F491514

General Info

Members Datasets Scaffolds Average Seq Length
1195 636 1012 155

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10015808|Ga0213874_100158082
Length 157
Sequence MQIEYFQLIDRILDLNLEEKTITVEAQVPKQSTIFEGHFPGYPIMPGVLLIESMAQTSGWLLLALLKFERMPFLAAVKEAKMRGGFVPPGELLTIEASLVHEGSGYAITDARIKVGGTLRCNATITFRHVAFPSPHLREHMDAVAKRIGFPQQAFQS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
22 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
23 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
24 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
25 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
26 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
27 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
28 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
29 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
30 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
31 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
32 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
33 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
34 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
35 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
36 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
37 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
38 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
39 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
40 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
41 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
44 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
48 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
49 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
50 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
51 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
52 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
53 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
56 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
57 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
58 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
59 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
60 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
61 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
62 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
63 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
64 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
65 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
66 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
67 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
68 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
69 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
70 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
71 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
72 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
73 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
74 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
75 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
76 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
77 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
78 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
79 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
80 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
81 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
82 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
83 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
84 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
85 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
86 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
87 2922368715
88 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
89 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
90 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
91 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
92 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
93 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
94 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
95 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
96 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
97 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
98 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
99 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
100 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
101 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
102 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
103 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
104 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
105 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
106 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
107 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
108 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
109 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
110 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
111 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
112 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
113 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
114 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
115 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
116 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
117 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
118 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
119 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
120 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
121 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
122 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
123 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
124 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
125 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
126 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
127 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
128 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
129 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
130 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
131 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
132 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
133 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
134 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
135 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
136 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
137 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
138 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
139 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
140 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
141 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
142 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
143 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
144 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
145 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
146 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
147 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
148 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
149 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
150 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
151 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
152 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
153 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
154 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
155 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
156 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
157 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
158 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
159 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
160 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
161 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
162 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
163 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
164 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
165 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
166 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
167 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
168 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
169 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
170 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
171 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
172 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
173 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
174 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
175 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
176 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
177 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
178 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
184 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
185 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
186 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
187 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
188 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
189 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
190 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
191 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
192 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
193 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
194 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
195 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
196 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
197 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
198 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
199 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
200 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
201 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
202 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
203 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
204 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
205 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
206 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
207 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
208 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
209 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
210 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
211 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
212 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
213 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
214 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
215 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
216 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
217 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
218 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
219 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
220 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
221 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
222 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
223 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
224 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
225 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
226 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
227 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
228 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
229 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
230 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
231 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
232 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
233 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
234 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
235 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
236 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
237 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
238 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
239 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
240 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
244 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
245 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
246 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
247 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
248 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
253 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
254 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
255 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
256 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
257 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
259 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
260 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
261 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
262 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
263 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
264 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
265 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
269 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
273 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
275 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
330 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
331 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
332 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
333 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
334 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
338 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
339 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
340 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
341 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
342 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
343 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
344 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
345 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
346 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
347 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
348 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
349 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
350 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
351 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
352 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
353 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
354 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
355 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
356 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
357 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
358 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
359 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
360 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
361 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
362 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
363 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
364 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
365 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
366 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
367 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
368 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
369 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
370 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
371 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
372 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
373 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
374 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
375 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
376 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
377 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
378 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
379 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
380 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
381 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
382 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
383 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
384 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
385 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
386 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
387 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
388 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
389 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
390 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
391 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
392 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
393 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
394 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
395 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
396 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
397 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
398 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
399 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
400 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
401 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
402 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
403 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
404 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
405 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
406 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
407 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
408 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
409 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
410 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
411 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
412 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
413 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
414 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
415 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
416 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
417 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
418 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
419 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
420 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
421 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
422 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
423 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
424 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
425 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
