4330 |
| 361 | Ga0207706_10833667 | 3300025933 | Bacteria | 782 |
| 362 | Ga0207709_10089618 | 3300025935 | Bacteria | 2006 |
| 363 | Ga0207670_10115890 | 3300025936 | Bacteria | 1939 |
| 364 | Ga0207665_10000355 | 3300025939 | Bacteria | 31763 |
| 365 | Ga0207665_10003937 | 3300025939 | Bacteria | 9942 |
| 366 | Ga0207711_10809945 | 3300025941 | Bacteria | 872 |
| 367 | Ga0207661_10008365 | 3300025944 | Bacteria | 7390 |
| 368 | Ga0207661_10082671 | 3300025944 | Bacteria | 2655 |
| 369 | Ga0207679_10375144 | 3300025945 | Bacteria | 1246 |
| 370 | Ga0207679_10668334 | 3300025945 | Bacteria | 941 |
| 371 | Ga0207667_10112404 | 3300025949 | Bacteria | 2809 |
| 372 | Ga0207667_10148159 | 3300025949 | Bacteria | 2416 |
| 373 | Ga0207667_10189050 | 3300025949 | Bacteria | 2113 |
| 374 | Ga0207667_10384559 | 3300025949 | Bacteria | 1430 |
| 375 | Ga0207667_11115977 | 3300025949 | Bacteria | 771 |
| 376 | Ga0207667_11436601 | 3300025949 | Bacteria | 662 |
| 377 | Ga0207651_10320626 | 3300025960 | Bacteria | 1295 |
| 378 | Ga0207712_11039742 | 3300025961 | Bacteria | 728 |
| 379 | Ga0207668_10494164 | 3300025972 | Bacteria | 1051 |
| 380 | Ga0207668_10563470 | 3300025972 | Bacteria | 988 |
| 381 | Ga0207640_10177712 | 3300025981 | Bacteria | 1593 |
| 382 | Ga0207658_10277395 | 3300025986 | Bacteria | 1435 |
| 383 | Ga0207658_11541344 | 3300025986 | Bacteria | 608 |
| 384 | Ga0207677_10830286 | 3300026023 | Bacteria | 829 |
| 385 | Ga0207703_10165258 | 3300026035 | Bacteria | 1941 |
| 386 | Ga0207703_10895296 | 3300026035 | Bacteria | 850 |
| 387 | Ga0207703_10922455 | 3300026035 | Bacteria | 836 |
| 388 | Ga0207639_10042274 | 3300026041 | Bacteria | 3415 |
| 389 | Ga0207639_10119500 | 3300026041 | Bacteria | 2163 |
| 390 | Ga0207639_10304947 | 3300026041 | Bacteria | 1409 |
| 391 | Ga0207639_10450095 | 3300026041 | Bacteria | 1169 |
| 392 | Ga0207639_10466450 | 3300026041 | Bacteria | 1149 |
| 393 | Ga0207678_10008230 | 3300026067 | Bacteria | 9189 |
| 394 | Ga0207678_10030531 | 3300026067 | Bacteria | 4704 |
| 395 | Ga0207678_10069576 | 3300026067 | Bacteria | 3018 |
| 396 | Ga0207678_10164813 | 3300026067 | Bacteria | 1892 |
| 397 | Ga0207678_10296238 | 3300026067 | Bacteria | 1390 |
| 398 | Ga0207678_11045404 | 3300026067 | Bacteria | 723 |
| 399 | Ga0207708_10889845 | 3300026075 | Bacteria | 770 |
| 400 | Ga0207702_10112461 | 3300026078 | Bacteria | 2423 |
| 401 | Ga0207702_10231068 | 3300026078 | Bacteria | 1729 |
| 402 | Ga0207702_10391799 | 3300026078 | Bacteria | 1338 |
| 403 | Ga0207702_10396802 | 3300026078 | Bacteria | 1329 |
| 404 | Ga0207702_10432069 | 3300026078 | Bacteria | 1275 |
| 405 | Ga0207702_11285846 | 3300026078 | Bacteria | 726 |
| 406 | Ga0207641_10536148 | 3300026088 | Bacteria | 1140 |
| 407 | Ga0207641_10680434 | 3300026088 | Bacteria | 1012 |
| 408 | Ga0207641_10965119 | 3300026088 | Bacteria | 848 |
| 409 | Ga0207648_10318416 | 3300026089 | Bacteria | 1397 |
| 410 | Ga0207676_10154911 | 3300026095 | Bacteria | 1978 |
| 411 | Ga0207676_10758060 | 3300026095 | Bacteria | 944 |
| 412 | Ga0207674_10088216 | 3300026116 | Bacteria | 3095 |
| 413 | Ga0207674_10117044 | 3300026116 | Bacteria | 2636 |
| 414 | Ga0207675_100982365 | 3300026118 | Bacteria | 862 |
| 415 | Ga0207698_10042438 | 3300026142 | Bacteria | 3398 |
| 416 | Ga0207698_10056264 | 3300026142 | Bacteria | 3036 |
| 417 | Ga0207698_10352731 | 3300026142 | Bacteria | 1390 |
| 418 | Ga0207698_11200897 | 3300026142 | Bacteria | 772 |
| 419 | Ga0209389_1000107 | 3300027296 | Bacteria | 74129 |
| 420 | Ga0209389_1005934 | 3300027296 | Bacteria | 10512 |
| 421 | Ga0209589_1000092 | 3300027357 | Bacteria | 89530 |
| 422 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 423 | Ga0209489_107740 | 3300027361 | Bacteria | 15589 |
| 424 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 425 | Ga0209813_10005581 | 3300027866 | Bacteria | 3063 |
| 426 | Ga0209813_10087381 | 3300027866 | Bacteria | 1041 |
| 427 | Ga0268266_10038865 | 3300028379 | Bacteria | 4052 |
| 428 | Ga0268266_10179065 | 3300028379 | Bacteria | 1929 |
| 429 | Ga0268266_10212574 | 3300028379 | Bacteria | 1774 |
| 430 | Ga0268266_10243666 | 3300028379 | Bacteria | 1660 |
| 431 | Ga0268266_10970652 | 3300028379 | Bacteria | 822 |
| 432 | Ga0268265_10080719 | 3300028380 | Bacteria | 2566 |
| 433 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 434 | Ga0265337_1002468 | 3300028556 | Bacteria | 8449 |
| 435 | Ga0265326_10003263 | 3300028558 | Bacteria | 5347 |
| 436 | Ga0265319_1007768 | 3300028563 | Bacteria | 4778 |
| 437 | Ga0265334_10000456 | 3300028573 | Bacteria | 21294 |
| 438 | Ga0265323_10000424 | 3300028653 | Bacteria | 24236 |
| 439 | Ga0265322_10005214 | 3300028654 | Bacteria | 3846 |
| 440 | Ga0307515_10074714 | 3300028794 | Bacteria | 4528 |
| 441 | Ga0265338_10000321 | 3300028800 | Bacteria | 87046 |
| 442 | Ga0265324_10023377 | 3300029957 | Bacteria | 2201 |
| 443 | Ga0265330_10101988 | 3300031235 | Bacteria | 1228 |
| 444 | Ga0265330_10147547 | 3300031235 | Bacteria | 1000 |
| 445 | Ga0265320_10186503 | 3300031240 | Bacteria | 929 |
| 446 | Ga0265340_10068526 | 3300031247 | Bacteria | 1685 |
| 447 | Ga0265339_10045369 | 3300031249 | Bacteria | 2419 |
| 448 | Ga0265331_10261854 | 3300031250 | Bacteria | 775 |
| 449 | Ga0307509_10217624 | 3300031507 | Bacteria | 1727 |
| 450 | Ga0307408_100814022 | 3300031548 | Bacteria | 849 |
| 451 | Ga0307508_10039062 | 3300031616 | Bacteria | 4264 |
| 452 | Ga0265314_10019799 | 3300031711 | Bacteria | 5204 |
| 453 | Ga0265342_10007904 | 3300031712 | Bacteria | 7711 |
| 454 | Ga0265342_10212989 | 3300031712 | Bacteria | 1044 |
| 455 | Ga0307507_10018406 | 3300033179 | Bacteria | 7945 |
| 456 | Ga0307510_10019136 | 3300033180 | Bacteria | 8033 |
| 457 | Ga0307510_10156655 | 3300033180 | Bacteria | 1883 |
| 458 | Ga0316215_1006801 | 3300033544 | Bacteria | 1111 |
| 459 | Ga0316214_1006677 | 3300033545 | Bacteria | 1528 |
| 460 | Ga0373923_0031055 | 3300035111 | Bacteria | 2151 |
| 461 | Ga0373936_0039776 | 3300035113 | Bacteria | 1882 |
| 462 | Ga0373936_0042475 | 3300035113 | Bacteria | 1825 |
| 463 | Ga0373953_0098249 | 3300035117 | Bacteria | 1230 |
| 464 | Ga0373954_0052970 | 3300035118 | Bacteria | 1907 |
| 465 | Ga0373956_0026015 | 3300035119 | Bacteria | 2533 |
| 466 | Ga0373960_0063783 | 3300035121 | Bacteria | 1124 |
| 467 | Ga0373943_0028281 | 3300035170 | Bacteria | 2641 |
| 468 | Ga0373943_0071314 | 3300035170 | Bacteria | 1760 |
| 469 | Ga0373946_0346807 | 3300035171 | Bacteria | 742 |
| 470 | Ga0373955_0007905 | 3300035172 | Bacteria | 4910 |
| 471 | Ga0373931_0322617 | 3300035691 | Bacteria | 960 |
| 472 | Ga0373935_0071239 | 3300035692 | Bacteria | 2242 |
| 473 | Ga0373935_0267902 | 3300035692 | Bacteria | 1199 |
| 474 | Ga0373927_0010043 | 3300035695 | Bacteria | 6339 |
| 475 | Ga0373927_0232406 | 3300035695 | Bacteria | 1211 |
| 476 | Ga0373933_0000199 | 3300035724 | Bacteria | 39593 |
| 477 | Ga0373933_0017531 | 3300035724 | Bacteria | 4017 |
| 478 | Ga0373947_0391755 | 3300035725 | Bacteria | 936 |
| 479 | Ga0373937_0008799 | 3300036401 | Bacteria | 8759 |
| 480 | Ga0373937_0063198 | 3300036401 | Bacteria | 3404 |
| 481 | Ga0373937_0456722 | 3300036401 | Bacteria | 1213 |
| 482 | Ga0373925_0029517 | 3300037068 | Bacteria | 4024 |
| 483 | Ga0373925_0084180 | 3300037068 | Bacteria | 2423 |
| 484 | Ga0373925_0131969 | 3300037068 | Bacteria | 1948 |
| 485 | Ga0395899_0053300 | 3300037312 | Bacteria | 2995 |
| 486 | Ga0395899_0379679 | 3300037312 | Bacteria | 939 |
| 487 | Ga0395900_0000820 | 3300037418 | Bacteria | 41179 |
| 488 | Ga0395900_0066935 | 3300037418 | Bacteria | 3691 |
| 489 | Ga0395900_0084498 | 3300037418 | Bacteria | 3262 |
| 490 | Ga0395900_0563087 | 3300037418 | Bacteria | 1083 |
| 491 | Ga0395898_0039019 | 3300037466 | Bacteria | 4703 |
| 492 | Ga0395898_0070853 | 3300037466 | Bacteria | 3369 |
| 493 | Ga0395898_0081273 | 3300037466 | Bacteria | 3125 |
| 494 | Ga0395898_0441886 | 3300037466 | Bacteria | 1239 |
| 495 | Ga0395905_0006498 | 3300037471 | Bacteria | 11758 |
| 496 | Ga0395905_0027848 | 3300037471 | Bacteria | 5328 |
| 497 | Ga0395905_0151862 | 3300037471 | Bacteria | 2179 |
| 498 | Ga0395905_0450739 | 3300037471 | Bacteria | 1185 |
| 499 | Ga0436364_0230953 | 3300037853 | Bacteria | 544 |
| 500 | Ga0436364_0432530 | 3300037853 | Bacteria | 535 |
| 501 | Ga0436364_1074811 | 3300037853 | Bacteria | 1940 |
| 502 | Ga0395901_0003090 | 3300038443 | Bacteria | 16741 |
| 503 | Ga0395901_0081268 | 3300038443 | Bacteria | 3385 |
| 504 | Ga0395901_0313828 | 3300038443 | Bacteria | 1623 |
| 505 | Ga0436365_0535048 | 3300039437 | Bacteria | 1538 |
| 506 | Ga0436365_0536419 | 3300039437 | Bacteria | 1304 |
| 507 | Ga0436365_0570459 | 3300039437 | Bacteria | 2626 |
| 508 | Ga0436365_1508712 | 3300039437 | Bacteria | 2539 |
| 509 | Ga0436365_1571518 | 3300039437 | Bacteria | 1040 |
| 510 | Ga0436365_1576869 | 3300039437 | Bacteria | 993 |
| 511 | Ga0436360_0264935 | 3300039438 | Bacteria | 1885 |
| 512 | Ga0436361_0983536 | 3300039447 | Bacteria | 979 |
| 513 | Ga0436361_1032582 | 3300039447 | Bacteria | 996 |
| 514 | Ga0436363_0484248 | 3300039450 | Bacteria | 907 |
| 515 | Ga0436363_0929560 | 3300039450 | Bacteria | 1289 |
| 516 | Ga0436362_1093918 | 3300039453 | Bacteria | 2921 |
| 517 | Ga0451787_188948 | 3300041441 | Bacteria | 828 |
| 518 | Ga0451789_1360976 | 3300041443 | Bacteria | 1072 |
| 519 | Ga0451793_1099887 | 3300041452 | Bacteria | 1055 |
| 520 | Ga0451797_0340083 | 3300041453 | Bacteria | 1176 |
| 521 | Ga0451795_1217617 | 3300041456 | Bacteria | 984 |
| 522 | Ga0451802_0763160 | 3300041460 | Bacteria | 1763 |
| 523 | Ga0451807_1079633 | 3300041486 | Bacteria | 768 |
| 524 | Ga0451833_0328009 | 3300041491 | Bacteria | 1132 |
| 525 | Ga0451835_0292434 | 3300041492 | Bacteria | 659 |
| 526 | Ga0451841_0463910 | 3300041498 | Bacteria | 1922 |
| 527 | Ga0451849_0093937 | 3300041505 | Bacteria | 1886 |
| 528 | Ga0451843_0540096 | 3300041509 | Bacteria | 684 |
| 529 | Ga0451855_1276054 | 3300041511 | Bacteria | 593 |
| 530 | Ga0451853_1099499 | 3300041512 | Bacteria | 651 |
| 531 | Ga0439455_0164454 | 3300042012 | Bacteria | 635 |
| 532 | Ga0466972_0000846 | 3300044658 | Bacteria | 14671 |
| 533 | Ga0466972_0036013 | 3300044658 | Bacteria | 2422 |
| 534 | Ga0466972_0205479 | 3300044658 | Bacteria | 922 |
| 535 | Ga0466965_0229024 | 3300044683 | Bacteria | 992 |
| 536 | Ga0466965_0275521 | 3300044683 | Bacteria | 907 |
| 537 | Ga0466966_0000334 | 3300044684 | Bacteria | 30532 |
| 538 | Ga0466966_0477135 | 3300044684 | Bacteria | 750 |
| 539 | Ga0466961_0000509 | 3300044693 | Bacteria | 24794 |
| 540 | Ga0466961_0278834 | 3300044693 | Bacteria | 1023 |
| 541 | Ga0466961_0281834 | 3300044693 | Bacteria | 1017 |
| 542 | Ga0466961_0371180 | 3300044693 | Bacteria | 869 |
| 543 | Ga0466963_0021037 | 3300044694 | Bacteria | 4111 |
| 544 | Ga0466964_0020638 | 3300044706 | Bacteria | 2539 |
| 545 | Ga0466964_0564134 | 3300044706 | Bacteria | 620 |
| 546 | Ga0466971_0333011 | 3300044719 | Bacteria | 733 |
| 547 | Ga0466968_0276803 | 3300044735 | Bacteria | 802 |
| 548 | Ga0466970_0212676 | 3300044765 | Bacteria | 1078 |
| 549 | Ga0466970_0359153 | 3300044765 | Bacteria | 827 |
| 550 | Ga0466970_0543013 | 3300044765 | Bacteria | 671 |
| 551 | Ga0466970_0557952 | 3300044765 | Bacteria | 662 |
| 552 | Ga0466957_0058165 | 3300044842 | Bacteria | 2368 |
| 553 | Ga0466957_0071535 | 3300044842 | Bacteria | 2145 |
| 554 | Ga0466957_0156280 | 3300044842 | Bacteria | 1478 |
| 555 | Ga0466957_0273217 | 3300044842 | Bacteria | 1129 |
| 556 | Ga0466957_0739848 | 3300044842 | Bacteria | 696 |
| 557 | Ga0466960_0011942 | 3300044901 | Bacteria | 3654 |
| 558 | Ga0466960_0321481 | 3300044901 | Bacteria | 876 |
| 559 | Ga0466959_0058586 | 3300045049 | Bacteria | 2805 |
| 560 | Ga0466959_0108199 | 3300045049 | Bacteria | 1986 |
| 561 | Ga0466959_0730111 | 3300045049 | Bacteria | 663 |
| 562 | Ga0466958_0058680 | 3300045836 | Bacteria | 2340 |
| 563 | Ga0466958_0083330 | 3300045836 | Bacteria | 1971 |
| 564 | Ga0466958_0680507 | 3300045836 | Bacteria | 670 |
| 565 | Ga0466967_0009054 | 3300045976 | Bacteria | 7360 |
| 566 | Ga0466967_0122516 | 3300045976 | Bacteria | 2405 |
| 567 | Ga0466967_0183712 | 3300045976 | Bacteria | 1973 |
| 568 | Ga0466967_0709738 | 3300045976 | Bacteria | 996 |
| 569 | Ga0466967_1026645 | 3300045976 | Bacteria | 821 |
| 570 | Ga0466967_1635493 | 3300045976 | Bacteria | 641 |
| 571 | Ga0466967_1685899 | 3300045976 | Bacteria | 631 |
| 572 | Ga0495592_0021156 | 3300046454 | Bacteria | 4947 |
| 573 | Ga0495592_0162252 | 3300046454 | Bacteria | 1537 |
| 574 | Ga0495603_0240395 | 3300046455 | Bacteria | 1043 |
| 575 | Ga0495629_0027278 | 3300046459 | Bacteria | 4055 |
| 576 | Ga0495629_0050041 | 3300046459 | Bacteria | 2928 |
| 577 | Ga0495638_0031076 | 3300046460 | Bacteria | 3433 |
| 578 | Ga0495641_0342136 | 3300046461 | Bacteria | 676 |
| 579 | Ga0495651_0001733 | 3300046462 | Bacteria | 16846 |
| 580 | Ga0495651_0096032 | 3300046462 | Bacteria | 2215 |
| 581 | Ga0495650_0077872 | 3300046471 | Bacteria | 1285 |
| 582 | Ga0495650_0130214 | 3300046471 | Bacteria | 918 |
| 583 | Ga0495580_0007795 | 3300046472 | Bacteria | 8578 |
| 584 | Ga0495582_0004536 | 3300046473 | Bacteria | 7799 |
| 585 | Ga0495582_0219308 | 3300046473 | Bacteria | 1088 |
| 586 | Ga0495605_0035330 | 3300046474 | Bacteria | 2526 |
| 587 | Ga0495605_0062745 | 3300046474 | Bacteria | 1775 |
| 588 | Ga0495605_0217783 | 3300046474 | Bacteria | 826 |
| 589 | Ga0495639_0014908 | 3300046475 | Bacteria | 3367 |
| 590 | Ga0495639_0043424 | 3300046475 | Bacteria | 2031 |
| 591 | Ga0495662_0064517 | 3300046476 | Bacteria | 1770 |
| 592 | Ga0495662_0071248 | 3300046476 | Bacteria | 1684 |
| 593 | Ga0495664_0001939 | 3300046477 | Bacteria | 11029 |
| 594 | Ga0495664_0012734 | 3300046477 | Bacteria | 4763 |
| 595 | Ga0495584_0048416 | 3300046491 | Bacteria | 2143 |
| 596 | Ga0495594_0002231 | 3300046499 | Bacteria | 10081 |
| 597 | Ga0495594_0407125 | 3300046499 | Bacteria | 774 |
| 598 | Ga0495596_0149066 | 3300046500 | Bacteria | 909 |
| 599 | Ga0495607_0035552 | 3300046501 | Bacteria | 3012 |
| 600 | Ga0495607_0172044 | 3300046501 | Bacteria | 1093 |
| 601 | Ga0495607_0192791 | 3300046501 | Bacteria | 1014 |
| 602 | Ga0495606_0028614 | 3300046507 | Bacteria | 3927 |
| 603 | Ga0495606_0136165 | 3300046507 | Bacteria | 1454 |
| 604 | Ga0495606_0137286 | 3300046507 | Bacteria | 1447 |
| 605 | Ga0495606_0231032 | 3300046507 | Bacteria | 1036 |
| 606 | Ga0495608_0005911 | 3300046511 | Bacteria | 8704 |
| 607 | Ga0495608_0479481 | 3300046511 | Bacteria | 755 |
| 608 | Ga0495610_0031675 | 3300046512 | Bacteria | 2756 |
| 609 | Ga0495616_0033183 | 3300046513 | Bacteria | 2692 |
| 610 | Ga0495616_0035701 | 3300046513 | Bacteria | 2570 |
| 611 | Ga0495616_0066680 | 3300046513 | Bacteria | 1751 |
| 612 | Ga0495616_0141581 | 3300046513 | Bacteria | 1094 |
| 613 | Ga0495618_0129607 | 3300046514 | Bacteria | 1614 |
| 614 | Ga0495618_0368820 | 3300046514 | Bacteria | 882 |
| 615 | Ga0495618_0503870 | 3300046514 | Bacteria | 729 |
| 616 | Ga0495620_0217150 | 3300046515 | Bacteria | 732 |
| 617 | Ga0495620_0232967 | 3300046515 | Bacteria | 704 |
| 618 | Ga0495628_0018357 | 3300046516 | Bacteria | 5795 |
| 619 | Ga0495628_0038168 | 3300046516 | Bacteria | 3846 |
| 620 | Ga0495630_0193217 | 3300046517 | Bacteria | 1553 |
| 621 | Ga0495631_0173506 | 3300046518 | Bacteria | 924 |
| 622 | Ga0495632_0484871 | 3300046519 | Bacteria | 534 |
| 623 | Ga0495643_0064424 | 3300046522 | Bacteria | 1936 |
| 624 | Ga0495643_0087741 | 3300046522 | Bacteria | 1609 |
| 625 | Ga0495643_0206118 | 3300046522 | Bacteria | 941 |