426 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
427 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
428 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
429 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
430 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
431 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
432 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
433 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
434 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
435 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
436 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
437 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
438 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
439 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
440 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
441 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
442 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
443 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
444 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
445 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
446 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
447 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
448 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
449 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
450 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
451 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
452 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
453 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
454 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
455 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
462 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
463 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
464 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
465 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
466 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
467 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
468 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
469 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
470 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
471 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
472 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
473 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
474 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
475 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
476 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
477 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
478 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
479 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
480 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
481 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
482 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
483 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
484 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
485 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
486 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
487 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
488 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
489 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
490 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
491 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
492 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
493 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
494 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
495 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
496 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
497 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
498 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
499 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
500 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
501 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
502 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
503 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
504 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
505 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
506 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
507 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
508 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
509 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
510 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
511 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
512 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
513 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
514 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
515 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
516 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
517 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
529 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
530 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
531 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
532 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
533 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
535 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
536 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
537 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
538 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
539 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
540 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
541 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
542 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
543 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
544 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
545 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
546 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
547 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
548 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
549 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
550 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
551 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
552 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
553 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
554 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
555 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
556 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
557 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
558 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
559 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
560 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
561 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
562 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
563 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
564 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
565 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
566 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
567 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
568 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
569 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
570 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
571 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
572 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
573 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
574 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
575 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
576 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
577 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
578 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
579 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
580 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
581 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
582 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
583 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
584 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
585 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
586 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
587 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
588 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
589 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
590 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
591 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
592 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
593 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
594 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
595 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
596 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
597 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
598 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
599 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
600 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
601 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
602 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
603 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
604 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
605 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
606 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
607 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
608 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
609 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
610 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
611 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
612 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
613 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
614 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
615 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
616 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
617 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
618 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
619 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
620 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
621 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
622 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
623 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
624 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
625 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
626 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
627 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
628 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
629 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
630 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
631 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
632 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
633 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
634 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
635 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
636 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.67
Metatranscriptomes 0.08
Isolates 15.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.74
Nodule 11.97
Rhizoplane 6.44
Rhizosphere 52.97
Stem 0
Stem Tuber 0
Unclassified 11.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1004015 3300003214 Bacteria 3346
2 JGI25153J46596_10001910 3300003215 Bacteria 12359
3 JGI25153J46596_10017357 3300003215 Bacteria 2838
4 JGI25160J50197_1012180 3300003354 Bacteria 3004
5 JGI25160J50197_1014115 3300003354 Bacteria 2687
6 Ga0055539_1011018 3300003752 Bacteria 1117
7 Ga0055525_1004569 3300003759 Bacteria 1188
8 Ga0055542_1011971 3300003762 Bacteria 1516
9 Ga0055529_1017403 3300003763 Bacteria 901
10 Ga0055526_1027163 3300003771 Bacteria 1778
11 Ga0055524_1022327 3300003775 Bacteria 2071
12 Ga0055531_10021404 3300003794 Bacteria 2509
13 Ga0055543_1020348 3300004625 Bacteria 1220
14 Ga0065165_1001250 3300005262 Bacteria 28850
15 Ga0065165_1029674 3300005262 Bacteria 1749
16 Ga0065165_1083704 3300005262 Bacteria 823
17 Ga0070658_10065051 3300005327 Bacteria 2975
18 Ga0070658_10956154 3300005327 Bacteria 745
19 Ga0070683_100507935 3300005329 Bacteria 1152
20 Ga0070690_100293741 3300005330 Bacteria 1163
21 Ga0070670_100115805 3300005331 Bacteria 2311
22 Ga0070680_100037530 3300005336 Bacteria 3915
23 Ga0070680_100182490 3300005336 Bacteria 1768
24 Ga0070680_100390502 3300005336 Bacteria 1185
25 Ga0070680_100868753 3300005336 Bacteria 778
26 Ga0070682_101040068 3300005337 Bacteria 682
27 Ga0068868_100289922 3300005338 Bacteria 1387
28 Ga0070660_100063701 3300005339 Bacteria 2866
29 Ga0070660_100242798 3300005339 Bacteria 1467
30 Ga0070660_100362590 3300005339 Bacteria 1194
31 Ga0070660_100475100 3300005339 Bacteria 1039
32 Ga0070689_100118919 3300005340 Bacteria 2109
33 Ga0070689_101101491 3300005340 Bacteria 710
34 Ga0070691_10032104 3300005341 Bacteria 2466
35 Ga0070661_100199740 3300005344 Bacteria 1527
36 Ga0070661_100445586 3300005344 Bacteria 1029
37 Ga0070668_100121121 3300005347 Bacteria 2091
38 Ga0070668_100123332 3300005347 Bacteria 2073
39 Ga0070671_100098494 3300005355 Bacteria 2453
40 Ga0070688_100754461 3300005365 Bacteria 758
41 Ga0070659_100023050 3300005366 Bacteria 4760
42 Ga0070659_100484750 3300005366 Bacteria 1052
43 Ga0070659_100686335 3300005366 Bacteria 885
44 Ga0070659_100774739 3300005366 Bacteria 833
45 Ga0070667_100308698 3300005367 Bacteria 1425
46 Ga0070667_100658490 3300005367 Bacteria 967
47 Ga0070709_10000751 3300005434 Bacteria 18320
48 Ga0070709_10006118 3300005434 Bacteria 6547
49 Ga0070714_100001123 3300005435 Bacteria 19235
50 Ga0070714_100012709 3300005435 Bacteria 6725
51 Ga0070714_100081809 3300005435 Bacteria 2812
52 Ga0070714_100337867 3300005435 Bacteria 1412
53 Ga0070714_100980869 3300005435 Bacteria 822
54 Ga0070713_100000647 3300005436 Bacteria 22255
55 Ga0070713_100006657 3300005436 Bacteria 8039
56 Ga0070713_100181230 3300005436 Bacteria 1893
57 Ga0070713_101389385 3300005436 Bacteria 681
58 Ga0070710_10001077 3300005437 Bacteria 12915
59 Ga0070710_10001287 3300005437 Bacteria 11902
60 Ga0070711_100004377 3300005439 Bacteria 8321
61 Ga0070711_100014618 3300005439 Bacteria 4947
62 Ga0070663_100017304 3300005455 Bacteria 4703
63 Ga0070663_100027716 3300005455 Bacteria 3849
64 Ga0070663_100291995 3300005455 Bacteria 1302
65 Ga0070663_100302288 3300005455 Bacteria 1281
66 Ga0070663_100494689 3300005455 Bacteria 1014
67 Ga0070663_100863507 3300005455 Bacteria 779
68 Ga0070678_100110148 3300005456 Bacteria 2153
69 Ga0070662_101050919 3300005457 Bacteria 698
70 Ga0070681_10014556 3300005458 Bacteria 7827
71 Ga0070681_10079676 3300005458 Bacteria 3231
72 Ga0070681_10080405 3300005458 Bacteria 3215
73 Ga0070681_10669455 3300005458 Bacteria 953
74 Ga0070679_100013382 3300005530 Bacteria 7856
75 Ga0070679_100082005 3300005530 Bacteria 3215
76 Ga0070679_100085568 3300005530 Bacteria 3140
77 Ga0070679_100215125 3300005530 Bacteria 1884
78 Ga0070679_100476208 3300005530 Bacteria 1193
79 Ga0070679_100745922 3300005530 Bacteria 922
80 Ga0070679_100814556 3300005530 Bacteria 877
81 Ga0070684_100018906 3300005535 Bacteria 5689
82 Ga0070684_100045861 3300005535 Bacteria 3786
83 Ga0070684_101536186 3300005535 Bacteria 628
84 Ga0068853_100047159 3300005539 Bacteria 3697
85 Ga0068853_100096401 3300005539 Bacteria 2610
86 Ga0068853_100330422 3300005539 Bacteria 1414
87 Ga0068853_100638239 3300005539 Bacteria 1013
88 Ga0068853_101569545 3300005539 Bacteria 638
89 Ga0070693_100061094 3300005547 Bacteria 2190
90 Ga0070665_100233806 3300005548 Bacteria 1838
91 Ga0070665_100409309 3300005548 Bacteria 1364
92 Ga0070665_100455287 3300005548 Bacteria 1289
93 Ga0070665_100474852 3300005548 Bacteria 1261
94 Ga0070665_100800182 3300005548 Bacteria 956
95 Ga0070704_100325569 3300005549 Bacteria 1289
96 Ga0068855_100077895 3300005563 Bacteria 3846
97 Ga0068855_100095252 3300005563 Bacteria 3431
98 Ga0068855_100142669 3300005563 Bacteria 2728
99 Ga0068855_100239930 3300005563 Bacteria 2026
100 Ga0068855_101188570 3300005563 Bacteria 793
101 Ga0068855_101382155 3300005563 Bacteria 726
102 Ga0070664_100391379 3300005564 Bacteria 1270
103 Ga0070664_101060853 3300005564 Bacteria 762
104 Ga0068857_100214729 3300005577 Bacteria 1756
105 Ga0068857_100279426 3300005577 Bacteria 1535
106 Ga0068857_100604737 3300005577 Bacteria 1037
107 Ga0068857_101132655 3300005577 Bacteria 756
108 Ga0068857_101352488 3300005577 Bacteria 692
109 Ga0068854_100249881 3300005578 Bacteria 1416
110 Ga0068854_100583027 3300005578 Bacteria 952
111 Ga0068856_100085960 3300005614 Bacteria 3125
112 Ga0068856_100381119 3300005614 Bacteria 1429
113 Ga0068856_100603986 3300005614 Bacteria 1118
114 Ga0068856_101234211 3300005614 Bacteria 764
115 Ga0068856_102284394 3300005614 Bacteria 549
116 Ga0068852_100051692 3300005616 Bacteria 3528
117 Ga0068852_100240316 3300005616 Bacteria 1730
118 Ga0068852_100844000 3300005616 Bacteria 931
119 Ga0068859_100721536 3300005617 Bacteria 1087
120 Ga0068864_101123519 3300005618 Bacteria 783
121 Ga0068866_10864738 3300005718 Bacteria 633
122 Ga0068866_11218860 3300005718 Bacteria 544
123 Ga0068851_10055902 3300005834 Bacteria 2012
124 Ga0068863_100285454 3300005841 Bacteria 1600
125 Ga0068863_100304776 3300005841 Bacteria 1546
126 Ga0068863_101085821 3300005841 Bacteria 805
127 Ga0068858_100120356 3300005842 Bacteria 2455
128 Ga0068858_100707434 3300005842 Bacteria 980
129 Ga0068862_100680894 3300005844 Bacteria 994
130 Ga0081540_1004236 3300005983 Bacteria 11018
131 Ga0081540_1010774 3300005983 Bacteria 6148
132 Ga0070717_10000905 3300006028 Bacteria 19709
133 Ga0070717_10004417 3300006028 Bacteria 10151
134 Ga0070717_10678789 3300006028 Bacteria 935
135 Ga0070717_11298683 3300006028 Bacteria 661
136 Ga0075365_10007374 3300006038 Bacteria 6151
137 Ga0075365_10027847 3300006038 Bacteria 3599
138 Ga0075365_10031750 3300006038 Bacteria 3389
139 Ga0075365_10171287 3300006038 Bacteria 1515
140 Ga0075365_10471560 3300006038 Bacteria 887
141 Ga0075365_10543526 3300006038 Bacteria 822
142 Ga0075368_10000443 3300006042 Bacteria 12217
143 Ga0075368_10007756 3300006042 Bacteria 3801
144 Ga0075363_100027645 3300006048 Bacteria 2910
145 Ga0075363_100094310 3300006048 Bacteria 1650
146 Ga0075363_100121681 3300006048 Bacteria 1458
147 Ga0075363_100244850 3300006048 Bacteria 1031
148 Ga0075364_10058986 3300006051 Bacteria 2516
149 Ga0075364_10236121 3300006051 Bacteria 1242
150 Ga0070715_10000111 3300006163 Bacteria 20025
151 Ga0070715_10117541 3300006163 Bacteria 1263
152 Ga0070716_100008083 3300006173 Bacteria 5209
153 Ga0070716_100021118 3300006173 Bacteria 3427
154 Ga0070716_100023807 3300006173 Bacteria 3253
155 Ga0070716_100357792 3300006173 Bacteria 1036