| 626 | Ga0495643_0278586 | 3300046522 | Bacteria | 770 |
| 627 | Ga0495648_0041061 | 3300046524 | Bacteria | 2926 |
| 628 | Ga0495648_0130138 | 3300046524 | Bacteria | 1339 |
| 629 | Ga0495648_0173142 | 3300046524 | Bacteria | 1104 |
| 630 | Ga0495648_0224983 | 3300046524 | Bacteria | 922 |
| 631 | Ga0495648_0250849 | 3300046524 | Bacteria | 854 |
| 632 | Ga0495648_0311671 | 3300046524 | Bacteria | 733 |
| 633 | Ga0495666_0178959 | 3300046526 | Bacteria | 980 |
| 634 | Ga0495652_0030271 | 3300046529 | Bacteria | 4748 |
| 635 | Ga0495652_0137427 | 3300046529 | Bacteria | 1926 |
| 636 | Ga0495652_0359133 | 3300046529 | Bacteria | 1041 |
| 637 | Ga0495654_0023964 | 3300046530 | Bacteria | 3157 |
| 638 | Ga0495654_0134517 | 3300046530 | Bacteria | 1107 |
| 639 | Ga0495640_0084420 | 3300046533 | Bacteria | 2106 |
| 640 | Ga0495640_0091149 | 3300046533 | Bacteria | 2011 |
| 641 | Ga0495586_0069902 | 3300046535 | Bacteria | 1917 |
| 642 | Ga0495586_0408346 | 3300046535 | Bacteria | 782 |
| 643 | Ga0495587_0008847 | 3300046536 | Bacteria | 6463 |
| 644 | Ga0495609_0081646 | 3300046538 | Bacteria | 1413 |
| 645 | Ga0495609_0375318 | 3300046538 | Bacteria | 571 |
| 646 | Ga0495597_0134085 | 3300046542 | Bacteria | 1025 |
| 647 | Ga0495645_0047214 | 3300046543 | Bacteria | 3138 |
| 648 | Ga0495622_0017010 | 3300046557 | Bacteria | 3385 |
| 649 | Ga0495622_0028730 | 3300046557 | Bacteria | 2597 |
| 650 | Ga0495667_0003089 | 3300046559 | Bacteria | 11169 |
| 651 | Ga0495667_0108754 | 3300046559 | Bacteria | 1791 |
| 652 | Ga0495668_0256547 | 3300046616 | Bacteria | 957 |
| 653 | Ga0495634_0069997 | 3300046642 | Bacteria | 2313 |
| 654 | Ga0495634_0143040 | 3300046642 | Bacteria | 1517 |
| 655 | Ga0495634_0143086 | 3300046642 | Bacteria | 1517 |
| 656 | Ga0495634_0196457 | 3300046642 | Bacteria | 1255 |
| 657 | Ga0495611_0152894 | 3300046648 | Bacteria | 1077 |
| 658 | Ga0495625_0156639 | 3300046660 | Bacteria | 1528 |
| 659 | Ga0495625_0166279 | 3300046660 | Bacteria | 1474 |
| 660 | Ga0495625_0205232 | 3300046660 | Bacteria | 1298 |
| 661 | Ga0495625_0222951 | 3300046660 | Bacteria | 1234 |
| 662 | Ga0495635_0021808 | 3300046663 | Bacteria | 4464 |
| 663 | Ga0495635_0154829 | 3300046663 | Bacteria | 1560 |
| 664 | Ga0495661_0257843 | 3300046665 | Bacteria | 887 |
| 665 | Ga0495588_0461114 | 3300046674 | Bacteria | 666 |
| 666 | Ga0495657_0007669 | 3300046675 | Bacteria | 8308 |
| 667 | Ga0495657_0033170 | 3300046675 | Bacteria | 3597 |
| 668 | Ga0495599_0078614 | 3300046678 | Bacteria | 2060 |
| 669 | Ga0495599_0163976 | 3300046678 | Bacteria | 1373 |
| 670 | Ga0495646_0080456 | 3300046680 | Bacteria | 1900 |
| 671 | Ga0495646_0230386 | 3300046680 | Bacteria | 999 |
| 672 | Ga0495647_0058570 | 3300046681 | Bacteria | 1514 |
| 673 | Ga0495647_0482278 | 3300046681 | Bacteria | 576 |
| 674 | Ga0495658_0024230 | 3300046683 | Bacteria | 3229 |
| 675 | Ga0495658_0168604 | 3300046683 | Bacteria | 1354 |
| 676 | Ga0495669_0081234 | 3300046684 | Bacteria | 1488 |
| 677 | Ga0495613_0072125 | 3300046689 | Bacteria | 2517 |
| 678 | Ga0495613_0081969 | 3300046689 | Bacteria | 2343 |
| 679 | Ga0495624_0024439 | 3300046690 | Bacteria | 3975 |
| 680 | Ga0495624_0141336 | 3300046690 | Bacteria | 1474 |
| 681 | Ga0495670_0000963 | 3300046691 | Bacteria | 13946 |
| 682 | Ga0495649_0010905 | 3300046694 | Bacteria | 5353 |
| 683 | Ga0495649_0063489 | 3300046694 | Bacteria | 1984 |
| 684 | Ga0495649_0144488 | 3300046694 | Bacteria | 1251 |
| 685 | Ga0495589_0258343 | 3300046794 | Bacteria | 813 |
| 686 | Ga0495600_0035115 | 3300046809 | Bacteria | 3255 |
| 687 | Ga0495600_0372738 | 3300046809 | Bacteria | 891 |
| 688 | Ga0495581_0014251 | 3300047315 | Bacteria | 4610 |
| 689 | Ga0495604_0007727 | 3300047317 | Bacteria | 8516 |
| 690 | Ga0495604_0075510 | 3300047317 | Bacteria | 2537 |
| 691 | Ga0495604_0115082 | 3300047317 | Bacteria | 1955 |
| 692 | Ga0495604_0260480 | 3300047317 | Bacteria | 1179 |
| 693 | Ga0495674_0006216 | 3300047319 | Bacteria | 11455 |
| 694 | Ga0495674_0029090 | 3300047319 | Bacteria | 5033 |
| 695 | Ga0495672_0283249 | 3300047320 | Bacteria | 791 |
| 696 | Ga0495676_0099349 | 3300047321 | Bacteria | 2157 |
| 697 | Ga0495680_0032133 | 3300047322 | Bacteria | 4265 |
| 698 | Ga0495683_0182534 | 3300047323 | Bacteria | 957 |
| 699 | Ga0495687_023857 | 3300047443 | Bacteria | 2917 |
| 700 | Ga0495687_044794 | 3300047443 | Bacteria | 1920 |
| 701 | Ga0495675_0009070 | 3300047444 | Bacteria | 6181 |
| 702 | Ga0495673_0031757 | 3300047469 | Bacteria | 2470 |
| 703 | Ga0495684_0023878 | 3300047471 | Bacteria | 4702 |
| 704 | Ga0495684_0035401 | 3300047471 | Bacteria | 3829 |
| 705 | Ga0495686_0508466 | 3300047472 | Bacteria | 633 |
| 706 | Ga0495593_0035519 | 3300047673 | Bacteria | 2706 |
| 707 | Ga0495593_0161835 | 3300047673 | Bacteria | 1129 |
| 708 | Ga0495602_0022455 | 3300048088 | Bacteria | 6175 |
| 709 | Ga0495602_0458621 | 3300048088 | Bacteria | 898 |
| 710 | Ga0496100_0017591 | 3300048903 | Bacteria | 4223 |
| 711 | Ga0496100_0132409 | 3300048903 | Bacteria | 1758 |
| 712 | Ga0496101_0021665 | 3300048904 | Bacteria | 4416 |
| 713 | Ga0496101_0159109 | 3300048904 | Bacteria | 1731 |
| 714 | Ga0496101_0321438 | 3300048904 | Bacteria | 1214 |
| 715 | Ga0496102_0009634 | 3300048905 | Bacteria | 8308 |
| 716 | Ga0496102_0054915 | 3300048905 | Bacteria | 3632 |
| 717 | Ga0496102_0463231 | 3300048905 | Bacteria | 1188 |
| 718 | Ga0496102_0510546 | 3300048905 | Bacteria | 1124 |
| 719 | Ga0496102_0622066 | 3300048905 | Bacteria | 1003 |
| 720 | Ga0496102_0839847 | 3300048905 | Bacteria | 841 |
| 721 | Ga0496103_0036608 | 3300048906 | Bacteria | 3005 |
| 722 | Ga0496103_0619979 | 3300048906 | Bacteria | 688 |
| 723 | Ga0496104_0004574 | 3300048907 | Bacteria | 12056 |
| 724 | Ga0496104_0073288 | 3300048907 | Bacteria | 3257 |
| 725 | Ga0496104_0195029 | 3300048907 | Bacteria | 1937 |
| 726 | Ga0496104_0201495 | 3300048907 | Bacteria | 1902 |
| 727 | Ga0496104_0473070 | 3300048907 | Bacteria | 1164 |
| 728 | Ga0496104_1257294 | 3300048907 | Bacteria | 643 |
| 729 | Ga0496105_0000527 | 3300048908 | Bacteria | 25240 |
| 730 | Ga0496105_0056097 | 3300048908 | Bacteria | 3252 |
| 731 | Ga0496106_0002824 | 3300048909 | Bacteria | 12877 |
| 732 | Ga0496106_0027981 | 3300048909 | Bacteria | 4197 |
| 733 | Ga0496106_0091608 | 3300048909 | Bacteria | 2347 |
| 734 | Ga0496107_0010480 | 3300048910 | Bacteria | 6443 |
| 735 | Ga0496107_0028033 | 3300048910 | Bacteria | 4002 |
| 736 | Ga0496107_0106734 | 3300048910 | Bacteria | 2057 |
| 737 | Ga0496107_0247615 | 3300048910 | Bacteria | 1326 |
| 738 | Ga0496107_0933363 | 3300048910 | Bacteria | 632 |
| 739 | Ga0496108_0018136 | 3300048911 | Bacteria | 5759 |
| 740 | Ga0496108_0025756 | 3300048911 | Bacteria | 4850 |
| 741 | Ga0496108_0953846 | 3300048911 | Bacteria | 734 |
| 742 | Ga0496109_0020859 | 3300048912 | Bacteria | 5790 |
| 743 | Ga0496109_0161976 | 3300048912 | Bacteria | 2096 |
| 744 | Ga0496109_0216354 | 3300048912 | Bacteria | 1802 |
| 745 | Ga0496109_0403711 | 3300048912 | Bacteria | 1291 |
| 746 | Ga0496109_0823658 | 3300048912 | Bacteria | 866 |
| 747 | Ga0496110_0027155 | 3300048913 | Bacteria | 4905 |
| 748 | Ga0496110_0030187 | 3300048913 | Bacteria | 4671 |
| 749 | Ga0496110_0072319 | 3300048913 | Bacteria | 3059 |
| 750 | Ga0496110_0074314 | 3300048913 | Bacteria | 3018 |
| 751 | Ga0496110_0302670 | 3300048913 | Bacteria | 1456 |
| 752 | Ga0496110_1113010 | 3300048913 | Bacteria | 698 |
| 753 | Ga0496111_0060998 | 3300048914 | Bacteria | 2734 |
| 754 | Ga0496111_0190209 | 3300048914 | Bacteria | 1526 |
| 755 | Ga0496111_0227738 | 3300048914 | Bacteria | 1385 |
| 756 | Ga0496111_0715809 | 3300048914 | Bacteria | 727 |
| 757 | Ga0496112_0006413 | 3300048915 | Bacteria | 10325 |
| 758 | Ga0496112_0010513 | 3300048915 | Bacteria | 8399 |
| 759 | Ga0496112_0429514 | 3300048915 | Bacteria | 1259 |
| 760 | Ga0496112_0546289 | 3300048915 | Bacteria | 1092 |
| 761 | Ga0496112_0584857 | 3300048915 | Bacteria | 1049 |
| 762 | Ga0496113_0179827 | 3300048916 | Bacteria | 1677 |
| 763 | Ga0496113_0229390 | 3300048916 | Bacteria | 1480 |
| 764 | Ga0496113_0283774 | 3300048916 | Bacteria | 1324 |
| 765 | Ga0496113_0325478 | 3300048916 | Bacteria | 1232 |
| 766 | Ga0496113_0459128 | 3300048916 | Bacteria | 1023 |
| 767 | Ga0496113_0886396 | 3300048916 | Bacteria | 706 |
| 768 | Ga0496114_0017928 | 3300048917 | Bacteria | 5722 |
| 769 | Ga0496114_0123124 | 3300048917 | Bacteria | 2232 |
| 770 | Ga0496114_0225208 | 3300048917 | Bacteria | 1647 |
| 771 | Ga0496114_0400260 | 3300048917 | Bacteria | 1216 |
| 772 | Ga0496114_1402618 | 3300048917 | Bacteria | 586 |
| 773 | Ga0496115_0106316 | 3300048918 | Bacteria | 2304 |
| 774 | Ga0496115_0242179 | 3300048918 | Bacteria | 1486 |
| 775 | Ga0496115_0246134 | 3300048918 | Bacteria | 1473 |
| 776 | Ga0496115_0489962 | 3300048918 | Bacteria | 989 |
| 777 | Ga0496115_0680535 | 3300048918 | Bacteria | 810 |
| 778 | Ga0496115_0802889 | 3300048918 | Bacteria | 732 |
| 779 | Ga0496116_0012377 | 3300048919 | Bacteria | 6974 |
| 780 | Ga0496116_0043539 | 3300048919 | Bacteria | 3057 |
| 781 | Ga0496116_0258800 | 3300048919 | Bacteria | 860 |
| 782 | Ga0496117_0016115 | 3300048920 | Bacteria | 6324 |
| 783 | Ga0496117_0052465 | 3300048920 | Bacteria | 2872 |
| 784 | Ga0496117_0061321 | 3300048920 | Bacteria | 2586 |
| 785 | Ga0496117_0062047 | 3300048920 | Bacteria | 2564 |
| 786 | Ga0496118_0004964 | 3300048921 | Bacteria | 15387 |
| 787 | Ga0496118_0013461 | 3300048921 | Bacteria | 7733 |
| 788 | Ga0496118_0087024 | 3300048921 | Bacteria | 2169 |
| 789 | Ga0496118_0110460 | 3300048921 | Bacteria | 1826 |
| 790 | Ga0496118_0201462 | 3300048921 | Bacteria | 1178 |
| 791 | Ga0496118_0261767 | 3300048921 | Bacteria | 975 |
| 792 | Ga0496118_0363162 | 3300048921 | Bacteria | 767 |
| 793 | Ga0496119_0029287 | 3300048922 | Bacteria | 3738 |
| 794 | Ga0496119_0044910 | 3300048922 | Bacteria | 2776 |
| 795 | Ga0496119_0048849 | 3300048922 | Bacteria | 2620 |
| 796 | Ga0496119_0163830 | 3300048922 | Bacteria | 1179 |
| 797 | Ga0496120_0008444 | 3300048923 | Bacteria | 7475 |
| 798 | Ga0496120_0043583 | 3300048923 | Bacteria | 2613 |
| 799 | Ga0496120_0166746 | 3300048923 | Bacteria | 1093 |
| 800 | Ga0496121_0002820 | 3300048924 | Bacteria | 25702 |
| 801 | Ga0496121_0017933 | 3300048924 | Bacteria | 7181 |
| 802 | Ga0496121_0019022 | 3300048924 | Bacteria | 6890 |
| 803 | Ga0496121_0035353 | 3300048924 | Bacteria | 4480 |
| 804 | Ga0496121_0057037 | 3300048924 | Bacteria | 3239 |
| 805 | Ga0496121_0082556 | 3300048924 | Bacteria | 2540 |
| 806 | Ga0496121_0117993 | 3300048924 | Bacteria | 2009 |
| 807 | Ga0496121_0185608 | 3300048924 | Bacteria | 1496 |
| 808 | Ga0496121_0339179 | 3300048924 | Bacteria | 1005 |
| 809 | Ga0496121_0478822 | 3300048924 | Bacteria | 795 |
| 810 | Ga0496121_0697313 | 3300048924 | Bacteria | 611 |
| 811 | Ga0496122_0282557 | 3300048925 | Bacteria | 906 |
| 812 | Ga0496124_0002651 | 3300048927 | Bacteria | 22984 |
| 813 | Ga0496124_0033680 | 3300048927 | Bacteria | 4505 |
| 814 | Ga0496124_0141737 | 3300048927 | Bacteria | 1896 |
| 815 | Ga0496124_0195437 | 3300048927 | Bacteria | 1544 |
| 816 | Ga0496124_0238325 | 3300048927 | Bacteria | 1355 |
| 817 | Ga0496124_0365873 | 3300048927 | Bacteria | 1014 |
| 818 | Ga0496124_0792593 | 3300048927 | Bacteria | 588 |
| 819 | Ga0496124_0935007 | 3300048927 | Bacteria | 523 |
| 820 | Ga0496125_0008852 | 3300048928 | Bacteria | 10461 |
| 821 | Ga0496125_0024004 | 3300048928 | Bacteria | 5617 |
| 822 | Ga0496125_0025082 | 3300048928 | Bacteria | 5469 |
| 823 | Ga0496125_0029022 | 3300048928 | Bacteria | 4981 |
| 824 | Ga0496125_0066594 | 3300048928 | Bacteria | 2845 |
| 825 | Ga0496125_0068173 | 3300048928 | Bacteria | 2800 |
| 826 | Ga0496125_0080114 | 3300048928 | Bacteria | 2500 |
| 827 | Ga0496126_0008467 | 3300048929 | Bacteria | 11092 |
| 828 | Ga0496126_0013579 | 3300048929 | Bacteria | 8270 |
| 829 | Ga0496126_0014996 | 3300048929 | Bacteria | 7812 |
| 830 | Ga0496126_0063124 | 3300048929 | Bacteria | 3321 |
| 831 | Ga0496126_0072456 | 3300048929 | Bacteria | 3064 |
| 832 | Ga0496126_0134860 | 3300048929 | Bacteria | 2130 |
| 833 | Ga0496126_0320075 | 3300048929 | Bacteria | 1275 |
| 834 | Ga0496126_0385106 | 3300048929 | Bacteria | 1140 |
| 835 | Ga0496126_0398999 | 3300048929 | Bacteria | 1116 |
| 836 | Ga0496126_0523110 | 3300048929 | Bacteria | 945 |
| 837 | Ga0496126_0557091 | 3300048929 | Bacteria | 909 |
| 838 | Ga0496126_0592123 | 3300048929 | Bacteria | 875 |
| 839 | Ga0496126_0817006 | 3300048929 | Bacteria | 714 |
| 840 | Ga0495678_031118 | 3300049459 | Bacteria | 2228 |
| 841 | Ga0495682_0009330 | 3300049460 | Bacteria | 3831 |
| 842 | Ga0495682_0053769 | 3300049460 | Bacteria | 1462 |
| 843 | Ga0495682_0055819 | 3300049460 | Bacteria | 1432 |
| 844 | Ga0501031_0335122 | 3300049568 | Bacteria | 979 |
| 845 | Ga0501032_0089474 | 3300049569 | Bacteria | 2043 |
| 846 | Ga0501032_0682422 | 3300049569 | Bacteria | 651 |
| 847 | Ga0501033_0313602 | 3300049570 | Bacteria | 1102 |
| 848 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 849 | Ga0501034_0046426 | 3300049571 | Bacteria | 4389 |
| 850 | Ga0501034_0456807 | 3300049571 | Bacteria | 1194 |
| 851 | Ga0501034_0855233 | 3300049571 | Bacteria | 799 |
| 852 | Ga0501036_0103924 | 3300049572 | Bacteria | 2402 |
| 853 | Ga0501036_0176420 | 3300049572 | Bacteria | 1799 |
| 854 | Ga0501037_0126603 | 3300049573 | Bacteria | 1833 |
| 855 | Ga0501038_0006039 | 3300049574 | Bacteria | 11212 |
| 856 | Ga0501040_0132966 | 3300049576 | Bacteria | 1750 |
| 857 | Ga0501043_0017698 | 3300049579 | Bacteria | 5588 |
| 858 | Ga0501043_0108635 | 3300049579 | Bacteria | 2178 |
| 859 | Ga0501043_0475317 | 3300049579 | Bacteria | 936 |
| 860 | Ga0501046_0032215 | 3300049580 | Bacteria | 4245 |
| 861 | Ga0501047_0051102 | 3300049581 | Bacteria | 3992 |
| 862 | Ga0501048_0013502 | 3300049582 | Bacteria | 6062 |
| 863 | Ga0501070_0041109 | 3300049586 | Bacteria | 3852 |
| 864 | Ga0501070_0112544 | 3300049586 | Bacteria | 2249 |
| 865 | Ga0501073_0115850 | 3300049589 | Bacteria | 1857 |
| 866 | Ga0501073_0800735 | 3300049589 | Bacteria | 649 |
| 867 | Ga0501074_0035635 | 3300049590 | Bacteria | 3605 |
| 868 | Ga0501080_0042828 | 3300049742 | Bacteria | 4215 |
| 869 | Ga0501080_0137365 | 3300049742 | Bacteria | 2261 |
| 870 | Ga0501035_0126553 | 3300049822 | Bacteria | 2230 |
| 871 | Ga0501035_0153196 | 3300049822 | Bacteria | 1999 |
| 872 | Ga0501044_0007497 | 3300049823 | Bacteria | 12001 |
| 873 | Ga0501044_0029896 | 3300049823 | Bacteria | 5744 |
| 874 | Ga0501044_0078881 | 3300049823 | Bacteria | 3337 |
| 875 | Ga0501044_0296280 | 3300049823 | Bacteria | 1547 |
| 876 | nmdc:mga03683_159542_c1 | 3300050489 | Bacteria | 1021 |
| 877 | nmdc:mga03683_61618_c1 | 3300050489 | Bacteria | 1587 |
| 878 | nmdc:mga03n38_220034_c1 | 3300050490 | Bacteria | 991 |
| 879 | nmdc:mga03n38_240531_c1 | 3300050490 | Bacteria | 952 |
| 880 | nmdc:mga03n38_281488_c1 | 3300050490 | Bacteria | 888 |
| 881 | nmdc:mga03n38_8084_c1 | 3300050490 | Bacteria | 3755 |
| 882 | nmdc:mga00v17_152090_c1 | 3300050491 | Bacteria | 1487 |
| 883 | nmdc:mga00v17_561489_c1 | 3300050491 | Bacteria | 738 |
| 884 | nmdc:mga00v17_66785_c1 | 3300050491 | Bacteria | 2221 |
| 885 | nmdc:mga0yw44_13027_c1 | 3300050492 | Bacteria | 4360 |
| 886 | nmdc:mga0yw44_338611_c1 | 3300050492 | Bacteria | 1012 |
| 887 | nmdc:mga0yw44_448081_c1 | 3300050492 | Bacteria | 875 |
| 888 | nmdc:mga0yw44_82874_c1 | 3300050492 | Bacteria | 2013 |
| 889 | nmdc:mga0k408_3760_c1 | 3300050493 | Bacteria | 6742 |
| 890 | nmdc:mga0k408_77172_c1 | 3300050493 | Bacteria | 1948 |
| 891 | nmdc:mga0k408_91664_c1 | 3300050493 | Bacteria | 1785 |
| 892 | nmdc:mga06z11_13600_c1 | 3300050494 | Bacteria | 3580 |
| 893 | nmdc:mga06z11_192674_c1 | 3300050494 | Bacteria | 1181 |
| 894 | nmdc:mga06z11_267940_c1 | 3300050494 | Bacteria | 1009 |
| 895 | nmdc:mga06z11_393292_c1 | 3300050494 | Bacteria | 834 |
| 896 | nmdc:mga06z11_475674_c1 | 3300050494 | Bacteria | 756 |
| 897 | nmdc:mga04h51_31801_c1 | 3300050495 | Bacteria | 1670 |
| 898 | nmdc:mga04h51_96647_c1 | 3300050495 | Bacteria | 1071 |
| 899 | nmdc:mga07m45_21803_c1 | 3300050496 | Bacteria | 3492 |
| 900 | nmdc:mga07m45_91322_c1 | 3300050496 | Bacteria | 1744 |
| 901 | nmdc:mga07m45_94321_c1 | 3300050496 | Bacteria | 1716 |
| 902 | nmdc:mga0n895_1340567_c1 | 3300050512 | Bacteria | 685 |
| 903 | nmdc:mga0n895_556640_c1 | 3300050512 | Bacteria | 1152 |
| 904 | nmdc:mga0sz30_239974_c1 | 3300050516 | Bacteria | 807 |
| 905 | nmdc:mga0sz30_307117_c1 | 3300050516 | Bacteria | 708 |
| 906 | nmdc:mga0sz30_38220_c1 | 3300050516 | Bacteria | 2011 |
| 907 | nmdc:mga0sz30_48879_c1 | 3300050516 | Bacteria | 1791 |
| 908 | nmdc:mga0sz30_94706_c1 | 3300050516 | Bacteria | 1302 |
| 909 | Ga0495601_0152922 | 3300053077 | Bacteria | 1506 |
| 910 | Ga0495601_0255969 | 3300053077 | Bacteria | 1143 |
| 911 | Ga0495612_0017216 | 3300053078 | Bacteria | 2895 |
| 912 | Ga0500610_0184871 | 3300053079 | Bacteria | 1017 |
| 913 | Ga0500610_0242213 | 3300053079 | Bacteria | 838 |
| 914 | Ga0500635_0014552 | 3300053080 | Bacteria | 2308 |
| 915 | Ga0500635_0026210 | 3300053080 | Bacteria | 1843 |
| 916 | Ga0500635_0132792 | 3300053080 | Bacteria | 939 |
| 917 | Ga0495655_0014279 | 3300053083 | Bacteria | 1662 |
| 918 | Ga0495655_0024406 | 3300053083 | Bacteria | 1404 |
| 919 | Ga0495595_0124865 | 3300053084 | Bacteria | 1255 |
| 920 | Ga0495619_0150792 | 3300053085 | Bacteria | 1604 |
| 921 | Ga0495619_0215190 | 3300053085 | Bacteria | 1331 |
| 922 | Ga0495619_0284790 | 3300053085 | Bacteria | 1145 |
| 923 | Ga0495619_0337095 | 3300053085 | Bacteria | 1044 |
| 924 | Ga0500578_0466151 | 3300053086 | Bacteria | 716 |
| 925 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 926 | Ga0500643_039575 | 3300053087 | Bacteria | 1392 |
| 927 | Ga0500644_0101593 | 3300053088 | Bacteria | 1093 |
| 928 | Ga0500581_148762 | 3300053089 | Bacteria | 1101 |
| 929 | Ga0500647_0026856 | 3300053091 | Bacteria | 2718 |
| 930 | Ga0500583_0009468 | 3300053092 | Bacteria | 3563 |
| 931 | Ga0500651_0039750 | 3300053093 | Bacteria | 2962 |
| 932 | Ga0500566_0000204 | 3300053094 | Bacteria | 31169 |
| 933 | Ga0500566_0003695 | 3300053094 | Bacteria | 9139 |
| 934 | Ga0500566_0011050 | 3300053094 | Bacteria | 5319 |
| 935 | Ga0500566_0047105 | 3300053094 | Bacteria | 2475 |
| 936 | Ga0500566_0294287 | 3300053094 | Bacteria | 767 |
| 937 | Ga0500640_001800 | 3300053095 | Bacteria | 6748 |
| 938 | Ga0500640_069438 | 3300053095 | Bacteria | 1513 |
| 939 | Ga0500641_0011583 | 3300053096 | Bacteria | 3203 |
| 940 | Ga0500641_0089848 | 3300053096 | Bacteria | 1310 |
| 941 | Ga0500648_086637 | 3300053097 | Bacteria | 1757 |
| 942 | Ga0500650_0010869 | 3300053098 | Bacteria | 3723 |
| 943 | Ga0500650_0098154 | 3300053098 | Bacteria | 1371 |
| 944 | Ga0500555_001232 | 3300053103 | Bacteria | 8233 |
| 945 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 946 | Ga0500556_0045721 | 3300053104 | Bacteria | 1563 |
| 947 | Ga0500557_000052 | 3300053105 | Bacteria | 50636 |
| 948 | Ga0500562_127130 | 3300053108 | Bacteria | 694 |
| 949 | Ga0500572_000307 | 3300053111 | Bacteria | 17413 |
| 950 | Ga0500572_000451 | 3300053111 | Bacteria | 14277 |
| 951 | Ga0500591_139140 | 3300053115 | Bacteria | 962 |
| 952 | Ga0500592_011352 | 3300053116 | Bacteria | 1424 |
| 953 | Ga0500595_027995 | 3300053119 | Bacteria | 1924 |
| 954 | Ga0500597_130297 | 3300053120 | Bacteria | 1087 |
| 955 | Ga0500597_225985 | 3300053120 | Bacteria | 776 |
| 956 | Ga0500607_049924 | 3300053121 | Bacteria | 2231 |
| 957 | Ga0500608_003260 | 3300053122 | Bacteria | 6047 |
| 958 | Ga0500608_020784 | 3300053122 | Bacteria | 3023 |
| 959 | Ga0500608_055785 | 3300053122 | Bacteria | 1893 |
| 960 | Ga0500614_002722 | 3300053123 | Bacteria | 3899 |
| 961 | Ga0500614_017858 | 3300053123 | Bacteria | 1608 |
| 962 | Ga0500642_0000274 | 3300053130 | Bacteria | 19303 |
| 963 | Ga0500642_0179222 | 3300053130 | Bacteria | 990 |
| 964 | Ga0500559_0000066 | 3300053136 | Bacteria | 84664 |
| 965 | Ga0500559_0000143 | 3300053136 | Bacteria | 55572 |
| 966 | Ga0500559_0027270 | 3300053136 | Bacteria | 2437 |
| 967 | Ga0500559_0037695 | 3300053136 | Bacteria | 2096 |
| 968 | Ga0500559_0270231 | 3300053136 | Bacteria | 800 |
| 969 | Ga0500564_024180 | 3300053138 | Bacteria | 2787 |
| 970 | Ga0500568_0004322 | 3300053139 | Bacteria | 7622 |
| 971 | Ga0500568_0008587 | 3300053139 | Bacteria | 4910 |
| 972 | Ga0500585_123841 | 3300053144 | Bacteria | 920 |
| 973 | Ga0500588_0035520 | 3300053146 | Bacteria | 1468 |
| 974 | Ga0500590_124109 | 3300053148 | Bacteria | 1205 |
| 975 | Ga0500603_000834 | 3300053150 | Bacteria | 7360 |
| 976 | Ga0500604_0074390 | 3300053151 | Bacteria | 1088 |
| 977 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 978 | Ga0500616_0000061 | 3300053153 | Bacteria | 249158 |
| 979 | Ga0500616_0039160 | 3300053153 | Bacteria | 2557 |
| 980 | Ga0500619_011481 | 3300053154 | Bacteria | 2279 |
| 981 | Ga0500620_010363 | 3300053155 | Bacteria | 2449 |
| 982 | Ga0500622_0000518 | 3300053156 | Bacteria | 35866 |
| 983 | Ga0500622_0008171 | 3300053156 | Bacteria | 5878 |
| 984 | Ga0500624_003192 | 3300053157 | Bacteria | 2158 |
| 985 | Ga0500624_018186 | 3300053157 | Bacteria | 1104 |
| 986 | Ga0500627_0046909 | 3300053158 | Bacteria | 1874 |
| 987 | Ga0500630_000027 | 3300053159 | Bacteria | 42085 |
| 988 | Ga0500633_0061133 | 3300053160 | Bacteria | 1325 |
| 989 | Ga0500638_118260 | 3300053162 | Bacteria | 1215 |
| 990 | Ga0500639_000020 | 3300053163 | Bacteria | 102959 |
| 991 | Ga0500639_008513 | 3300053163 | Bacteria | 5351 |
| 992 | Ga0500639_027459 | 3300053163 | Bacteria | 3008 |
| 993 | Ga0500636_0000042 | 3300053177 | Bacteria | 69412 |
| 994 | Ga0500636_0002347 | 3300053177 | Bacteria | 10501 |
| 995 | Ga0500636_0010264 | 3300053177 | Bacteria | 5460 |
| 996 | Ga0500636_0165491 | 3300053177 | Bacteria | 1201 |
| 997 | Ga0500637_0047062 | 3300053178 | Bacteria | 2449 |
| 998 | Ga0500637_0068654 | 3300053178 | Bacteria | 2037 |
| 999 | Ga0500637_0095278 | 3300053178 | Bacteria | 1724 |
| 1000 | Ga0500637_0163564 | 3300053178 | Bacteria | 1282 |
| 1001 | Ga0500649_144835 | 3300053722 | Bacteria | 865 |
| 1002 | Ga0500576_053720 | 3300053725 | Bacteria | 1780 |
| 1003 | Ga0500611_040567 | 3300053727 | Bacteria | 1020 |
| 1004 | Ga0500625_008844 | 3300053729 | Bacteria | 4472 |
| 1005 | Ga0500609_008520 | 3300053731 | Bacteria | 1384 |
| 1006 | Ga0500656_005423 | 3300053732 | Bacteria | 1261 |
| 1007 | Ga0500596_006963 | 3300053735 | Bacteria | 1878 |
| 1008 | Ga0500599_003266 | 3300053736 | Bacteria | 1971 |
| 1009 | Ga0500601_000228 | 3300053737 | Bacteria | 11112 |
| 1010 | Ga0500661_017224 | 3300055283 | Bacteria | 1290 |
| 1011 | Ga0466962_0154092 | 3300061719 | Bacteria | 1115 |
| 1012 | Ga0466962_0183348 | 3300061719 | Bacteria | 1021 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10435896 | Ga0157379_104358962 | 129 |
| 2 | 3300053080 | Ga0500635_0132792 | Ga0500635_0132792_19_441 | 140 |
| 3 | 3300025986 | Ga0207658_11541344 | Ga0207658_115413442 | 142 |
| 4 | iso_pu_bacteria | 2847930680 | 2847936595 | 145 |
| 5 | iso_pu_bacteria | 2879083081 | 2879088061 | 145 |
| 6 | iso_pu_bacteria | 2888378607 | 2888384493 | 145 |
| 7 | 3300005530 | Ga0070679_100814556 | Ga0070679_1008145562 | 148 |
| 8 | 3300037853 | Ga0436364_0432530 | Ga0436364_0432530_14_460 | 148 |
| 9 | 3300048918 | Ga0496115_0802889 | Ga0496115_0802889_273_719 | 148 |
| 10 | 3300044765 | Ga0466970_0557952 | Ga0466970_0557952_202_651 | 149 |
| 11 | 3300046501 | Ga0495607_0172044 | Ga0495607_0172044_20_469 | 149 |
| 12 | 3300046507 | Ga0495606_0028614 | Ga0495606_0028614_17_466 | 149 |
| 13 | 3300046507 | Ga0495606_0136165 | Ga0495606_0136165_14_463 | 149 |
| 14 | 3300046517 | Ga0495630_0193217 | Ga0495630_0193217_20_469 | 149 |
| 15 | 3300046680 | Ga0495646_0080456 | Ga0495646_0080456_20_469 | 149 |
| 16 | 3300050491 | nmdc:mga00v17_561489_c1 | nmdc:mga00v17_561489_c1_277_726 | 149 |
| 17 | 3300009098 | Ga0105245_10560575 | Ga0105245_105605752 | 152 |
| 18 | iso_pu_bacteria | 2507262055 | 2507508209 | 152 |
| 19 | iso_pu_bacteria | 2508501009 | 2508542275 | 152 |
| 20 | iso_pu_bacteria | 2508501042 | 2508691959 | 152 |
| 21 | iso_pu_bacteria | 2511231028 | 2511398752 | 152 |
| 22 | iso_pu_bacteria | 2513237092 | 2513622339 | 152 |
| 23 | iso_pu_bacteria | 2513237094 | 2513640516 | 152 |
| 24 | iso_pu_bacteria | 2513237095 | 2513645428 | 152 |
| 25 | iso_pu_bacteria | 2513237102 | 2513701731 | 152 |
| 26 | iso_pu_bacteria | 2513237104 | 2513718377 | 152 |
| 27 | iso_pu_bacteria | 2513237139 | 2513873153 | 152 |
| 28 | iso_pu_bacteria | 2513237161 | 2514016502 | 152 |
| 29 | iso_pu_bacteria | 2515154112 | 2515627284 | 152 |
| 30 | iso_pu_bacteria | 2517093001 | 2517102605 | 152 |
| 31 | iso_pu_bacteria | 2524023205 | 2524437750 | 152 |
| 32 | iso_pu_bacteria | 2528768022 | 2528848722 | 152 |
| 33 | iso_pu_bacteria | 2602042107 | 2603856789 | 152 |
| 34 | iso_pu_bacteria | 2617270735 | 2617346980 | 152 |
| 35 | iso_pu_bacteria | 2617270741 | 2617375398 | 152 |
| 36 | iso_pu_bacteria | 2744054633 | 2745074842 | 152 |
| 37 | iso_pu_bacteria | 2791355196 | 2793062581 | 152 |
| 38 | iso_pu_bacteria | 2802429603 | 2805914948 | 152 |
| 39 | iso_pu_bacteria | 2816332527 | 2818239665 | 152 |
| 40 | iso_pu_bacteria | 2824600985 | 2824602343 | 152 |
| 41 | iso_pu_bacteria | 2824609381 | 2824610563 | 152 |
| 42 | iso_pu_bacteria | 2824617872 | 2824618124 | 152 |
| 43 | iso_pu_bacteria | 2824626560 | 2824626792 | 152 |
| 44 | iso_pu_bacteria | 2824635225 | 2824636573 | 152 |
| 45 | iso_pu_bacteria | 2824644064 | 2824645107 | 152 |
| 46 | iso_pu_bacteria | 2824653114 | 2824654312 | 152 |
| 47 | iso_pu_bacteria | 2824661429 | 2824661609 | 152 |
| 48 | iso_pu_bacteria | 2824671348 | 2824672055 | 152 |
| 49 | iso_pu_bacteria | 2824679649 | 2824679883 | 152 |
| 50 | iso_pu_bacteria | 2824687955 | 2824688654 | 152 |
| 51 | iso_pu_bacteria | 2824696289 | 2824697108 | 152 |
| 52 | iso_pu_bacteria | 2824704595 | 2824705072 | 152 |
| 53 | iso_pu_bacteria | 2824714736 | 2824720401 | 152 |
| 54 | iso_pu_bacteria | 2824723954 | 2824729465 | 152 |
| 55 | iso_pu_bacteria | 2824732956 | 2824734588 | 152 |
| 56 | iso_pu_bacteria | 2824746037 | 2824749880 | 152 |
| 57 | iso_pu_bacteria | 2824753945 | 2824754390 | 152 |
| 58 | iso_pu_bacteria | 2824763712 | 2824767889 | 152 |
| 59 | iso_pu_bacteria | 2824773399 | 2824780368 | 152 |
| 60 | iso_pu_bacteria | 2838122688 | 2838123332 | 152 |
| 61 | iso_pu_bacteria | 2841941048 | 2841946625 | 152 |
| 62 | iso_pu_bacteria | 2841949485 | 2841954143 | 152 |
| 63 | iso_pu_bacteria | 2841957949 | 2841960994 | 152 |
| 64 | iso_pu_bacteria | 2841966195 | 2841969519 | 152 |
| 65 | iso_pu_bacteria | 2841974524 | 2841974596 | 152 |
| 66 | iso_pu_bacteria | 2841983080 | 2841983843 | 152 |
| 67 | iso_pu_bacteria | 2842038055 | 2842040198 | 152 |
| 68 | iso_pu_bacteria | 2842045827 | 2842046857 | 152 |
| 69 | iso_pu_bacteria | 2844315083 | 2844319424 | 152 |
| 70 | iso_pu_bacteria | 2847939898 | 2847946944 | 152 |
| 71 | iso_pu_bacteria | 2849076700 | 2849078947 | 152 |
| 72 | iso_pu_bacteria | 2857509624 | 2857515925 | 152 |
| 73 | iso_pu_bacteria | 2857524615 | 2857528267 | 152 |
| 74 | iso_pu_bacteria | 2874590934 | 2874598420 | 152 |
| 75 | iso_pu_bacteria | 2874612657 | 2874619358 | 152 |
| 76 | iso_pu_bacteria | 2874620515 | 2874626423 | 152 |
| 77 | iso_pu_bacteria | 2874628541 | 2874632287 | 152 |
| 78 | iso_pu_bacteria | 2874645413 | 2874652525 | 152 |
| 79 | iso_pu_bacteria | 2876761206 | 2876764969 | 152 |
| 80 | iso_pu_bacteria | 2876771140 | 2876778102 | 152 |
| 81 | iso_pu_bacteria | 2876818435 | 2876826029 | 152 |
| 82 | iso_pu_bacteria | 2879074833 | 2879081896 | 152 |
| 83 | iso_pu_bacteria | 2879099564 | 2879108363 | 152 |
| 84 | iso_pu_bacteria | 2879127579 | 2879135018 | 152 |
| 85 | iso_pu_bacteria | 2879142872 | 2879149703 | 152 |
| 86 | iso_pu_bacteria | 2881364244 | 2881368451 | 152 |
| 87 | iso_pu_bacteria | 2881665667 | 2881672520 | 152 |
| 88 | iso_pu_bacteria | 2885366525 | 2885369272 | 152 |
| 89 | iso_pu_bacteria | 2885409591 | 2885413301 | 152 |
| 90 | iso_pu_bacteria | 2888388044 | 2888393415 | 152 |
| 91 | iso_pu_bacteria | 2888419890 | 2888424938 | 152 |
| 92 | iso_pu_bacteria | 2893066018 | 2893068700 | 152 |
| 93 | iso_pu_bacteria | 2903727486 | 2903734366 | 152 |
| 94 | iso_pu_bacteria | 2904666416 | 2904671762 | 152 |
| 95 | iso_pu_bacteria | 2904711408 | 2904715113 | 152 |
| 96 | iso_pu_bacteria | 2906602504 | 2906605610 | 152 |
| 97 | iso_pu_bacteria | 2906626472 | 2906627149 | 152 |
| 98 | iso_pu_bacteria | 2906643746 | 2906646180 | 152 |
| 99 | iso_pu_bacteria | 2908775508 | 2908780544 | 152 |
| 100 | iso_pu_bacteria | 2919073203 | 2919075691 | 152 |
| 101 | iso_pu_bacteria | 2922368715 | 2922374909 | 152 |
| 102 | iso_pu_bacteria | 2922393267 | 2922394554 | 152 |
| 103 | iso_pu_bacteria | 2929615660 | 2929621951 | 152 |
| 104 | iso_pu_bacteria | 2929624759 | 2929629742 | 152 |
| 105 | iso_pu_bacteria | 2932784394 | 2932788816 | 152 |
| 106 | iso_pu_bacteria | 2932794094 | 2932797981 | 152 |
| 107 | iso_pu_bacteria | 2932801729 | 2932807176 | 152 |
| 108 | iso_pu_bacteria | 2932809354 | 2932812791 | 152 |
| 109 | iso_pu_bacteria | 2932818245 | 2932819117 | 152 |
| 110 | iso_pu_bacteria | 2932828146 | 2932830482 | 152 |
| 111 | iso_pu_bacteria | 2933577622 | 2933583774 | 152 |
| 112 | iso_pu_bacteria | 2935608549 | 2935609308 | 152 |
| 113 | iso_pu_bacteria | 2935616580 | 2935616777 | 152 |
| 114 | iso_pu_bacteria | 2935638405 | 2935641893 | 152 |
| 115 | iso_pu_bacteria | 2935648319 | 2935650903 | 152 |
| 116 | iso_pu_bacteria | 2935656913 | 2935659084 | 152 |
| 117 | iso_pu_bacteria | 2935665750 | 2935673024 | 152 |
| 118 | iso_pu_bacteria | 2935675223 | 2935675829 | 152 |
| 119 | iso_pu_bacteria | 2935684952 | 2935685826 | 152 |
| 120 | iso_pu_bacteria | 2935694250 | 2935697928 | 152 |
| 121 | iso_pu_bacteria | 2935703347 | 2935705666 | 152 |
| 122 | iso_pu_bacteria | 2935713505 | 2935714378 | 152 |
| 123 | iso_pu_bacteria | 2935722832 | 2935724997 | 152 |
| 124 | iso_pu_bacteria | 2935732158 | 2935732644 | 152 |
| 125 | iso_pu_bacteria | 2935741537 | 2935742023 | 152 |
| 126 | iso_pu_bacteria | 2935750917 | 2935751791 | 152 |
| 127 | iso_pu_bacteria | 2935760218 | 2935765048 | 152 |
| 128 | iso_pu_bacteria | 2935769743 | 2935771665 | 152 |
| 129 | iso_pu_bacteria | 2935777560 | 2935778920 | 152 |
| 130 | iso_pu_bacteria | 2935785616 | 2935791159 | 152 |
| 131 | iso_pu_bacteria | 2935793552 | 2935795512 | 152 |
| 132 | iso_pu_bacteria | 2935801545 | 2935802644 | 152 |
| 133 | iso_pu_bacteria | 2935810662 | 2935813526 | 152 |
| 134 | iso_pu_bacteria | 2935819856 | 2935822468 | 152 |
| 135 | iso_pu_bacteria | 2935827899 | 2935830060 | 152 |
| 136 | iso_pu_bacteria | 2935837841 | 2935837978 | 152 |
| 137 | iso_pu_bacteria | 2935847175 | 2935848051 | 152 |
| 138 | iso_pu_bacteria | 2935855204 | 2935855401 | 152 |
| 139 | iso_pu_bacteria | 2935864058 | 2935867355 | 152 |
| 140 | iso_pu_bacteria | 2935873716 | 2935875826 | 152 |
| 141 | iso_pu_bacteria | 2935883170 | 2935885824 | 152 |
| 142 | iso_pu_bacteria | 2935908558 | 2935908726 | 152 |
| 143 | iso_pu_bacteria | 2935916978 | 2935917872 | 152 |