156 Ga0070716_100537428 3300006173 Bacteria 869
157 Ga0070716_100977719 3300006173 Bacteria 668
158 Ga0070712_100109890 3300006175 Bacteria 2055
159 Ga0070712_100699536 3300006175 Bacteria 864
160 Ga0070712_100718820 3300006175 Bacteria 853
161 Ga0070712_101032778 3300006175 Bacteria 712
162 Ga0075362_10022013 3300006177 Bacteria 2681
163 Ga0075362_10064656 3300006177 Bacteria 1660
164 Ga0075362_10301813 3300006177 Bacteria 795
165 Ga0075367_10010758 3300006178 Bacteria 4818
166 Ga0075367_10088555 3300006178 Bacteria 1881
167 Ga0075367_10441545 3300006178 Bacteria 824
168 Ga0075369_10002023 3300006186 Bacteria 7141
169 Ga0075369_10002445 3300006186 Bacteria 6624
170 Ga0075369_10043109 3300006186 Bacteria 1935
171 Ga0075369_10046711 3300006186 Bacteria 1865
172 Ga0075369_10075978 3300006186 Bacteria 1484
173 Ga0075369_10192580 3300006186 Bacteria 940
174 Ga0075369_10249280 3300006186 Bacteria 824
175 Ga0075366_10017661 3300006195 Bacteria 4109
176 Ga0075366_10077932 3300006195 Bacteria 1978
177 Ga0097621_100234175 3300006237 Bacteria 1604
178 Ga0097621_100652607 3300006237 Bacteria 965
179 Ga0075370_10036194 3300006353 Bacteria 2772
180 Ga0075370_10120412 3300006353 Bacteria 1528
181 Ga0075370_10162585 3300006353 Bacteria 1310
182 Ga0075370_10311123 3300006353 Bacteria 937
183 Ga0075434_100638582 3300006871 Bacteria 1083
184 Ga0068865_101084785 3300006881 Bacteria 704
185 Ga0097620_100721517 3300006931 Bacteria 1087
186 Ga0099825_1035906 3300006941 Bacteria 1740
187 Ga0099824_1010553 3300006942 Bacteria 10831
188 Ga0099823_1084262 3300006944 Bacteria 1176
189 Ga0105250_10081413 3300009092 Bacteria 1313
190 Ga0105240_10006904 3300009093 Bacteria 16585
191 Ga0105240_10160913 3300009093 Bacteria 2666
192 Ga0105240_10620792 3300009093 Bacteria 1188
193 Ga0105245_10510199 3300009098 Bacteria 1220
194 Ga0105245_10560575 3300009098 Bacteria 1165
195 Ga0105245_11254869 3300009098 Bacteria 789
196 Ga0105247_10023906 3300009101 Bacteria 3682
197 Ga0105247_10451341 3300009101 Bacteria 927
198 Ga0105241_10054047 3300009174 Bacteria 3073
199 Ga0105241_10255381 3300009174 Bacteria 1488
200 Ga0105241_11034345 3300009174 Bacteria 770
201 Ga0105248_10179647 3300009177 Bacteria 2385
202 Ga0105237_10033149 3300009545 Bacteria 5233
203 Ga0105237_10041832 3300009545 Bacteria 4621
204 Ga0105237_10128536 3300009545 Bacteria 2528
205 Ga0105237_10164160 3300009545 Bacteria 2220
206 Ga0105238_10011980 3300009551 Bacteria 8735
207 Ga0105238_10031278 3300009551 Bacteria 5418
208 Ga0105238_10055394 3300009551 Bacteria 3980
209 Ga0105238_10198783 3300009551 Bacteria 1980
210 Ga0105238_10234582 3300009551 Bacteria 1812
211 Ga0105238_10885933 3300009551 Bacteria 910
212 Ga0105238_11333419 3300009551 Bacteria 744
213 Ga0105249_11013040 3300009553 Bacteria 899
214 Ga0105239_10105480 3300010375 Bacteria 3121
215 Ga0105239_10249481 3300010375 Bacteria 1993
216 Ga0105239_10669518 3300010375 Bacteria 1186
217 Ga0105239_10712535 3300010375 Bacteria 1148
218 Ga0105239_11050970 3300010375 Bacteria 937
219 Ga0105239_11208625 3300010375 Bacteria 871
220 Ga0105239_11273729 3300010375 Bacteria 848
221 Ga0105239_11532657 3300010375 Bacteria 770
222 Ga0105246_10003537 3300011119 Bacteria 9458
223 Ga0105246_10131288 3300011119 Bacteria 1871
224 Ga0105246_10712302 3300011119 Bacteria 881
225 Ga0157373_10040070 3300013100 Bacteria 3352
226 Ga0157373_10318958 3300013100 Bacteria 1105
227 Ga0157371_10230752 3300013102 Bacteria 1330
228 Ga0157371_10330650 3300013102 Bacteria 1107
229 Ga0157370_10479215 3300013104 Bacteria 1143
230 Ga0157370_10618516 3300013104 Bacteria 991
231 Ga0157369_10026776 3300013105 Bacteria 6394
232 Ga0157369_10066689 3300013105 Bacteria 3871
233 Ga0157369_10102101 3300013105 Bacteria 3057
234 Ga0157369_11301903 3300013105 Bacteria 741
235 Ga0157374_10021982 3300013296 Bacteria 5684
236 Ga0157374_10139860 3300013296 Bacteria 2349
237 Ga0157374_10203998 3300013296 Bacteria 1937
238 Ga0157374_10349504 3300013296 Bacteria 1469
239 Ga0157378_10515208 3300013297 Bacteria 1197
240 Ga0157378_10877904 3300013297 Bacteria 926
241 Ga0163162_10179714 3300013306 Bacteria 2242
242 Ga0157372_10683265 3300013307 Bacteria 1195
243 Ga0157372_11210464 3300013307 Bacteria 873
244 Ga0157372_11255550 3300013307 Bacteria 855
245 Ga0157372_12020159 3300013307 Bacteria 662
246 Ga0157375_10084779 3300013308 Bacteria 3218
247 Ga0157375_11894807 3300013308 Bacteria 708
248 Ga0163163_10000985 3300014325 Bacteria 24137
249 Ga0163163_10385552 3300014325 Bacteria 1459
250 Ga0182008_10339606 3300014497 Bacteria 794
251 Ga0157377_10758235 3300014745 Bacteria 711
252 Ga0157379_10276398 3300014968 Bacteria 1528
253 Ga0157379_10435896 3300014968 Bacteria 1208
254 Ga0157379_10448002 3300014968 Bacteria 1191
255 Ga0157379_10609043 3300014968 Bacteria 1020
256 Ga0157376_10040370 3300014969 Bacteria 3814
257 Ga0154015_1294201 3300020610 Bacteria 620
258 Ga0214544_1000002 3300021320 Bacteria 753857
259 Ga0214542_1000001 3300021321 Bacteria 1018696
260 Ga0214545_1000001 3300021324 Bacteria 1092817
261 Ga0214543_1000001 3300021327 Bacteria 776921
262 Ga0213874_10015808 3300021377 Bacteria 1997
263 Ga0213876_10004192 3300021384 Bacteria 8083
264 Ga0213876_10030041 3300021384 Bacteria 2865
265 Ga0213875_10054161 3300021388 Bacteria 1879
266 Ga0209563_106889 3300025230 Bacteria 1914
267 Ga0209677_102534 3300025253 Bacteria 6765
268 Ga0209677_102699 3300025253 Bacteria 6391
269 Ga0209148_1000374 3300025254 Bacteria 54657
270 Ga0209233_1001622 3300025261 Bacteria 8756
271 Ga0209233_1004832 3300025261 Bacteria 4538
272 Ga0209233_1005085 3300025261 Bacteria 4400
273 Ga0209455_1001411 3300025272 Bacteria 10891
274 Ga0209455_1003883 3300025272 Bacteria 5098
275 Ga0209455_1007726 3300025272 Bacteria 2997
276 Ga0209673_1023500 3300025273 Bacteria 2096
277 Ga0209564_1011932 3300025295 Bacteria 3839
278 Ga0209564_1012318 3300025295 Bacteria 3741
279 Ga0209758_1000024 3300025297 Bacteria 591966
280 Ga0209758_1000068 3300025297 Bacteria 286488
281 Ga0209758_1001579 3300025297 Bacteria 26050
282 Ga0209758_1002091 3300025297 Bacteria 21224
283 Ga0209758_1022280 3300025297 Bacteria 2913
284 Ga0209758_1061358 3300025297 Bacteria 1239
285 Ga0209758_1085525 3300025297 Bacteria 939
286 Ga0209256_1008086 3300025299 Bacteria 4968
287 Ga0209256_1044051 3300025299 Bacteria 1116
288 Ga0207426_1000238 3300025302 Bacteria 124393
289 Ga0207426_1000726 3300025302 Bacteria 37826
290 Ga0207426_1023270 3300025302 Bacteria 2115
291 Ga0209257_1004927 3300025304 Bacteria 9810
292 Ga0207697_10104704 3300025315 Bacteria 1208
293 Ga0207656_10088167 3300025321 Bacteria 1404
294 Ga0207692_10000175 3300025898 Bacteria 20519
295 Ga0207692_10009115 3300025898 Bacteria 4131
296 Ga0207692_10520812 3300025898 Bacteria 757
297 Ga0207642_10642159 3300025899 Bacteria 664
298 Ga0207710_10014704 3300025900 Bacteria 3303
299 Ga0207710_10045700 3300025900 Bacteria 1953
300 Ga0207688_10049337 3300025901 Bacteria 2353
301 Ga0207680_10118806 3300025903 Bacteria 1726
302 Ga0207647_10017311 3300025904 Bacteria 4900
303 Ga0207685_10000929 3300025905 Bacteria 5596
304 Ga0207685_10053246 3300025905 Bacteria 1571
305 Ga0207699_10001765 3300025906 Bacteria 10215
306 Ga0207699_10007395 3300025906 Bacteria 5373
307 Ga0207699_10551535 3300025906 Bacteria 836
308 Ga0207699_10652675 3300025906 Bacteria 768
309 Ga0207705_10040079 3300025909 Bacteria 3358
310 Ga0207654_10006042 3300025911 Bacteria 6088
311 Ga0207654_10076895 3300025911 Bacteria 1999
312 Ga0207654_10376771 3300025911 Bacteria 982
313 Ga0207654_10550224 3300025911 Bacteria 820
314 Ga0207654_10600107 3300025911 Bacteria 785
315 Ga0207707_10000950 3300025912 Bacteria 27902
316 Ga0207707_10016441 3300025912 Bacteria 6453
317 Ga0207707_10808533 3300025912 Bacteria 781
318 Ga0207695_10000008 3300025913 Bacteria 1058268
319 Ga0207695_10378658 3300025913 Bacteria 1301
320 Ga0207695_10562427 3300025913 Bacteria 1022
321 Ga0207671_10008090 3300025914 Bacteria 8979
322 Ga0207671_10223291 3300025914 Bacteria 1476
323 Ga0207671_10579322 3300025914 Bacteria 895
324 Ga0207671_10662976 3300025914 Bacteria 831
325 Ga0207671_10730992 3300025914 Bacteria 787
326 Ga0207693_10004043 3300025915 Bacteria 12466
327 Ga0207693_10041091 3300025915 Bacteria 3642
328 Ga0207693_10086662 3300025915 Bacteria 2454
329 Ga0207663_10000098 3300025916 Bacteria 41171
330 Ga0207660_10048368 3300025917 Bacteria 3009
331 Ga0207660_10080030 3300025917 Bacteria 2398
332 Ga0207660_10126458 3300025917 Bacteria 1941
333 Ga0207657_10098593 3300025919 Bacteria 2428
334 Ga0207657_10129475 3300025919 Bacteria 2070
335 Ga0207657_10389938 3300025919 Bacteria 1096
336 Ga0207657_10414033 3300025919 Bacteria 1060
337 Ga0207649_10113640 3300025920 Bacteria 1814
338 Ga0207652_10069917 3300025921 Bacteria 3048
339 Ga0207652_10322037 3300025921 Bacteria 1396
340 Ga0207652_10403559 3300025921 Bacteria 1233
341 Ga0207694_10170993 3300025924 Bacteria 1759
342 Ga0207694_10531547 3300025924 Bacteria 986
343 Ga0207694_10608083 3300025924 Bacteria 919
344 Ga0207694_10694587 3300025924 Bacteria 858
345 Ga0207650_10334566 3300025925 Bacteria 1242
346 Ga0207687_10531731 3300025927 Bacteria 984
347 Ga0207687_10544863 3300025927 Bacteria 973
348 Ga0207687_10971448 3300025927 Bacteria 728
349 Ga0207700_10001663 3300025928 Bacteria 12623
350 Ga0207700_10188064 3300025928 Bacteria 1734
351 Ga0207700_10673494 3300025928 Bacteria 923
352 Ga0207700_10774064 3300025928 Bacteria 858
353 Ga0207664_10007161 3300025929 Bacteria 7734
354 Ga0207664_10066454 3300025929 Bacteria 2890
355 Ga0207664_10282165 3300025929 Bacteria 1457
356 Ga0207664_10297754 3300025929 Bacteria 1419
357 Ga0207664_10776891 3300025929 Bacteria 862
358 Ga0207644_10189698 3300025931 Bacteria 1615
359 Ga0207690_10623132 3300025932 Bacteria 882
360 Ga0207706_10037062 3300025933 Bacteria 4330
361 Ga0207706_10833667 3300025933 Bacteria 782
362 Ga0207709_10089618 3300025935 Bacteria 2006
363 Ga0207670_10115890 3300025936 Bacteria 1939
364 Ga0207665_10000355 3300025939 Bacteria 31763
365 Ga0207665_10003937 3300025939 Bacteria 9942
366 Ga0207711_10809945 3300025941 Bacteria 872
367 Ga0207661_10008365 3300025944 Bacteria 7390
368 Ga0207661_10082671 3300025944 Bacteria 2655
369 Ga0207679_10375144 3300025945 Bacteria 1246
370 Ga0207679_10668334 3300025945 Bacteria 941
371 Ga0207667_10112404 3300025949 Bacteria 2809
372 Ga0207667_10148159 3300025949 Bacteria 2416
373 Ga0207667_10189050 3300025949 Bacteria 2113
374 Ga0207667_10384559 3300025949 Bacteria 1430
375 Ga0207667_11115977 3300025949 Bacteria 771
376 Ga0207667_11436601 3300025949 Bacteria 662
377 Ga0207651_10320626 3300025960 Bacteria 1295
378 Ga0207712_11039742 3300025961 Bacteria 728
379 Ga0207668_10494164 3300025972 Bacteria 1051
380 Ga0207668_10563470 3300025972 Bacteria 988
381 Ga0207640_10177712 3300025981 Bacteria 1593
382 Ga0207658_10277395 3300025986 Bacteria 1435
383 Ga0207658_11541344 3300025986 Bacteria 608
384 Ga0207677_10830286 3300026023 Bacteria 829
385 Ga0207703_10165258 3300026035 Bacteria 1941
386 Ga0207703_10895296 3300026035 Bacteria 850
387 Ga0207703_10922455 3300026035 Bacteria 836
388 Ga0207639_10042274 3300026041 Bacteria 3415
389 Ga0207639_10119500 3300026041 Bacteria 2163
390 Ga0207639_10304947 3300026041 Bacteria 1409
391 Ga0207639_10450095 3300026041 Bacteria 1169
392 Ga0207639_10466450 3300026041 Bacteria 1149
393 Ga0207678_10008230 3300026067 Bacteria 9189
394 Ga0207678_10030531 3300026067 Bacteria 4704
395 Ga0207678_10069576 3300026067 Bacteria 3018
396 Ga0207678_10164813 3300026067 Bacteria 1892
397 Ga0207678_10296238 3300026067 Bacteria 1390
398 Ga0207678_11045404 3300026067 Bacteria 723
399 Ga0207708_10889845 3300026075 Bacteria 770
400 Ga0207702_10112461 3300026078 Bacteria 2423
401 Ga0207702_10231068 3300026078 Bacteria 1729
402 Ga0207702_10391799 3300026078 Bacteria 1338
403 Ga0207702_10396802 3300026078 Bacteria 1329
404 Ga0207702_10432069 3300026078 Bacteria 1275
405 Ga0207702_11285846 3300026078 Bacteria 726
406 Ga0207641_10536148 3300026088 Bacteria 1140
407 Ga0207641_10680434 3300026088 Bacteria 1012
408 Ga0207641_10965119 3300026088 Bacteria 848
409 Ga0207648_10318416 3300026089 Bacteria 1397
410 Ga0207676_10154911 3300026095 Bacteria 1978
411 Ga0207676_10758060 3300026095 Bacteria 944
412 Ga0207674_10088216 3300026116 Bacteria 3095
413 Ga0207674_10117044 3300026116 Bacteria 2636
414 Ga0207675_100982365 3300026118 Bacteria 862
415 Ga0207698_10042438 3300026142 Bacteria 3398
416 Ga0207698_10056264 3300026142 Bacteria 3036
417 Ga0207698_10352731 3300026142 Bacteria 1390
418 Ga0207698_11200897 3300026142 Bacteria 772
419 Ga0209389_1000107 3300027296 Bacteria 74129
420 Ga0209389_1005934 3300027296 Bacteria 10512
421 Ga0209589_1000092 3300027357 Bacteria 89530
422 Ga0209489_100006 3300027361 Bacteria 475698
423 Ga0209489_107740 3300027361 Bacteria 15589
424 Ga0209700_100005 3300027363 Bacteria 573969
425 Ga0209813_10005581 3300027866 Bacteria 3063
426 Ga0209813_10087381 3300027866 Bacteria 1041
427 Ga0268266_10038865 3300028379 Bacteria 4052
428 Ga0268266_10179065 3300028379 Bacteria 1929
429 Ga0268266_10212574 3300028379 Bacteria 1774
430 Ga0268266_10243666 3300028379 Bacteria 1660
431 Ga0268266_10970652 3300028379 Bacteria 822
432 Ga0268265_10080719 3300028380 Bacteria 2566
433 Ga0268264_10000065 3300028381 Bacteria 298403
434 Ga0265337_1002468 3300028556 Bacteria 8449
435 Ga0265326_10003263 3300028558 Bacteria 5347
436 Ga0265319_1007768 3300028563 Bacteria 4778
437 Ga0265334_10000456 3300028573 Bacteria 21294
438 Ga0265323_10000424 3300028653 Bacteria 24236
439 Ga0265322_10005214 3300028654 Bacteria 3846
440 Ga0307515_10074714 3300028794 Bacteria 4528
441 Ga0265338_10000321 3300028800 Bacteria 87046
442 Ga0265324_10023377 3300029957 Bacteria 2201
443 Ga0265330_10101988 3300031235 Bacteria 1228
444 Ga0265330_10147547 3300031235 Bacteria 1000
445 Ga0265320_10186503 3300031240 Bacteria 929
446 Ga0265340_10068526 3300031247 Bacteria 1685
447 Ga0265339_10045369 3300031249 Bacteria 2419
448 Ga0265331_10261854 3300031250 Bacteria 775
449 Ga0307509_10217624 3300031507 Bacteria 1727
450 Ga0307408_100814022 3300031548 Bacteria 849
451 Ga0307508_10039062 3300031616 Bacteria 4264
452 Ga0265314_10019799 3300031711 Bacteria 5204
453 Ga0265342_10007904 3300031712 Bacteria 7711
454 Ga0265342_10212989 3300031712 Bacteria 1044
455 Ga0307507_10018406 3300033179 Bacteria 7945
456 Ga0307510_10019136 3300033180 Bacteria 8033
457 Ga0307510_10156655 3300033180 Bacteria 1883
458 Ga0316215_1006801 3300033544 Bacteria 1111
459 Ga0316214_1006677 3300033545 Bacteria 1528
460 Ga0373923_0031055 3300035111 Bacteria 2151
461 Ga0373936_0039776 3300035113 Bacteria 1882
462 Ga0373936_0042475 3300035113 Bacteria 1825
463 Ga0373953_0098249 3300035117 Bacteria 1230
464 Ga0373954_0052970 3300035118 Bacteria 1907
465 Ga0373956_0026015 3300035119 Bacteria 2533
466 Ga0373960_0063783 3300035121 Bacteria 1124
467 Ga0373943_0028281 3300035170 Bacteria 2641
468 Ga0373943_0071314 3300035170 Bacteria 1760
469 Ga0373946_0346807 3300035171 Bacteria 742
470 Ga0373955_0007905 3300035172 Bacteria 4910
471 Ga0373931_0322617 3300035691 Bacteria 960
472 Ga0373935_0071239 3300035692 Bacteria 2242
473 Ga0373935_0267902 3300035692 Bacteria 1199
474 Ga0373927_0010043 3300035695 Bacteria 6339
475 Ga0373927_0232406 3300035695 Bacteria 1211
476 Ga0373933_0000199 3300035724 Bacteria 39593
477 Ga0373933_0017531 3300035724 Bacteria 4017
478 Ga0373947_0391755 3300035725 Bacteria 936
479 Ga0373937_0008799 3300036401 Bacteria 8759
480 Ga0373937_0063198 3300036401 Bacteria 3404
481 Ga0373937_0456722 3300036401 Bacteria 1213
482 Ga0373925_0029517 3300037068 Bacteria 4024
483 Ga0373925_0084180 3300037068 Bacteria 2423
484 Ga0373925_0131969 3300037068 Bacteria 1948
485 Ga0395899_0053300 3300037312 Bacteria 2995
486 Ga0395899_0379679 3300037312 Bacteria 939
487 Ga0395900_0000820 3300037418 Bacteria 41179
488 Ga0395900_0066935 3300037418 Bacteria 3691
489 Ga0395900_0084498 3300037418 Bacteria 3262
490 Ga0395900_0563087 3300037418 Bacteria 1083
491 Ga0395898_0039019 3300037466 Bacteria 4703
492 Ga0395898_0070853 3300037466 Bacteria 3369
493 Ga0395898_0081273 3300037466 Bacteria 3125
494 Ga0395898_0441886 3300037466 Bacteria 1239
495 Ga0395905_0006498 3300037471 Bacteria 11758
496 Ga0395905_0027848 3300037471 Bacteria 5328
497 Ga0395905_0151862 3300037471 Bacteria 2179
498 Ga0395905_0450739 3300037471 Bacteria 1185
499 Ga0436364_0230953 3300037853 Bacteria 544
500 Ga0436364_0432530 3300037853 Bacteria 535
501 Ga0436364_1074811 3300037853 Bacteria 1940
502 Ga0395901_0003090 3300038443 Bacteria 16741
503 Ga0395901_0081268 3300038443 Bacteria 3385
504 Ga0395901_0313828 3300038443 Bacteria 1623
505 Ga0436365_0535048 3300039437 Bacteria 1538
506 Ga0436365_0536419 3300039437 Bacteria 1304
507 Ga0436365_0570459 3300039437 Bacteria 2626
508 Ga0436365_1508712 3300039437 Bacteria 2539
509 Ga0436365_1571518 3300039437 Bacteria 1040
510 Ga0436365_1576869 3300039437 Bacteria 993
511 Ga0436360_0264935 3300039438 Bacteria 1885
512 Ga0436361_0983536 3300039447 Bacteria 979
513 Ga0436361_1032582 3300039447 Bacteria 996
514 Ga0436363_0484248 3300039450 Bacteria 907
515 Ga0436363_0929560 3300039450 Bacteria 1289
516 Ga0436362_1093918 3300039453 Bacteria 2921
517 Ga0451787_188948 3300041441 Bacteria 828
518 Ga0451789_1360976 3300041443 Bacteria 1072
519 Ga0451793_1099887 3300041452 Bacteria 1055
520 Ga0451797_0340083 3300041453 Bacteria 1176
521 Ga0451795_1217617 3300041456 Bacteria 984
522 Ga0451802_0763160 3300041460 Bacteria 1763
523 Ga0451807_1079633 3300041486 Bacteria 768
524 Ga0451833_0328009 3300041491 Bacteria 1132
525 Ga0451835_0292434 3300041492 Bacteria 659
526 Ga0451841_0463910 3300041498 Bacteria 1922
527 Ga0451849_0093937 3300041505 Bacteria 1886
528 Ga0451843_0540096 3300041509 Bacteria 684
529 Ga0451855_1276054 3300041511 Bacteria 593
530 Ga0451853_1099499 3300041512 Bacteria 651
531 Ga0439455_0164454 3300042012 Bacteria 635
532 Ga0466972_0000846 3300044658 Bacteria 14671
533 Ga0466972_0036013 3300044658 Bacteria 2422
534 Ga0466972_0205479 3300044658 Bacteria 922
535 Ga0466965_0229024 3300044683 Bacteria 992
536 Ga0466965_0275521 3300044683 Bacteria 907
537 Ga0466966_0000334 3300044684 Bacteria 30532
538 Ga0466966_0477135 3300044684 Bacteria 750
539 Ga0466961_0000509 3300044693 Bacteria 24794
540 Ga0466961_0278834 3300044693 Bacteria 1023
541 Ga0466961_0281834 3300044693 Bacteria 1017
542 Ga0466961_0371180 3300044693 Bacteria 869
543 Ga0466963_0021037 3300044694 Bacteria 4111
544 Ga0466964_0020638 3300044706 Bacteria 2539
545 Ga0466964_0564134 3300044706 Bacteria 620
546 Ga0466971_0333011 3300044719 Bacteria 733
547 Ga0466968_0276803 3300044735 Bacteria 802
548 Ga0466970_0212676 3300044765 Bacteria 1078
549 Ga0466970_0359153 3300044765 Bacteria 827
550 Ga0466970_0543013 3300044765 Bacteria 671
551 Ga0466970_0557952 3300044765 Bacteria 662