| 144 | iso_pu_bacteria | 2935926038 | 2935926700 | 152 |
| 145 | iso_pu_bacteria | 2935934488 | 2935935150 | 152 |
| 146 | iso_pu_bacteria | 2935942939 | 2935943600 | 152 |
| 147 | iso_pu_bacteria | 2935951376 | 2935952038 | 152 |
| 148 | iso_pu_bacteria | 2935959822 | 2935960811 | 152 |
| 149 | iso_pu_bacteria | 2935967501 | 2935968163 | 152 |
| 150 | iso_pu_bacteria | 2935975950 | 2935978778 | 152 |
| 151 | iso_pu_bacteria | 2935984226 | 2935987353 | 152 |
| 152 | iso_pu_bacteria | 2935992306 | 2935996490 | 152 |
| 153 | iso_pu_bacteria | 2936002035 | 2936003770 | 152 |
| 154 | iso_pu_bacteria | 2936011229 | 2936013499 | 152 |
| 155 | iso_pu_bacteria | 2936019824 | 2936022374 | 152 |
| 156 | iso_pu_bacteria | 2936028420 | 2936030820 | 152 |
| 157 | iso_pu_bacteria | 2936037263 | 2936042475 | 152 |
| 158 | iso_pu_bacteria | 2936046547 | 2936048633 | 152 |
| 159 | iso_pu_bacteria | 2936055302 | 2936058847 | 152 |
| 160 | iso_pu_bacteria | 2940556831 | 2940557406 | 152 |
| 161 | iso_pu_bacteria | 2941531003 | 2941533195 | 152 |
| 162 | iso_pu_bacteria | 2941538514 | 2941539356 | 152 |
| 163 | iso_pu_bacteria | 3005483717 | 3005484674 | 152 |
| 164 | iso_pu_bacteria | 3005506211 | 3005510685 | 152 |
| 165 | iso_pu_bacteria | 3005587118 | 3005587676 | 152 |
| 166 | iso_pu_bacteria | 3005594810 | 3005599636 | 152 |
| 167 | iso_pu_bacteria | 3005710791 | 3005715286 | 152 |
| 168 | iso_pu_bacteria | 3005718088 | 3005722664 | 152 |
| 169 | iso_pu_bacteria | 8006926726 | 8006933133 | 152 |
| 170 | iso_pu_bacteria | 8016511872 | 8016521809 | 152 |
| 171 | iso_pu_bacteria | 8016522445 | 8016529219 | 152 |
| 172 | iso_pu_bacteria | 8016530956 | 8016534430 | 152 |
| 173 | iso_pu_bacteria | 8016539877 | 8016547654 | 152 |
| 174 | iso_pu_bacteria | 8016548790 | 8016554485 | 152 |
| 175 | iso_pu_bacteria | 8016566248 | 8016572771 | 152 |
| 176 | iso_pu_bacteria | 8016575299 | 8016576929 | 152 |
| 177 | iso_pu_bacteria | 8016583857 | 8016593290 | 152 |
| 178 | iso_pu_bacteria | 8016595262 | 8016600633 | 152 |
| 179 | iso_pu_bacteria | 8016603502 | 8016610104 | 152 |
| 180 | iso_pu_bacteria | 8016613128 | 8016614834 | 152 |
| 181 | iso_pu_bacteria | 8016622563 | 8016626147 | 152 |
| 182 | iso_pu_bacteria | 8016630954 | 8016639929 | 152 |
| 183 | iso_pu_bacteria | 8017057580 | 8017063842 | 152 |
| 184 | iso_pu_bacteria | 8019530166 | 8019534192 | 152 |
| 185 | iso_pu_bacteria | 8019538911 | 8019545270 | 152 |
| 186 | iso_pu_bacteria | 8019547302 | 8019553244 | 152 |
| 187 | iso_pu_bacteria | 8019586578 | 8019590999 | 152 |
| 188 | iso_pu_bacteria | 8019597564 | 8019600346 | 152 |
| 189 | iso_pu_bacteria | 8019608314 | 8019618194 | 152 |
| 190 | iso_pu_bacteria | 8019638758 | 8019645680 | 152 |
| 191 | iso_pu_bacteria | 8019648815 | 8019658948 | 152 |
| 192 | iso_pu_bacteria | 8019659431 | 8019661930 | 152 |
| 193 | iso_pu_bacteria | 8019668869 | 8019671451 | 152 |
| 194 | iso_pu_bacteria | 8019678201 | 8019684653 | 152 |
| 195 | iso_pu_bacteria | 8019687851 | 8019690477 | 152 |
| 196 | iso_pu_bacteria | 8055742211 | 8055745884 | 152 |
| 197 | iso_pu_bacteria | 8056967851 | 8056968415 | 152 |
| 198 | 3300026075 | Ga0207708_10889845 | Ga0207708_108898452 | 153 |
| 199 | 3300048924 | Ga0496121_0035353 | Ga0496121_0035353_2669_3136 | 154 |
| 200 | 3300048929 | Ga0496126_0008467 | Ga0496126_0008467_3072_3539 | 154 |
| 201 | 3300005336 | Ga0070680_100182490 | Ga0070680_1001824902 | 155 |
| 202 | 3300005339 | Ga0070660_100242798 | Ga0070660_1002427982 | 155 |
| 203 | 3300005366 | Ga0070659_100023050 | Ga0070659_1000230503 | 155 |
| 204 | 3300005366 | Ga0070659_100774739 | Ga0070659_1007747392 | 155 |
| 205 | 3300005435 | Ga0070714_100081809 | Ga0070714_1000818093 | 155 |
| 206 | 3300005436 | Ga0070713_101389385 | Ga0070713_1013893851 | 155 |
| 207 | 3300005530 | Ga0070679_100215125 | Ga0070679_1002151252 | 155 |
| 208 | 3300005539 | Ga0068853_100096401 | Ga0068853_1000964014 | 155 |
| 209 | 3300005548 | Ga0070665_100474852 | Ga0070665_1004748522 | 155 |
| 210 | 3300005563 | Ga0068855_100095252 | Ga0068855_1000952523 | 155 |
| 211 | 3300005563 | Ga0068855_101382155 | Ga0068855_1013821552 | 155 |
| 212 | 3300005614 | Ga0068856_102284394 | Ga0068856_1022843941 | 155 |
| 213 | 3300006028 | Ga0070717_11298683 | Ga0070717_112986831 | 155 |
| 214 | 3300006173 | Ga0070716_100357792 | Ga0070716_1003577922 | 155 |
| 215 | 3300006175 | Ga0070712_101032778 | Ga0070712_1010327782 | 155 |
| 216 | 3300009098 | Ga0105245_10510199 | Ga0105245_105101991 | 155 |
| 217 | 3300009545 | Ga0105237_10041832 | Ga0105237_100418322 | 155 |
| 218 | 3300009551 | Ga0105238_10031278 | Ga0105238_100312783 | 155 |
| 219 | 3300009551 | Ga0105238_10198783 | Ga0105238_101987832 | 155 |
| 220 | 3300013100 | Ga0157373_10040070 | Ga0157373_100400705 | 155 |
| 221 | 3300013102 | Ga0157371_10330650 | Ga0157371_103306502 | 155 |
| 222 | 3300013105 | Ga0157369_11301903 | Ga0157369_113019032 | 155 |
| 223 | 3300013296 | Ga0157374_10021982 | Ga0157374_100219827 | 155 |
| 224 | 3300013306 | Ga0163162_10179714 | Ga0163162_101797142 | 155 |
| 225 | 3300013307 | Ga0157372_11255550 | Ga0157372_112555502 | 155 |
| 226 | 3300025914 | Ga0207671_10662976 | Ga0207671_106629761 | 155 |
| 227 | 3300025921 | Ga0207652_10322037 | Ga0207652_103220372 | 155 |
| 228 | 3300025927 | Ga0207687_10971448 | Ga0207687_109714482 | 155 |
| 229 | 3300025928 | Ga0207700_10673494 | Ga0207700_106734942 | 155 |
| 230 | 3300025929 | Ga0207664_10282165 | Ga0207664_102821651 | 155 |
| 231 | 3300025949 | Ga0207667_10148159 | Ga0207667_101481594 | 155 |
| 232 | 3300026041 | Ga0207639_10042274 | Ga0207639_100422744 | 155 |
| 233 | 3300026142 | Ga0207698_11200897 | Ga0207698_112008972 | 155 |
| 234 | 3300028379 | Ga0268266_10038865 | Ga0268266_100388653 | 155 |
| 235 | 3300037312 | Ga0395899_0053300 | Ga0395899_0053300_1486_1953 | 155 |
| 236 | 3300037418 | Ga0395900_0066935 | Ga0395900_0066935_2004_2471 | 155 |
| 237 | 3300037418 | Ga0395900_0084498 | Ga0395900_0084498_2570_3037 | 155 |
| 238 | 3300037466 | Ga0395898_0070853 | Ga0395898_0070853_889_1356 | 155 |
| 239 | 3300037466 | Ga0395898_0081273 | Ga0395898_0081273_2157_2624 | 155 |
| 240 | 3300038443 | Ga0395901_0003090 | Ga0395901_0003090_11457_11924 | 155 |
| 241 | 3300039437 | Ga0436365_1508712 | Ga0436365_1508712_1365_1832 | 155 |
| 242 | 3300039437 | Ga0436365_1571518 | Ga0436365_1571518_195_662 | 155 |
| 243 | 3300044842 | Ga0466957_0058165 | Ga0466957_0058165_1758_2225 | 155 |
| 244 | 3300044842 | Ga0466957_0739848 | Ga0466957_0739848_145_612 | 155 |
| 245 | 3300045976 | Ga0466967_0122516 | Ga0466967_0122516_662_1129 | 155 |
| 246 | 3300045976 | Ga0466967_1635493 | Ga0466967_1635493_135_602 | 155 |
| 247 | 3300048914 | Ga0496111_0227738 | Ga0496111_0227738_724_1191 | 155 |
| 248 | 3300048917 | Ga0496114_0400260 | Ga0496114_0400260_99_566 | 155 |
| 249 | 3300049569 | Ga0501032_0682422 | Ga0501032_0682422_117_584 | 155 |
| 250 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_124200_124667 | 155 |
| 251 | 3300049571 | Ga0501034_0046426 | Ga0501034_0046426_2990_3457 | 155 |
| 252 | 3300049580 | Ga0501046_0032215 | Ga0501046_0032215_2937_3404 | 155 |
| 253 | 3300049582 | Ga0501048_0013502 | Ga0501048_0013502_4912_5379 | 155 |
| 254 | 3300049586 | Ga0501070_0041109 | Ga0501070_0041109_2935_3402 | 155 |
| 255 | 3300049822 | Ga0501035_0153196 | Ga0501035_0153196_144_611 | 155 |
| 256 | 3300049823 | Ga0501044_0029896 | Ga0501044_0029896_2568_3035 | 155 |
| 257 | 3300003214 | JGI25165J46597_1004015 | JGI25165J46597_10040153 | 156 |
| 258 | 3300003215 | JGI25153J46596_10001910 | JGI25153J46596_1000191011 | 156 |
| 259 | 3300003215 | JGI25153J46596_10017357 | JGI25153J46596_100173573 | 156 |
| 260 | 3300003354 | JGI25160J50197_1012180 | JGI25160J50197_10121802 | 156 |
| 261 | 3300003354 | JGI25160J50197_1014115 | JGI25160J50197_10141152 | 156 |
| 262 | 3300003752 | Ga0055539_1011018 | Ga0055539_10110182 | 156 |
| 263 | 3300003759 | Ga0055525_1004569 | Ga0055525_10045692 | 156 |
| 264 | 3300003762 | Ga0055542_1011971 | Ga0055542_10119713 | 156 |
| 265 | 3300003763 | Ga0055529_1017403 | Ga0055529_10174031 | 156 |
| 266 | 3300003771 | Ga0055526_1027163 | Ga0055526_10271632 | 156 |
| 267 | 3300003775 | Ga0055524_1022327 | Ga0055524_10223273 | 156 |
| 268 | 3300003794 | Ga0055531_10021404 | Ga0055531_100214043 | 156 |
| 269 | 3300004625 | Ga0055543_1020348 | Ga0055543_10203482 | 156 |
| 270 | 3300005262 | Ga0065165_1001250 | Ga0065165_10012502 | 156 |
| 271 | 3300005262 | Ga0065165_1029674 | Ga0065165_10296742 | 156 |
| 272 | 3300005262 | Ga0065165_1083704 | Ga0065165_10837041 | 156 |
| 273 | 3300005327 | Ga0070658_10065051 | Ga0070658_100650512 | 156 |
| 274 | 3300005327 | Ga0070658_10956154 | Ga0070658_109561542 | 156 |
| 275 | 3300005329 | Ga0070683_100507935 | Ga0070683_1005079351 | 156 |
| 276 | 3300005330 | Ga0070690_100293741 | Ga0070690_1002937412 | 156 |
| 277 | 3300005331 | Ga0070670_100115805 | Ga0070670_1001158052 | 156 |
| 278 | 3300005336 | Ga0070680_100037530 | Ga0070680_1000375305 | 156 |
| 279 | 3300005336 | Ga0070680_100390502 | Ga0070680_1003905022 | 156 |
| 280 | 3300005336 | Ga0070680_100868753 | Ga0070680_1008687532 | 156 |
| 281 | 3300005337 | Ga0070682_101040068 | Ga0070682_1010400681 | 156 |
| 282 | 3300005338 | Ga0068868_100289922 | Ga0068868_1002899223 | 156 |
| 283 | 3300005339 | Ga0070660_100063701 | Ga0070660_1000637012 | 156 |
| 284 | 3300005339 | Ga0070660_100362590 | Ga0070660_1003625901 | 156 |
| 285 | 3300005339 | Ga0070660_100475100 | Ga0070660_1004751002 | 156 |
| 286 | 3300005340 | Ga0070689_100118919 | Ga0070689_1001189193 | 156 |
| 287 | 3300005340 | Ga0070689_101101491 | Ga0070689_1011014911 | 156 |
| 288 | 3300005341 | Ga0070691_10032104 | Ga0070691_100321044 | 156 |
| 289 | 3300005344 | Ga0070661_100199740 | Ga0070661_1001997402 | 156 |
| 290 | 3300005344 | Ga0070661_100445586 | Ga0070661_1004455862 | 156 |
| 291 | 3300005347 | Ga0070668_100121121 | Ga0070668_1001211212 | 156 |
| 292 | 3300005347 | Ga0070668_100123332 | Ga0070668_1001233322 | 156 |
| 293 | 3300005355 | Ga0070671_100098494 | Ga0070671_1000984942 | 156 |
| 294 | 3300005365 | Ga0070688_100754461 | Ga0070688_1007544611 | 156 |
| 295 | 3300005366 | Ga0070659_100484750 | Ga0070659_1004847502 | 156 |
| 296 | 3300005366 | Ga0070659_100686335 | Ga0070659_1006863352 | 156 |
| 297 | 3300005367 | Ga0070667_100308698 | Ga0070667_1003086982 | 156 |
| 298 | 3300005367 | Ga0070667_100658490 | Ga0070667_1006584902 | 156 |
| 299 | 3300005434 | Ga0070709_10000751 | Ga0070709_1000075114 | 156 |
| 300 | 3300005434 | Ga0070709_10006118 | Ga0070709_100061186 | 156 |
| 301 | 3300005435 | Ga0070714_100001123 | Ga0070714_10000112312 | 156 |
| 302 | 3300005435 | Ga0070714_100012709 | Ga0070714_1000127092 | 156 |
| 303 | 3300005435 | Ga0070714_100337867 | Ga0070714_1003378672 | 156 |
| 304 | 3300005435 | Ga0070714_100980869 | Ga0070714_1009808691 | 156 |
| 305 | 3300005436 | Ga0070713_100000647 | Ga0070713_10000064710 | 156 |
| 306 | 3300005436 | Ga0070713_100006657 | Ga0070713_1000066573 | 156 |
| 307 | 3300005436 | Ga0070713_100181230 | Ga0070713_1001812304 | 156 |
| 308 | 3300005437 | Ga0070710_10001077 | Ga0070710_1000107710 | 156 |
| 309 | 3300005437 | Ga0070710_10001287 | Ga0070710_100012878 | 156 |
| 310 | 3300005439 | Ga0070711_100004377 | Ga0070711_1000043775 | 156 |
| 311 | 3300005439 | Ga0070711_100014618 | Ga0070711_1000146184 | 156 |
| 312 | 3300005455 | Ga0070663_100017304 | Ga0070663_1000173045 | 156 |
| 313 | 3300005455 | Ga0070663_100027716 | Ga0070663_1000277163 | 156 |
| 314 | 3300005455 | Ga0070663_100291995 | Ga0070663_1002919951 | 156 |
| 315 | 3300005455 | Ga0070663_100302288 | Ga0070663_1003022882 | 156 |
| 316 | 3300005455 | Ga0070663_100494689 | Ga0070663_1004946892 | 156 |
| 317 | 3300005455 | Ga0070663_100863507 | Ga0070663_1008635072 | 156 |
| 318 | 3300005456 | Ga0070678_100110148 | Ga0070678_1001101482 | 156 |
| 319 | 3300005457 | Ga0070662_101050919 | Ga0070662_1010509191 | 156 |
| 320 | 3300005458 | Ga0070681_10014556 | Ga0070681_100145566 | 156 |
| 321 | 3300005458 | Ga0070681_10079676 | Ga0070681_100796762 | 156 |
| 322 | 3300005458 | Ga0070681_10080405 | Ga0070681_100804055 | 156 |
| 323 | 3300005458 | Ga0070681_10669455 | Ga0070681_106694552 | 156 |
| 324 | 3300005530 | Ga0070679_100013382 | Ga0070679_1000133828 | 156 |
| 325 | 3300005530 | Ga0070679_100082005 | Ga0070679_1000820055 | 156 |
| 326 | 3300005530 | Ga0070679_100085568 | Ga0070679_1000855683 | 156 |
| 327 | 3300005530 | Ga0070679_100476208 | Ga0070679_1004762082 | 156 |
| 328 | 3300005530 | Ga0070679_100745922 | Ga0070679_1007459222 | 156 |
| 329 | 3300005535 | Ga0070684_100018906 | Ga0070684_1000189063 | 156 |
| 330 | 3300005535 | Ga0070684_100045861 | Ga0070684_1000458614 | 156 |
| 331 | 3300005535 | Ga0070684_101536186 | Ga0070684_1015361862 | 156 |
| 332 | 3300005539 | Ga0068853_100047159 | Ga0068853_1000471594 | 156 |
| 333 | 3300005539 | Ga0068853_100330422 | Ga0068853_1003304222 | 156 |
| 334 | 3300005539 | Ga0068853_100638239 | Ga0068853_1006382391 | 156 |
| 335 | 3300005539 | Ga0068853_101569545 | Ga0068853_1015695451 | 156 |
| 336 | 3300005547 | Ga0070693_100061094 | Ga0070693_1000610947 | 156 |
| 337 | 3300005548 | Ga0070665_100233806 | Ga0070665_1002338062 | 156 |
| 338 | 3300005548 | Ga0070665_100409309 | Ga0070665_1004093092 | 156 |
| 339 | 3300005548 | Ga0070665_100455287 | Ga0070665_1004552872 | 156 |
| 340 | 3300005548 | Ga0070665_100800182 | Ga0070665_1008001822 | 156 |
| 341 | 3300005549 | Ga0070704_100325569 | Ga0070704_1003255692 | 156 |
| 342 | 3300005563 | Ga0068855_100077895 | Ga0068855_1000778953 | 156 |
| 343 | 3300005563 | Ga0068855_100142669 | Ga0068855_1001426692 | 156 |
| 344 | 3300005563 | Ga0068855_100239930 | Ga0068855_1002399301 | 156 |
| 345 | 3300005563 | Ga0068855_101188570 | Ga0068855_1011885702 | 156 |
| 346 | 3300005564 | Ga0070664_100391379 | Ga0070664_1003913792 | 156 |
| 347 | 3300005564 | Ga0070664_101060853 | Ga0070664_1010608531 | 156 |
| 348 | 3300005577 | Ga0068857_100214729 | Ga0068857_1002147292 | 156 |
| 349 | 3300005577 | Ga0068857_100279426 | Ga0068857_1002794263 | 156 |
| 350 | 3300005577 | Ga0068857_100604737 | Ga0068857_1006047372 | 156 |
| 351 | 3300005577 | Ga0068857_101132655 | Ga0068857_1011326552 | 156 |
| 352 | 3300005577 | Ga0068857_101352488 | Ga0068857_1013524882 | 156 |
| 353 | 3300005578 | Ga0068854_100249881 | Ga0068854_1002498813 | 156 |
| 354 | 3300005578 | Ga0068854_100583027 | Ga0068854_1005830272 | 156 |
| 355 | 3300005614 | Ga0068856_100085960 | Ga0068856_1000859604 | 156 |
| 356 | 3300005614 | Ga0068856_100381119 | Ga0068856_1003811192 | 156 |
| 357 | 3300005614 | Ga0068856_100603986 | Ga0068856_1006039861 | 156 |
| 358 | 3300005614 | Ga0068856_101234211 | Ga0068856_1012342112 | 156 |
| 359 | 3300005616 | Ga0068852_100051692 | Ga0068852_1000516923 | 156 |
| 360 | 3300005616 | Ga0068852_100240316 | Ga0068852_1002403161 | 156 |
| 361 | 3300005616 | Ga0068852_100844000 | Ga0068852_1008440002 | 156 |
| 362 | 3300005617 | Ga0068859_100721536 | Ga0068859_1007215362 | 156 |
| 363 | 3300005618 | Ga0068864_101123519 | Ga0068864_1011235192 | 156 |
| 364 | 3300005718 | Ga0068866_10864738 | Ga0068866_108647382 | 156 |
| 365 | 3300005718 | Ga0068866_11218860 | Ga0068866_112188601 | 156 |
| 366 | 3300005834 | Ga0068851_10055902 | Ga0068851_100559024 | 156 |
| 367 | 3300005841 | Ga0068863_100285454 | Ga0068863_1002854542 | 156 |
| 368 | 3300005841 | Ga0068863_100304776 | Ga0068863_1003047762 | 156 |
| 369 | 3300005841 | Ga0068863_101085821 | Ga0068863_1010858212 | 156 |
| 370 | 3300005842 | Ga0068858_100120356 | Ga0068858_1001203562 | 156 |
| 371 | 3300005842 | Ga0068858_100707434 | Ga0068858_1007074342 | 156 |
| 372 | 3300005844 | Ga0068862_100680894 | Ga0068862_1006808942 | 156 |
| 373 | 3300005983 | Ga0081540_1004236 | Ga0081540_10042368 | 156 |
| 374 | 3300005983 | Ga0081540_1010774 | Ga0081540_10107742 | 156 |
| 375 | 3300006028 | Ga0070717_10000905 | Ga0070717_1000090513 | 156 |
| 376 | 3300006028 | Ga0070717_10004417 | Ga0070717_100044178 | 156 |
| 377 | 3300006028 | Ga0070717_10678789 | Ga0070717_106787892 | 156 |
| 378 | 3300006038 | Ga0075365_10007374 | Ga0075365_100073742 | 156 |
| 379 | 3300006038 | Ga0075365_10027847 | Ga0075365_100278473 | 156 |
| 380 | 3300006038 | Ga0075365_10031750 | Ga0075365_100317502 | 156 |
| 381 | 3300006038 | Ga0075365_10171287 | Ga0075365_101712873 | 156 |
| 382 | 3300006038 | Ga0075365_10471560 | Ga0075365_104715602 | 156 |
| 383 | 3300006038 | Ga0075365_10543526 | Ga0075365_105435262 | 156 |
| 384 | 3300006042 | Ga0075368_10000443 | Ga0075368_1000044311 | 156 |
| 385 | 3300006042 | Ga0075368_10007756 | Ga0075368_100077562 | 156 |
| 386 | 3300006048 | Ga0075363_100027645 | Ga0075363_1000276452 | 156 |
| 387 | 3300006048 | Ga0075363_100094310 | Ga0075363_1000943102 | 156 |
| 388 | 3300006048 | Ga0075363_100121681 | Ga0075363_1001216813 | 156 |
| 389 | 3300006048 | Ga0075363_100244850 | Ga0075363_1002448502 | 156 |
| 390 | 3300006051 | Ga0075364_10058986 | Ga0075364_100589862 | 156 |
| 391 | 3300006051 | Ga0075364_10236121 | Ga0075364_102361212 | 156 |
| 392 | 3300006163 | Ga0070715_10000111 | Ga0070715_1000011117 | 156 |
| 393 | 3300006163 | Ga0070715_10117541 | Ga0070715_101175412 | 156 |
| 394 | 3300006173 | Ga0070716_100008083 | Ga0070716_1000080837 | 156 |
| 395 | 3300006173 | Ga0070716_100021118 | Ga0070716_1000211182 | 156 |
| 396 | 3300006173 | Ga0070716_100023807 | Ga0070716_1000238072 | 156 |
| 397 | 3300006173 | Ga0070716_100537428 | Ga0070716_1005374282 | 156 |
| 398 | 3300006173 | Ga0070716_100977719 | Ga0070716_1009777192 | 156 |
| 399 | 3300006175 | Ga0070712_100109890 | Ga0070712_1001098902 | 156 |
| 400 | 3300006175 | Ga0070712_100699536 | Ga0070712_1006995361 | 156 |
| 401 | 3300006175 | Ga0070712_100718820 | Ga0070712_1007188202 | 156 |
| 402 | 3300006177 | Ga0075362_10022013 | Ga0075362_100220133 | 156 |
| 403 | 3300006177 | Ga0075362_10064656 | Ga0075362_100646562 | 156 |
| 404 | 3300006177 | Ga0075362_10301813 | Ga0075362_103018132 | 156 |
| 405 | 3300006178 | Ga0075367_10010758 | Ga0075367_100107582 | 156 |
| 406 | 3300006178 | Ga0075367_10088555 | Ga0075367_100885552 | 156 |
| 407 | 3300006178 | Ga0075367_10441545 | Ga0075367_104415452 | 156 |
| 408 | 3300006186 | Ga0075369_10002023 | Ga0075369_100020234 | 156 |
| 409 | 3300006186 | Ga0075369_10002445 | Ga0075369_100024456 | 156 |
| 410 | 3300006186 | Ga0075369_10043109 | Ga0075369_100431092 | 156 |
| 411 | 3300006186 | Ga0075369_10046711 | Ga0075369_100467114 | 156 |
| 412 | 3300006186 | Ga0075369_10075978 | Ga0075369_100759782 | 156 |
| 413 | 3300006186 | Ga0075369_10192580 | Ga0075369_101925802 | 156 |
| 414 | 3300006186 | Ga0075369_10249280 | Ga0075369_102492802 | 156 |
| 415 | 3300006195 | Ga0075366_10017661 | Ga0075366_100176613 | 156 |
| 416 | 3300006195 | Ga0075366_10077932 | Ga0075366_100779322 | 156 |
| 417 | 3300006237 | Ga0097621_100234175 | Ga0097621_1002341751 | 156 |
| 418 | 3300006237 | Ga0097621_100652607 | Ga0097621_1006526072 | 156 |
| 419 | 3300006353 | Ga0075370_10036194 | Ga0075370_100361942 | 156 |
| 420 | 3300006353 | Ga0075370_10120412 | Ga0075370_101204122 | 156 |
| 421 | 3300006353 | Ga0075370_10162585 | Ga0075370_101625852 | 156 |
| 422 | 3300006353 | Ga0075370_10311123 | Ga0075370_103111232 | 156 |
| 423 | 3300006871 | Ga0075434_100638582 | Ga0075434_1006385822 | 156 |
| 424 | 3300006881 | Ga0068865_101084785 | Ga0068865_1010847852 | 156 |
| 425 | 3300006931 | Ga0097620_100721517 | Ga0097620_1007215172 | 156 |
| 426 | 3300006941 | Ga0099825_1035906 | Ga0099825_10359062 | 156 |
| 427 | 3300006942 | Ga0099824_1010553 | Ga0099824_10105537 | 156 |
| 428 | 3300006944 | Ga0099823_1084262 | Ga0099823_10842622 | 156 |
| 429 | 3300009092 | Ga0105250_10081413 | Ga0105250_100814132 | 156 |
| 430 | 3300009093 | Ga0105240_10006904 | Ga0105240_100069043 | 156 |
| 431 | 3300009093 | Ga0105240_10160913 | Ga0105240_101609133 | 156 |
| 432 | 3300009093 | Ga0105240_10620792 | Ga0105240_106207922 | 156 |
| 433 | 3300009098 | Ga0105245_11254869 | Ga0105245_112548692 | 156 |
| 434 | 3300009101 | Ga0105247_10023906 | Ga0105247_100239062 | 156 |
| 435 | 3300009101 | Ga0105247_10451341 | Ga0105247_104513412 | 156 |
| 436 | 3300009174 | Ga0105241_10054047 | Ga0105241_100540476 | 156 |
| 437 | 3300009174 | Ga0105241_10255381 | Ga0105241_102553813 | 156 |
| 438 | 3300009174 | Ga0105241_11034345 | Ga0105241_110343451 | 156 |
| 439 | 3300009177 | Ga0105248_10179647 | Ga0105248_101796473 | 156 |
| 440 | 3300009545 | Ga0105237_10033149 | Ga0105237_100331495 | 156 |
| 441 | 3300009545 | Ga0105237_10128536 | Ga0105237_101285362 | 156 |
| 442 | 3300009545 | Ga0105237_10164160 | Ga0105237_101641602 | 156 |
| 443 | 3300009551 | Ga0105238_10011980 | Ga0105238_100119809 | 156 |
| 444 | 3300009551 | Ga0105238_10055394 | Ga0105238_100553942 | 156 |
| 445 | 3300009551 | Ga0105238_10234582 | Ga0105238_102345822 | 156 |
| 446 | 3300009551 | Ga0105238_10885933 | Ga0105238_108859332 | 156 |
| 447 | 3300009551 | Ga0105238_11333419 | Ga0105238_113334192 | 156 |
| 448 | 3300009553 | Ga0105249_11013040 | Ga0105249_110130402 | 156 |
| 449 | 3300010375 | Ga0105239_10105480 | Ga0105239_101054804 | 156 |
| 450 | 3300010375 | Ga0105239_10249481 | Ga0105239_102494812 | 156 |
| 451 | 3300010375 | Ga0105239_10669518 | Ga0105239_106695182 | 156 |
| 452 | 3300010375 | Ga0105239_10712535 | Ga0105239_107125352 | 156 |
| 453 | 3300010375 | Ga0105239_11050970 | Ga0105239_110509702 | 156 |
| 454 | 3300010375 | Ga0105239_11208625 | Ga0105239_112086252 | 156 |
| 455 | 3300010375 | Ga0105239_11273729 | Ga0105239_112737292 | 156 |
| 456 | 3300010375 | Ga0105239_11532657 | Ga0105239_115326572 | 156 |
| 457 | 3300011119 | Ga0105246_10003537 | Ga0105246_1000353713 | 156 |
| 458 | 3300011119 | Ga0105246_10131288 | Ga0105246_101312882 | 156 |
| 459 | 3300011119 | Ga0105246_10712302 | Ga0105246_107123022 | 156 |
| 460 | 3300013100 | Ga0157373_10318958 | Ga0157373_103189582 | 156 |
| 461 | 3300013102 | Ga0157371_10230752 | Ga0157371_102307522 | 156 |
| 462 | 3300013104 | Ga0157370_10479215 | Ga0157370_104792152 | 156 |
| 463 | 3300013104 | Ga0157370_10618516 | Ga0157370_106185162 | 156 |
| 464 | 3300013105 | Ga0157369_10026776 | Ga0157369_100267763 | 156 |
| 465 | 3300013105 | Ga0157369_10066689 | Ga0157369_100666891 | 156 |
| 466 | 3300013105 | Ga0157369_10102101 | Ga0157369_101021012 | 156 |
| 467 | 3300013296 | Ga0157374_10139860 | Ga0157374_101398604 | 156 |
| 468 | 3300013296 | Ga0157374_10203998 | Ga0157374_102039982 | 156 |
| 469 | 3300013296 | Ga0157374_10349504 | Ga0157374_103495043 | 156 |
| 470 | 3300013297 | Ga0157378_10515208 | Ga0157378_105152082 | 156 |
| 471 | 3300013297 | Ga0157378_10877904 | Ga0157378_108779042 | 156 |
| 472 | 3300013307 | Ga0157372_10683265 | Ga0157372_106832652 | 156 |
| 473 | 3300013307 | Ga0157372_11210464 | Ga0157372_112104641 | 156 |
| 474 | 3300013307 | Ga0157372_12020159 | Ga0157372_120201592 | 156 |
| 475 | 3300013308 | Ga0157375_10084779 | Ga0157375_100847792 | 156 |
| 476 | 3300013308 | Ga0157375_11894807 | Ga0157375_118948072 | 156 |
| 477 | 3300014325 | Ga0163163_10000985 | Ga0163163_1000098520 | 156 |
| 478 | 3300014325 | Ga0163163_10385552 | Ga0163163_103855523 | 156 |
| 479 | 3300014497 | Ga0182008_10339606 | Ga0182008_103396062 | 156 |
| 480 | 3300014745 | Ga0157377_10758235 | Ga0157377_107582351 | 156 |
| 481 | 3300014968 | Ga0157379_10276398 | Ga0157379_102763982 | 156 |
| 482 | 3300014968 | Ga0157379_10448002 | Ga0157379_104480022 | 156 |
| 483 | 3300014968 | Ga0157379_10609043 | Ga0157379_106090432 | 156 |
| 484 | 3300014969 | Ga0157376_10040370 | Ga0157376_100403702 | 156 |
| 485 | 3300020610 | Ga0154015_1294201 | Ga0154015_12942011 | 156 |
| 486 | 3300021320 | Ga0214544_1000002 | Ga0214544_100000276 | 156 |
| 487 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001426 | 156 |
| 488 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001492 | 156 |
| 489 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001704 | 156 |
| 490 | 3300021377 | Ga0213874_10015808 | Ga0213874_100158082 | 156 |
| 491 | 3300021384 | Ga0213876_10004192 | Ga0213876_100041924 | 156 |
| 492 | 3300021384 | Ga0213876_10030041 | Ga0213876_100300412 | 156 |
| 493 | 3300021388 | Ga0213875_10054161 | Ga0213875_100541612 | 156 |
| 494 | 3300025230 | Ga0209563_106889 | Ga0209563_1068892 | 156 |
| 495 | 3300025253 | Ga0209677_102534 | Ga0209677_1025343 | 156 |
| 496 | 3300025253 | Ga0209677_102699 | Ga0209677_1026999 | 156 |
| 497 | 3300025254 | Ga0209148_1000374 | Ga0209148_10003743 | 156 |
| 498 | 3300025261 | Ga0209233_1001622 | Ga0209233_10016223 | 156 |
| 499 | 3300025261 | Ga0209233_1004832 | Ga0209233_10048322 | 156 |
| 500 | 3300025261 | Ga0209233_1005085 | Ga0209233_10050857 | 156 |
| 501 | 3300025272 | Ga0209455_1001411 | Ga0209455_10014118 | 156 |
| 502 | 3300025272 | Ga0209455_1003883 | Ga0209455_10038836 | 156 |
| 503 | 3300025272 | Ga0209455_1007726 | Ga0209455_10077262 | 156 |
| 504 | 3300025273 | Ga0209673_1023500 | Ga0209673_10235002 | 156 |
| 505 | 3300025295 | Ga0209564_1011932 | Ga0209564_10119322 | 156 |
| 506 | 3300025295 | Ga0209564_1012318 | Ga0209564_10123182 | 156 |
| 507 | 3300025297 | Ga0209758_1000024 | Ga0209758_1000024102 | 156 |
| 508 | 3300025297 | Ga0209758_1000068 | Ga0209758_100006857 | 156 |
| 509 | 3300025297 | Ga0209758_1001579 | Ga0209758_10015798 | 156 |
| 510 | 3300025297 | Ga0209758_1002091 | Ga0209758_100209116 | 156 |
| 511 | 3300025297 | Ga0209758_1022280 | Ga0209758_10222806 | 156 |
| 512 | 3300025297 | Ga0209758_1061358 | Ga0209758_10613582 | 156 |
| 513 | 3300025297 | Ga0209758_1085525 | Ga0209758_10855252 | 156 |
| 514 | 3300025299 | Ga0209256_1008086 | Ga0209256_10080862 | 156 |
| 515 | 3300025299 | Ga0209256_1044051 | Ga0209256_10440512 | 156 |
| 516 | 3300025302 | Ga0207426_1000238 | Ga0207426_10002385 | 156 |
| 517 | 3300025302 | Ga0207426_1000726 | Ga0207426_100072626 | 156 |
| 518 | 3300025302 | Ga0207426_1023270 | Ga0207426_10232702 | 156 |
| 519 | 3300025304 | Ga0209257_1004927 | Ga0209257_10049278 | 156 |
| 520 | 3300025315 | Ga0207697_10104704 | Ga0207697_101047042 | 156 |
| 521 | 3300025321 | Ga0207656_10088167 | Ga0207656_100881672 | 156 |
| 522 | 3300025898 | Ga0207692_10000175 | Ga0207692_100001756 | 156 |
| 523 | 3300025898 | Ga0207692_10009115 | Ga0207692_100091155 | 156 |
| 524 | 3300025898 | Ga0207692_10520812 | Ga0207692_105208122 | 156 |
| 525 | 3300025899 | Ga0207642_10642159 | Ga0207642_106421592 | 156 |
| 526 | 3300025900 | Ga0207710_10014704 | Ga0207710_100147042 | 156 |
| 527 | 3300025900 | Ga0207710_10045700 | Ga0207710_100457002 | 156 |
| 528 | 3300025901 | Ga0207688_10049337 | Ga0207688_100493372 | 156 |
| 529 | 3300025903 | Ga0207680_10118806 | Ga0207680_101188064 | 156 |
| 530 | 3300025904 | Ga0207647_10017311 | Ga0207647_100173113 | 156 |
| 531 | 3300025905 | Ga0207685_10000929 | Ga0207685_100009292 | 156 |
| 532 | 3300025905 | Ga0207685_10053246 | Ga0207685_100532463 | 156 |
| 533 | 3300025906 | Ga0207699_10001765 | Ga0207699_100017659 | 156 |
| 534 | 3300025906 | Ga0207699_10007395 | Ga0207699_100073953 | 156 |
| 535 | 3300025906 | Ga0207699_10551535 | Ga0207699_105515352 | 156 |
| 536 | 3300025906 | Ga0207699_10652675 | Ga0207699_106526752 | 156 |
| 537 | 3300025909 | Ga0207705_10040079 | Ga0207705_100400793 | 156 |
| 538 | 3300025911 | Ga0207654_10006042 | Ga0207654_100060422 | 156 |
| 539 | 3300025911 | Ga0207654_10076895 | Ga0207654_100768952 | 156 |
| 540 | 3300025911 | Ga0207654_10376771 | Ga0207654_103767712 | 156 |
| 541 | 3300025911 | Ga0207654_10550224 | Ga0207654_105502242 | 156 |
| 542 | 3300025911 | Ga0207654_10600107 | Ga0207654_106001072 | 156 |
| 543 | 3300025912 | Ga0207707_10000950 | Ga0207707_1000095016 | 156 |
| 544 | 3300025912 | Ga0207707_10016441 | Ga0207707_100164418 | 156 |
| 545 | 3300025912 | Ga0207707_10808533 | Ga0207707_108085332 | 156 |
| 546 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008178 | 156 |
| 547 | 3300025913 | Ga0207695_10378658 | Ga0207695_103786582 | 156 |
| 548 | 3300025913 | Ga0207695_10562427 | Ga0207695_105624272 | 156 |
| 549 | 3300025914 | Ga0207671_10008090 | Ga0207671_100080902 | 156 |
| 550 | 3300025914 | Ga0207671_10223291 | Ga0207671_102232912 | 156 |
| 551 | 3300025914 | Ga0207671_10579322 | Ga0207671_105793222 | 156 |
| 552 | 3300025914 | Ga0207671_10730992 | Ga0207671_107309922 | 156 |
| 553 | 3300025915 | Ga0207693_10004043 | Ga0207693_100040437 | 156 |
| 554 | 3300025915 | Ga0207693_10041091 | Ga0207693_100410914 | 156 |
| 555 | 3300025915 | Ga0207693_10086662 | Ga0207693_100866624 | 156 |
| 556 | 3300025916 | Ga0207663_10000098 | Ga0207663_100000987 | 156 |
| 557 | 3300025917 | Ga0207660_10048368 | Ga0207660_100483684 | 156 |
| 558 | 3300025917 | Ga0207660_10080030 | Ga0207660_100800303 | 156 |
| 559 | 3300025917 | Ga0207660_10126458 | Ga0207660_101264583 | 156 |
| 560 | 3300025919 | Ga0207657_10098593 | Ga0207657_100985933 | 156 |
| 561 | 3300025919 | Ga0207657_10129475 | Ga0207657_101294753 | 156 |
| 562 | 3300025919 | Ga0207657_10389938 | Ga0207657_103899382 | 156 |
| 563 | 3300025919 | Ga0207657_10414033 | Ga0207657_104140332 | 156 |
| 564 | 3300025920 | Ga0207649_10113640 | Ga0207649_101136402 | 156 |
| 565 | 3300025921 | Ga0207652_10069917 | Ga0207652_100699173 | 156 |
| 566 | 3300025921 | Ga0207652_10403559 | Ga0207652_104035592 | 156 |
| 567 | 3300025924 | Ga0207694_10170993 | Ga0207694_101709932 | 156 |
| 568 | 3300025924 | Ga0207694_10531547 | Ga0207694_105315472 | 156 |
| 569 | 3300025924 | Ga0207694_10608083 | Ga0207694_106080832 | 156 |
| 570 | 3300025924 | Ga0207694_10694587 | Ga0207694_106945872 | 156 |
| 571 | 3300025925 | Ga0207650_10334566 | Ga0207650_103345662 | 156 |
| 572 | 3300025927 | Ga0207687_10531731 | Ga0207687_105317312 | 156 |
| 573 | 3300025927 | Ga0207687_10544863 | Ga0207687_105448632 | 156 |
| 574 | 3300025928 | Ga0207700_10001663 | Ga0207700_1000166311 | 156 |
| 575 | 3300025928 | Ga0207700_10188064 | Ga0207700_101880641 | 156 |
| 576 | 3300025928 | Ga0207700_10774064 | Ga0207700_107740642 | 156 |
| 577 | 3300025929 | Ga0207664_10007161 | Ga0207664_100071617 | 156 |
| 578 | 3300025929 | Ga0207664_10066454 | Ga0207664_100664542 | 156 |
| 579 | 3300025929 | Ga0207664_10297754 | Ga0207664_102977543 | 156 |
| 580 | 3300025929 | Ga0207664_10776891 | Ga0207664_107768912 | 156 |
| 581 | 3300025931 | Ga0207644_10189698 | Ga0207644_101896982 | 156 |
| 582 | 3300025932 | Ga0207690_10623132 | Ga0207690_106231322 | 156 |
| 583 | 3300025933 | Ga0207706_10037062 | Ga0207706_100370622 | 156 |
| 584 | 3300025933 | Ga0207706_10833667 | Ga0207706_108336672 | 156 |
| 585 | 3300025935 | Ga0207709_10089618 | Ga0207709_100896183 | 156 |
| 586 | 3300025936 | Ga0207670_10115890 | Ga0207670_101158903 | 156 |
| 587 | 3300025939 | Ga0207665_10000355 | Ga0207665_100003559 | 156 |
| 588 | 3300025939 | Ga0207665_10003937 | Ga0207665_100039379 | 156 |
| 589 | 3300025941 | Ga0207711_10809945 | Ga0207711_108099452 | 156 |
| 590 | 3300025944 | Ga0207661_10008365 | Ga0207661_100083655 | 156 |
| 591 | 3300025944 | Ga0207661_10082671 | Ga0207661_100826714 | 156 |
| 592 | 3300025945 | Ga0207679_10375144 | Ga0207679_103751442 | 156 |
| 593 | 3300025945 | Ga0207679_10668334 | Ga0207679_106683342 | 156 |
| 594 | 3300025949 | Ga0207667_10112404 | Ga0207667_101124043 | 156 |
| 595 | 3300025949 | Ga0207667_10189050 | Ga0207667_101890503 | 156 |