552 Ga0466957_0058165 3300044842 Bacteria 2368
553 Ga0466957_0071535 3300044842 Bacteria 2145
554 Ga0466957_0156280 3300044842 Bacteria 1478
555 Ga0466957_0273217 3300044842 Bacteria 1129
556 Ga0466957_0739848 3300044842 Bacteria 696
557 Ga0466960_0011942 3300044901 Bacteria 3654
558 Ga0466960_0321481 3300044901 Bacteria 876
559 Ga0466959_0058586 3300045049 Bacteria 2805
560 Ga0466959_0108199 3300045049 Bacteria 1986
561 Ga0466959_0730111 3300045049 Bacteria 663
562 Ga0466958_0058680 3300045836 Bacteria 2340
563 Ga0466958_0083330 3300045836 Bacteria 1971
564 Ga0466958_0680507 3300045836 Bacteria 670
565 Ga0466967_0009054 3300045976 Bacteria 7360
566 Ga0466967_0122516 3300045976 Bacteria 2405
567 Ga0466967_0183712 3300045976 Bacteria 1973
568 Ga0466967_0709738 3300045976 Bacteria 996
569 Ga0466967_1026645 3300045976 Bacteria 821
570 Ga0466967_1635493 3300045976 Bacteria 641
571 Ga0466967_1685899 3300045976 Bacteria 631
572 Ga0495592_0021156 3300046454 Bacteria 4947
573 Ga0495592_0162252 3300046454 Bacteria 1537
574 Ga0495603_0240395 3300046455 Bacteria 1043
575 Ga0495629_0027278 3300046459 Bacteria 4055
576 Ga0495629_0050041 3300046459 Bacteria 2928
577 Ga0495638_0031076 3300046460 Bacteria 3433
578 Ga0495641_0342136 3300046461 Bacteria 676
579 Ga0495651_0001733 3300046462 Bacteria 16846
580 Ga0495651_0096032 3300046462 Bacteria 2215
581 Ga0495650_0077872 3300046471 Bacteria 1285
582 Ga0495650_0130214 3300046471 Bacteria 918
583 Ga0495580_0007795 3300046472 Bacteria 8578
584 Ga0495582_0004536 3300046473 Bacteria 7799
585 Ga0495582_0219308 3300046473 Bacteria 1088
586 Ga0495605_0035330 3300046474 Bacteria 2526
587 Ga0495605_0062745 3300046474 Bacteria 1775
588 Ga0495605_0217783 3300046474 Bacteria 826
589 Ga0495639_0014908 3300046475 Bacteria 3367
590 Ga0495639_0043424 3300046475 Bacteria 2031
591 Ga0495662_0064517 3300046476 Bacteria 1770
592 Ga0495662_0071248 3300046476 Bacteria 1684
593 Ga0495664_0001939 3300046477 Bacteria 11029
594 Ga0495664_0012734 3300046477 Bacteria 4763
595 Ga0495584_0048416 3300046491 Bacteria 2143
596 Ga0495594_0002231 3300046499 Bacteria 10081
597 Ga0495594_0407125 3300046499 Bacteria 774
598 Ga0495596_0149066 3300046500 Bacteria 909
599 Ga0495607_0035552 3300046501 Bacteria 3012
600 Ga0495607_0172044 3300046501 Bacteria 1093
601 Ga0495607_0192791 3300046501 Bacteria 1014
602 Ga0495606_0028614 3300046507 Bacteria 3927
603 Ga0495606_0136165 3300046507 Bacteria 1454
604 Ga0495606_0137286 3300046507 Bacteria 1447
605 Ga0495606_0231032 3300046507 Bacteria 1036
606 Ga0495608_0005911 3300046511 Bacteria 8704
607 Ga0495608_0479481 3300046511 Bacteria 755
608 Ga0495610_0031675 3300046512 Bacteria 2756
609 Ga0495616_0033183 3300046513 Bacteria 2692
610 Ga0495616_0035701 3300046513 Bacteria 2570
611 Ga0495616_0066680 3300046513 Bacteria 1751
612 Ga0495616_0141581 3300046513 Bacteria 1094
613 Ga0495618_0129607 3300046514 Bacteria 1614
614 Ga0495618_0368820 3300046514 Bacteria 882
615 Ga0495618_0503870 3300046514 Bacteria 729
616 Ga0495620_0217150 3300046515 Bacteria 732
617 Ga0495620_0232967 3300046515 Bacteria 704
618 Ga0495628_0018357 3300046516 Bacteria 5795
619 Ga0495628_0038168 3300046516 Bacteria 3846
620 Ga0495630_0193217 3300046517 Bacteria 1553
621 Ga0495631_0173506 3300046518 Bacteria 924
622 Ga0495632_0484871 3300046519 Bacteria 534
623 Ga0495643_0064424 3300046522 Bacteria 1936
624 Ga0495643_0087741 3300046522 Bacteria 1609
625 Ga0495643_0206118 3300046522 Bacteria 941
626 Ga0495643_0278586 3300046522 Bacteria 770
627 Ga0495648_0041061 3300046524 Bacteria 2926
628 Ga0495648_0130138 3300046524 Bacteria 1339
629 Ga0495648_0173142 3300046524 Bacteria 1104
630 Ga0495648_0224983 3300046524 Bacteria 922
631 Ga0495648_0250849 3300046524 Bacteria 854
632 Ga0495648_0311671 3300046524 Bacteria 733
633 Ga0495666_0178959 3300046526 Bacteria 980
634 Ga0495652_0030271 3300046529 Bacteria 4748
635 Ga0495652_0137427 3300046529 Bacteria 1926
636 Ga0495652_0359133 3300046529 Bacteria 1041
637 Ga0495654_0023964 3300046530 Bacteria 3157
638 Ga0495654_0134517 3300046530 Bacteria 1107
639 Ga0495640_0084420 3300046533 Bacteria 2106
640 Ga0495640_0091149 3300046533 Bacteria 2011
641 Ga0495586_0069902 3300046535 Bacteria 1917
642 Ga0495586_0408346 3300046535 Bacteria 782
643 Ga0495587_0008847 3300046536 Bacteria 6463
644 Ga0495609_0081646 3300046538 Bacteria 1413
645 Ga0495609_0375318 3300046538 Bacteria 571
646 Ga0495597_0134085 3300046542 Bacteria 1025
647 Ga0495645_0047214 3300046543 Bacteria 3138
648 Ga0495622_0017010 3300046557 Bacteria 3385
649 Ga0495622_0028730 3300046557 Bacteria 2597
650 Ga0495667_0003089 3300046559 Bacteria 11169
651 Ga0495667_0108754 3300046559 Bacteria 1791
652 Ga0495668_0256547 3300046616 Bacteria 957
653 Ga0495634_0069997 3300046642 Bacteria 2313
654 Ga0495634_0143040 3300046642 Bacteria 1517
655 Ga0495634_0143086 3300046642 Bacteria 1517
656 Ga0495634_0196457 3300046642 Bacteria 1255
657 Ga0495611_0152894 3300046648 Bacteria 1077
658 Ga0495625_0156639 3300046660 Bacteria 1528
659 Ga0495625_0166279 3300046660 Bacteria 1474
660 Ga0495625_0205232 3300046660 Bacteria 1298
661 Ga0495625_0222951 3300046660 Bacteria 1234
662 Ga0495635_0021808 3300046663 Bacteria 4464
663 Ga0495635_0154829 3300046663 Bacteria 1560
664 Ga0495661_0257843 3300046665 Bacteria 887
665 Ga0495588_0461114 3300046674 Bacteria 666
666 Ga0495657_0007669 3300046675 Bacteria 8308
667 Ga0495657_0033170 3300046675 Bacteria 3597
668 Ga0495599_0078614 3300046678 Bacteria 2060
669 Ga0495599_0163976 3300046678 Bacteria 1373
670 Ga0495646_0080456 3300046680 Bacteria 1900
671 Ga0495646_0230386 3300046680 Bacteria 999
672 Ga0495647_0058570 3300046681 Bacteria 1514
673 Ga0495647_0482278 3300046681 Bacteria 576
674 Ga0495658_0024230 3300046683 Bacteria 3229
675 Ga0495658_0168604 3300046683 Bacteria 1354
676 Ga0495669_0081234 3300046684 Bacteria 1488
677 Ga0495613_0072125 3300046689 Bacteria 2517
678 Ga0495613_0081969 3300046689 Bacteria 2343
679 Ga0495624_0024439 3300046690 Bacteria 3975
680 Ga0495624_0141336 3300046690 Bacteria 1474
681 Ga0495670_0000963 3300046691 Bacteria 13946
682 Ga0495649_0010905 3300046694 Bacteria 5353
683 Ga0495649_0063489 3300046694 Bacteria 1984
684 Ga0495649_0144488 3300046694 Bacteria 1251
685 Ga0495589_0258343 3300046794 Bacteria 813
686 Ga0495600_0035115 3300046809 Bacteria 3255
687 Ga0495600_0372738 3300046809 Bacteria 891
688 Ga0495581_0014251 3300047315 Bacteria 4610
689 Ga0495604_0007727 3300047317 Bacteria 8516
690 Ga0495604_0075510 3300047317 Bacteria 2537
691 Ga0495604_0115082 3300047317 Bacteria 1955
692 Ga0495604_0260480 3300047317 Bacteria 1179
693 Ga0495674_0006216 3300047319 Bacteria 11455
694 Ga0495674_0029090 3300047319 Bacteria 5033
695 Ga0495672_0283249 3300047320 Bacteria 791
696 Ga0495676_0099349 3300047321 Bacteria 2157
697 Ga0495680_0032133 3300047322 Bacteria 4265
698 Ga0495683_0182534 3300047323 Bacteria 957
699 Ga0495687_023857 3300047443 Bacteria 2917
700 Ga0495687_044794 3300047443 Bacteria 1920
701 Ga0495675_0009070 3300047444 Bacteria 6181
702 Ga0495673_0031757 3300047469 Bacteria 2470
703 Ga0495684_0023878 3300047471 Bacteria 4702
704 Ga0495684_0035401 3300047471 Bacteria 3829
705 Ga0495686_0508466 3300047472 Bacteria 633
706 Ga0495593_0035519 3300047673 Bacteria 2706
707 Ga0495593_0161835 3300047673 Bacteria 1129
708 Ga0495602_0022455 3300048088 Bacteria 6175
709 Ga0495602_0458621 3300048088 Bacteria 898
710 Ga0496100_0017591 3300048903 Bacteria 4223
711 Ga0496100_0132409 3300048903 Bacteria 1758
712 Ga0496101_0021665 3300048904 Bacteria 4416
713 Ga0496101_0159109 3300048904 Bacteria 1731
714 Ga0496101_0321438 3300048904 Bacteria 1214
715 Ga0496102_0009634 3300048905 Bacteria 8308
716 Ga0496102_0054915 3300048905 Bacteria 3632
717 Ga0496102_0463231 3300048905 Bacteria 1188
718 Ga0496102_0510546 3300048905 Bacteria 1124
719 Ga0496102_0622066 3300048905 Bacteria 1003
720 Ga0496102_0839847 3300048905 Bacteria 841
721 Ga0496103_0036608 3300048906 Bacteria 3005
722 Ga0496103_0619979 3300048906 Bacteria 688
723 Ga0496104_0004574 3300048907 Bacteria 12056
724 Ga0496104_0073288 3300048907 Bacteria 3257
725 Ga0496104_0195029 3300048907 Bacteria 1937
726 Ga0496104_0201495 3300048907 Bacteria 1902
727 Ga0496104_0473070 3300048907 Bacteria 1164
728 Ga0496104_1257294 3300048907 Bacteria 643
729 Ga0496105_0000527 3300048908 Bacteria 25240
730 Ga0496105_0056097 3300048908 Bacteria 3252
731 Ga0496106_0002824 3300048909 Bacteria 12877
732 Ga0496106_0027981 3300048909 Bacteria 4197
733 Ga0496106_0091608 3300048909 Bacteria 2347
734 Ga0496107_0010480 3300048910 Bacteria 6443
735 Ga0496107_0028033 3300048910 Bacteria 4002
736 Ga0496107_0106734 3300048910 Bacteria 2057
737 Ga0496107_0247615 3300048910 Bacteria 1326
738 Ga0496107_0933363 3300048910 Bacteria 632
739 Ga0496108_0018136 3300048911 Bacteria 5759
740 Ga0496108_0025756 3300048911 Bacteria 4850
741 Ga0496108_0953846 3300048911 Bacteria 734
742 Ga0496109_0020859 3300048912 Bacteria 5790
743 Ga0496109_0161976 3300048912 Bacteria 2096
744 Ga0496109_0216354 3300048912 Bacteria 1802
745 Ga0496109_0403711 3300048912 Bacteria 1291
746 Ga0496109_0823658 3300048912 Bacteria 866
747 Ga0496110_0027155 3300048913 Bacteria 4905
748 Ga0496110_0030187 3300048913 Bacteria 4671
749 Ga0496110_0072319 3300048913 Bacteria 3059
750 Ga0496110_0074314 3300048913 Bacteria 3018
751 Ga0496110_0302670 3300048913 Bacteria 1456
752 Ga0496110_1113010 3300048913 Bacteria 698
753 Ga0496111_0060998 3300048914 Bacteria 2734
754 Ga0496111_0190209 3300048914 Bacteria 1526
755 Ga0496111_0227738 3300048914 Bacteria 1385
756 Ga0496111_0715809 3300048914 Bacteria 727
757 Ga0496112_0006413 3300048915 Bacteria 10325
758 Ga0496112_0010513 3300048915 Bacteria 8399
759 Ga0496112_0429514 3300048915 Bacteria 1259
760 Ga0496112_0546289 3300048915 Bacteria 1092
761 Ga0496112_0584857 3300048915 Bacteria 1049
762 Ga0496113_0179827 3300048916 Bacteria 1677
763 Ga0496113_0229390 3300048916 Bacteria 1480
764 Ga0496113_0283774 3300048916 Bacteria 1324
765 Ga0496113_0325478 3300048916 Bacteria 1232
766 Ga0496113_0459128 3300048916 Bacteria 1023
767 Ga0496113_0886396 3300048916 Bacteria 706
768 Ga0496114_0017928 3300048917 Bacteria 5722
769 Ga0496114_0123124 3300048917 Bacteria 2232
770 Ga0496114_0225208 3300048917 Bacteria 1647
771 Ga0496114_0400260 3300048917 Bacteria 1216
772 Ga0496114_1402618 3300048917 Bacteria 586
773 Ga0496115_0106316 3300048918 Bacteria 2304
774 Ga0496115_0242179 3300048918 Bacteria 1486
775 Ga0496115_0246134 3300048918 Bacteria 1473
776 Ga0496115_0489962 3300048918 Bacteria 989
777 Ga0496115_0680535 3300048918 Bacteria 810
778 Ga0496115_0802889 3300048918 Bacteria 732
779 Ga0496116_0012377 3300048919 Bacteria 6974
780 Ga0496116_0043539 3300048919 Bacteria 3057
781 Ga0496116_0258800 3300048919 Bacteria 860
782 Ga0496117_0016115 3300048920 Bacteria 6324
783 Ga0496117_0052465 3300048920 Bacteria 2872
784 Ga0496117_0061321 3300048920 Bacteria 2586
785 Ga0496117_0062047 3300048920 Bacteria 2564
786 Ga0496118_0004964 3300048921 Bacteria 15387
787 Ga0496118_0013461 3300048921 Bacteria 7733
788 Ga0496118_0087024 3300048921 Bacteria 2169
789 Ga0496118_0110460 3300048921 Bacteria 1826
790 Ga0496118_0201462 3300048921 Bacteria 1178
791 Ga0496118_0261767 3300048921 Bacteria 975
792 Ga0496118_0363162 3300048921 Bacteria 767
793 Ga0496119_0029287 3300048922 Bacteria 3738
794 Ga0496119_0044910 3300048922 Bacteria 2776
795 Ga0496119_0048849 3300048922 Bacteria 2620
796 Ga0496119_0163830 3300048922 Bacteria 1179
797 Ga0496120_0008444 3300048923 Bacteria 7475
798 Ga0496120_0043583 3300048923 Bacteria 2613
799 Ga0496120_0166746 3300048923 Bacteria 1093
800 Ga0496121_0002820 3300048924 Bacteria 25702
801 Ga0496121_0017933 3300048924 Bacteria 7181
802 Ga0496121_0019022 3300048924 Bacteria 6890
803 Ga0496121_0035353 3300048924 Bacteria 4480
804 Ga0496121_0057037 3300048924 Bacteria 3239
805 Ga0496121_0082556 3300048924 Bacteria 2540
806 Ga0496121_0117993 3300048924 Bacteria 2009
807 Ga0496121_0185608 3300048924 Bacteria 1496
808 Ga0496121_0339179 3300048924 Bacteria 1005
809 Ga0496121_0478822 3300048924 Bacteria 795
810 Ga0496121_0697313 3300048924 Bacteria 611
811 Ga0496122_0282557 3300048925 Bacteria 906
812 Ga0496124_0002651 3300048927 Bacteria 22984
813 Ga0496124_0033680 3300048927 Bacteria 4505
814 Ga0496124_0141737 3300048927 Bacteria 1896
815 Ga0496124_0195437 3300048927 Bacteria 1544
816 Ga0496124_0238325 3300048927 Bacteria 1355
817 Ga0496124_0365873 3300048927 Bacteria 1014
818 Ga0496124_0792593 3300048927 Bacteria 588
819 Ga0496124_0935007 3300048927 Bacteria 523
820 Ga0496125_0008852 3300048928 Bacteria 10461
821 Ga0496125_0024004 3300048928 Bacteria 5617
822 Ga0496125_0025082 3300048928 Bacteria 5469
823 Ga0496125_0029022 3300048928 Bacteria 4981
824 Ga0496125_0066594 3300048928 Bacteria 2845
825 Ga0496125_0068173 3300048928 Bacteria 2800
826 Ga0496125_0080114 3300048928 Bacteria 2500
827 Ga0496126_0008467 3300048929 Bacteria 11092
828 Ga0496126_0013579 3300048929 Bacteria 8270
829 Ga0496126_0014996 3300048929 Bacteria 7812
830 Ga0496126_0063124 3300048929 Bacteria 3321
831 Ga0496126_0072456 3300048929 Bacteria 3064
832 Ga0496126_0134860 3300048929 Bacteria 2130
833 Ga0496126_0320075 3300048929 Bacteria 1275
834 Ga0496126_0385106 3300048929 Bacteria 1140
835 Ga0496126_0398999 3300048929 Bacteria 1116
836 Ga0496126_0523110 3300048929 Bacteria 945
837 Ga0496126_0557091 3300048929 Bacteria 909
838 Ga0496126_0592123 3300048929 Bacteria 875
839 Ga0496126_0817006 3300048929 Bacteria 714
840 Ga0495678_031118 3300049459 Bacteria 2228
841 Ga0495682_0009330 3300049460 Bacteria 3831
842 Ga0495682_0053769 3300049460 Bacteria 1462
843 Ga0495682_0055819 3300049460 Bacteria 1432
844 Ga0501031_0335122 3300049568 Bacteria 979
845 Ga0501032_0089474 3300049569 Bacteria 2043
846 Ga0501032_0682422 3300049569 Bacteria 651
847 Ga0501033_0313602 3300049570 Bacteria 1102
848 Ga0501034_0000032 3300049571 Bacteria 243763
849 Ga0501034_0046426 3300049571 Bacteria 4389
850 Ga0501034_0456807 3300049571 Bacteria 1194
851 Ga0501034_0855233 3300049571 Bacteria 799
852 Ga0501036_0103924 3300049572 Bacteria 2402
853 Ga0501036_0176420 3300049572 Bacteria 1799
854 Ga0501037_0126603 3300049573 Bacteria 1833
855 Ga0501038_0006039 3300049574 Bacteria 11212
856 Ga0501040_0132966 3300049576 Bacteria 1750
857 Ga0501043_0017698 3300049579 Bacteria 5588
858 Ga0501043_0108635 3300049579 Bacteria 2178
859 Ga0501043_0475317 3300049579 Bacteria 936
860 Ga0501046_0032215 3300049580 Bacteria 4245
861 Ga0501047_0051102 3300049581 Bacteria 3992
862 Ga0501048_0013502 3300049582 Bacteria 6062
863 Ga0501070_0041109 3300049586 Bacteria 3852
864 Ga0501070_0112544 3300049586 Bacteria 2249
865 Ga0501073_0115850 3300049589 Bacteria 1857
866 Ga0501073_0800735 3300049589 Bacteria 649
867 Ga0501074_0035635 3300049590 Bacteria 3605
868 Ga0501080_0042828 3300049742 Bacteria 4215
869 Ga0501080_0137365 3300049742 Bacteria 2261
870 Ga0501035_0126553 3300049822 Bacteria 2230
871 Ga0501035_0153196 3300049822 Bacteria 1999
872 Ga0501044_0007497 3300049823 Bacteria 12001
873 Ga0501044_0029896 3300049823 Bacteria 5744
874 Ga0501044_0078881 3300049823 Bacteria 3337
875 Ga0501044_0296280 3300049823 Bacteria 1547
876 nmdc:mga03683_159542_c1 3300050489 Bacteria 1021
877 nmdc:mga03683_61618_c1 3300050489 Bacteria 1587
878 nmdc:mga03n38_220034_c1 3300050490 Bacteria 991
879 nmdc:mga03n38_240531_c1 3300050490 Bacteria 952
880 nmdc:mga03n38_281488_c1 3300050490 Bacteria 888
881 nmdc:mga03n38_8084_c1 3300050490 Bacteria 3755
882 nmdc:mga00v17_152090_c1 3300050491 Bacteria 1487
883 nmdc:mga00v17_561489_c1 3300050491 Bacteria 738
884 nmdc:mga00v17_66785_c1 3300050491 Bacteria 2221
885 nmdc:mga0yw44_13027_c1 3300050492 Bacteria 4360
886 nmdc:mga0yw44_338611_c1 3300050492 Bacteria 1012
887 nmdc:mga0yw44_448081_c1 3300050492 Bacteria 875
888 nmdc:mga0yw44_82874_c1 3300050492 Bacteria 2013
889 nmdc:mga0k408_3760_c1 3300050493 Bacteria 6742
890 nmdc:mga0k408_77172_c1 3300050493 Bacteria 1948
891 nmdc:mga0k408_91664_c1 3300050493 Bacteria 1785
892 nmdc:mga06z11_13600_c1 3300050494 Bacteria 3580
893 nmdc:mga06z11_192674_c1 3300050494 Bacteria 1181
894 nmdc:mga06z11_267940_c1 3300050494 Bacteria 1009
895 nmdc:mga06z11_393292_c1 3300050494 Bacteria 834
896 nmdc:mga06z11_475674_c1 3300050494 Bacteria 756
897 nmdc:mga04h51_31801_c1 3300050495 Bacteria 1670
898 nmdc:mga04h51_96647_c1 3300050495 Bacteria 1071
899 nmdc:mga07m45_21803_c1 3300050496 Bacteria 3492
900 nmdc:mga07m45_91322_c1 3300050496 Bacteria 1744
901 nmdc:mga07m45_94321_c1 3300050496 Bacteria 1716
902 nmdc:mga0n895_1340567_c1 3300050512 Bacteria 685
903 nmdc:mga0n895_556640_c1 3300050512 Bacteria 1152
904 nmdc:mga0sz30_239974_c1 3300050516 Bacteria 807
905 nmdc:mga0sz30_307117_c1 3300050516 Bacteria 708
906 nmdc:mga0sz30_38220_c1 3300050516 Bacteria 2011
907 nmdc:mga0sz30_48879_c1 3300050516 Bacteria 1791
908 nmdc:mga0sz30_94706_c1 3300050516 Bacteria 1302
909 Ga0495601_0152922 3300053077 Bacteria 1506
910 Ga0495601_0255969 3300053077 Bacteria 1143
911 Ga0495612_0017216 3300053078 Bacteria 2895
912 Ga0500610_0184871 3300053079 Bacteria 1017
913 Ga0500610_0242213 3300053079 Bacteria 838
914 Ga0500635_0014552 3300053080 Bacteria 2308
915 Ga0500635_0026210 3300053080 Bacteria 1843
916 Ga0500635_0132792 3300053080 Bacteria 939
917 Ga0495655_0014279 3300053083 Bacteria 1662
918 Ga0495655_0024406 3300053083 Bacteria 1404
919 Ga0495595_0124865 3300053084 Bacteria 1255
920 Ga0495619_0150792 3300053085 Bacteria 1604
921 Ga0495619_0215190 3300053085 Bacteria 1331
922 Ga0495619_0284790 3300053085 Bacteria 1145
923 Ga0495619_0337095 3300053085 Bacteria 1044
924 Ga0500578_0466151 3300053086 Bacteria 716
925 Ga0500643_000007 3300053087 Bacteria 462836
926 Ga0500643_039575 3300053087 Bacteria 1392
927 Ga0500644_0101593 3300053088 Bacteria 1093
928 Ga0500581_148762 3300053089 Bacteria 1101
929 Ga0500647_0026856 3300053091 Bacteria 2718
930 Ga0500583_0009468 3300053092 Bacteria 3563
931 Ga0500651_0039750 3300053093 Bacteria 2962
932 Ga0500566_0000204 3300053094 Bacteria 31169
933 Ga0500566_0003695 3300053094 Bacteria 9139
934 Ga0500566_0011050 3300053094 Bacteria 5319
935 Ga0500566_0047105 3300053094 Bacteria 2475
936 Ga0500566_0294287 3300053094 Bacteria 767
937 Ga0500640_001800 3300053095 Bacteria 6748
938 Ga0500640_069438 3300053095 Bacteria 1513
939 Ga0500641_0011583 3300053096 Bacteria 3203
940 Ga0500641_0089848 3300053096 Bacteria 1310
941 Ga0500648_086637 3300053097 Bacteria 1757
942 Ga0500650_0010869 3300053098 Bacteria 3723
943 Ga0500650_0098154 3300053098 Bacteria 1371
944 Ga0500555_001232 3300053103 Bacteria 8233
945 Ga0500556_0000002 3300053104 Bacteria 773626
946 Ga0500556_0045721 3300053104 Bacteria 1563
947 Ga0500557_000052 3300053105 Bacteria 50636
948 Ga0500562_127130 3300053108 Bacteria 694
949 Ga0500572_000307 3300053111 Bacteria 17413
950 Ga0500572_000451 3300053111 Bacteria 14277
951 Ga0500591_139140 3300053115 Bacteria 962
952 Ga0500592_011352 3300053116 Bacteria 1424
953 Ga0500595_027995 3300053119 Bacteria 1924
954 Ga0500597_130297 3300053120 Bacteria 1087
955 Ga0500597_225985 3300053120 Bacteria 776
956 Ga0500607_049924 3300053121 Bacteria 2231
957 Ga0500608_003260 3300053122 Bacteria 6047
958 Ga0500608_020784 3300053122 Bacteria 3023
959 Ga0500608_055785 3300053122 Bacteria 1893
960 Ga0500614_002722 3300053123 Bacteria 3899
961 Ga0500614_017858 3300053123 Bacteria 1608
962 Ga0500642_0000274 3300053130 Bacteria 19303
963 Ga0500642_0179222 3300053130 Bacteria 990
964 Ga0500559_0000066 3300053136 Bacteria 84664
965 Ga0500559_0000143 3300053136 Bacteria 55572
966 Ga0500559_0027270 3300053136 Bacteria 2437
967 Ga0500559_0037695 3300053136 Bacteria 2096
968 Ga0500559_0270231 3300053136 Bacteria 800
969 Ga0500564_024180 3300053138 Bacteria 2787
970 Ga0500568_0004322 3300053139 Bacteria 7622
971 Ga0500568_0008587 3300053139 Bacteria 4910
972 Ga0500585_123841 3300053144 Bacteria 920
973 Ga0500588_0035520 3300053146 Bacteria 1468
974 Ga0500590_124109 3300053148 Bacteria 1205
975 Ga0500603_000834 3300053150 Bacteria 7360
976 Ga0500604_0074390 3300053151 Bacteria 1088
977 Ga0500616_0000034 3300053153 Bacteria 396651
978 Ga0500616_0000061 3300053153 Bacteria 249158
979 Ga0500616_0039160 3300053153 Bacteria 2557
980 Ga0500619_011481 3300053154 Bacteria 2279
981 Ga0500620_010363 3300053155 Bacteria 2449
982 Ga0500622_0000518 3300053156 Bacteria 35866
983 Ga0500622_0008171 3300053156 Bacteria 5878
984 Ga0500624_003192 3300053157 Bacteria 2158
985 Ga0500624_018186 3300053157 Bacteria 1104
986 Ga0500627_0046909 3300053158 Bacteria 1874
987 Ga0500630_000027 3300053159 Bacteria 42085
988 Ga0500633_0061133 3300053160 Bacteria 1325
989 Ga0500638_118260 3300053162 Bacteria 1215
990 Ga0500639_000020 3300053163 Bacteria 102959
991 Ga0500639_008513 3300053163 Bacteria 5351
992 Ga0500639_027459 3300053163 Bacteria 3008
993 Ga0500636_0000042 3300053177 Bacteria 69412
994 Ga0500636_0002347 3300053177 Bacteria 10501
995 Ga0500636_0010264 3300053177 Bacteria 5460
996 Ga0500636_0165491 3300053177 Bacteria 1201
997 Ga0500637_0047062 3300053178 Bacteria 2449
998 Ga0500637_0068654 3300053178 Bacteria 2037
999 Ga0500637_0095278 3300053178 Bacteria 1724
1000 Ga0500637_0163564 3300053178 Bacteria 1282
1001 Ga0500649_144835 3300053722 Bacteria 865
1002 Ga0500576_053720 3300053725 Bacteria 1780
1003 Ga0500611_040567 3300053727 Bacteria 1020
1004 Ga0500625_008844 3300053729 Bacteria 4472
1005 Ga0500609_008520 3300053731 Bacteria 1384
1006 Ga0500656_005423 3300053732 Bacteria 1261
1007 Ga0500596_006963 3300053735 Bacteria 1878
1008 Ga0500599_003266 3300053736 Bacteria 1971
1009 Ga0500601_000228 3300053737 Bacteria 11112
1010 Ga0500661_017224 3300055283 Bacteria 1290
1011 Ga0466962_0154092 3300061719 Bacteria 1115
1012 Ga0466962_0183348 3300061719 Bacteria 1021

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10435896 Ga0157379_104358962 129
2 3300053080 Ga0500635_0132792 Ga0500635_0132792_19_441 140
3 3300025986 Ga0207658_11541344 Ga0207658_115413442 142
4 iso_pu_bacteria 2847930680 2847936595 145
5 iso_pu_bacteria 2879083081 2879088061 145
6 iso_pu_bacteria 2888378607 2888384493 145
7 3300005530 Ga0070679_100814556 Ga0070679_1008145562 148
8 3300037853 Ga0436364_0432530 Ga0436364_0432530_14_460 148
9 3300048918 Ga0496115_0802889 Ga0496115_0802889_273_719 148
10 3300044765 Ga0466970_0557952 Ga0466970_0557952_202_651 149
11 3300046501 Ga0495607_0172044 Ga0495607_0172044_20_469 149
12 3300046507 Ga0495606_0028614 Ga0495606_0028614_17_466 149
13 3300046507 Ga0495606_0136165 Ga0495606_0136165_14_463 149
14 3300046517 Ga0495630_0193217 Ga0495630_0193217_20_469 149
15 3300046680 Ga0495646_0080456 Ga0495646_0080456_20_469 149
16 3300050491 nmdc:mga00v17_561489_c1 nmdc:mga00v17_561489_c1_277_726 149
17 3300009098 Ga0105245_10560575 Ga0105245_105605752 152
18 iso_pu_bacteria 2507262055 2507508209 152
19 iso_pu_bacteria 2508501009 2508542275 152
20 iso_pu_bacteria 2508501042 2508691959 152
21 iso_pu_bacteria 2511231028 2511398752 152
22 iso_pu_bacteria 2513237092 2513622339 152
23 iso_pu_bacteria 2513237094 2513640516 152
24 iso_pu_bacteria 2513237095 2513645428 152
25 iso_pu_bacteria 2513237102 2513701731 152
26 iso_pu_bacteria 2513237104 2513718377 152
27 iso_pu_bacteria 2513237139 2513873153 152
28 iso_pu_bacteria 2513237161 2514016502 152
29 iso_pu_bacteria 2515154112 2515627284 152
30 iso_pu_bacteria 2517093001 2517102605 152
31 iso_pu_bacteria 2524023205 2524437750 152
32 iso_pu_bacteria 2528768022 2528848722 152
33 iso_pu_bacteria 2602042107 2603856789 152
34 iso_pu_bacteria 2617270735 2617346980 152
35 iso_pu_bacteria 2617270741 2617375398 152
36 iso_pu_bacteria 2744054633 2745074842 152
37 iso_pu_bacteria 2791355196 2793062581 152
38 iso_pu_bacteria 2802429603 2805914948 152
39 iso_pu_bacteria 2816332527 2818239665 152
40 iso_pu_bacteria 2824600985 2824602343 152
41 iso_pu_bacteria 2824609381 2824610563 152
42 iso_pu_bacteria 2824617872 2824618124 152
43 iso_pu_bacteria 2824626560 2824626792 152
44 iso_pu_bacteria 2824635225 2824636573 152
45 iso_pu_bacteria 2824644064 2824645107 152
46 iso_pu_bacteria 2824653114 2824654312 152
47 iso_pu_bacteria 2824661429 2824661609 152
48 iso_pu_bacteria 2824671348 2824672055 152
49 iso_pu_bacteria 2824679649 2824679883 152
50 iso_pu_bacteria 2824687955 2824688654 152
51 iso_pu_bacteria 2824696289 2824697108 152
52 iso_pu_bacteria 2824704595 2824705072 152
53 iso_pu_bacteria 2824714736 2824720401 152
54 iso_pu_bacteria 2824723954 2824729465 152
55 iso_pu_bacteria 2824732956 2824734588 152
56 iso_pu_bacteria 2824746037 2824749880 152
57 iso_pu_bacteria 2824753945 2824754390 152
58 iso_pu_bacteria 2824763712 2824767889 152
59 iso_pu_bacteria 2824773399 2824780368 152
60 iso_pu_bacteria 2838122688 2838123332 152
61 iso_pu_bacteria 2841941048 2841946625 152
62 iso_pu_bacteria 2841949485 2841954143 152
63 iso_pu_bacteria 2841957949 2841960994 152
64 iso_pu_bacteria 2841966195 2841969519 152
65 iso_pu_bacteria 2841974524 2841974596 152
66 iso_pu_bacteria 2841983080 2841983843 152
67 iso_pu_bacteria 2842038055 2842040198 152
68 iso_pu_bacteria 2842045827 2842046857 152
69 iso_pu_bacteria 2844315083 2844319424 152
70 iso_pu_bacteria 2847939898 2847946944 152
71 iso_pu_bacteria 2849076700 2849078947 152
72 iso_pu_bacteria 2857509624 2857515925 152
73 iso_pu_bacteria 2857524615 2857528267 152
74 iso_pu_bacteria 2874590934 2874598420 152
75 iso_pu_bacteria 2874612657 2874619358 152
76 iso_pu_bacteria 2874620515 2874626423 152
77 iso_pu_bacteria 2874628541 2874632287 152
78 iso_pu_bacteria 2874645413 2874652525 152
79 iso_pu_bacteria 2876761206 2876764969 152
80 iso_pu_bacteria 2876771140 2876778102 152
81 iso_pu_bacteria 2876818435 2876826029 152
82 iso_pu_bacteria 2879074833 2879081896 152
83 iso_pu_bacteria 2879099564 2879108363 152
84 iso_pu_bacteria 2879127579 2879135018 152
85 iso_pu_bacteria 2879142872 2879149703 152
86 iso_pu_bacteria 2881364244 2881368451 152
87 iso_pu_bacteria 2881665667 2881672520 152
88 iso_pu_bacteria 2885366525 2885369272 152
89 iso_pu_bacteria 2885409591 2885413301 152
90 iso_pu_bacteria 2888388044 2888393415 152
91 iso_pu_bacteria 2888419890 2888424938 152
92 iso_pu_bacteria 2893066018 2893068700 152
93 iso_pu_bacteria 2903727486 2903734366 152
94 iso_pu_bacteria 2904666416 2904671762 152
95 iso_pu_bacteria 2904711408 2904715113 152
96 iso_pu_bacteria 2906602504 2906605610 152
97 iso_pu_bacteria 2906626472 2906627149 152
98 iso_pu_bacteria 2906643746 2906646180 152
99 iso_pu_bacteria 2908775508 2908780544 152
100 iso_pu_bacteria 2919073203 2919075691 152
101 iso_pu_bacteria 2922368715 2922374909 152
102 iso_pu_bacteria 2922393267 2922394554 152
103 iso_pu_bacteria 2929615660 2929621951 152
104 iso_pu_bacteria 2929624759 2929629742 152
105 iso_pu_bacteria 2932784394 2932788816 152
106 iso_pu_bacteria 2932794094 2932797981 152
107 iso_pu_bacteria 2932801729 2932807176 152
108 iso_pu_bacteria 2932809354 2932812791 152
109 iso_pu_bacteria 2932818245 2932819117 152
110 iso_pu_bacteria 2932828146 2932830482 152
111 iso_pu_bacteria 2933577622 2933583774 152
112 iso_pu_bacteria 2935608549 2935609308 152
113 iso_pu_bacteria 2935616580 2935616777 152
114 iso_pu_bacteria 2935638405 2935641893 152
115 iso_pu_bacteria 2935648319 2935650903 152
116 iso_pu_bacteria 2935656913 2935659084 152
117 iso_pu_bacteria 2935665750 2935673024 152
118 iso_pu_bacteria 2935675223 2935675829 152
119 iso_pu_bacteria 2935684952 2935685826 152
120 iso_pu_bacteria 2935694250 2935697928 152
121 iso_pu_bacteria 2935703347 2935705666 152
122 iso_pu_bacteria 2935713505 2935714378 152
123 iso_pu_bacteria 2935722832 2935724997 152
124 iso_pu_bacteria 2935732158 2935732644 152
125 iso_pu_bacteria 2935741537 2935742023 152
126 iso_pu_bacteria 2935750917 2935751791 152
127 iso_pu_bacteria 2935760218 2935765048 152
128 iso_pu_bacteria 2935769743 2935771665 152
129 iso_pu_bacteria 2935777560 2935778920 152
130 iso_pu_bacteria 2935785616 2935791159 152
131 iso_pu_bacteria 2935793552 2935795512 152
132 iso_pu_bacteria 2935801545 2935802644 152
133 iso_pu_bacteria 2935810662 2935813526 152
134 iso_pu_bacteria 2935819856 2935822468 152
135 iso_pu_bacteria 2935827899 2935830060 152
136 iso_pu_bacteria 2935837841 2935837978 152
137 iso_pu_bacteria 2935847175 2935848051 152
138 iso_pu_bacteria 2935855204 2935855401 152
139 iso_pu_bacteria 2935864058 2935867355 152
140 iso_pu_bacteria 2935873716 2935875826 152
141 iso_pu_bacteria 2935883170 2935885824 152
142 iso_pu_bacteria 2935908558 2935908726 152
143 iso_pu_bacteria 2935916978 2935917872 152
144 iso_pu_bacteria 2935926038 2935926700 152
145 iso_pu_bacteria 2935934488 2935935150 152
146 iso_pu_bacteria 2935942939 2935943600 152
147 iso_pu_bacteria 2935951376 2935952038 152
148 iso_pu_bacteria 2935959822 2935960811 152
149 iso_pu_bacteria 2935967501 2935968163 152
150 iso_pu_bacteria 2935975950 2935978778 152
151 iso_pu_bacteria 2935984226 2935987353 152
152 iso_pu_bacteria 2935992306 2935996490 152
153 iso_pu_bacteria 2936002035 2936003770 152
154 iso_pu_bacteria 2936011229 2936013499 152
155 iso_pu_bacteria 2936019824 2936022374 152
156 iso_pu_bacteria 2936028420 2936030820 152
157 iso_pu_bacteria 2936037263 2936042475 152
158 iso_pu_bacteria 2936046547 2936048633 152
159 iso_pu_bacteria 2936055302 2936058847 152
160 iso_pu_bacteria 2940556831 2940557406 152
161 iso_pu_bacteria 2941531003 2941533195 152
162 iso_pu_bacteria 2941538514 2941539356 152
163 iso_pu_bacteria 3005483717 3005484674 152
164 iso_pu_bacteria 3005506211 3005510685 152
165 iso_pu_bacteria 3005587118 3005587676 152
166 iso_pu_bacteria 3005594810 3005599636 152
167 iso_pu_bacteria 3005710791 3005715286 152
168 iso_pu_bacteria 3005718088 3005722664 152
169 iso_pu_bacteria 8006926726 8006933133 152
170 iso_pu_bacteria 8016511872 8016521809 152
171 iso_pu_bacteria 8016522445 8016529219 152
172 iso_pu_bacteria 8016530956 8016534430 152
173 iso_pu_bacteria 8016539877 8016547654 152
174 iso_pu_bacteria 8016548790 8016554485 152
175 iso_pu_bacteria 8016566248 8016572771 152
176 iso_pu_bacteria 8016575299 8016576929 152
177 iso_pu_bacteria 8016583857 8016593290 152
178 iso_pu_bacteria 8016595262 8016600633 152
179 iso_pu_bacteria 8016603502 8016610104 152
180 iso_pu_bacteria 8016613128 8016614834 152
181 iso_pu_bacteria 8016622563 8016626147 152
182 iso_pu_bacteria 8016630954 8016639929 152
183 iso_pu_bacteria 8017057580 8017063842 152
184 iso_pu_bacteria 8019530166 8019534192 152
185 iso_pu_bacteria 8019538911 8019545270 152
186 iso_pu_bacteria 8019547302 8019553244 152
187 iso_pu_bacteria 8019586578 8019590999 152
188 iso_pu_bacteria 8019597564 8019600346 152
189 iso_pu_bacteria 8019608314 8019618194 152
190 iso_pu_bacteria 8019638758 8019645680 152
191 iso_pu_bacteria 8019648815 8019658948 152
192 iso_pu_bacteria 8019659431 8019661930 152
193 iso_pu_bacteria 8019668869 8019671451 152
194 iso_pu_bacteria 8019678201 8019684653 152
195 iso_pu_bacteria 8019687851 8019690477 152
196 iso_pu_bacteria 8055742211 8055745884 152
197 iso_pu_bacteria 8056967851 8056968415 152
198 3300026075 Ga0207708_10889845 Ga0207708_108898452 153
199 3300048924 Ga0496121_0035353 Ga0496121_0035353_2669_3136 154
200 3300048929 Ga0496126_0008467 Ga0496126_0008467_3072_3539 154
201 3300005336 Ga0070680_100182490 Ga0070680_1001824902 155
202 3300005339 Ga0070660_100242798 Ga0070660_1002427982 155
203 3300005366 Ga0070659_100023050 Ga0070659_1000230503 155
204 3300005366 Ga0070659_100774739 Ga0070659_1007747392 155
205 3300005435 Ga0070714_100081809 Ga0070714_1000818093 155
206 3300005436 Ga0070713_101389385 Ga0070713_1013893851 155
207 3300005530 Ga0070679_100215125 Ga0070679_1002151252 155
208 3300005539 Ga0068853_100096401 Ga0068853_1000964014 155
209 3300005548 Ga0070665_100474852 Ga0070665_1004748522 155
210 3300005563 Ga0068855_100095252 Ga0068855_1000952523 155
211 3300005563 Ga0068855_101382155 Ga0068855_1013821552 155
212 3300005614 Ga0068856_102284394 Ga0068856_1022843941 155
213 3300006028 Ga0070717_11298683 Ga0070717_112986831 155
214 3300006173 Ga0070716_100357792 Ga0070716_1003577922 155
215 3300006175 Ga0070712_101032778 Ga0070712_1010327782 155
216 3300009098 Ga0105245_10510199 Ga0105245_105101991 155
217 3300009545 Ga0105237_10041832 Ga0105237_100418322 155
218 3300009551 Ga0105238_10031278 Ga0105238_100312783 155
219 3300009551 Ga0105238_10198783 Ga0105238_101987832 155
220 3300013100 Ga0157373_10040070 Ga0157373_100400705 155
221 3300013102 Ga0157371_10330650 Ga0157371_103306502 155
222 3300013105 Ga0157369_11301903 Ga0157369_113019032 155
223 3300013296 Ga0157374_10021982 Ga0157374_100219827 155
224 3300013306 Ga0163162_10179714 Ga0163162_101797142 155
225 3300013307 Ga0157372_11255550 Ga0157372_112555502 155
226 3300025914 Ga0207671_10662976 Ga0207671_106629761 155
227 3300025921 Ga0207652_10322037 Ga0207652_103220372 155
228 3300025927 Ga0207687_10971448 Ga0207687_109714482 155
229 3300025928 Ga0207700_10673494 Ga0207700_106734942 155
230 3300025929 Ga0207664_10282165 Ga0207664_102821651 155
231 3300025949 Ga0207667_10148159 Ga0207667_101481594 155
232 3300026041 Ga0207639_10042274 Ga0207639_100422744 155
233 3300026142 Ga0207698_11200897 Ga0207698_112008972 155
234 3300028379 Ga0268266_10038865 Ga0268266_100388653 155
235 3300037312 Ga0395899_0053300 Ga0395899_0053300_1486_1953 155
236 3300037418 Ga0395900_0066935 Ga0395900_0066935_2004_2471 155
237 3300037418 Ga0395900_0084498 Ga0395900_0084498_2570_3037 155
238 3300037466 Ga0395898_0070853 Ga0395898_0070853_889_1356 155
239 3300037466 Ga0395898_0081273 Ga0395898_0081273_2157_2624 155
240 3300038443 Ga0395901_0003090 Ga0395901_0003090_11457_11924 155
241 3300039437 Ga0436365_1508712 Ga0436365_1508712_1365_1832 155
242 3300039437 Ga0436365_1571518 Ga0436365_1571518_195_662 155
243 3300044842 Ga0466957_0058165 Ga0466957_0058165_1758_2225 155
244 3300044842 Ga0466957_0739848 Ga0466957_0739848_145_612 155
245 3300045976 Ga0466967_0122516 Ga0466967_0122516_662_1129 155
246 3300045976 Ga0466967_1635493 Ga0466967_1635493_135_602 155
247 3300048914 Ga0496111_0227738 Ga0496111_0227738_724_1191 155
248 3300048917 Ga0496114_0400260 Ga0496114_0400260_99_566 155
249 3300049569 Ga0501032_0682422 Ga0501032_0682422_117_584 155
250 3300049571 Ga0501034_0000032 Ga0501034_0000032_124200_124667 155
251 3300049571 Ga0501034_0046426 Ga0501034_0046426_2990_3457 155
252 3300049580 Ga0501046_0032215 Ga0501046_0032215_2937_3404 155
253 3300049582 Ga0501048_0013502 Ga0501048_0013502_4912_5379 155
254 3300049586 Ga0501070_0041109 Ga0501070_0041109_2935_3402 155
255 3300049822 Ga0501035_0153196 Ga0501035_0153196_144_611 155
256 3300049823 Ga0501044_0029896 Ga0501044_0029896_2568_3035 155
257 3300003214 JGI25165J46597_1004015 JGI25165J46597_10040153 156
258 3300003215 JGI25153J46596_10001910 JGI25153J46596_1000191011 156
259 3300003215 JGI25153J46596_10017357 JGI25153J46596_100173573 156
260 3300003354 JGI25160J50197_1012180 JGI25160J50197_10121802 156
261 3300003354 JGI25160J50197_1014115 JGI25160J50197_10141152 156
262 3300003752 Ga0055539_1011018 Ga0055539_10110182 156
263 3300003759 Ga0055525_1004569 Ga0055525_10045692 156
264 3300003762 Ga0055542_1011971 Ga0055542_10119713 156
265 3300003763 Ga0055529_1017403 Ga0055529_10174031 156
266 3300003771 Ga0055526_1027163 Ga0055526_10271632 156
267 3300003775 Ga0055524_1022327 Ga0055524_10223273 156
268 3300003794 Ga0055531_10021404 Ga0055531_100214043 156
269 3300004625 Ga0055543_1020348 Ga0055543_10203482 156
270 3300005262 Ga0065165_1001250 Ga0065165_10012502 156
271 3300005262 Ga0065165_1029674 Ga0065165_10296742 156
272 3300005262 Ga0065165_1083704 Ga0065165_10837041 156
273 3300005327 Ga0070658_10065051 Ga0070658_100650512 156
274 3300005327 Ga0070658_10956154 Ga0070658_109561542 156
275 3300005329 Ga0070683_100507935 Ga0070683_1005079351 156
276 3300005330 Ga0070690_100293741 Ga0070690_1002937412 156
277 3300005331 Ga0070670_100115805 Ga0070670_1001158052 156
278 3300005336 Ga0070680_100037530 Ga0070680_1000375305 156
279 3300005336 Ga0070680_100390502 Ga0070680_1003905022 156
280 3300005336 Ga0070680_100868753 Ga0070680_1008687532 156
281 3300005337 Ga0070682_101040068 Ga0070682_1010400681 156
282 3300005338 Ga0068868_100289922 Ga0068868_1002899223 156
283 3300005339 Ga0070660_100063701 Ga0070660_1000637012 156
284 3300005339 Ga0070660_100362590 Ga0070660_1003625901 156
285 3300005339 Ga0070660_100475100 Ga0070660_1004751002 156
286 3300005340 Ga0070689_100118919 Ga0070689_1001189193 156
287 3300005340 Ga0070689_101101491 Ga0070689_1011014911 156
288 3300005341 Ga0070691_10032104 Ga0070691_100321044 156
289 3300005344 Ga0070661_100199740 Ga0070661_1001997402 156
290 3300005344 Ga0070661_100445586 Ga0070661_1004455862 156
291 3300005347 Ga0070668_100121121 Ga0070668_1001211212 156
292 3300005347 Ga0070668_100123332 Ga0070668_1001233322 156
293 3300005355 Ga0070671_100098494 Ga0070671_1000984942 156
294 3300005365 Ga0070688_100754461 Ga0070688_1007544611 156
295 3300005366 Ga0070659_100484750 Ga0070659_1004847502 156
296 3300005366 Ga0070659_100686335 Ga0070659_1006863352 156
297 3300005367 Ga0070667_100308698 Ga0070667_1003086982 156
298 3300005367 Ga0070667_100658490 Ga0070667_1006584902 156
299 3300005434 Ga0070709_10000751 Ga0070709_1000075114 156
300 3300005434 Ga0070709_10006118 Ga0070709_100061186 156
301 3300005435 Ga0070714_100001123 Ga0070714_10000112312 156
302 3300005435 Ga0070714_100012709 Ga0070714_1000127092 156
303 3300005435 Ga0070714_100337867 Ga0070714_1003378672 156
304 3300005435 Ga0070714_100980869 Ga0070714_1009808691 156
305 3300005436 Ga0070713_100000647 Ga0070713_10000064710 156
306 3300005436 Ga0070713_100006657 Ga0070713_1000066573 156
307 3300005436 Ga0070713_100181230 Ga0070713_1001812304 156
308 3300005437 Ga0070710_10001077 Ga0070710_1000107710 156