| 596 | 3300025949 | Ga0207667_10384559 | Ga0207667_103845592 | 156 |
| 597 | 3300025949 | Ga0207667_11115977 | Ga0207667_111159772 | 156 |
| 598 | 3300025949 | Ga0207667_11436601 | Ga0207667_114366012 | 156 |
| 599 | 3300025960 | Ga0207651_10320626 | Ga0207651_103206261 | 156 |
| 600 | 3300025961 | Ga0207712_11039742 | Ga0207712_110397422 | 156 |
| 601 | 3300025972 | Ga0207668_10494164 | Ga0207668_104941642 | 156 |
| 602 | 3300025972 | Ga0207668_10563470 | Ga0207668_105634702 | 156 |
| 603 | 3300025981 | Ga0207640_10177712 | Ga0207640_101777122 | 156 |
| 604 | 3300025986 | Ga0207658_10277395 | Ga0207658_102773952 | 156 |
| 605 | 3300026023 | Ga0207677_10830286 | Ga0207677_108302861 | 156 |
| 606 | 3300026035 | Ga0207703_10165258 | Ga0207703_101652584 | 156 |
| 607 | 3300026035 | Ga0207703_10895296 | Ga0207703_108952962 | 156 |
| 608 | 3300026035 | Ga0207703_10922455 | Ga0207703_109224552 | 156 |
| 609 | 3300026041 | Ga0207639_10119500 | Ga0207639_101195003 | 156 |
| 610 | 3300026041 | Ga0207639_10304947 | Ga0207639_103049472 | 156 |
| 611 | 3300026041 | Ga0207639_10450095 | Ga0207639_104500952 | 156 |
| 612 | 3300026041 | Ga0207639_10466450 | Ga0207639_104664502 | 156 |
| 613 | 3300026067 | Ga0207678_10008230 | Ga0207678_100082306 | 156 |
| 614 | 3300026067 | Ga0207678_10030531 | Ga0207678_100305315 | 156 |
| 615 | 3300026067 | Ga0207678_10069576 | Ga0207678_100695762 | 156 |
| 616 | 3300026067 | Ga0207678_10164813 | Ga0207678_101648132 | 156 |
| 617 | 3300026067 | Ga0207678_10296238 | Ga0207678_102962382 | 156 |
| 618 | 3300026067 | Ga0207678_11045404 | Ga0207678_110454042 | 156 |
| 619 | 3300026078 | Ga0207702_10112461 | Ga0207702_101124613 | 156 |
| 620 | 3300026078 | Ga0207702_10231068 | Ga0207702_102310683 | 156 |
| 621 | 3300026078 | Ga0207702_10391799 | Ga0207702_103917993 | 156 |
| 622 | 3300026078 | Ga0207702_10396802 | Ga0207702_103968022 | 156 |
| 623 | 3300026078 | Ga0207702_10432069 | Ga0207702_104320692 | 156 |
| 624 | 3300026078 | Ga0207702_11285846 | Ga0207702_112858462 | 156 |
| 625 | 3300026088 | Ga0207641_10536148 | Ga0207641_105361482 | 156 |
| 626 | 3300026088 | Ga0207641_10680434 | Ga0207641_106804342 | 156 |
| 627 | 3300026088 | Ga0207641_10965119 | Ga0207641_109651192 | 156 |
| 628 | 3300026089 | Ga0207648_10318416 | Ga0207648_103184162 | 156 |
| 629 | 3300026095 | Ga0207676_10154911 | Ga0207676_101549112 | 156 |
| 630 | 3300026095 | Ga0207676_10758060 | Ga0207676_107580602 | 156 |
| 631 | 3300026116 | Ga0207674_10088216 | Ga0207674_100882165 | 156 |
| 632 | 3300026116 | Ga0207674_10117044 | Ga0207674_101170442 | 156 |
| 633 | 3300026118 | Ga0207675_100982365 | Ga0207675_1009823652 | 156 |
| 634 | 3300026142 | Ga0207698_10042438 | Ga0207698_100424382 | 156 |
| 635 | 3300026142 | Ga0207698_10056264 | Ga0207698_100562643 | 156 |
| 636 | 3300026142 | Ga0207698_10352731 | Ga0207698_103527312 | 156 |
| 637 | 3300027296 | Ga0209389_1000107 | Ga0209389_100010746 | 156 |
| 638 | 3300027296 | Ga0209389_1005934 | Ga0209389_10059344 | 156 |
| 639 | 3300027357 | Ga0209589_1000092 | Ga0209589_10000928 | 156 |
| 640 | 3300027361 | Ga0209489_100006 | Ga0209489_100006465 | 156 |
| 641 | 3300027361 | Ga0209489_107740 | Ga0209489_1077408 | 156 |
| 642 | 3300027363 | Ga0209700_100005 | Ga0209700_100005333 | 156 |
| 643 | 3300027866 | Ga0209813_10005581 | Ga0209813_100055811 | 156 |
| 644 | 3300027866 | Ga0209813_10087381 | Ga0209813_100873813 | 156 |
| 645 | 3300028379 | Ga0268266_10179065 | Ga0268266_101790652 | 156 |
| 646 | 3300028379 | Ga0268266_10212574 | Ga0268266_102125742 | 156 |
| 647 | 3300028379 | Ga0268266_10243666 | Ga0268266_102436662 | 156 |
| 648 | 3300028379 | Ga0268266_10970652 | Ga0268266_109706522 | 156 |
| 649 | 3300028380 | Ga0268265_10080719 | Ga0268265_100807193 | 156 |
| 650 | 3300028381 | Ga0268264_10000065 | Ga0268264_10000065167 | 156 |
| 651 | 3300028556 | Ga0265337_1002468 | Ga0265337_10024687 | 156 |
| 652 | 3300028558 | Ga0265326_10003263 | Ga0265326_100032635 | 156 |
| 653 | 3300028563 | Ga0265319_1007768 | Ga0265319_10077684 | 156 |
| 654 | 3300028573 | Ga0265334_10000456 | Ga0265334_100004568 | 156 |
| 655 | 3300028653 | Ga0265323_10000424 | Ga0265323_1000042416 | 156 |
| 656 | 3300028654 | Ga0265322_10005214 | Ga0265322_100052141 | 156 |
| 657 | 3300028794 | Ga0307515_10074714 | Ga0307515_100747147 | 156 |
| 658 | 3300028800 | Ga0265338_10000321 | Ga0265338_1000032145 | 156 |
| 659 | 3300029957 | Ga0265324_10023377 | Ga0265324_100233773 | 156 |
| 660 | 3300031235 | Ga0265330_10101988 | Ga0265330_101019883 | 156 |
| 661 | 3300031235 | Ga0265330_10147547 | Ga0265330_101475472 | 156 |
| 662 | 3300031240 | Ga0265320_10186503 | Ga0265320_101865032 | 156 |
| 663 | 3300031247 | Ga0265340_10068526 | Ga0265340_100685263 | 156 |
| 664 | 3300031249 | Ga0265339_10045369 | Ga0265339_100453692 | 156 |
| 665 | 3300031250 | Ga0265331_10261854 | Ga0265331_102618541 | 156 |
| 666 | 3300031507 | Ga0307509_10217624 | Ga0307509_102176242 | 156 |
| 667 | 3300031548 | Ga0307408_100814022 | Ga0307408_1008140222 | 156 |
| 668 | 3300031616 | Ga0307508_10039062 | Ga0307508_100390623 | 156 |
| 669 | 3300031711 | Ga0265314_10019799 | Ga0265314_100197994 | 156 |
| 670 | 3300031712 | Ga0265342_10007904 | Ga0265342_100079048 | 156 |
| 671 | 3300031712 | Ga0265342_10212989 | Ga0265342_102129892 | 156 |
| 672 | 3300033179 | Ga0307507_10018406 | Ga0307507_100184062 | 156 |
| 673 | 3300033180 | Ga0307510_10019136 | Ga0307510_100191363 | 156 |
| 674 | 3300033180 | Ga0307510_10156655 | Ga0307510_101566553 | 156 |
| 675 | 3300033544 | Ga0316215_1006801 | Ga0316215_10068012 | 156 |
| 676 | 3300033545 | Ga0316214_1006677 | Ga0316214_10066772 | 156 |
| 677 | 3300035111 | Ga0373923_0031055 | Ga0373923_0031055_919_1389 | 156 |
| 678 | 3300035113 | Ga0373936_0039776 | Ga0373936_0039776_891_1361 | 156 |
| 679 | 3300035113 | Ga0373936_0042475 | Ga0373936_0042475_1115_1585 | 156 |
| 680 | 3300035117 | Ga0373953_0098249 | Ga0373953_0098249_267_737 | 156 |
| 681 | 3300035118 | Ga0373954_0052970 | Ga0373954_0052970_947_1420 | 156 |
| 682 | 3300035119 | Ga0373956_0026015 | Ga0373956_0026015_507_977 | 156 |
| 683 | 3300035121 | Ga0373960_0063783 | Ga0373960_0063783_572_1042 | 156 |
| 684 | 3300035170 | Ga0373943_0028281 | Ga0373943_0028281_1510_1980 | 156 |
| 685 | 3300035170 | Ga0373943_0071314 | Ga0373943_0071314_45_515 | 156 |
| 686 | 3300035171 | Ga0373946_0346807 | Ga0373946_0346807_53_523 | 156 |
| 687 | 3300035172 | Ga0373955_0007905 | Ga0373955_0007905_929_1399 | 156 |
| 688 | 3300035691 | Ga0373931_0322617 | Ga0373931_0322617_187_657 | 156 |
| 689 | 3300035692 | Ga0373935_0071239 | Ga0373935_0071239_1194_1664 | 156 |
| 690 | 3300035692 | Ga0373935_0267902 | Ga0373935_0267902_226_696 | 156 |
| 691 | 3300035695 | Ga0373927_0010043 | Ga0373927_0010043_1596_2066 | 156 |
| 692 | 3300035695 | Ga0373927_0232406 | Ga0373927_0232406_177_647 | 156 |
| 693 | 3300035724 | Ga0373933_0000199 | Ga0373933_0000199_23390_23860 | 156 |
| 694 | 3300035724 | Ga0373933_0017531 | Ga0373933_0017531_2554_3024 | 156 |
| 695 | 3300035725 | Ga0373947_0391755 | Ga0373947_0391755_192_662 | 156 |
| 696 | 3300036401 | Ga0373937_0008799 | Ga0373937_0008799_3205_3678 | 156 |
| 697 | 3300036401 | Ga0373937_0063198 | Ga0373937_0063198_886_1356 | 156 |
| 698 | 3300036401 | Ga0373937_0456722 | Ga0373937_0456722_595_1068 | 156 |
| 699 | 3300037068 | Ga0373925_0029517 | Ga0373925_0029517_2221_2691 | 156 |
| 700 | 3300037068 | Ga0373925_0084180 | Ga0373925_0084180_1024_1494 | 156 |
| 701 | 3300037068 | Ga0373925_0131969 | Ga0373925_0131969_123_593 | 156 |
| 702 | 3300037312 | Ga0395899_0379679 | Ga0395899_0379679_344_814 | 156 |
| 703 | 3300037418 | Ga0395900_0000820 | Ga0395900_0000820_1128_1598 | 156 |
| 704 | 3300037418 | Ga0395900_0563087 | Ga0395900_0563087_438_908 | 156 |
| 705 | 3300037466 | Ga0395898_0039019 | Ga0395898_0039019_638_1108 | 156 |
| 706 | 3300037466 | Ga0395898_0441886 | Ga0395898_0441886_238_708 | 156 |
| 707 | 3300037471 | Ga0395905_0006498 | Ga0395905_0006498_6629_7099 | 156 |
| 708 | 3300037471 | Ga0395905_0027848 | Ga0395905_0027848_3102_3572 | 156 |
| 709 | 3300037471 | Ga0395905_0151862 | Ga0395905_0151862_335_805 | 156 |
| 710 | 3300037471 | Ga0395905_0450739 | Ga0395905_0450739_684_1154 | 156 |
| 711 | 3300037853 | Ga0436364_0230953 | Ga0436364_0230953_59_529 | 156 |
| 712 | 3300037853 | Ga0436364_1074811 | Ga0436364_1074811_328_798 | 156 |
| 713 | 3300038443 | Ga0395901_0081268 | Ga0395901_0081268_2765_3235 | 156 |
| 714 | 3300038443 | Ga0395901_0313828 | Ga0395901_0313828_334_804 | 156 |
| 715 | 3300039437 | Ga0436365_0535048 | Ga0436365_0535048_322_792 | 156 |
| 716 | 3300039437 | Ga0436365_0536419 | Ga0436365_0536419_297_767 | 156 |
| 717 | 3300039437 | Ga0436365_0570459 | Ga0436365_0570459_1656_2126 | 156 |
| 718 | 3300039437 | Ga0436365_1576869 | Ga0436365_1576869_187_657 | 156 |
| 719 | 3300039438 | Ga0436360_0264935 | Ga0436360_0264935_216_686 | 156 |
| 720 | 3300039447 | Ga0436361_0983536 | Ga0436361_0983536_132_602 | 156 |
| 721 | 3300039447 | Ga0436361_1032582 | Ga0436361_1032582_96_566 | 156 |
| 722 | 3300039450 | Ga0436363_0484248 | Ga0436363_0484248_128_607 | 156 |
| 723 | 3300039450 | Ga0436363_0929560 | Ga0436363_0929560_29_499 | 156 |
| 724 | 3300039453 | Ga0436362_1093918 | Ga0436362_1093918_654_1124 | 156 |
| 725 | 3300041441 | Ga0451787_188948 | Ga0451787_188948_183_653 | 156 |
| 726 | 3300041443 | Ga0451789_1360976 | Ga0451789_1360976_71_541 | 156 |
| 727 | 3300041452 | Ga0451793_1099887 | Ga0451793_1099887_426_896 | 156 |
| 728 | 3300041453 | Ga0451797_0340083 | Ga0451797_0340083_620_1090 | 156 |
| 729 | 3300041456 | Ga0451795_1217617 | Ga0451795_1217617_285_755 | 156 |
| 730 | 3300041460 | Ga0451802_0763160 | Ga0451802_0763160_170_640 | 156 |
| 731 | 3300041486 | Ga0451807_1079633 | Ga0451807_1079633_54_524 | 156 |
| 732 | 3300041491 | Ga0451833_0328009 | Ga0451833_0328009_418_888 | 156 |
| 733 | 3300041492 | Ga0451835_0292434 | Ga0451835_0292434_10_480 | 156 |
| 734 | 3300041498 | Ga0451841_0463910 | Ga0451841_0463910_92_562 | 156 |
| 735 | 3300041505 | Ga0451849_0093937 | Ga0451849_0093937_260_730 | 156 |
| 736 | 3300041509 | Ga0451843_0540096 | Ga0451843_0540096_155_625 | 156 |
| 737 | 3300041511 | Ga0451855_1276054 | Ga0451855_1276054_34_504 | 156 |
| 738 | 3300041512 | Ga0451853_1099499 | Ga0451853_1099499_104_574 | 156 |
| 739 | 3300042012 | Ga0439455_0164454 | Ga0439455_0164454_140_610 | 156 |
| 740 | 3300044658 | Ga0466972_0000846 | Ga0466972_0000846_11433_11903 | 156 |
| 741 | 3300044658 | Ga0466972_0036013 | Ga0466972_0036013_1454_1924 | 156 |
| 742 | 3300044658 | Ga0466972_0205479 | Ga0466972_0205479_262_732 | 156 |
| 743 | 3300044683 | Ga0466965_0229024 | Ga0466965_0229024_174_644 | 156 |
| 744 | 3300044683 | Ga0466965_0275521 | Ga0466965_0275521_263_733 | 156 |
| 745 | 3300044684 | Ga0466966_0000334 | Ga0466966_0000334_11120_11590 | 156 |
| 746 | 3300044684 | Ga0466966_0477135 | Ga0466966_0477135_188_658 | 156 |
| 747 | 3300044693 | Ga0466961_0000509 | Ga0466961_0000509_4648_5118 | 156 |
| 748 | 3300044693 | Ga0466961_0278834 | Ga0466961_0278834_414_884 | 156 |
| 749 | 3300044693 | Ga0466961_0281834 | Ga0466961_0281834_459_929 | 156 |
| 750 | 3300044693 | Ga0466961_0371180 | Ga0466961_0371180_201_671 | 156 |
| 751 | 3300044694 | Ga0466963_0021037 | Ga0466963_0021037_1520_1990 | 156 |
| 752 | 3300044706 | Ga0466964_0020638 | Ga0466964_0020638_705_1175 | 156 |
| 753 | 3300044706 | Ga0466964_0564134 | Ga0466964_0564134_28_498 | 156 |
| 754 | 3300044719 | Ga0466971_0333011 | Ga0466971_0333011_162_632 | 156 |
| 755 | 3300044735 | Ga0466968_0276803 | Ga0466968_0276803_183_653 | 156 |
| 756 | 3300044765 | Ga0466970_0212676 | Ga0466970_0212676_339_809 | 156 |
| 757 | 3300044765 | Ga0466970_0359153 | Ga0466970_0359153_201_671 | 156 |
| 758 | 3300044765 | Ga0466970_0543013 | Ga0466970_0543013_11_481 | 156 |
| 759 | 3300044842 | Ga0466957_0071535 | Ga0466957_0071535_72_542 | 156 |
| 760 | 3300044842 | Ga0466957_0156280 | Ga0466957_0156280_371_841 | 156 |
| 761 | 3300044842 | Ga0466957_0273217 | Ga0466957_0273217_261_731 | 156 |
| 762 | 3300044901 | Ga0466960_0011942 | Ga0466960_0011942_447_917 | 156 |
| 763 | 3300044901 | Ga0466960_0321481 | Ga0466960_0321481_237_707 | 156 |
| 764 | 3300045049 | Ga0466959_0058586 | Ga0466959_0058586_1677_2150 | 156 |
| 765 | 3300045049 | Ga0466959_0108199 | Ga0466959_0108199_374_844 | 156 |
| 766 | 3300045049 | Ga0466959_0730111 | Ga0466959_0730111_25_495 | 156 |
| 767 | 3300045836 | Ga0466958_0058680 | Ga0466958_0058680_1475_1945 | 156 |
| 768 | 3300045836 | Ga0466958_0083330 | Ga0466958_0083330_756_1226 | 156 |
| 769 | 3300045836 | Ga0466958_0680507 | Ga0466958_0680507_93_566 | 156 |
| 770 | 3300045976 | Ga0466967_0009054 | Ga0466967_0009054_4210_4680 | 156 |
| 771 | 3300045976 | Ga0466967_0183712 | Ga0466967_0183712_1167_1637 | 156 |
| 772 | 3300045976 | Ga0466967_0709738 | Ga0466967_0709738_347_820 | 156 |
| 773 | 3300045976 | Ga0466967_1026645 | Ga0466967_1026645_82_552 | 156 |
| 774 | 3300045976 | Ga0466967_1685899 | Ga0466967_1685899_117_587 | 156 |
| 775 | 3300046454 | Ga0495592_0021156 | Ga0495592_0021156_1567_2037 | 156 |
| 776 | 3300046454 | Ga0495592_0162252 | Ga0495592_0162252_285_755 | 156 |
| 777 | 3300046455 | Ga0495603_0240395 | Ga0495603_0240395_216_686 | 156 |
| 778 | 3300046459 | Ga0495629_0027278 | Ga0495629_0027278_667_1137 | 156 |
| 779 | 3300046459 | Ga0495629_0050041 | Ga0495629_0050041_1456_1926 | 156 |
| 780 | 3300046460 | Ga0495638_0031076 | Ga0495638_0031076_1913_2383 | 156 |
| 781 | 3300046461 | Ga0495641_0342136 | Ga0495641_0342136_132_605 | 156 |
| 782 | 3300046462 | Ga0495651_0001733 | Ga0495651_0001733_9812_10282 | 156 |
| 783 | 3300046462 | Ga0495651_0096032 | Ga0495651_0096032_839_1309 | 156 |
| 784 | 3300046471 | Ga0495650_0077872 | Ga0495650_0077872_85_555 | 156 |
| 785 | 3300046471 | Ga0495650_0130214 | Ga0495650_0130214_90_560 | 156 |
| 786 | 3300046472 | Ga0495580_0007795 | Ga0495580_0007795_3582_4052 | 156 |
| 787 | 3300046473 | Ga0495582_0004536 | Ga0495582_0004536_3086_3556 | 156 |
| 788 | 3300046473 | Ga0495582_0219308 | Ga0495582_0219308_84_554 | 156 |
| 789 | 3300046474 | Ga0495605_0035330 | Ga0495605_0035330_56_526 | 156 |
| 790 | 3300046474 | Ga0495605_0062745 | Ga0495605_0062745_139_612 | 156 |
| 791 | 3300046474 | Ga0495605_0217783 | Ga0495605_0217783_29_499 | 156 |
| 792 | 3300046475 | Ga0495639_0014908 | Ga0495639_0014908_2025_2495 | 156 |
| 793 | 3300046475 | Ga0495639_0043424 | Ga0495639_0043424_1329_1802 | 156 |
| 794 | 3300046476 | Ga0495662_0064517 | Ga0495662_0064517_1209_1679 | 156 |
| 795 | 3300046476 | Ga0495662_0071248 | Ga0495662_0071248_595_1065 | 156 |
| 796 | 3300046477 | Ga0495664_0001939 | Ga0495664_0001939_4306_4776 | 156 |
| 797 | 3300046477 | Ga0495664_0012734 | Ga0495664_0012734_98_568 | 156 |
| 798 | 3300046491 | Ga0495584_0048416 | Ga0495584_0048416_1398_1868 | 156 |
| 799 | 3300046499 | Ga0495594_0002231 | Ga0495594_0002231_6343_6816 | 156 |
| 800 | 3300046499 | Ga0495594_0407125 | Ga0495594_0407125_219_689 | 156 |
| 801 | 3300046500 | Ga0495596_0149066 | Ga0495596_0149066_243_713 | 156 |
| 802 | 3300046501 | Ga0495607_0035552 | Ga0495607_0035552_1309_1782 | 156 |
| 803 | 3300046501 | Ga0495607_0192791 | Ga0495607_0192791_108_578 | 156 |
| 804 | 3300046507 | Ga0495606_0137286 | Ga0495606_0137286_898_1368 | 156 |
| 805 | 3300046507 | Ga0495606_0231032 | Ga0495606_0231032_296_766 | 156 |
| 806 | 3300046511 | Ga0495608_0005911 | Ga0495608_0005911_6865_7335 | 156 |
| 807 | 3300046511 | Ga0495608_0479481 | Ga0495608_0479481_225_695 | 156 |
| 808 | 3300046512 | Ga0495610_0031675 | Ga0495610_0031675_1491_1961 | 156 |