309 3300005437 Ga0070710_10001287 Ga0070710_100012878 156
310 3300005439 Ga0070711_100004377 Ga0070711_1000043775 156
311 3300005439 Ga0070711_100014618 Ga0070711_1000146184 156
312 3300005455 Ga0070663_100017304 Ga0070663_1000173045 156
313 3300005455 Ga0070663_100027716 Ga0070663_1000277163 156
314 3300005455 Ga0070663_100291995 Ga0070663_1002919951 156
315 3300005455 Ga0070663_100302288 Ga0070663_1003022882 156
316 3300005455 Ga0070663_100494689 Ga0070663_1004946892 156
317 3300005455 Ga0070663_100863507 Ga0070663_1008635072 156
318 3300005456 Ga0070678_100110148 Ga0070678_1001101482 156
319 3300005457 Ga0070662_101050919 Ga0070662_1010509191 156
320 3300005458 Ga0070681_10014556 Ga0070681_100145566 156
321 3300005458 Ga0070681_10079676 Ga0070681_100796762 156
322 3300005458 Ga0070681_10080405 Ga0070681_100804055 156
323 3300005458 Ga0070681_10669455 Ga0070681_106694552 156
324 3300005530 Ga0070679_100013382 Ga0070679_1000133828 156
325 3300005530 Ga0070679_100082005 Ga0070679_1000820055 156
326 3300005530 Ga0070679_100085568 Ga0070679_1000855683 156
327 3300005530 Ga0070679_100476208 Ga0070679_1004762082 156
328 3300005530 Ga0070679_100745922 Ga0070679_1007459222 156
329 3300005535 Ga0070684_100018906 Ga0070684_1000189063 156
330 3300005535 Ga0070684_100045861 Ga0070684_1000458614 156
331 3300005535 Ga0070684_101536186 Ga0070684_1015361862 156
332 3300005539 Ga0068853_100047159 Ga0068853_1000471594 156
333 3300005539 Ga0068853_100330422 Ga0068853_1003304222 156
334 3300005539 Ga0068853_100638239 Ga0068853_1006382391 156
335 3300005539 Ga0068853_101569545 Ga0068853_1015695451 156
336 3300005547 Ga0070693_100061094 Ga0070693_1000610947 156
337 3300005548 Ga0070665_100233806 Ga0070665_1002338062 156
338 3300005548 Ga0070665_100409309 Ga0070665_1004093092 156
339 3300005548 Ga0070665_100455287 Ga0070665_1004552872 156
340 3300005548 Ga0070665_100800182 Ga0070665_1008001822 156
341 3300005549 Ga0070704_100325569 Ga0070704_1003255692 156
342 3300005563 Ga0068855_100077895 Ga0068855_1000778953 156
343 3300005563 Ga0068855_100142669 Ga0068855_1001426692 156
344 3300005563 Ga0068855_100239930 Ga0068855_1002399301 156
345 3300005563 Ga0068855_101188570 Ga0068855_1011885702 156
346 3300005564 Ga0070664_100391379 Ga0070664_1003913792 156
347 3300005564 Ga0070664_101060853 Ga0070664_1010608531 156
348 3300005577 Ga0068857_100214729 Ga0068857_1002147292 156
349 3300005577 Ga0068857_100279426 Ga0068857_1002794263 156
350 3300005577 Ga0068857_100604737 Ga0068857_1006047372 156
351 3300005577 Ga0068857_101132655 Ga0068857_1011326552 156
352 3300005577 Ga0068857_101352488 Ga0068857_1013524882 156
353 3300005578 Ga0068854_100249881 Ga0068854_1002498813 156
354 3300005578 Ga0068854_100583027 Ga0068854_1005830272 156
355 3300005614 Ga0068856_100085960 Ga0068856_1000859604 156
356 3300005614 Ga0068856_100381119 Ga0068856_1003811192 156
357 3300005614 Ga0068856_100603986 Ga0068856_1006039861 156
358 3300005614 Ga0068856_101234211 Ga0068856_1012342112 156
359 3300005616 Ga0068852_100051692 Ga0068852_1000516923 156
360 3300005616 Ga0068852_100240316 Ga0068852_1002403161 156
361 3300005616 Ga0068852_100844000 Ga0068852_1008440002 156
362 3300005617 Ga0068859_100721536 Ga0068859_1007215362 156
363 3300005618 Ga0068864_101123519 Ga0068864_1011235192 156
364 3300005718 Ga0068866_10864738 Ga0068866_108647382 156
365 3300005718 Ga0068866_11218860 Ga0068866_112188601 156
366 3300005834 Ga0068851_10055902 Ga0068851_100559024 156
367 3300005841 Ga0068863_100285454 Ga0068863_1002854542 156
368 3300005841 Ga0068863_100304776 Ga0068863_1003047762 156
369 3300005841 Ga0068863_101085821 Ga0068863_1010858212 156
370 3300005842 Ga0068858_100120356 Ga0068858_1001203562 156
371 3300005842 Ga0068858_100707434 Ga0068858_1007074342 156
372 3300005844 Ga0068862_100680894 Ga0068862_1006808942 156
373 3300005983 Ga0081540_1004236 Ga0081540_10042368 156
374 3300005983 Ga0081540_1010774 Ga0081540_10107742 156
375 3300006028 Ga0070717_10000905 Ga0070717_1000090513 156
376 3300006028 Ga0070717_10004417 Ga0070717_100044178 156
377 3300006028 Ga0070717_10678789 Ga0070717_106787892 156
378 3300006038 Ga0075365_10007374 Ga0075365_100073742 156
379 3300006038 Ga0075365_10027847 Ga0075365_100278473 156
380 3300006038 Ga0075365_10031750 Ga0075365_100317502 156
381 3300006038 Ga0075365_10171287 Ga0075365_101712873 156
382 3300006038 Ga0075365_10471560 Ga0075365_104715602 156
383 3300006038 Ga0075365_10543526 Ga0075365_105435262 156
384 3300006042 Ga0075368_10000443 Ga0075368_1000044311 156
385 3300006042 Ga0075368_10007756 Ga0075368_100077562 156
386 3300006048 Ga0075363_100027645 Ga0075363_1000276452 156
387 3300006048 Ga0075363_100094310 Ga0075363_1000943102 156
388 3300006048 Ga0075363_100121681 Ga0075363_1001216813 156
389 3300006048 Ga0075363_100244850 Ga0075363_1002448502 156
390 3300006051 Ga0075364_10058986 Ga0075364_100589862 156
391 3300006051 Ga0075364_10236121 Ga0075364_102361212 156
392 3300006163 Ga0070715_10000111 Ga0070715_1000011117 156
393 3300006163 Ga0070715_10117541 Ga0070715_101175412 156
394 3300006173 Ga0070716_100008083 Ga0070716_1000080837 156
395 3300006173 Ga0070716_100021118 Ga0070716_1000211182 156
396 3300006173 Ga0070716_100023807 Ga0070716_1000238072 156
397 3300006173 Ga0070716_100537428 Ga0070716_1005374282 156
398 3300006173 Ga0070716_100977719 Ga0070716_1009777192 156
399 3300006175 Ga0070712_100109890 Ga0070712_1001098902 156
400 3300006175 Ga0070712_100699536 Ga0070712_1006995361 156
401 3300006175 Ga0070712_100718820 Ga0070712_1007188202 156
402 3300006177 Ga0075362_10022013 Ga0075362_100220133 156
403 3300006177 Ga0075362_10064656 Ga0075362_100646562 156
404 3300006177 Ga0075362_10301813 Ga0075362_103018132 156
405 3300006178 Ga0075367_10010758 Ga0075367_100107582 156
406 3300006178 Ga0075367_10088555 Ga0075367_100885552 156
407 3300006178 Ga0075367_10441545 Ga0075367_104415452 156
408 3300006186 Ga0075369_10002023 Ga0075369_100020234 156
409 3300006186 Ga0075369_10002445 Ga0075369_100024456 156
410 3300006186 Ga0075369_10043109 Ga0075369_100431092 156
411 3300006186 Ga0075369_10046711 Ga0075369_100467114 156
412 3300006186 Ga0075369_10075978 Ga0075369_100759782 156
413 3300006186 Ga0075369_10192580 Ga0075369_101925802 156
414 3300006186 Ga0075369_10249280 Ga0075369_102492802 156
415 3300006195 Ga0075366_10017661 Ga0075366_100176613 156
416 3300006195 Ga0075366_10077932 Ga0075366_100779322 156
417 3300006237 Ga0097621_100234175 Ga0097621_1002341751 156
418 3300006237 Ga0097621_100652607 Ga0097621_1006526072 156
419 3300006353 Ga0075370_10036194 Ga0075370_100361942 156
420 3300006353 Ga0075370_10120412 Ga0075370_101204122 156
421 3300006353 Ga0075370_10162585 Ga0075370_101625852 156
422 3300006353 Ga0075370_10311123 Ga0075370_103111232 156
423 3300006871 Ga0075434_100638582 Ga0075434_1006385822 156
424 3300006881 Ga0068865_101084785 Ga0068865_1010847852 156
425 3300006931 Ga0097620_100721517 Ga0097620_1007215172 156
426 3300006941 Ga0099825_1035906 Ga0099825_10359062 156
427 3300006942 Ga0099824_1010553 Ga0099824_10105537 156
428 3300006944 Ga0099823_1084262 Ga0099823_10842622 156
429 3300009092 Ga0105250_10081413 Ga0105250_100814132 156
430 3300009093 Ga0105240_10006904 Ga0105240_100069043 156
431 3300009093 Ga0105240_10160913 Ga0105240_101609133 156
432 3300009093 Ga0105240_10620792 Ga0105240_106207922 156
433 3300009098 Ga0105245_11254869 Ga0105245_112548692 156
434 3300009101 Ga0105247_10023906 Ga0105247_100239062 156
435 3300009101 Ga0105247_10451341 Ga0105247_104513412 156
436 3300009174 Ga0105241_10054047 Ga0105241_100540476 156
437 3300009174 Ga0105241_10255381 Ga0105241_102553813 156
438 3300009174 Ga0105241_11034345 Ga0105241_110343451 156
439 3300009177 Ga0105248_10179647 Ga0105248_101796473 156
440 3300009545 Ga0105237_10033149 Ga0105237_100331495 156
441 3300009545 Ga0105237_10128536 Ga0105237_101285362 156
442 3300009545 Ga0105237_10164160 Ga0105237_101641602 156
443 3300009551 Ga0105238_10011980 Ga0105238_100119809 156
444 3300009551 Ga0105238_10055394 Ga0105238_100553942 156
445 3300009551 Ga0105238_10234582 Ga0105238_102345822 156
446 3300009551 Ga0105238_10885933 Ga0105238_108859332 156
447 3300009551 Ga0105238_11333419 Ga0105238_113334192 156
448 3300009553 Ga0105249_11013040 Ga0105249_110130402 156
449 3300010375 Ga0105239_10105480 Ga0105239_101054804 156
450 3300010375 Ga0105239_10249481 Ga0105239_102494812 156
451 3300010375 Ga0105239_10669518 Ga0105239_106695182 156
452 3300010375 Ga0105239_10712535 Ga0105239_107125352 156
453 3300010375 Ga0105239_11050970 Ga0105239_110509702 156
454 3300010375 Ga0105239_11208625 Ga0105239_112086252 156
455 3300010375 Ga0105239_11273729 Ga0105239_112737292 156
456 3300010375 Ga0105239_11532657 Ga0105239_115326572 156
457 3300011119 Ga0105246_10003537 Ga0105246_1000353713 156
458 3300011119 Ga0105246_10131288 Ga0105246_101312882 156
459 3300011119 Ga0105246_10712302 Ga0105246_107123022 156
460 3300013100 Ga0157373_10318958 Ga0157373_103189582 156
461 3300013102 Ga0157371_10230752 Ga0157371_102307522 156
462 3300013104 Ga0157370_10479215 Ga0157370_104792152 156
463 3300013104 Ga0157370_10618516 Ga0157370_106185162 156
464 3300013105 Ga0157369_10026776 Ga0157369_100267763 156
465 3300013105 Ga0157369_10066689 Ga0157369_100666891 156
466 3300013105 Ga0157369_10102101 Ga0157369_101021012 156
467 3300013296 Ga0157374_10139860 Ga0157374_101398604 156
468 3300013296 Ga0157374_10203998 Ga0157374_102039982 156
469 3300013296 Ga0157374_10349504 Ga0157374_103495043 156
470 3300013297 Ga0157378_10515208 Ga0157378_105152082 156
471 3300013297 Ga0157378_10877904 Ga0157378_108779042 156
472 3300013307 Ga0157372_10683265 Ga0157372_106832652 156
473 3300013307 Ga0157372_11210464 Ga0157372_112104641 156
474 3300013307 Ga0157372_12020159 Ga0157372_120201592 156
475 3300013308 Ga0157375_10084779 Ga0157375_100847792 156
476 3300013308 Ga0157375_11894807 Ga0157375_118948072 156
477 3300014325 Ga0163163_10000985 Ga0163163_1000098520 156
478 3300014325 Ga0163163_10385552 Ga0163163_103855523 156
479 3300014497 Ga0182008_10339606 Ga0182008_103396062 156
480 3300014745 Ga0157377_10758235 Ga0157377_107582351 156
481 3300014968 Ga0157379_10276398 Ga0157379_102763982 156
482 3300014968 Ga0157379_10448002 Ga0157379_104480022 156
483 3300014968 Ga0157379_10609043 Ga0157379_106090432 156
484 3300014969 Ga0157376_10040370 Ga0157376_100403702 156
485 3300020610 Ga0154015_1294201 Ga0154015_12942011 156
486 3300021320 Ga0214544_1000002 Ga0214544_100000276 156
487 3300021321 Ga0214542_1000001 Ga0214542_1000001426 156
488 3300021324 Ga0214545_1000001 Ga0214545_1000001492 156
489 3300021327 Ga0214543_1000001 Ga0214543_1000001704 156
490 3300021377 Ga0213874_10015808 Ga0213874_100158082 156
491 3300021384 Ga0213876_10004192 Ga0213876_100041924 156
492 3300021384 Ga0213876_10030041 Ga0213876_100300412 156
493 3300021388 Ga0213875_10054161 Ga0213875_100541612 156
494 3300025230 Ga0209563_106889 Ga0209563_1068892 156
495 3300025253 Ga0209677_102534 Ga0209677_1025343 156
496 3300025253 Ga0209677_102699 Ga0209677_1026999 156
497 3300025254 Ga0209148_1000374 Ga0209148_10003743 156
498 3300025261 Ga0209233_1001622 Ga0209233_10016223 156
499 3300025261 Ga0209233_1004832 Ga0209233_10048322 156
500 3300025261 Ga0209233_1005085 Ga0209233_10050857 156
501 3300025272 Ga0209455_1001411 Ga0209455_10014118 156
502 3300025272 Ga0209455_1003883 Ga0209455_10038836 156
503 3300025272 Ga0209455_1007726 Ga0209455_10077262 156
504 3300025273 Ga0209673_1023500 Ga0209673_10235002 156
505 3300025295 Ga0209564_1011932 Ga0209564_10119322 156
506 3300025295 Ga0209564_1012318 Ga0209564_10123182 156
507 3300025297 Ga0209758_1000024 Ga0209758_1000024102 156
508 3300025297 Ga0209758_1000068 Ga0209758_100006857 156
509 3300025297 Ga0209758_1001579 Ga0209758_10015798 156
510 3300025297 Ga0209758_1002091 Ga0209758_100209116 156
511 3300025297 Ga0209758_1022280 Ga0209758_10222806 156
512 3300025297 Ga0209758_1061358 Ga0209758_10613582 156
513 3300025297 Ga0209758_1085525 Ga0209758_10855252 156
514 3300025299 Ga0209256_1008086 Ga0209256_10080862 156
515 3300025299 Ga0209256_1044051 Ga0209256_10440512 156
516 3300025302 Ga0207426_1000238 Ga0207426_10002385 156
517 3300025302 Ga0207426_1000726 Ga0207426_100072626 156
518 3300025302 Ga0207426_1023270 Ga0207426_10232702 156
519 3300025304 Ga0209257_1004927 Ga0209257_10049278 156
520 3300025315 Ga0207697_10104704 Ga0207697_101047042 156
521 3300025321 Ga0207656_10088167 Ga0207656_100881672 156
522 3300025898 Ga0207692_10000175 Ga0207692_100001756 156
523 3300025898 Ga0207692_10009115 Ga0207692_100091155 156
524 3300025898 Ga0207692_10520812 Ga0207692_105208122 156
525 3300025899 Ga0207642_10642159 Ga0207642_106421592 156
526 3300025900 Ga0207710_10014704 Ga0207710_100147042 156
527 3300025900 Ga0207710_10045700 Ga0207710_100457002 156
528 3300025901 Ga0207688_10049337 Ga0207688_100493372 156
529 3300025903 Ga0207680_10118806 Ga0207680_101188064 156
530 3300025904 Ga0207647_10017311 Ga0207647_100173113 156
531 3300025905 Ga0207685_10000929 Ga0207685_100009292 156
532 3300025905 Ga0207685_10053246 Ga0207685_100532463 156
533 3300025906 Ga0207699_10001765 Ga0207699_100017659 156
534 3300025906 Ga0207699_10007395 Ga0207699_100073953 156
535 3300025906 Ga0207699_10551535 Ga0207699_105515352 156
536 3300025906 Ga0207699_10652675 Ga0207699_106526752 156
537 3300025909 Ga0207705_10040079 Ga0207705_100400793 156
538 3300025911 Ga0207654_10006042 Ga0207654_100060422 156
539 3300025911 Ga0207654_10076895 Ga0207654_100768952 156
540 3300025911 Ga0207654_10376771 Ga0207654_103767712 156
541 3300025911 Ga0207654_10550224 Ga0207654_105502242 156
542 3300025911 Ga0207654_10600107 Ga0207654_106001072 156
543 3300025912 Ga0207707_10000950 Ga0207707_1000095016 156
544 3300025912 Ga0207707_10016441 Ga0207707_100164418 156
545 3300025912 Ga0207707_10808533 Ga0207707_108085332 156
546 3300025913 Ga0207695_10000008 Ga0207695_10000008178 156
547 3300025913 Ga0207695_10378658 Ga0207695_103786582 156
548 3300025913 Ga0207695_10562427 Ga0207695_105624272 156
549 3300025914 Ga0207671_10008090 Ga0207671_100080902 156
550 3300025914 Ga0207671_10223291 Ga0207671_102232912 156
551 3300025914 Ga0207671_10579322 Ga0207671_105793222 156
552 3300025914 Ga0207671_10730992 Ga0207671_107309922 156
553 3300025915 Ga0207693_10004043 Ga0207693_100040437 156
554 3300025915 Ga0207693_10041091 Ga0207693_100410914 156
555 3300025915 Ga0207693_10086662 Ga0207693_100866624 156
556 3300025916 Ga0207663_10000098 Ga0207663_100000987 156
557 3300025917 Ga0207660_10048368 Ga0207660_100483684 156
558 3300025917 Ga0207660_10080030 Ga0207660_100800303 156
559 3300025917 Ga0207660_10126458 Ga0207660_101264583 156
560 3300025919 Ga0207657_10098593 Ga0207657_100985933 156
561 3300025919 Ga0207657_10129475 Ga0207657_101294753 156
562 3300025919 Ga0207657_10389938 Ga0207657_103899382 156
563 3300025919 Ga0207657_10414033 Ga0207657_104140332 156
564 3300025920 Ga0207649_10113640 Ga0207649_101136402 156
565 3300025921 Ga0207652_10069917 Ga0207652_100699173 156
566 3300025921 Ga0207652_10403559 Ga0207652_104035592 156
567 3300025924 Ga0207694_10170993 Ga0207694_101709932 156
568 3300025924 Ga0207694_10531547 Ga0207694_105315472 156
569 3300025924 Ga0207694_10608083 Ga0207694_106080832 156
570 3300025924 Ga0207694_10694587 Ga0207694_106945872 156
571 3300025925 Ga0207650_10334566 Ga0207650_103345662 156
572 3300025927 Ga0207687_10531731 Ga0207687_105317312 156
573 3300025927 Ga0207687_10544863 Ga0207687_105448632 156
574 3300025928 Ga0207700_10001663 Ga0207700_1000166311 156
575 3300025928 Ga0207700_10188064 Ga0207700_101880641 156
576 3300025928 Ga0207700_10774064 Ga0207700_107740642 156
577 3300025929 Ga0207664_10007161 Ga0207664_100071617 156
578 3300025929 Ga0207664_10066454 Ga0207664_100664542 156
579 3300025929 Ga0207664_10297754 Ga0207664_102977543 156
580 3300025929 Ga0207664_10776891 Ga0207664_107768912 156
581 3300025931 Ga0207644_10189698 Ga0207644_101896982 156
582 3300025932 Ga0207690_10623132 Ga0207690_106231322 156
583 3300025933 Ga0207706_10037062 Ga0207706_100370622 156
584 3300025933 Ga0207706_10833667 Ga0207706_108336672 156
585 3300025935 Ga0207709_10089618 Ga0207709_100896183 156
586 3300025936 Ga0207670_10115890 Ga0207670_101158903 156
587 3300025939 Ga0207665_10000355 Ga0207665_100003559 156
588 3300025939 Ga0207665_10003937 Ga0207665_100039379 156
589 3300025941 Ga0207711_10809945 Ga0207711_108099452 156
590 3300025944 Ga0207661_10008365 Ga0207661_100083655 156
591 3300025944 Ga0207661_10082671 Ga0207661_100826714 156
592 3300025945 Ga0207679_10375144 Ga0207679_103751442 156
593 3300025945 Ga0207679_10668334 Ga0207679_106683342 156
594 3300025949 Ga0207667_10112404 Ga0207667_101124043 156
595 3300025949 Ga0207667_10189050 Ga0207667_101890503 156
596 3300025949 Ga0207667_10384559 Ga0207667_103845592 156
597 3300025949 Ga0207667_11115977 Ga0207667_111159772 156
598 3300025949 Ga0207667_11436601 Ga0207667_114366012 156
599 3300025960 Ga0207651_10320626 Ga0207651_103206261 156
600 3300025961 Ga0207712_11039742 Ga0207712_110397422 156
601 3300025972 Ga0207668_10494164 Ga0207668_104941642 156
602 3300025972 Ga0207668_10563470 Ga0207668_105634702 156
603 3300025981 Ga0207640_10177712 Ga0207640_101777122 156
604 3300025986 Ga0207658_10277395 Ga0207658_102773952 156
605 3300026023 Ga0207677_10830286 Ga0207677_108302861 156
606 3300026035 Ga0207703_10165258 Ga0207703_101652584 156
607 3300026035 Ga0207703_10895296 Ga0207703_108952962 156
608 3300026035 Ga0207703_10922455 Ga0207703_109224552 156
609 3300026041 Ga0207639_10119500 Ga0207639_101195003 156
610 3300026041 Ga0207639_10304947 Ga0207639_103049472 156
611 3300026041 Ga0207639_10450095 Ga0207639_104500952 156
612 3300026041 Ga0207639_10466450 Ga0207639_104664502 156
613 3300026067 Ga0207678_10008230 Ga0207678_100082306 156
614 3300026067 Ga0207678_10030531 Ga0207678_100305315 156
615 3300026067 Ga0207678_10069576 Ga0207678_100695762 156
616 3300026067 Ga0207678_10164813 Ga0207678_101648132 156
617 3300026067 Ga0207678_10296238 Ga0207678_102962382 156
618 3300026067 Ga0207678_11045404 Ga0207678_110454042 156
619 3300026078 Ga0207702_10112461 Ga0207702_101124613 156
620 3300026078 Ga0207702_10231068 Ga0207702_102310683 156
621 3300026078 Ga0207702_10391799 Ga0207702_103917993 156
622 3300026078 Ga0207702_10396802 Ga0207702_103968022 156
623 3300026078 Ga0207702_10432069 Ga0207702_104320692 156
624 3300026078 Ga0207702_11285846 Ga0207702_112858462 156
625 3300026088 Ga0207641_10536148 Ga0207641_105361482 156
626 3300026088 Ga0207641_10680434 Ga0207641_106804342 156
627 3300026088 Ga0207641_10965119 Ga0207641_109651192 156
628 3300026089 Ga0207648_10318416 Ga0207648_103184162 156
629 3300026095 Ga0207676_10154911 Ga0207676_101549112 156
630 3300026095 Ga0207676_10758060 Ga0207676_107580602 156
631 3300026116 Ga0207674_10088216 Ga0207674_100882165 156
632 3300026116 Ga0207674_10117044 Ga0207674_101170442 156
633 3300026118 Ga0207675_100982365 Ga0207675_1009823652 156
634 3300026142 Ga0207698_10042438 Ga0207698_100424382 156
635 3300026142 Ga0207698_10056264 Ga0207698_100562643 156
636 3300026142 Ga0207698_10352731 Ga0207698_103527312 156
637 3300027296 Ga0209389_1000107 Ga0209389_100010746 156
638 3300027296 Ga0209389_1005934 Ga0209389_10059344 156
639 3300027357 Ga0209589_1000092 Ga0209589_10000928 156
640 3300027361 Ga0209489_100006 Ga0209489_100006465 156
641 3300027361 Ga0209489_107740 Ga0209489_1077408 156
642 3300027363 Ga0209700_100005 Ga0209700_100005333 156
643 3300027866 Ga0209813_10005581 Ga0209813_100055811 156
644 3300027866 Ga0209813_10087381 Ga0209813_100873813 156
645 3300028379 Ga0268266_10179065 Ga0268266_101790652 156
646 3300028379 Ga0268266_10212574 Ga0268266_102125742 156
647 3300028379 Ga0268266_10243666 Ga0268266_102436662 156
648 3300028379 Ga0268266_10970652 Ga0268266_109706522 156
649 3300028380 Ga0268265_10080719 Ga0268265_100807193 156
650 3300028381 Ga0268264_10000065 Ga0268264_10000065167 156
651 3300028556 Ga0265337_1002468 Ga0265337_10024687 156
652 3300028558 Ga0265326_10003263 Ga0265326_100032635 156
653 3300028563 Ga0265319_1007768 Ga0265319_10077684 156
654 3300028573 Ga0265334_10000456 Ga0265334_100004568 156
655 3300028653 Ga0265323_10000424 Ga0265323_1000042416 156
656 3300028654 Ga0265322_10005214 Ga0265322_100052141 156
657 3300028794 Ga0307515_10074714 Ga0307515_100747147 156
658 3300028800 Ga0265338_10000321 Ga0265338_1000032145 156
659 3300029957 Ga0265324_10023377 Ga0265324_100233773 156
660 3300031235 Ga0265330_10101988 Ga0265330_101019883 156
661 3300031235 Ga0265330_10147547 Ga0265330_101475472 156
662 3300031240 Ga0265320_10186503 Ga0265320_101865032 156
663 3300031247 Ga0265340_10068526 Ga0265340_100685263 156
664 3300031249 Ga0265339_10045369 Ga0265339_100453692 156
665 3300031250 Ga0265331_10261854 Ga0265331_102618541 156
666 3300031507 Ga0307509_10217624 Ga0307509_102176242 156
667 3300031548 Ga0307408_100814022 Ga0307408_1008140222 156
668 3300031616 Ga0307508_10039062 Ga0307508_100390623 156
669 3300031711 Ga0265314_10019799 Ga0265314_100197994 156
670 3300031712 Ga0265342_10007904 Ga0265342_100079048 156
671 3300031712 Ga0265342_10212989 Ga0265342_102129892 156
672 3300033179 Ga0307507_10018406 Ga0307507_100184062 156
673 3300033180 Ga0307510_10019136 Ga0307510_100191363 156
674 3300033180 Ga0307510_10156655 Ga0307510_101566553 156
675 3300033544 Ga0316215_1006801 Ga0316215_10068012 156
676 3300033545 Ga0316214_1006677 Ga0316214_10066772 156
677 3300035111 Ga0373923_0031055 Ga0373923_0031055_919_1389 156
678 3300035113 Ga0373936_0039776 Ga0373936_0039776_891_1361 156
679 3300035113 Ga0373936_0042475 Ga0373936_0042475_1115_1585 156
680 3300035117 Ga0373953_0098249 Ga0373953_0098249_267_737 156
681 3300035118 Ga0373954_0052970 Ga0373954_0052970_947_1420 156
682 3300035119 Ga0373956_0026015 Ga0373956_0026015_507_977 156
683 3300035121 Ga0373960_0063783 Ga0373960_0063783_572_1042 156
684 3300035170 Ga0373943_0028281 Ga0373943_0028281_1510_1980 156
685 3300035170 Ga0373943_0071314 Ga0373943_0071314_45_515 156
686 3300035171 Ga0373946_0346807 Ga0373946_0346807_53_523 156
687 3300035172 Ga0373955_0007905 Ga0373955_0007905_929_1399 156
688 3300035691 Ga0373931_0322617 Ga0373931_0322617_187_657 156
689 3300035692 Ga0373935_0071239 Ga0373935_0071239_1194_1664 156
690 3300035692 Ga0373935_0267902 Ga0373935_0267902_226_696 156
691 3300035695 Ga0373927_0010043 Ga0373927_0010043_1596_2066 156
692 3300035695 Ga0373927_0232406 Ga0373927_0232406_177_647 156
693 3300035724 Ga0373933_0000199 Ga0373933_0000199_23390_23860 156
694 3300035724 Ga0373933_0017531 Ga0373933_0017531_2554_3024 156
695 3300035725 Ga0373947_0391755 Ga0373947_0391755_192_662 156
696 3300036401 Ga0373937_0008799 Ga0373937_0008799_3205_3678 156
697 3300036401 Ga0373937_0063198 Ga0373937_0063198_886_1356 156
698 3300036401 Ga0373937_0456722 Ga0373937_0456722_595_1068 156
699 3300037068 Ga0373925_0029517 Ga0373925_0029517_2221_2691 156
700 3300037068 Ga0373925_0084180 Ga0373925_0084180_1024_1494 156
701 3300037068 Ga0373925_0131969 Ga0373925_0131969_123_593 156
702 3300037312 Ga0395899_0379679 Ga0395899_0379679_344_814 156
703 3300037418 Ga0395900_0000820 Ga0395900_0000820_1128_1598 156
704 3300037418 Ga0395900_0563087 Ga0395900_0563087_438_908 156
705 3300037466 Ga0395898_0039019 Ga0395898_0039019_638_1108 156
706 3300037466 Ga0395898_0441886 Ga0395898_0441886_238_708 156
707 3300037471 Ga0395905_0006498 Ga0395905_0006498_6629_7099 156
708 3300037471 Ga0395905_0027848 Ga0395905_0027848_3102_3572 156
709 3300037471 Ga0395905_0151862 Ga0395905_0151862_335_805 156
710 3300037471 Ga0395905_0450739 Ga0395905_0450739_684_1154 156
711 3300037853 Ga0436364_0230953 Ga0436364_0230953_59_529 156
712 3300037853 Ga0436364_1074811 Ga0436364_1074811_328_798 156
713 3300038443 Ga0395901_0081268 Ga0395901_0081268_2765_3235 156
714 3300038443 Ga0395901_0313828 Ga0395901_0313828_334_804 156
715 3300039437 Ga0436365_0535048 Ga0436365_0535048_322_792 156
716 3300039437 Ga0436365_0536419 Ga0436365_0536419_297_767 156
717 3300039437 Ga0436365_0570459 Ga0436365_0570459_1656_2126 156
718 3300039437 Ga0436365_1576869 Ga0436365_1576869_187_657 156
719 3300039438 Ga0436360_0264935 Ga0436360_0264935_216_686 156
720 3300039447 Ga0436361_0983536 Ga0436361_0983536_132_602 156
721 3300039447 Ga0436361_1032582 Ga0436361_1032582_96_566 156
722 3300039450 Ga0436363_0484248 Ga0436363_0484248_128_607 156
723 3300039450 Ga0436363_0929560 Ga0436363_0929560_29_499 156
724 3300039453 Ga0436362_1093918 Ga0436362_1093918_654_1124 156
725 3300041441 Ga0451787_188948 Ga0451787_188948_183_653 156
726 3300041443 Ga0451789_1360976 Ga0451789_1360976_71_541 156
727 3300041452 Ga0451793_1099887 Ga0451793_1099887_426_896 156
728 3300041453 Ga0451797_0340083 Ga0451797_0340083_620_1090 156
729 3300041456 Ga0451795_1217617 Ga0451795_1217617_285_755 156
730 3300041460 Ga0451802_0763160 Ga0451802_0763160_170_640 156
731 3300041486 Ga0451807_1079633 Ga0451807_1079633_54_524 156
732 3300041491 Ga0451833_0328009 Ga0451833_0328009_418_888 156
733 3300041492 Ga0451835_0292434 Ga0451835_0292434_10_480 156
734 3300041498 Ga0451841_0463910 Ga0451841_0463910_92_562 156
735 3300041505 Ga0451849_0093937 Ga0451849_0093937_260_730 156
736 3300041509 Ga0451843_0540096 Ga0451843_0540096_155_625 156
737 3300041511 Ga0451855_1276054 Ga0451855_1276054_34_504 156
738 3300041512 Ga0451853_1099499 Ga0451853_1099499_104_574 156
739 3300042012 Ga0439455_0164454 Ga0439455_0164454_140_610 156
740 3300044658 Ga0466972_0000846 Ga0466972_0000846_11433_11903 156
741 3300044658 Ga0466972_0036013 Ga0466972_0036013_1454_1924 156
742 3300044658 Ga0466972_0205479 Ga0466972_0205479_262_732 156
743 3300044683 Ga0466965_0229024 Ga0466965_0229024_174_644 156
744 3300044683 Ga0466965_0275521 Ga0466965_0275521_263_733 156
745 3300044684 Ga0466966_0000334 Ga0466966_0000334_11120_11590 156
746 3300044684 Ga0466966_0477135 Ga0466966_0477135_188_658 156
747 3300044693 Ga0466961_0000509 Ga0466961_0000509_4648_5118 156
748 3300044693 Ga0466961_0278834 Ga0466961_0278834_414_884 156
749 3300044693 Ga0466961_0281834 Ga0466961_0281834_459_929 156
750 3300044693 Ga0466961_0371180 Ga0466961_0371180_201_671 156
751 3300044694 Ga0466963_0021037 Ga0466963_0021037_1520_1990 156
752 3300044706 Ga0466964_0020638 Ga0466964_0020638_705_1175 156
753 3300044706 Ga0466964_0564134 Ga0466964_0564134_28_498 156
754 3300044719 Ga0466971_0333011 Ga0466971_0333011_162_632 156
755 3300044735 Ga0466968_0276803 Ga0466968_0276803_183_653 156
756 3300044765 Ga0466970_0212676 Ga0466970_0212676_339_809 156
757 3300044765 Ga0466970_0359153 Ga0466970_0359153_201_671 156
758 3300044765 Ga0466970_0543013 Ga0466970_0543013_11_481 156
759 3300044842 Ga0466957_0071535 Ga0466957_0071535_72_542 156
760 3300044842 Ga0466957_0156280 Ga0466957_0156280_371_841 156
761 3300044842 Ga0466957_0273217 Ga0466957_0273217_261_731 156
762 3300044901 Ga0466960_0011942 Ga0466960_0011942_447_917 156
763 3300044901 Ga0466960_0321481 Ga0466960_0321481_237_707 156
764 3300045049 Ga0466959_0058586 Ga0466959_0058586_1677_2150 156
765 3300045049 Ga0466959_0108199 Ga0466959_0108199_374_844 156
766 3300045049 Ga0466959_0730111 Ga0466959_0730111_25_495 156
767 3300045836 Ga0466958_0058680 Ga0466958_0058680_1475_1945 156
768 3300045836 Ga0466958_0083330 Ga0466958_0083330_756_1226 156
769 3300045836 Ga0466958_0680507 Ga0466958_0680507_93_566 156
770 3300045976 Ga0466967_0009054 Ga0466967_0009054_4210_4680 156
771 3300045976 Ga0466967_0183712 Ga0466967_0183712_1167_1637 156
772 3300045976 Ga0466967_0709738 Ga0466967_0709738_347_820 156
773 3300045976 Ga0466967_1026645 Ga0466967_1026645_82_552 156
774 3300045976 Ga0466967_1685899 Ga0466967_1685899_117_587 156
775 3300046454 Ga0495592_0021156 Ga0495592_0021156_1567_2037 156
776 3300046454 Ga0495592_0162252 Ga0495592_0162252_285_755 156
777 3300046455 Ga0495603_0240395 Ga0495603_0240395_216_686 156
778 3300046459 Ga0495629_0027278 Ga0495629_0027278_667_1137 156
779 3300046459 Ga0495629_0050041 Ga0495629_0050041_1456_1926 156
780 3300046460 Ga0495638_0031076 Ga0495638_0031076_1913_2383 156
781 3300046461 Ga0495641_0342136 Ga0495641_0342136_132_605 156
782 3300046462 Ga0495651_0001733 Ga0495651_0001733_9812_10282 156
783 3300046462 Ga0495651_0096032 Ga0495651_0096032_839_1309 156
784 3300046471 Ga0495650_0077872 Ga0495650_0077872_85_555 156
785 3300046471 Ga0495650_0130214 Ga0495650_0130214_90_560 156
786 3300046472 Ga0495580_0007795 Ga0495580_0007795_3582_4052 156
787 3300046473 Ga0495582_0004536 Ga0495582_0004536_3086_3556 156
788 3300046473 Ga0495582_0219308 Ga0495582_0219308_84_554 156
789 3300046474 Ga0495605_0035330 Ga0495605_0035330_56_526 156
790 3300046474 Ga0495605_0062745 Ga0495605_0062745_139_612 156
791 3300046474 Ga0495605_0217783 Ga0495605_0217783_29_499 156
792 3300046475 Ga0495639_0014908 Ga0495639_0014908_2025_2495 156
793 3300046475 Ga0495639_0043424 Ga0495639_0043424_1329_1802 156
794 3300046476 Ga0495662_0064517 Ga0495662_0064517_1209_1679 156
795 3300046476 Ga0495662_0071248 Ga0495662_0071248_595_1065 156
796 3300046477 Ga0495664_0001939 Ga0495664_0001939_4306_4776 156
797 3300046477 Ga0495664_0012734 Ga0495664_0012734_98_568 156
798 3300046491 Ga0495584_0048416 Ga0495584_0048416_1398_1868 156
799 3300046499 Ga0495594_0002231 Ga0495594_0002231_6343_6816 156
800 3300046499 Ga0495594_0407125 Ga0495594_0407125_219_689 156
801 3300046500 Ga0495596_0149066 Ga0495596_0149066_243_713 156
802 3300046501 Ga0495607_0035552 Ga0495607_0035552_1309_1782 156
803 3300046501 Ga0495607_0192791 Ga0495607_0192791_108_578 156
804 3300046507 Ga0495606_0137286 Ga0495606_0137286_898_1368 156
805 3300046507 Ga0495606_0231032 Ga0495606_0231032_296_766 156
806 3300046511 Ga0495608_0005911 Ga0495608_0005911_6865_7335 156
807 3300046511 Ga0495608_0479481 Ga0495608_0479481_225_695 156
808 3300046512 Ga0495610_0031675 Ga0495610_0031675_1491_1961 156
809 3300046513 Ga0495616_0033183 Ga0495616_0033183_2015_2485 156
810 3300046513 Ga0495616_0035701 Ga0495616_0035701_1808_2278 156
811 3300046513 Ga0495616_0066680 Ga0495616_0066680_1014_1484 156
812 3300046513 Ga0495616_0141581 Ga0495616_0141581_560_1033 156
813 3300046514 Ga0495618_0129607 Ga0495618_0129607_845_1315 156
814 3300046514 Ga0495618_0368820 Ga0495618_0368820_198_668 156
815 3300046514 Ga0495618_0503870 Ga0495618_0503870_183_653 156
816 3300046515 Ga0495620_0217150 Ga0495620_0217150_188_658 156
817 3300046515 Ga0495620_0232967 Ga0495620_0232967_183_653 156
818 3300046516 Ga0495628_0018357 Ga0495628_0018357_3100_3570 156
819 3300046516 Ga0495628_0038168 Ga0495628_0038168_649_1119 156
820 3300046518 Ga0495631_0173506 Ga0495631_0173506_186_656 156
821 3300046519 Ga0495632_0484871 Ga0495632_0484871_15_485 156
822 3300046522 Ga0495643_0064424 Ga0495643_0064424_42_512 156
823 3300046522 Ga0495643_0087741 Ga0495643_0087741_850_1320 156
824 3300046522 Ga0495643_0206118 Ga0495643_0206118_327_800 156
825 3300046522 Ga0495643_0278586 Ga0495643_0278586_218_688 156
826 3300046524 Ga0495648_0041061 Ga0495648_0041061_2107_2580 156
827 3300046524 Ga0495648_0130138 Ga0495648_0130138_325_795 156
828 3300046524 Ga0495648_0173142 Ga0495648_0173142_116_586 156
829 3300046524 Ga0495648_0224983 Ga0495648_0224983_392_865 156
830 3300046524 Ga0495648_0250849 Ga0495648_0250849_362_832 156
831 3300046524 Ga0495648_0311671 Ga0495648_0311671_130_600 156
832 3300046526 Ga0495666_0178959 Ga0495666_0178959_99_569 156
833 3300046529 Ga0495652_0030271 Ga0495652_0030271_2678_3148 156
834 3300046529 Ga0495652_0137427 Ga0495652_0137427_893_1363 156
835 3300046529 Ga0495652_0359133 Ga0495652_0359133_334_804 156
836 3300046530 Ga0495654_0023964 Ga0495654_0023964_1812_2285 156
837 3300046530 Ga0495654_0134517 Ga0495654_0134517_303_773 156
838 3300046533 Ga0495640_0084420 Ga0495640_0084420_1614_2084 156
839 3300046533 Ga0495640_0091149 Ga0495640_0091149_720_1190 156
840 3300046535 Ga0495586_0069902 Ga0495586_0069902_873_1343 156
841 3300046535 Ga0495586_0408346 Ga0495586_0408346_248_721 156
842 3300046536 Ga0495587_0008847 Ga0495587_0008847_5162_5632 156
843 3300046538 Ga0495609_0081646 Ga0495609_0081646_284_754 156
844 3300046538 Ga0495609_0375318 Ga0495609_0375318_70_540 156
845 3300046542 Ga0495597_0134085 Ga0495597_0134085_327_797 156
846 3300046543 Ga0495645_0047214 Ga0495645_0047214_2161_2631 156
847 3300046557 Ga0495622_0017010 Ga0495622_0017010_2443_2913 156
848 3300046557 Ga0495622_0028730 Ga0495622_0028730_299_769 156
849 3300046559 Ga0495667_0003089 Ga0495667_0003089_10118_10588 156
850 3300046559 Ga0495667_0108754 Ga0495667_0108754_699_1169 156
851 3300046616 Ga0495668_0256547 Ga0495668_0256547_378_848 156
852 3300046642 Ga0495634_0069997 Ga0495634_0069997_637_1107 156
853 3300046642 Ga0495634_0143040 Ga0495634_0143040_972_1442 156
854 3300046642 Ga0495634_0143086 Ga0495634_0143086_907_1377 156
855 3300046642 Ga0495634_0196457 Ga0495634_0196457_210_680 156
856 3300046648 Ga0495611_0152894 Ga0495611_0152894_440_910 156
857 3300046660 Ga0495625_0156639 Ga0495625_0156639_566_1036 156
858 3300046660 Ga0495625_0166279 Ga0495625_0166279_779_1252 156
859 3300046660 Ga0495625_0205232 Ga0495625_0205232_531_1001 156
860 3300046660 Ga0495625_0222951 Ga0495625_0222951_645_1115 156
861 3300046663 Ga0495635_0021808 Ga0495635_0021808_1727_2197 156
862 3300046663 Ga0495635_0154829 Ga0495635_0154829_985_1455 156
863 3300046665 Ga0495661_0257843 Ga0495661_0257843_73_543 156
864 3300046674 Ga0495588_0461114 Ga0495588_0461114_33_503 156
865 3300046675 Ga0495657_0007669 Ga0495657_0007669_5342_5812 156
866 3300046675 Ga0495657_0033170 Ga0495657_0033170_212_682 156
867 3300046678 Ga0495599_0078614 Ga0495599_0078614_190_660 156
868 3300046678 Ga0495599_0163976 Ga0495599_0163976_634_1104 156
869 3300046680 Ga0495646_0230386 Ga0495646_0230386_369_839 156
870 3300046681 Ga0495647_0058570 Ga0495647_0058570_1010_1480 156
871 3300046681 Ga0495647_0482278 Ga0495647_0482278_61_531 156
872 3300046683 Ga0495658_0024230 Ga0495658_0024230_1415_1885 156
873 3300046683 Ga0495658_0168604 Ga0495658_0168604_440_910 156
874 3300046684 Ga0495669_0081234 Ga0495669_0081234_70_540 156
875 3300046689 Ga0495613_0072125 Ga0495613_0072125_1826_2296 156
876 3300046689 Ga0495613_0081969 Ga0495613_0081969_969_1439 156
877 3300046690 Ga0495624_0024439 Ga0495624_0024439_3431_3901 156
878 3300046690 Ga0495624_0141336 Ga0495624_0141336_219_689 156
879 3300046691 Ga0495670_0000963 Ga0495670_0000963_7965_8438 156
880 3300046694 Ga0495649_0010905 Ga0495649_0010905_4533_5003 156
881 3300046694 Ga0495649_0063489 Ga0495649_0063489_1200_1670 156
882 3300046694 Ga0495649_0144488 Ga0495649_0144488_711_1181 156
883 3300046794 Ga0495589_0258343 Ga0495589_0258343_237_707 156
884 3300046809 Ga0495600_0035115 Ga0495600_0035115_536_1006 156
885 3300046809 Ga0495600_0372738 Ga0495600_0372738_225_695 156
886 3300047315 Ga0495581_0014251 Ga0495581_0014251_692_1162 156
887 3300047317 Ga0495604_0007727 Ga0495604_0007727_238_708 156
888 3300047317 Ga0495604_0075510 Ga0495604_0075510_1830_2300 156
889 3300047317 Ga0495604_0115082 Ga0495604_0115082_649_1119 156
890 3300047317 Ga0495604_0260480 Ga0495604_0260480_546_1016 156
891 3300047319 Ga0495674_0006216 Ga0495674_0006216_2150_2620 156
892 3300047319 Ga0495674_0029090 Ga0495674_0029090_3891_4361 156
893 3300047320 Ga0495672_0283249 Ga0495672_0283249_303_773 156
894 3300047321 Ga0495676_0099349 Ga0495676_0099349_346_816 156
895 3300047322 Ga0495680_0032133 Ga0495680_0032133_2101_2571 156
896 3300047323 Ga0495683_0182534 Ga0495683_0182534_151_621 156
897 3300047443 Ga0495687_023857 Ga0495687_023857_2072_2542 156
898 3300047443 Ga0495687_044794 Ga0495687_044794_157_627 156
899 3300047444 Ga0495675_0009070 Ga0495675_0009070_2455_2925 156
900 3300047469 Ga0495673_0031757 Ga0495673_0031757_270_740 156
901 3300047471 Ga0495684_0023878 Ga0495684_0023878_3675_4145 156
902 3300047471 Ga0495684_0035401 Ga0495684_0035401_2957_3427 156
903 3300047472 Ga0495686_0508466 Ga0495686_0508466_68_538 156
904 3300047673 Ga0495593_0035519 Ga0495593_0035519_738_1208 156
905 3300047673 Ga0495593_0161835 Ga0495593_0161835_296_766 156
906 3300048088 Ga0495602_0022455 Ga0495602_0022455_1096_1566 156
907 3300048088 Ga0495602_0458621 Ga0495602_0458621_47_517 156
908 3300048903 Ga0496100_0017591 Ga0496100_0017591_141_611 156
909 3300048903 Ga0496100_0132409 Ga0496100_0132409_577_1050 156
910 3300048904 Ga0496101_0021665 Ga0496101_0021665_3732_4202 156
911 3300048904 Ga0496101_0159109 Ga0496101_0159109_208_681 156
912 3300048904 Ga0496101_0321438 Ga0496101_0321438_290_760 156
913 3300048905 Ga0496102_0009634 Ga0496102_0009634_737_1210 156
914 3300048905 Ga0496102_0054915 Ga0496102_0054915_2452_2922 156
915 3300048905 Ga0496102_0463231 Ga0496102_0463231_358_828 156
916 3300048905 Ga0496102_0510546 Ga0496102_0510546_613_1083 156
917 3300048905 Ga0496102_0622066 Ga0496102_0622066_82_555 156
918 3300048905 Ga0496102_0839847 Ga0496102_0839847_46_516 156
919 3300048906 Ga0496103_0036608 Ga0496103_0036608_206_676 156
920 3300048906 Ga0496103_0619979 Ga0496103_0619979_70_540 156
921 3300048907 Ga0496104_0004574 Ga0496104_0004574_9248_9721 156
922 3300048907 Ga0496104_0073288 Ga0496104_0073288_2108_2578 156
923 3300048907 Ga0496104_0195029 Ga0496104_0195029_30_500 156
924 3300048907 Ga0496104_0201495 Ga0496104_0201495_295_765 156
925 3300048907 Ga0496104_0473070 Ga0496104_0473070_113_583 156
926 3300048907 Ga0496104_1257294 Ga0496104_1257294_127_597 156
927 3300048908 Ga0496105_0000527 Ga0496105_0000527_24425_24895 156
928 3300048908 Ga0496105_0056097 Ga0496105_0056097_170_640 156
929 3300048909 Ga0496106_0002824 Ga0496106_0002824_3092_3562 156
930 3300048909 Ga0496106_0027981 Ga0496106_0027981_3560_4033 156
931 3300048909 Ga0496106_0091608 Ga0496106_0091608_428_898 156