| 809 | 3300046513 | Ga0495616_0033183 | Ga0495616_0033183_2015_2485 | 156 |
| 810 | 3300046513 | Ga0495616_0035701 | Ga0495616_0035701_1808_2278 | 156 |
| 811 | 3300046513 | Ga0495616_0066680 | Ga0495616_0066680_1014_1484 | 156 |
| 812 | 3300046513 | Ga0495616_0141581 | Ga0495616_0141581_560_1033 | 156 |
| 813 | 3300046514 | Ga0495618_0129607 | Ga0495618_0129607_845_1315 | 156 |
| 814 | 3300046514 | Ga0495618_0368820 | Ga0495618_0368820_198_668 | 156 |
| 815 | 3300046514 | Ga0495618_0503870 | Ga0495618_0503870_183_653 | 156 |
| 816 | 3300046515 | Ga0495620_0217150 | Ga0495620_0217150_188_658 | 156 |
| 817 | 3300046515 | Ga0495620_0232967 | Ga0495620_0232967_183_653 | 156 |
| 818 | 3300046516 | Ga0495628_0018357 | Ga0495628_0018357_3100_3570 | 156 |
| 819 | 3300046516 | Ga0495628_0038168 | Ga0495628_0038168_649_1119 | 156 |
| 820 | 3300046518 | Ga0495631_0173506 | Ga0495631_0173506_186_656 | 156 |
| 821 | 3300046519 | Ga0495632_0484871 | Ga0495632_0484871_15_485 | 156 |
| 822 | 3300046522 | Ga0495643_0064424 | Ga0495643_0064424_42_512 | 156 |
| 823 | 3300046522 | Ga0495643_0087741 | Ga0495643_0087741_850_1320 | 156 |
| 824 | 3300046522 | Ga0495643_0206118 | Ga0495643_0206118_327_800 | 156 |
| 825 | 3300046522 | Ga0495643_0278586 | Ga0495643_0278586_218_688 | 156 |
| 826 | 3300046524 | Ga0495648_0041061 | Ga0495648_0041061_2107_2580 | 156 |
| 827 | 3300046524 | Ga0495648_0130138 | Ga0495648_0130138_325_795 | 156 |
| 828 | 3300046524 | Ga0495648_0173142 | Ga0495648_0173142_116_586 | 156 |
| 829 | 3300046524 | Ga0495648_0224983 | Ga0495648_0224983_392_865 | 156 |
| 830 | 3300046524 | Ga0495648_0250849 | Ga0495648_0250849_362_832 | 156 |
| 831 | 3300046524 | Ga0495648_0311671 | Ga0495648_0311671_130_600 | 156 |
| 832 | 3300046526 | Ga0495666_0178959 | Ga0495666_0178959_99_569 | 156 |
| 833 | 3300046529 | Ga0495652_0030271 | Ga0495652_0030271_2678_3148 | 156 |
| 834 | 3300046529 | Ga0495652_0137427 | Ga0495652_0137427_893_1363 | 156 |
| 835 | 3300046529 | Ga0495652_0359133 | Ga0495652_0359133_334_804 | 156 |
| 836 | 3300046530 | Ga0495654_0023964 | Ga0495654_0023964_1812_2285 | 156 |
| 837 | 3300046530 | Ga0495654_0134517 | Ga0495654_0134517_303_773 | 156 |
| 838 | 3300046533 | Ga0495640_0084420 | Ga0495640_0084420_1614_2084 | 156 |
| 839 | 3300046533 | Ga0495640_0091149 | Ga0495640_0091149_720_1190 | 156 |
| 840 | 3300046535 | Ga0495586_0069902 | Ga0495586_0069902_873_1343 | 156 |
| 841 | 3300046535 | Ga0495586_0408346 | Ga0495586_0408346_248_721 | 156 |
| 842 | 3300046536 | Ga0495587_0008847 | Ga0495587_0008847_5162_5632 | 156 |
| 843 | 3300046538 | Ga0495609_0081646 | Ga0495609_0081646_284_754 | 156 |
| 844 | 3300046538 | Ga0495609_0375318 | Ga0495609_0375318_70_540 | 156 |
| 845 | 3300046542 | Ga0495597_0134085 | Ga0495597_0134085_327_797 | 156 |
| 846 | 3300046543 | Ga0495645_0047214 | Ga0495645_0047214_2161_2631 | 156 |
| 847 | 3300046557 | Ga0495622_0017010 | Ga0495622_0017010_2443_2913 | 156 |
| 848 | 3300046557 | Ga0495622_0028730 | Ga0495622_0028730_299_769 | 156 |
| 849 | 3300046559 | Ga0495667_0003089 | Ga0495667_0003089_10118_10588 | 156 |
| 850 | 3300046559 | Ga0495667_0108754 | Ga0495667_0108754_699_1169 | 156 |
| 851 | 3300046616 | Ga0495668_0256547 | Ga0495668_0256547_378_848 | 156 |
| 852 | 3300046642 | Ga0495634_0069997 | Ga0495634_0069997_637_1107 | 156 |
| 853 | 3300046642 | Ga0495634_0143040 | Ga0495634_0143040_972_1442 | 156 |
| 854 | 3300046642 | Ga0495634_0143086 | Ga0495634_0143086_907_1377 | 156 |
| 855 | 3300046642 | Ga0495634_0196457 | Ga0495634_0196457_210_680 | 156 |
| 856 | 3300046648 | Ga0495611_0152894 | Ga0495611_0152894_440_910 | 156 |
| 857 | 3300046660 | Ga0495625_0156639 | Ga0495625_0156639_566_1036 | 156 |
| 858 | 3300046660 | Ga0495625_0166279 | Ga0495625_0166279_779_1252 | 156 |
| 859 | 3300046660 | Ga0495625_0205232 | Ga0495625_0205232_531_1001 | 156 |
| 860 | 3300046660 | Ga0495625_0222951 | Ga0495625_0222951_645_1115 | 156 |
| 861 | 3300046663 | Ga0495635_0021808 | Ga0495635_0021808_1727_2197 | 156 |
| 862 | 3300046663 | Ga0495635_0154829 | Ga0495635_0154829_985_1455 | 156 |
| 863 | 3300046665 | Ga0495661_0257843 | Ga0495661_0257843_73_543 | 156 |
| 864 | 3300046674 | Ga0495588_0461114 | Ga0495588_0461114_33_503 | 156 |
| 865 | 3300046675 | Ga0495657_0007669 | Ga0495657_0007669_5342_5812 | 156 |
| 866 | 3300046675 | Ga0495657_0033170 | Ga0495657_0033170_212_682 | 156 |
| 867 | 3300046678 | Ga0495599_0078614 | Ga0495599_0078614_190_660 | 156 |
| 868 | 3300046678 | Ga0495599_0163976 | Ga0495599_0163976_634_1104 | 156 |
| 869 | 3300046680 | Ga0495646_0230386 | Ga0495646_0230386_369_839 | 156 |
| 870 | 3300046681 | Ga0495647_0058570 | Ga0495647_0058570_1010_1480 | 156 |
| 871 | 3300046681 | Ga0495647_0482278 | Ga0495647_0482278_61_531 | 156 |
| 872 | 3300046683 | Ga0495658_0024230 | Ga0495658_0024230_1415_1885 | 156 |
| 873 | 3300046683 | Ga0495658_0168604 | Ga0495658_0168604_440_910 | 156 |
| 874 | 3300046684 | Ga0495669_0081234 | Ga0495669_0081234_70_540 | 156 |
| 875 | 3300046689 | Ga0495613_0072125 | Ga0495613_0072125_1826_2296 | 156 |
| 876 | 3300046689 | Ga0495613_0081969 | Ga0495613_0081969_969_1439 | 156 |
| 877 | 3300046690 | Ga0495624_0024439 | Ga0495624_0024439_3431_3901 | 156 |
| 878 | 3300046690 | Ga0495624_0141336 | Ga0495624_0141336_219_689 | 156 |
| 879 | 3300046691 | Ga0495670_0000963 | Ga0495670_0000963_7965_8438 | 156 |
| 880 | 3300046694 | Ga0495649_0010905 | Ga0495649_0010905_4533_5003 | 156 |
| 881 | 3300046694 | Ga0495649_0063489 | Ga0495649_0063489_1200_1670 | 156 |
| 882 | 3300046694 | Ga0495649_0144488 | Ga0495649_0144488_711_1181 | 156 |
| 883 | 3300046794 | Ga0495589_0258343 | Ga0495589_0258343_237_707 | 156 |
| 884 | 3300046809 | Ga0495600_0035115 | Ga0495600_0035115_536_1006 | 156 |
| 885 | 3300046809 | Ga0495600_0372738 | Ga0495600_0372738_225_695 | 156 |
| 886 | 3300047315 | Ga0495581_0014251 | Ga0495581_0014251_692_1162 | 156 |
| 887 | 3300047317 | Ga0495604_0007727 | Ga0495604_0007727_238_708 | 156 |
| 888 | 3300047317 | Ga0495604_0075510 | Ga0495604_0075510_1830_2300 | 156 |
| 889 | 3300047317 | Ga0495604_0115082 | Ga0495604_0115082_649_1119 | 156 |
| 890 | 3300047317 | Ga0495604_0260480 | Ga0495604_0260480_546_1016 | 156 |
| 891 | 3300047319 | Ga0495674_0006216 | Ga0495674_0006216_2150_2620 | 156 |
| 892 | 3300047319 | Ga0495674_0029090 | Ga0495674_0029090_3891_4361 | 156 |
| 893 | 3300047320 | Ga0495672_0283249 | Ga0495672_0283249_303_773 | 156 |
| 894 | 3300047321 | Ga0495676_0099349 | Ga0495676_0099349_346_816 | 156 |
| 895 | 3300047322 | Ga0495680_0032133 | Ga0495680_0032133_2101_2571 | 156 |
| 896 | 3300047323 | Ga0495683_0182534 | Ga0495683_0182534_151_621 | 156 |
| 897 | 3300047443 | Ga0495687_023857 | Ga0495687_023857_2072_2542 | 156 |
| 898 | 3300047443 | Ga0495687_044794 | Ga0495687_044794_157_627 | 156 |
| 899 | 3300047444 | Ga0495675_0009070 | Ga0495675_0009070_2455_2925 | 156 |
| 900 | 3300047469 | Ga0495673_0031757 | Ga0495673_0031757_270_740 | 156 |
| 901 | 3300047471 | Ga0495684_0023878 | Ga0495684_0023878_3675_4145 | 156 |
| 902 | 3300047471 | Ga0495684_0035401 | Ga0495684_0035401_2957_3427 | 156 |
| 903 | 3300047472 | Ga0495686_0508466 | Ga0495686_0508466_68_538 | 156 |
| 904 | 3300047673 | Ga0495593_0035519 | Ga0495593_0035519_738_1208 | 156 |
| 905 | 3300047673 | Ga0495593_0161835 | Ga0495593_0161835_296_766 | 156 |
| 906 | 3300048088 | Ga0495602_0022455 | Ga0495602_0022455_1096_1566 | 156 |
| 907 | 3300048088 | Ga0495602_0458621 | Ga0495602_0458621_47_517 | 156 |
| 908 | 3300048903 | Ga0496100_0017591 | Ga0496100_0017591_141_611 | 156 |
| 909 | 3300048903 | Ga0496100_0132409 | Ga0496100_0132409_577_1050 | 156 |
| 910 | 3300048904 | Ga0496101_0021665 | Ga0496101_0021665_3732_4202 | 156 |
| 911 | 3300048904 | Ga0496101_0159109 | Ga0496101_0159109_208_681 | 156 |
| 912 | 3300048904 | Ga0496101_0321438 | Ga0496101_0321438_290_760 | 156 |
| 913 | 3300048905 | Ga0496102_0009634 | Ga0496102_0009634_737_1210 | 156 |
| 914 | 3300048905 | Ga0496102_0054915 | Ga0496102_0054915_2452_2922 | 156 |
| 915 | 3300048905 | Ga0496102_0463231 | Ga0496102_0463231_358_828 | 156 |
| 916 | 3300048905 | Ga0496102_0510546 | Ga0496102_0510546_613_1083 | 156 |
| 917 | 3300048905 | Ga0496102_0622066 | Ga0496102_0622066_82_555 | 156 |
| 918 | 3300048905 | Ga0496102_0839847 | Ga0496102_0839847_46_516 | 156 |
| 919 | 3300048906 | Ga0496103_0036608 | Ga0496103_0036608_206_676 | 156 |
| 920 | 3300048906 | Ga0496103_0619979 | Ga0496103_0619979_70_540 | 156 |
| 921 | 3300048907 | Ga0496104_0004574 | Ga0496104_0004574_9248_9721 | 156 |
| 922 | 3300048907 | Ga0496104_0073288 | Ga0496104_0073288_2108_2578 | 156 |
| 923 | 3300048907 | Ga0496104_0195029 | Ga0496104_0195029_30_500 | 156 |
| 924 | 3300048907 | Ga0496104_0201495 | Ga0496104_0201495_295_765 | 156 |
| 925 | 3300048907 | Ga0496104_0473070 | Ga0496104_0473070_113_583 | 156 |
| 926 | 3300048907 | Ga0496104_1257294 | Ga0496104_1257294_127_597 | 156 |
| 927 | 3300048908 | Ga0496105_0000527 | Ga0496105_0000527_24425_24895 | 156 |
| 928 | 3300048908 | Ga0496105_0056097 | Ga0496105_0056097_170_640 | 156 |
| 929 | 3300048909 | Ga0496106_0002824 | Ga0496106_0002824_3092_3562 | 156 |
| 930 | 3300048909 | Ga0496106_0027981 | Ga0496106_0027981_3560_4033 | 156 |
| 931 | 3300048909 | Ga0496106_0091608 | Ga0496106_0091608_428_898 | 156 |
| 932 | 3300048910 | Ga0496107_0010480 | Ga0496107_0010480_3251_3721 | 156 |
| 933 | 3300048910 | Ga0496107_0028033 | Ga0496107_0028033_2876_3349 | 156 |
| 934 | 3300048910 | Ga0496107_0106734 | Ga0496107_0106734_26_496 | 156 |
| 935 | 3300048910 | Ga0496107_0247615 | Ga0496107_0247615_267_737 | 156 |
| 936 | 3300048910 | Ga0496107_0933363 | Ga0496107_0933363_51_524 | 156 |
| 937 | 3300048911 | Ga0496108_0018136 | Ga0496108_0018136_2316_2789 | 156 |
| 938 | 3300048911 | Ga0496108_0025756 | Ga0496108_0025756_3814_4284 | 156 |
| 939 | 3300048911 | Ga0496108_0953846 | Ga0496108_0953846_75_545 | 156 |
| 940 | 3300048912 | Ga0496109_0020859 | Ga0496109_0020859_3584_4057 | 156 |
| 941 | 3300048912 | Ga0496109_0161976 | Ga0496109_0161976_1295_1765 | 156 |
| 942 | 3300048912 | Ga0496109_0216354 | Ga0496109_0216354_1300_1770 | 156 |
| 943 | 3300048912 | Ga0496109_0403711 | Ga0496109_0403711_469_939 | 156 |
| 944 | 3300048912 | Ga0496109_0823658 | Ga0496109_0823658_278_751 | 156 |
| 945 | 3300048913 | Ga0496110_0027155 | Ga0496110_0027155_1885_2358 | 156 |
| 946 | 3300048913 | Ga0496110_0030187 | Ga0496110_0030187_3686_4156 | 156 |
| 947 | 3300048913 | Ga0496110_0072319 | Ga0496110_0072319_1732_2202 | 156 |
| 948 | 3300048913 | Ga0496110_0074314 | Ga0496110_0074314_267_737 | 156 |
| 949 | 3300048913 | Ga0496110_0302670 | Ga0496110_0302670_280_753 | 156 |
| 950 | 3300048913 | Ga0496110_1113010 | Ga0496110_1113010_41_514 | 156 |
| 951 | 3300048914 | Ga0496111_0060998 | Ga0496111_0060998_1342_1815 | 156 |
| 952 | 3300048914 | Ga0496111_0190209 | Ga0496111_0190209_901_1371 | 156 |
| 953 | 3300048914 | Ga0496111_0715809 | Ga0496111_0715809_243_713 | 156 |
| 954 | 3300048915 | Ga0496112_0006413 | Ga0496112_0006413_6862_7335 | 156 |
| 955 | 3300048915 | Ga0496112_0010513 | Ga0496112_0010513_5515_5988 | 156 |
| 956 | 3300048915 | Ga0496112_0429514 | Ga0496112_0429514_279_749 | 156 |
| 957 | 3300048915 | Ga0496112_0546289 | Ga0496112_0546289_170_640 | 156 |
| 958 | 3300048915 | Ga0496112_0584857 | Ga0496112_0584857_563_1033 | 156 |
| 959 | 3300048916 | Ga0496113_0179827 | Ga0496113_0179827_681_1151 | 156 |
| 960 | 3300048916 | Ga0496113_0229390 | Ga0496113_0229390_537_1007 | 156 |
| 961 | 3300048916 | Ga0496113_0283774 | Ga0496113_0283774_96_566 | 156 |
| 962 | 3300048916 | Ga0496113_0325478 | Ga0496113_0325478_460_930 | 156 |
| 963 | 3300048916 | Ga0496113_0459128 | Ga0496113_0459128_225_698 | 156 |
| 964 | 3300048916 | Ga0496113_0886396 | Ga0496113_0886396_156_629 | 156 |
| 965 | 3300048917 | Ga0496114_0017928 | Ga0496114_0017928_1670_2140 | 156 |
| 966 | 3300048917 | Ga0496114_0123124 | Ga0496114_0123124_379_849 | 156 |
| 967 | 3300048917 | Ga0496114_0225208 | Ga0496114_0225208_172_645 | 156 |
| 968 | 3300048917 | Ga0496114_1402618 | Ga0496114_1402618_53_523 | 156 |
| 969 | 3300048918 | Ga0496115_0106316 | Ga0496115_0106316_148_621 | 156 |
| 970 | 3300048918 | Ga0496115_0242179 | Ga0496115_0242179_1003_1473 | 156 |
| 971 | 3300048918 | Ga0496115_0246134 | Ga0496115_0246134_781_1251 | 156 |
| 972 | 3300048918 | Ga0496115_0489962 | Ga0496115_0489962_202_672 | 156 |
| 973 | 3300048918 | Ga0496115_0680535 | Ga0496115_0680535_58_528 | 156 |
| 974 | 3300048919 | Ga0496116_0012377 | Ga0496116_0012377_1659_2132 | 156 |
| 975 | 3300048919 | Ga0496116_0043539 | Ga0496116_0043539_371_841 | 156 |
| 976 | 3300048919 | Ga0496116_0258800 | Ga0496116_0258800_63_533 | 156 |
| 977 | 3300048920 | Ga0496117_0016115 | Ga0496117_0016115_1248_1721 | 156 |
| 978 | 3300048920 | Ga0496117_0052465 | Ga0496117_0052465_1051_1521 | 156 |
| 979 | 3300048920 | Ga0496117_0061321 | Ga0496117_0061321_304_774 | 156 |
| 980 | 3300048920 | Ga0496117_0062047 | Ga0496117_0062047_463_936 | 156 |
| 981 | 3300048921 | Ga0496118_0004964 | Ga0496118_0004964_5525_5995 | 156 |
| 982 | 3300048921 | Ga0496118_0013461 | Ga0496118_0013461_1262_1735 | 156 |
| 983 | 3300048921 | Ga0496118_0087024 | Ga0496118_0087024_472_942 | 156 |
| 984 | 3300048921 | Ga0496118_0110460 | Ga0496118_0110460_447_917 | 156 |
| 985 | 3300048921 | Ga0496118_0201462 | Ga0496118_0201462_293_763 | 156 |
| 986 | 3300048921 | Ga0496118_0261767 | Ga0496118_0261767_326_796 | 156 |
| 987 | 3300048921 | Ga0496118_0363162 | Ga0496118_0363162_136_606 | 156 |
| 988 | 3300048922 | Ga0496119_0029287 | Ga0496119_0029287_1136_1606 | 156 |
| 989 | 3300048922 | Ga0496119_0044910 | Ga0496119_0044910_193_663 | 156 |
| 990 | 3300048922 | Ga0496119_0048849 | Ga0496119_0048849_2086_2559 | 156 |
| 991 | 3300048922 | Ga0496119_0163830 | Ga0496119_0163830_295_765 | 156 |
| 992 | 3300048923 | Ga0496120_0008444 | Ga0496120_0008444_5466_5936 | 156 |
| 993 | 3300048923 | Ga0496120_0043583 | Ga0496120_0043583_61_534 | 156 |
| 994 | 3300048923 | Ga0496120_0166746 | Ga0496120_0166746_476_946 | 156 |
| 995 | 3300048924 | Ga0496121_0002820 | Ga0496121_0002820_6152_6622 | 156 |
| 996 | 3300048924 | Ga0496121_0017933 | Ga0496121_0017933_4189_4659 | 156 |
| 997 | 3300048924 | Ga0496121_0019022 | Ga0496121_0019022_4609_5079 | 156 |
| 998 | 3300048924 | Ga0496121_0057037 | Ga0496121_0057037_2226_2699 | 156 |
| 999 | 3300048924 | Ga0496121_0082556 | Ga0496121_0082556_123_593 | 156 |
| 1000 | 3300048924 | Ga0496121_0117993 | Ga0496121_0117993_1458_1928 | 156 |
| 1001 | 3300048924 | Ga0496121_0185608 | Ga0496121_0185608_887_1357 | 156 |
| 1002 | 3300048924 | Ga0496121_0339179 | Ga0496121_0339179_302_772 | 156 |
| 1003 | 3300048924 | Ga0496121_0478822 | Ga0496121_0478822_297_767 | 156 |
| 1004 | 3300048924 | Ga0496121_0697313 | Ga0496121_0697313_23_493 | 156 |
| 1005 | 3300048925 | Ga0496122_0282557 | Ga0496122_0282557_290_760 | 156 |
| 1006 | 3300048927 | Ga0496124_0002651 | Ga0496124_0002651_10293_10763 | 156 |
| 1007 | 3300048927 | Ga0496124_0033680 | Ga0496124_0033680_1604_2074 | 156 |
| 1008 | 3300048927 | Ga0496124_0141737 | Ga0496124_0141737_1284_1754 | 156 |
| 1009 | 3300048927 | Ga0496124_0195437 | Ga0496124_0195437_352_822 | 156 |
| 1010 | 3300048927 | Ga0496124_0238325 | Ga0496124_0238325_644_1114 | 156 |
| 1011 | 3300048927 | Ga0496124_0365873 | Ga0496124_0365873_216_689 | 156 |
| 1012 | 3300048927 | Ga0496124_0792593 | Ga0496124_0792593_98_568 | 156 |
| 1013 | 3300048927 | Ga0496124_0935007 | Ga0496124_0935007_13_483 | 156 |
| 1014 | 3300048928 | Ga0496125_0008852 | Ga0496125_0008852_3396_3869 | 156 |
| 1015 | 3300048928 | Ga0496125_0024004 | Ga0496125_0024004_3797_4267 | 156 |