932 3300048910 Ga0496107_0010480 Ga0496107_0010480_3251_3721 156
933 3300048910 Ga0496107_0028033 Ga0496107_0028033_2876_3349 156
934 3300048910 Ga0496107_0106734 Ga0496107_0106734_26_496 156
935 3300048910 Ga0496107_0247615 Ga0496107_0247615_267_737 156
936 3300048910 Ga0496107_0933363 Ga0496107_0933363_51_524 156
937 3300048911 Ga0496108_0018136 Ga0496108_0018136_2316_2789 156
938 3300048911 Ga0496108_0025756 Ga0496108_0025756_3814_4284 156
939 3300048911 Ga0496108_0953846 Ga0496108_0953846_75_545 156
940 3300048912 Ga0496109_0020859 Ga0496109_0020859_3584_4057 156
941 3300048912 Ga0496109_0161976 Ga0496109_0161976_1295_1765 156
942 3300048912 Ga0496109_0216354 Ga0496109_0216354_1300_1770 156
943 3300048912 Ga0496109_0403711 Ga0496109_0403711_469_939 156
944 3300048912 Ga0496109_0823658 Ga0496109_0823658_278_751 156
945 3300048913 Ga0496110_0027155 Ga0496110_0027155_1885_2358 156
946 3300048913 Ga0496110_0030187 Ga0496110_0030187_3686_4156 156
947 3300048913 Ga0496110_0072319 Ga0496110_0072319_1732_2202 156
948 3300048913 Ga0496110_0074314 Ga0496110_0074314_267_737 156
949 3300048913 Ga0496110_0302670 Ga0496110_0302670_280_753 156
950 3300048913 Ga0496110_1113010 Ga0496110_1113010_41_514 156
951 3300048914 Ga0496111_0060998 Ga0496111_0060998_1342_1815 156
952 3300048914 Ga0496111_0190209 Ga0496111_0190209_901_1371 156
953 3300048914 Ga0496111_0715809 Ga0496111_0715809_243_713 156
954 3300048915 Ga0496112_0006413 Ga0496112_0006413_6862_7335 156
955 3300048915 Ga0496112_0010513 Ga0496112_0010513_5515_5988 156
956 3300048915 Ga0496112_0429514 Ga0496112_0429514_279_749 156
957 3300048915 Ga0496112_0546289 Ga0496112_0546289_170_640 156
958 3300048915 Ga0496112_0584857 Ga0496112_0584857_563_1033 156
959 3300048916 Ga0496113_0179827 Ga0496113_0179827_681_1151 156
960 3300048916 Ga0496113_0229390 Ga0496113_0229390_537_1007 156
961 3300048916 Ga0496113_0283774 Ga0496113_0283774_96_566 156
962 3300048916 Ga0496113_0325478 Ga0496113_0325478_460_930 156
963 3300048916 Ga0496113_0459128 Ga0496113_0459128_225_698 156
964 3300048916 Ga0496113_0886396 Ga0496113_0886396_156_629 156
965 3300048917 Ga0496114_0017928 Ga0496114_0017928_1670_2140 156
966 3300048917 Ga0496114_0123124 Ga0496114_0123124_379_849 156
967 3300048917 Ga0496114_0225208 Ga0496114_0225208_172_645 156
968 3300048917 Ga0496114_1402618 Ga0496114_1402618_53_523 156
969 3300048918 Ga0496115_0106316 Ga0496115_0106316_148_621 156
970 3300048918 Ga0496115_0242179 Ga0496115_0242179_1003_1473 156
971 3300048918 Ga0496115_0246134 Ga0496115_0246134_781_1251 156
972 3300048918 Ga0496115_0489962 Ga0496115_0489962_202_672 156
973 3300048918 Ga0496115_0680535 Ga0496115_0680535_58_528 156
974 3300048919 Ga0496116_0012377 Ga0496116_0012377_1659_2132 156
975 3300048919 Ga0496116_0043539 Ga0496116_0043539_371_841 156
976 3300048919 Ga0496116_0258800 Ga0496116_0258800_63_533 156
977 3300048920 Ga0496117_0016115 Ga0496117_0016115_1248_1721 156
978 3300048920 Ga0496117_0052465 Ga0496117_0052465_1051_1521 156
979 3300048920 Ga0496117_0061321 Ga0496117_0061321_304_774 156
980 3300048920 Ga0496117_0062047 Ga0496117_0062047_463_936 156
981 3300048921 Ga0496118_0004964 Ga0496118_0004964_5525_5995 156
982 3300048921 Ga0496118_0013461 Ga0496118_0013461_1262_1735 156
983 3300048921 Ga0496118_0087024 Ga0496118_0087024_472_942 156
984 3300048921 Ga0496118_0110460 Ga0496118_0110460_447_917 156
985 3300048921 Ga0496118_0201462 Ga0496118_0201462_293_763 156
986 3300048921 Ga0496118_0261767 Ga0496118_0261767_326_796 156
987 3300048921 Ga0496118_0363162 Ga0496118_0363162_136_606 156
988 3300048922 Ga0496119_0029287 Ga0496119_0029287_1136_1606 156
989 3300048922 Ga0496119_0044910 Ga0496119_0044910_193_663 156
990 3300048922 Ga0496119_0048849 Ga0496119_0048849_2086_2559 156
991 3300048922 Ga0496119_0163830 Ga0496119_0163830_295_765 156
992 3300048923 Ga0496120_0008444 Ga0496120_0008444_5466_5936 156
993 3300048923 Ga0496120_0043583 Ga0496120_0043583_61_534 156
994 3300048923 Ga0496120_0166746 Ga0496120_0166746_476_946 156
995 3300048924 Ga0496121_0002820 Ga0496121_0002820_6152_6622 156
996 3300048924 Ga0496121_0017933 Ga0496121_0017933_4189_4659 156
997 3300048924 Ga0496121_0019022 Ga0496121_0019022_4609_5079 156
998 3300048924 Ga0496121_0057037 Ga0496121_0057037_2226_2699 156
999 3300048924 Ga0496121_0082556 Ga0496121_0082556_123_593 156
1000 3300048924 Ga0496121_0117993 Ga0496121_0117993_1458_1928 156
1001 3300048924 Ga0496121_0185608 Ga0496121_0185608_887_1357 156
1002 3300048924 Ga0496121_0339179 Ga0496121_0339179_302_772 156
1003 3300048924 Ga0496121_0478822 Ga0496121_0478822_297_767 156
1004 3300048924 Ga0496121_0697313 Ga0496121_0697313_23_493 156
1005 3300048925 Ga0496122_0282557 Ga0496122_0282557_290_760 156
1006 3300048927 Ga0496124_0002651 Ga0496124_0002651_10293_10763 156
1007 3300048927 Ga0496124_0033680 Ga0496124_0033680_1604_2074 156
1008 3300048927 Ga0496124_0141737 Ga0496124_0141737_1284_1754 156
1009 3300048927 Ga0496124_0195437 Ga0496124_0195437_352_822 156
1010 3300048927 Ga0496124_0238325 Ga0496124_0238325_644_1114 156
1011 3300048927 Ga0496124_0365873 Ga0496124_0365873_216_689 156
1012 3300048927 Ga0496124_0792593 Ga0496124_0792593_98_568 156
1013 3300048927 Ga0496124_0935007 Ga0496124_0935007_13_483 156
1014 3300048928 Ga0496125_0008852 Ga0496125_0008852_3396_3869 156
1015 3300048928 Ga0496125_0024004 Ga0496125_0024004_3797_4267 156
1016 3300048928 Ga0496125_0025082 Ga0496125_0025082_3486_3959 156
1017 3300048928 Ga0496125_0029022 Ga0496125_0029022_2319_2789 156
1018 3300048928 Ga0496125_0066594 Ga0496125_0066594_248_718 156
1019 3300048928 Ga0496125_0068173 Ga0496125_0068173_2034_2504 156
1020 3300048928 Ga0496125_0080114 Ga0496125_0080114_1204_1674 156
1021 3300048929 Ga0496126_0013579 Ga0496126_0013579_2943_3413 156
1022 3300048929 Ga0496126_0014996 Ga0496126_0014996_7313_7783 156
1023 3300048929 Ga0496126_0063124 Ga0496126_0063124_156_626 156
1024 3300048929 Ga0496126_0072456 Ga0496126_0072456_1241_1714 156
1025 3300048929 Ga0496126_0134860 Ga0496126_0134860_997_1467 156
1026 3300048929 Ga0496126_0320075 Ga0496126_0320075_23_493 156
1027 3300048929 Ga0496126_0385106 Ga0496126_0385106_217_687 156
1028 3300048929 Ga0496126_0398999 Ga0496126_0398999_42_512 156
1029 3300048929 Ga0496126_0523110 Ga0496126_0523110_322_792 156
1030 3300048929 Ga0496126_0557091 Ga0496126_0557091_186_659 156
1031 3300048929 Ga0496126_0592123 Ga0496126_0592123_141_611 156
1032 3300048929 Ga0496126_0817006 Ga0496126_0817006_66_536 156
1033 3300049459 Ga0495678_031118 Ga0495678_031118_1502_1975 156
1034 3300049460 Ga0495682_0009330 Ga0495682_0009330_1694_2164 156
1035 3300049460 Ga0495682_0053769 Ga0495682_0053769_783_1253 156
1036 3300049460 Ga0495682_0055819 Ga0495682_0055819_275_745 156
1037 3300049568 Ga0501031_0335122 Ga0501031_0335122_440_913 156
1038 3300049569 Ga0501032_0089474 Ga0501032_0089474_853_1326 156
1039 3300049570 Ga0501033_0313602 Ga0501033_0313602_100_573 156
1040 3300049571 Ga0501034_0456807 Ga0501034_0456807_511_984 156
1041 3300049571 Ga0501034_0855233 Ga0501034_0855233_211_684 156
1042 3300049572 Ga0501036_0103924 Ga0501036_0103924_821_1294 156
1043 3300049572 Ga0501036_0176420 Ga0501036_0176420_506_979 156
1044 3300049573 Ga0501037_0126603 Ga0501037_0126603_1326_1799 156
1045 3300049574 Ga0501038_0006039 Ga0501038_0006039_3496_3969 156
1046 3300049576 Ga0501040_0132966 Ga0501040_0132966_623_1096 156
1047 3300049579 Ga0501043_0017698 Ga0501043_0017698_4923_5396 156
1048 3300049579 Ga0501043_0108635 Ga0501043_0108635_784_1257 156
1049 3300049579 Ga0501043_0475317 Ga0501043_0475317_118_591 156
1050 3300049581 Ga0501047_0051102 Ga0501047_0051102_534_1004 156
1051 3300049586 Ga0501070_0112544 Ga0501070_0112544_701_1171 156
1052 3300049589 Ga0501073_0115850 Ga0501073_0115850_683_1153 156
1053 3300049589 Ga0501073_0800735 Ga0501073_0800735_67_540 156
1054 3300049590 Ga0501074_0035635 Ga0501074_0035635_793_1263 156
1055 3300049742 Ga0501080_0042828 Ga0501080_0042828_2492_2965 156
1056 3300049742 Ga0501080_0137365 Ga0501080_0137365_1150_1620 156
1057 3300049822 Ga0501035_0126553 Ga0501035_0126553_116_589 156
1058 3300049823 Ga0501044_0007497 Ga0501044_0007497_9112_9585 156
1059 3300049823 Ga0501044_0078881 Ga0501044_0078881_682_1152 156
1060 3300049823 Ga0501044_0296280 Ga0501044_0296280_10_483 156
1061 3300050489 nmdc:mga03683_159542_c1 nmdc:mga03683_159542_c1_129_599 156
1062 3300050489 nmdc:mga03683_61618_c1 nmdc:mga03683_61618_c1_75_548 156
1063 3300050490 nmdc:mga03n38_220034_c1 nmdc:mga03n38_220034_c1_297_767 156
1064 3300050490 nmdc:mga03n38_240531_c1 nmdc:mga03n38_240531_c1_110_580 156
1065 3300050490 nmdc:mga03n38_281488_c1 nmdc:mga03n38_281488_c1_292_765 156
1066 3300050490 nmdc:mga03n38_8084_c1 nmdc:mga03n38_8084_c1_1632_2105 156
1067 3300050491 nmdc:mga00v17_152090_c1 nmdc:mga00v17_152090_c1_89_559 156
1068 3300050491 nmdc:mga00v17_66785_c1 nmdc:mga00v17_66785_c1_27_500 156
1069 3300050492 nmdc:mga0yw44_13027_c1 nmdc:mga0yw44_13027_c1_804_1277 156
1070 3300050492 nmdc:mga0yw44_338611_c1 nmdc:mga0yw44_338611_c1_418_888 156
1071 3300050492 nmdc:mga0yw44_448081_c1 nmdc:mga0yw44_448081_c1_321_791 156
1072 3300050492 nmdc:mga0yw44_82874_c1 nmdc:mga0yw44_82874_c1_228_698 156
1073 3300050493 nmdc:mga0k408_3760_c1 nmdc:mga0k408_3760_c1_1088_1558 156
1074 3300050493 nmdc:mga0k408_77172_c1 nmdc:mga0k408_77172_c1_1081_1551 156
1075 3300050493 nmdc:mga0k408_91664_c1 nmdc:mga0k408_91664_c1_295_768 156
1076 3300050494 nmdc:mga06z11_13600_c1 nmdc:mga06z11_13600_c1_1597_2070 156
1077 3300050494 nmdc:mga06z11_192674_c1 nmdc:mga06z11_192674_c1_351_821 156
1078 3300050494 nmdc:mga06z11_267940_c1 nmdc:mga06z11_267940_c1_466_936 156
1079 3300050494 nmdc:mga06z11_393292_c1 nmdc:mga06z11_393292_c1_149_619 156
1080 3300050494 nmdc:mga06z11_475674_c1 nmdc:mga06z11_475674_c1_38_508 156
1081 3300050495 nmdc:mga04h51_31801_c1 nmdc:mga04h51_31801_c1_1133_1606 156
1082 3300050495 nmdc:mga04h51_96647_c1 nmdc:mga04h51_96647_c1_298_768 156
1083 3300050496 nmdc:mga07m45_21803_c1 nmdc:mga07m45_21803_c1_217_687 156
1084 3300050496 nmdc:mga07m45_91322_c1 nmdc:mga07m45_91322_c1_1122_1592 156
1085 3300050496 nmdc:mga07m45_94321_c1 nmdc:mga07m45_94321_c1_334_804 156
1086 3300050512 nmdc:mga0n895_1340567_c1 nmdc:mga0n895_1340567_c1_46_519 156
1087 3300050512 nmdc:mga0n895_556640_c1 nmdc:mga0n895_556640_c1_446_919 156
1088 3300050516 nmdc:mga0sz30_239974_c1 nmdc:mga0sz30_239974_c1_96_566 156
1089 3300050516 nmdc:mga0sz30_307117_c1 nmdc:mga0sz30_307117_c1_125_595 156
1090 3300050516 nmdc:mga0sz30_38220_c1 nmdc:mga0sz30_38220_c1_676_1149 156
1091 3300050516 nmdc:mga0sz30_48879_c1 nmdc:mga0sz30_48879_c1_235_708 156
1092 3300050516 nmdc:mga0sz30_94706_c1 nmdc:mga0sz30_94706_c1_379_849 156
1093 3300053077 Ga0495601_0152922 Ga0495601_0152922_293_763 156
1094 3300053077 Ga0495601_0255969 Ga0495601_0255969_175_648 156
1095 3300053078 Ga0495612_0017216 Ga0495612_0017216_273_743 156
1096 3300053079 Ga0500610_0184871 Ga0500610_0184871_48_518 156
1097 3300053079 Ga0500610_0242213 Ga0500610_0242213_264_734 156
1098 3300053080 Ga0500635_0014552 Ga0500635_0014552_990_1460 156
1099 3300053080 Ga0500635_0026210 Ga0500635_0026210_143_613 156
1100 3300053083 Ga0495655_0014279 Ga0495655_0014279_174_644 156
1101 3300053083 Ga0495655_0024406 Ga0495655_0024406_705_1175 156
1102 3300053084 Ga0495595_0124865 Ga0495595_0124865_407_877 156
1103 3300053085 Ga0495619_0150792 Ga0495619_0150792_651_1121 156
1104 3300053085 Ga0495619_0215190 Ga0495619_0215190_237_707 156
1105 3300053085 Ga0495619_0284790 Ga0495619_0284790_330_800 156
1106 3300053085 Ga0495619_0337095 Ga0495619_0337095_390_863 156
1107 3300053086 Ga0500578_0466151 Ga0500578_0466151_119_589 156
1108 3300053087 Ga0500643_000007 Ga0500643_000007_20000_20470 156
1109 3300053087 Ga0500643_039575 Ga0500643_039575_858_1331 156
1110 3300053088 Ga0500644_0101593 Ga0500644_0101593_115_588 156
1111 3300053089 Ga0500581_148762 Ga0500581_148762_491_964 156
1112 3300053091 Ga0500647_0026856 Ga0500647_0026856_2089_2559 156
1113 3300053092 Ga0500583_0009468 Ga0500583_0009468_1760_2230 156
1114 3300053093 Ga0500651_0039750 Ga0500651_0039750_524_994 156
1115 3300053094 Ga0500566_0000204 Ga0500566_0000204_17898_18368 156
1116 3300053094 Ga0500566_0003695 Ga0500566_0003695_8228_8698 156
1117 3300053094 Ga0500566_0011050 Ga0500566_0011050_2762_3235 156
1118 3300053094 Ga0500566_0047105 Ga0500566_0047105_1317_1787 156
1119 3300053094 Ga0500566_0294287 Ga0500566_0294287_214_684 156
1120 3300053095 Ga0500640_001800 Ga0500640_001800_6165_6635 156
1121 3300053095 Ga0500640_069438 Ga0500640_069438_810_1280 156
1122 3300053096 Ga0500641_0011583 Ga0500641_0011583_186_659 156
1123 3300053096 Ga0500641_0089848 Ga0500641_0089848_284_757 156
1124 3300053097 Ga0500648_086637 Ga0500648_086637_507_977 156
1125 3300053098 Ga0500650_0010869 Ga0500650_0010869_2520_2993 156
1126 3300053098 Ga0500650_0098154 Ga0500650_0098154_427_897 156
1127 3300053103 Ga0500555_001232 Ga0500555_001232_6706_7176 156
1128 3300053104 Ga0500556_0000002 Ga0500556_0000002_372022_372495 156
1129 3300053104 Ga0500556_0045721 Ga0500556_0045721_1038_1508 156
1130 3300053105 Ga0500557_000052 Ga0500557_000052_6681_7151 156
1131 3300053108 Ga0500562_127130 Ga0500562_127130_178_651 156
1132 3300053111 Ga0500572_000307 Ga0500572_000307_9162_9632 156
1133 3300053111 Ga0500572_000451 Ga0500572_000451_4216_4686 156
1134 3300053115 Ga0500591_139140 Ga0500591_139140_412_882 156
1135 3300053116 Ga0500592_011352 Ga0500592_011352_757_1230 156
1136 3300053119 Ga0500595_027995 Ga0500595_027995_1442_1912 156
1137 3300053120 Ga0500597_130297 Ga0500597_130297_297_767 156
1138 3300053120 Ga0500597_225985 Ga0500597_225985_97_567 156
1139 3300053121 Ga0500607_049924 Ga0500607_049924_1008_1478 156
1140 3300053122 Ga0500608_003260 Ga0500608_003260_272_742 156
1141 3300053122 Ga0500608_020784 Ga0500608_020784_1426_1896 156
1142 3300053122 Ga0500608_055785 Ga0500608_055785_414_887 156
1143 3300053123 Ga0500614_002722 Ga0500614_002722_276_746 156
1144 3300053123 Ga0500614_017858 Ga0500614_017858_804_1274 156
1145 3300053130 Ga0500642_0000274 Ga0500642_0000274_17341_17811 156
1146 3300053130 Ga0500642_0179222 Ga0500642_0179222_86_556 156
1147 3300053136 Ga0500559_0000066 Ga0500559_0000066_72893_73366 156
1148 3300053136 Ga0500559_0000143 Ga0500559_0000143_37315_37785 156
1149 3300053136 Ga0500559_0027270 Ga0500559_0027270_1375_1845 156
1150 3300053136 Ga0500559_0037695 Ga0500559_0037695_879_1349 156
1151 3300053136 Ga0500559_0270231 Ga0500559_0270231_301_774 156
1152 3300053138 Ga0500564_024180 Ga0500564_024180_224_694 156
1153 3300053139 Ga0500568_0004322 Ga0500568_0004322_6339_6812 156
1154 3300053139 Ga0500568_0008587 Ga0500568_0008587_1996_2481 156
1155 3300053144 Ga0500585_123841 Ga0500585_123841_71_541 156
1156 3300053146 Ga0500588_0035520 Ga0500588_0035520_208_681 156
1157 3300053148 Ga0500590_124109 Ga0500590_124109_596_1069 156
1158 3300053150 Ga0500603_000834 Ga0500603_000834_171_641 156
1159 3300053151 Ga0500604_0074390 Ga0500604_0074390_45_518 156
1160 3300053153 Ga0500616_0000034 Ga0500616_0000034_336675_337148 156
1161 3300053153 Ga0500616_0000061 Ga0500616_0000061_175423_175896 156
1162 3300053153 Ga0500616_0039160 Ga0500616_0039160_2021_2491 156
1163 3300053154 Ga0500619_011481 Ga0500619_011481_1081_1551 156
1164 3300053155 Ga0500620_010363 Ga0500620_010363_145_615 156
1165 3300053156 Ga0500622_0000518 Ga0500622_0000518_19689_20162 156
1166 3300053156 Ga0500622_0008171 Ga0500622_0008171_565_1035 156
1167 3300053157 Ga0500624_003192 Ga0500624_003192_352_822 156
1168 3300053157 Ga0500624_018186 Ga0500624_018186_158_631 156
1169 3300053158 Ga0500627_0046909 Ga0500627_0046909_507_980 156
1170 3300053159 Ga0500630_000027 Ga0500630_000027_10893_11363 156
1171 3300053160 Ga0500633_0061133 Ga0500633_0061133_347_820 156
1172 3300053162 Ga0500638_118260 Ga0500638_118260_517_987 156
1173 3300053163 Ga0500639_000020 Ga0500639_000020_449_919 156
1174 3300053163 Ga0500639_008513 Ga0500639_008513_1685_2155 156
1175 3300053163 Ga0500639_027459 Ga0500639_027459_1611_2081 156
1176 3300053177 Ga0500636_0000042 Ga0500636_0000042_40694_41164 156
1177 3300053177 Ga0500636_0002347 Ga0500636_0002347_2413_2886 156
1178 3300053177 Ga0500636_0010264 Ga0500636_0010264_4495_4968 156
1179 3300053177 Ga0500636_0165491 Ga0500636_0165491_432_902 156
1180 3300053178 Ga0500637_0047062 Ga0500637_0047062_1090_1560 156
1181 3300053178 Ga0500637_0068654 Ga0500637_0068654_926_1396 156
1182 3300053178 Ga0500637_0095278 Ga0500637_0095278_54_524 156
1183 3300053178 Ga0500637_0163564 Ga0500637_0163564_348_821 156
1184 3300053722 Ga0500649_144835 Ga0500649_144835_242_712 156
1185 3300053725 Ga0500576_053720 Ga0500576_053720_569_1039 156
1186 3300053727 Ga0500611_040567 Ga0500611_040567_298_768 156
1187 3300053729 Ga0500625_008844 Ga0500625_008844_2056_2526 156
1188 3300053731 Ga0500609_008520 Ga0500609_008520_74_547 156
1189 3300053732 Ga0500656_005423 Ga0500656_005423_657_1127 156
1190 3300053735 Ga0500596_006963 Ga0500596_006963_1180_1650 156
1191 3300053736 Ga0500599_003266 Ga0500599_003266_751_1221 156
1192 3300053737 Ga0500601_000228 Ga0500601_000228_6146_6616 156
1193 3300055283 Ga0500661_017224 Ga0500661_017224_238_708 156
1194 3300061719 Ga0466962_0154092 Ga0466962_0154092_312_782 156
1195 3300061719 Ga0466962_0183348 Ga0466962_0183348_180_650 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

2

124

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5buy-assembly1.cif.gz_C crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis 0.9525 6 127
5buy-assembly1.cif.gz_F crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis 0.9418 6 127
5buy-assembly1.cif.gz_E crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from francisella tularensis 0.9396 6 125
7qv0-assembly1.cif.gz_B-2 covalent complex between scalindua brodae amxfabz and amxacp 0.9352 6 127
8ayc-assembly1.cif.gz_A scalindua brodae amxfabz, i69g mutant 0.935 6 127
ID Description Score Start End Superfamily
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9418 6 127 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9141 6 131 3.10.129.10
1zhgA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9139 8 128 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9127 6 131 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9072 8 130 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1G5DU17-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase 0.9669 8 154 GO:0016829
AF-A0A5J6MFS3-F1-model_v4 3-hydroxyacyl-ACP dehydratase 0.9651 1 150 GO:0016829
AF-A0A4R2GWH8-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase 0.9628 1 149 GO:0016829
AF-A0A5J6MFS3-F1-model_v4 3-hydroxyacyl-ACP dehydratase 0.9588 1 150 GO:0016829
AF-A0A177J9D9-F1-model_v4 deleted 0.9586 1 148

Feature Viewer

pLDDT pTM Quality
92.19 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map