| 1016 | 3300048928 | Ga0496125_0025082 | Ga0496125_0025082_3486_3959 | 156 |
| 1017 | 3300048928 | Ga0496125_0029022 | Ga0496125_0029022_2319_2789 | 156 |
| 1018 | 3300048928 | Ga0496125_0066594 | Ga0496125_0066594_248_718 | 156 |
| 1019 | 3300048928 | Ga0496125_0068173 | Ga0496125_0068173_2034_2504 | 156 |
| 1020 | 3300048928 | Ga0496125_0080114 | Ga0496125_0080114_1204_1674 | 156 |
| 1021 | 3300048929 | Ga0496126_0013579 | Ga0496126_0013579_2943_3413 | 156 |
| 1022 | 3300048929 | Ga0496126_0014996 | Ga0496126_0014996_7313_7783 | 156 |
| 1023 | 3300048929 | Ga0496126_0063124 | Ga0496126_0063124_156_626 | 156 |
| 1024 | 3300048929 | Ga0496126_0072456 | Ga0496126_0072456_1241_1714 | 156 |
| 1025 | 3300048929 | Ga0496126_0134860 | Ga0496126_0134860_997_1467 | 156 |
| 1026 | 3300048929 | Ga0496126_0320075 | Ga0496126_0320075_23_493 | 156 |
| 1027 | 3300048929 | Ga0496126_0385106 | Ga0496126_0385106_217_687 | 156 |
| 1028 | 3300048929 | Ga0496126_0398999 | Ga0496126_0398999_42_512 | 156 |
| 1029 | 3300048929 | Ga0496126_0523110 | Ga0496126_0523110_322_792 | 156 |
| 1030 | 3300048929 | Ga0496126_0557091 | Ga0496126_0557091_186_659 | 156 |
| 1031 | 3300048929 | Ga0496126_0592123 | Ga0496126_0592123_141_611 | 156 |
| 1032 | 3300048929 | Ga0496126_0817006 | Ga0496126_0817006_66_536 | 156 |
| 1033 | 3300049459 | Ga0495678_031118 | Ga0495678_031118_1502_1975 | 156 |
| 1034 | 3300049460 | Ga0495682_0009330 | Ga0495682_0009330_1694_2164 | 156 |
| 1035 | 3300049460 | Ga0495682_0053769 | Ga0495682_0053769_783_1253 | 156 |
| 1036 | 3300049460 | Ga0495682_0055819 | Ga0495682_0055819_275_745 | 156 |
| 1037 | 3300049568 | Ga0501031_0335122 | Ga0501031_0335122_440_913 | 156 |
| 1038 | 3300049569 | Ga0501032_0089474 | Ga0501032_0089474_853_1326 | 156 |
| 1039 | 3300049570 | Ga0501033_0313602 | Ga0501033_0313602_100_573 | 156 |
| 1040 | 3300049571 | Ga0501034_0456807 | Ga0501034_0456807_511_984 | 156 |
| 1041 | 3300049571 | Ga0501034_0855233 | Ga0501034_0855233_211_684 | 156 |
| 1042 | 3300049572 | Ga0501036_0103924 | Ga0501036_0103924_821_1294 | 156 |
| 1043 | 3300049572 | Ga0501036_0176420 | Ga0501036_0176420_506_979 | 156 |
| 1044 | 3300049573 | Ga0501037_0126603 | Ga0501037_0126603_1326_1799 | 156 |
| 1045 | 3300049574 | Ga0501038_0006039 | Ga0501038_0006039_3496_3969 | 156 |
| 1046 | 3300049576 | Ga0501040_0132966 | Ga0501040_0132966_623_1096 | 156 |
| 1047 | 3300049579 | Ga0501043_0017698 | Ga0501043_0017698_4923_5396 | 156 |
| 1048 | 3300049579 | Ga0501043_0108635 | Ga0501043_0108635_784_1257 | 156 |
| 1049 | 3300049579 | Ga0501043_0475317 | Ga0501043_0475317_118_591 | 156 |
| 1050 | 3300049581 | Ga0501047_0051102 | Ga0501047_0051102_534_1004 | 156 |
| 1051 | 3300049586 | Ga0501070_0112544 | Ga0501070_0112544_701_1171 | 156 |
| 1052 | 3300049589 | Ga0501073_0115850 | Ga0501073_0115850_683_1153 | 156 |
| 1053 | 3300049589 | Ga0501073_0800735 | Ga0501073_0800735_67_540 | 156 |
| 1054 | 3300049590 | Ga0501074_0035635 | Ga0501074_0035635_793_1263 | 156 |
| 1055 | 3300049742 | Ga0501080_0042828 | Ga0501080_0042828_2492_2965 | 156 |
| 1056 | 3300049742 | Ga0501080_0137365 | Ga0501080_0137365_1150_1620 | 156 |
| 1057 | 3300049822 | Ga0501035_0126553 | Ga0501035_0126553_116_589 | 156 |
| 1058 | 3300049823 | Ga0501044_0007497 | Ga0501044_0007497_9112_9585 | 156 |
| 1059 | 3300049823 | Ga0501044_0078881 | Ga0501044_0078881_682_1152 | 156 |
| 1060 | 3300049823 | Ga0501044_0296280 | Ga0501044_0296280_10_483 | 156 |
| 1061 | 3300050489 | nmdc:mga03683_159542_c1 | nmdc:mga03683_159542_c1_129_599 | 156 |
| 1062 | 3300050489 | nmdc:mga03683_61618_c1 | nmdc:mga03683_61618_c1_75_548 | 156 |
| 1063 | 3300050490 | nmdc:mga03n38_220034_c1 | nmdc:mga03n38_220034_c1_297_767 | 156 |
| 1064 | 3300050490 | nmdc:mga03n38_240531_c1 | nmdc:mga03n38_240531_c1_110_580 | 156 |
| 1065 | 3300050490 | nmdc:mga03n38_281488_c1 | nmdc:mga03n38_281488_c1_292_765 | 156 |
| 1066 | 3300050490 | nmdc:mga03n38_8084_c1 | nmdc:mga03n38_8084_c1_1632_2105 | 156 |
| 1067 | 3300050491 | nmdc:mga00v17_152090_c1 | nmdc:mga00v17_152090_c1_89_559 | 156 |
| 1068 | 3300050491 | nmdc:mga00v17_66785_c1 | nmdc:mga00v17_66785_c1_27_500 | 156 |
| 1069 | 3300050492 | nmdc:mga0yw44_13027_c1 | nmdc:mga0yw44_13027_c1_804_1277 | 156 |
| 1070 | 3300050492 | nmdc:mga0yw44_338611_c1 | nmdc:mga0yw44_338611_c1_418_888 | 156 |
| 1071 | 3300050492 | nmdc:mga0yw44_448081_c1 | nmdc:mga0yw44_448081_c1_321_791 | 156 |
| 1072 | 3300050492 | nmdc:mga0yw44_82874_c1 | nmdc:mga0yw44_82874_c1_228_698 | 156 |
| 1073 | 3300050493 | nmdc:mga0k408_3760_c1 | nmdc:mga0k408_3760_c1_1088_1558 | 156 |
| 1074 | 3300050493 | nmdc:mga0k408_77172_c1 | nmdc:mga0k408_77172_c1_1081_1551 | 156 |
| 1075 | 3300050493 | nmdc:mga0k408_91664_c1 | nmdc:mga0k408_91664_c1_295_768 | 156 |
| 1076 | 3300050494 | nmdc:mga06z11_13600_c1 | nmdc:mga06z11_13600_c1_1597_2070 | 156 |
| 1077 | 3300050494 | nmdc:mga06z11_192674_c1 | nmdc:mga06z11_192674_c1_351_821 | 156 |
| 1078 | 3300050494 | nmdc:mga06z11_267940_c1 | nmdc:mga06z11_267940_c1_466_936 | 156 |
| 1079 | 3300050494 | nmdc:mga06z11_393292_c1 | nmdc:mga06z11_393292_c1_149_619 | 156 |
| 1080 | 3300050494 | nmdc:mga06z11_475674_c1 | nmdc:mga06z11_475674_c1_38_508 | 156 |
| 1081 | 3300050495 | nmdc:mga04h51_31801_c1 | nmdc:mga04h51_31801_c1_1133_1606 | 156 |
| 1082 | 3300050495 | nmdc:mga04h51_96647_c1 | nmdc:mga04h51_96647_c1_298_768 | 156 |
| 1083 | 3300050496 | nmdc:mga07m45_21803_c1 | nmdc:mga07m45_21803_c1_217_687 | 156 |
| 1084 | 3300050496 | nmdc:mga07m45_91322_c1 | nmdc:mga07m45_91322_c1_1122_1592 | 156 |
| 1085 | 3300050496 | nmdc:mga07m45_94321_c1 | nmdc:mga07m45_94321_c1_334_804 | 156 |
| 1086 | 3300050512 | nmdc:mga0n895_1340567_c1 | nmdc:mga0n895_1340567_c1_46_519 | 156 |
| 1087 | 3300050512 | nmdc:mga0n895_556640_c1 | nmdc:mga0n895_556640_c1_446_919 | 156 |
| 1088 | 3300050516 | nmdc:mga0sz30_239974_c1 | nmdc:mga0sz30_239974_c1_96_566 | 156 |
| 1089 | 3300050516 | nmdc:mga0sz30_307117_c1 | nmdc:mga0sz30_307117_c1_125_595 | 156 |
| 1090 | 3300050516 | nmdc:mga0sz30_38220_c1 | nmdc:mga0sz30_38220_c1_676_1149 | 156 |
| 1091 | 3300050516 | nmdc:mga0sz30_48879_c1 | nmdc:mga0sz30_48879_c1_235_708 | 156 |
| 1092 | 3300050516 | nmdc:mga0sz30_94706_c1 | nmdc:mga0sz30_94706_c1_379_849 | 156 |
| 1093 | 3300053077 | Ga0495601_0152922 | Ga0495601_0152922_293_763 | 156 |
| 1094 | 3300053077 | Ga0495601_0255969 | Ga0495601_0255969_175_648 | 156 |
| 1095 | 3300053078 | Ga0495612_0017216 | Ga0495612_0017216_273_743 | 156 |
| 1096 | 3300053079 | Ga0500610_0184871 | Ga0500610_0184871_48_518 | 156 |
| 1097 | 3300053079 | Ga0500610_0242213 | Ga0500610_0242213_264_734 | 156 |
| 1098 | 3300053080 | Ga0500635_0014552 | Ga0500635_0014552_990_1460 | 156 |
| 1099 | 3300053080 | Ga0500635_0026210 | Ga0500635_0026210_143_613 | 156 |
| 1100 | 3300053083 | Ga0495655_0014279 | Ga0495655_0014279_174_644 | 156 |
| 1101 | 3300053083 | Ga0495655_0024406 | Ga0495655_0024406_705_1175 | 156 |
| 1102 | 3300053084 | Ga0495595_0124865 | Ga0495595_0124865_407_877 | 156 |
| 1103 | 3300053085 | Ga0495619_0150792 | Ga0495619_0150792_651_1121 | 156 |
| 1104 | 3300053085 | Ga0495619_0215190 | Ga0495619_0215190_237_707 | 156 |
| 1105 | 3300053085 | Ga0495619_0284790 | Ga0495619_0284790_330_800 | 156 |
| 1106 | 3300053085 | Ga0495619_0337095 | Ga0495619_0337095_390_863 | 156 |
| 1107 | 3300053086 | Ga0500578_0466151 | Ga0500578_0466151_119_589 | 156 |
| 1108 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_20000_20470 | 156 |
| 1109 | 3300053087 | Ga0500643_039575 | Ga0500643_039575_858_1331 | 156 |
| 1110 | 3300053088 | Ga0500644_0101593 | Ga0500644_0101593_115_588 | 156 |
| 1111 | 3300053089 | Ga0500581_148762 | Ga0500581_148762_491_964 | 156 |
| 1112 | 3300053091 | Ga0500647_0026856 | Ga0500647_0026856_2089_2559 | 156 |
| 1113 | 3300053092 | Ga0500583_0009468 | Ga0500583_0009468_1760_2230 | 156 |
| 1114 | 3300053093 | Ga0500651_0039750 | Ga0500651_0039750_524_994 | 156 |
| 1115 | 3300053094 | Ga0500566_0000204 | Ga0500566_0000204_17898_18368 | 156 |
| 1116 | 3300053094 | Ga0500566_0003695 | Ga0500566_0003695_8228_8698 | 156 |
| 1117 | 3300053094 | Ga0500566_0011050 | Ga0500566_0011050_2762_3235 | 156 |
| 1118 | 3300053094 | Ga0500566_0047105 | Ga0500566_0047105_1317_1787 | 156 |
| 1119 | 3300053094 | Ga0500566_0294287 | Ga0500566_0294287_214_684 | 156 |
| 1120 | 3300053095 | Ga0500640_001800 | Ga0500640_001800_6165_6635 | 156 |
| 1121 | 3300053095 | Ga0500640_069438 | Ga0500640_069438_810_1280 | 156 |
| 1122 | 3300053096 | Ga0500641_0011583 | Ga0500641_0011583_186_659 | 156 |
| 1123 | 3300053096 | Ga0500641_0089848 | Ga0500641_0089848_284_757 | 156 |
| 1124 | 3300053097 | Ga0500648_086637 | Ga0500648_086637_507_977 | 156 |
| 1125 | 3300053098 | Ga0500650_0010869 | Ga0500650_0010869_2520_2993 | 156 |
| 1126 | 3300053098 | Ga0500650_0098154 | Ga0500650_0098154_427_897 | 156 |
| 1127 | 3300053103 | Ga0500555_001232 | Ga0500555_001232_6706_7176 | 156 |
| 1128 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_372022_372495 | 156 |
| 1129 | 3300053104 | Ga0500556_0045721 | Ga0500556_0045721_1038_1508 | 156 |
| 1130 | 3300053105 | Ga0500557_000052 | Ga0500557_000052_6681_7151 | 156 |
| 1131 | 3300053108 | Ga0500562_127130 | Ga0500562_127130_178_651 | 156 |
| 1132 | 3300053111 | Ga0500572_000307 | Ga0500572_000307_9162_9632 | 156 |
| 1133 | 3300053111 | Ga0500572_000451 | Ga0500572_000451_4216_4686 | 156 |
| 1134 | 3300053115 | Ga0500591_139140 | Ga0500591_139140_412_882 | 156 |
| 1135 | 3300053116 | Ga0500592_011352 | Ga0500592_011352_757_1230 | 156 |
| 1136 | 3300053119 | Ga0500595_027995 | Ga0500595_027995_1442_1912 | 156 |
| 1137 | 3300053120 | Ga0500597_130297 | Ga0500597_130297_297_767 | 156 |
| 1138 | 3300053120 | Ga0500597_225985 | Ga0500597_225985_97_567 | 156 |
| 1139 | 3300053121 | Ga0500607_049924 | Ga0500607_049924_1008_1478 | 156 |
| 1140 | 3300053122 | Ga0500608_003260 | Ga0500608_003260_272_742 | 156 |
| 1141 | 3300053122 | Ga0500608_020784 | Ga0500608_020784_1426_1896 | 156 |
| 1142 | 3300053122 | Ga0500608_055785 | Ga0500608_055785_414_887 | 156 |
| 1143 | 3300053123 | Ga0500614_002722 | Ga0500614_002722_276_746 | 156 |
| 1144 | 3300053123 | Ga0500614_017858 | Ga0500614_017858_804_1274 | 156 |
| 1145 | 3300053130 | Ga0500642_0000274 | Ga0500642_0000274_17341_17811 | 156 |
| 1146 | 3300053130 | Ga0500642_0179222 | Ga0500642_0179222_86_556 | 156 |
| 1147 | 3300053136 | Ga0500559_0000066 | Ga0500559_0000066_72893_73366 | 156 |
| 1148 | 3300053136 | Ga0500559_0000143 | Ga0500559_0000143_37315_37785 | 156 |
| 1149 | 3300053136 | Ga0500559_0027270 | Ga0500559_0027270_1375_1845 | 156 |
| 1150 | 3300053136 | Ga0500559_0037695 | Ga0500559_0037695_879_1349 | 156 |
| 1151 | 3300053136 | Ga0500559_0270231 | Ga0500559_0270231_301_774 | 156 |
| 1152 | 3300053138 | Ga0500564_024180 | Ga0500564_024180_224_694 | 156 |
| 1153 | 3300053139 | Ga0500568_0004322 | Ga0500568_0004322_6339_6812 | 156 |
| 1154 | 3300053139 | Ga0500568_0008587 | Ga0500568_0008587_1996_2481 | 156 |
| 1155 | 3300053144 | Ga0500585_123841 | Ga0500585_123841_71_541 | 156 |
| 1156 | 3300053146 | Ga0500588_0035520 | Ga0500588_0035520_208_681 | 156 |
| 1157 | 3300053148 | Ga0500590_124109 | Ga0500590_124109_596_1069 | 156 |
| 1158 | 3300053150 | Ga0500603_000834 | Ga0500603_000834_171_641 | 156 |
| 1159 | 3300053151 | Ga0500604_0074390 | Ga0500604_0074390_45_518 | 156 |
| 1160 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_336675_337148 | 156 |
| 1161 | 3300053153 | Ga0500616_0000061 | Ga0500616_0000061_175423_175896 | 156 |
| 1162 | 3300053153 | Ga0500616_0039160 | Ga0500616_0039160_2021_2491 | 156 |
| 1163 | 3300053154 | Ga0500619_011481 | Ga0500619_011481_1081_1551 | 156 |
| 1164 | 3300053155 | Ga0500620_010363 | Ga0500620_010363_145_615 | 156 |
| 1165 | 3300053156 | Ga0500622_0000518 | Ga0500622_0000518_19689_20162 | 156 |
| 1166 | 3300053156 | Ga0500622_0008171 | Ga0500622_0008171_565_1035 | 156 |
| 1167 | 3300053157 | Ga0500624_003192 | Ga0500624_003192_352_822 | 156 |
| 1168 | 3300053157 | Ga0500624_018186 | Ga0500624_018186_158_631 | 156 |
| 1169 | 3300053158 | Ga0500627_0046909 | Ga0500627_0046909_507_980 | 156 |
| 1170 | 3300053159 | Ga0500630_000027 | Ga0500630_000027_10893_11363 | 156 |
| 1171 | 3300053160 | Ga0500633_0061133 | Ga0500633_0061133_347_820 | 156 |
| 1172 | 3300053162 | Ga0500638_118260 | Ga0500638_118260_517_987 | 156 |
| 1173 | 3300053163 | Ga0500639_000020 | Ga0500639_000020_449_919 | 156 |
| 1174 | 3300053163 | Ga0500639_008513 | Ga0500639_008513_1685_2155 | 156 |
| 1175 | 3300053163 | Ga0500639_027459 | Ga0500639_027459_1611_2081 | 156 |
| 1176 | 3300053177 | Ga0500636_0000042 | Ga0500636_0000042_40694_41164 | 156 |
| 1177 | 3300053177 | Ga0500636_0002347 | Ga0500636_0002347_2413_2886 | 156 |
| 1178 | 3300053177 | Ga0500636_0010264 | Ga0500636_0010264_4495_4968 | 156 |
| 1179 | 3300053177 | Ga0500636_0165491 | Ga0500636_0165491_432_902 | 156 |
| 1180 | 3300053178 | Ga0500637_0047062 | Ga0500637_0047062_1090_1560 | 156 |
| 1181 | 3300053178 | Ga0500637_0068654 | Ga0500637_0068654_926_1396 | 156 |
| 1182 | 3300053178 | Ga0500637_0095278 | Ga0500637_0095278_54_524 | 156 |
| 1183 | 3300053178 | Ga0500637_0163564 | Ga0500637_0163564_348_821 | 156 |
| 1184 | 3300053722 | Ga0500649_144835 | Ga0500649_144835_242_712 | 156 |
| 1185 | 3300053725 | Ga0500576_053720 | Ga0500576_053720_569_1039 | 156 |
| 1186 | 3300053727 | Ga0500611_040567 | Ga0500611_040567_298_768 | 156 |
| 1187 | 3300053729 | Ga0500625_008844 | Ga0500625_008844_2056_2526 | 156 |
| 1188 | 3300053731 | Ga0500609_008520 | Ga0500609_008520_74_547 | 156 |
| 1189 | 3300053732 | Ga0500656_005423 | Ga0500656_005423_657_1127 | 156 |
| 1190 | 3300053735 | Ga0500596_006963 | Ga0500596_006963_1180_1650 | 156 |
| 1191 | 3300053736 | Ga0500599_003266 | Ga0500599_003266_751_1221 | 156 |
| 1192 | 3300053737 | Ga0500601_000228 | Ga0500601_000228_6146_6616 | 156 |
| 1193 | 3300055283 | Ga0500661_017224 | Ga0500661_017224_238_708 | 156 |
| 1194 | 3300061719 | Ga0466962_0154092 | Ga0466962_0154092_312_782 | 156 |
| 1195 | 3300061719 | Ga0466962_0183348 | Ga0466962_0183348_180_650 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5buy-assembly1.cif.gz_C | crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis | 0.9525 | 6 | 127 |
| 5buy-assembly1.cif.gz_F | crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis | 0.9418 | 6 | 127 |
| 5buy-assembly1.cif.gz_E | crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis | 0.9396 | 6 | 125 |
| 7qv0-assembly1.cif.gz_B-2 | covalent complex between scalindua brodae amxfabz and amxacp | 0.9352 | 6 | 127 |
| 8ayc-assembly1.cif.gz_A | scalindua brodae amxfabz, i69g mutant | 0.935 | 6 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5buyF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9418 | 6 | 127 | 3.10.129.10 |
| af_Q2FWF5_1_146_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9141 | 6 | 131 | 3.10.129.10 |
| 1zhgA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9139 | 8 | 128 | 3.10.129.10 |
| 4h4gA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9127 | 6 | 131 | 3.10.129.10 |
| 2gllA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9072 | 8 | 130 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G5DU17-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase | 0.9669 | 8 | 154 |
GO:0016829
|
| AF-A0A5J6MFS3-F1-model_v4 | 3-hydroxyacyl-ACP dehydratase | 0.9651 | 1 | 150 |
GO:0016829
|
| AF-A0A4R2GWH8-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase | 0.9628 | 1 | 149 |
GO:0016829
|
| AF-A0A5J6MFS3-F1-model_v4 | 3-hydroxyacyl-ACP dehydratase | 0.9588 | 1 | 150 |
GO:0016829
|
| AF-A0A177J9D9-F1-model_v4 | deleted | 0.9586 | 1 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar