F491505

General Info

Members Datasets Scaffolds Average Seq Length
1195 351 2390 109

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100000134|Ga0070675_10000013423
Length 130
Sequence MQFTFRILHSAFGSLHLHCCMADQPKQINFTIVPDDSPEAAAAPRIYANFCSIAHTPFDFTLTFCEVMPLSDKEIKAAESEHVVRAPVRSKIVVPVQFVPNLIAALQEHWRVYSESYSNVGWNKGTGPVH

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
235 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
236 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
237 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
240 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
320 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
326 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
344 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
347 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 3.93
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 16.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100000134 3300005354 Bacteria 44325
2 JGI24751J29686_10016552 3300002459 Bacteria 1520
3 Ga0065714_10160523 3300005288 Bacteria 1054
4 Ga0065714_10533961 3300005288 Unclassified 506
5 Ga0065704_10188839 3300005289 Bacteria 1199
6 Ga0065704_10405409 3300005289 Bacteria 747
7 Ga0065704_10505288 3300005289 Bacteria 664
8 Ga0065704_10868077 3300005289 Unclassified 504
9 Ga0065712_10000765 3300005290 Bacteria 11251
10 Ga0065712_10035153 3300005290 Bacteria 897
11 Ga0065712_10082586 3300005290 Bacteria 2903
12 Ga0065712_10095885 3300005290 Bacteria 2193
13 Ga0065712_10144071 3300005290 Bacteria 1424
14 Ga0065712_10207745 3300005290 Bacteria 1055
15 Ga0065712_10231163 3300005290 Bacteria 1011
16 Ga0065712_10371614 3300005290 Bacteria 762
17 Ga0065712_10522083 3300005290 Bacteria 635
18 Ga0065715_10033140 3300005293 Bacteria 1311
19 Ga0065715_10105686 3300005293 Bacteria 2877
20 Ga0065715_10246880 3300005293 Bacteria 1180
21 Ga0065715_10403290 3300005293 Unclassified 879
22 Ga0065715_10892833 3300005293 Bacteria 577
23 Ga0065715_10916438 3300005293 Unclassified 570
24 Ga0065707_10125519 3300005295 Bacteria 2022
25 Ga0065707_10134727 3300005295 Bacteria 1861
26 Ga0065707_10328858 3300005295 Bacteria 941
27 Ga0065707_10364278 3300005295 Bacteria 899
28 Ga0065707_10481335 3300005295 Bacteria 773
29 Ga0065707_10610947 3300005295 Bacteria 684
30 Ga0065707_10665113 3300005295 Unclassified 618
31 Ga0065707_11095655 3300005295 Unclassified 516
32 Ga0070658_10730702 3300005327 Unclassified 860
33 Ga0070658_10781831 3300005327 Bacteria 829
34 Ga0070676_10000772 3300005328 Bacteria 15769
35 Ga0070676_10325474 3300005328 Bacteria 1049
36 Ga0070676_10641715 3300005328 Bacteria 770
37 Ga0070676_10855102 3300005328 Unclassified 675
38 Ga0070683_101361446 3300005329 Bacteria 682
39 Ga0070690_100164674 3300005330 Bacteria 1522
40 Ga0070690_100211653 3300005330 Unclassified 1354
41 Ga0070690_100314300 3300005330 Unclassified 1127
42 Ga0070690_100358136 3300005330 Bacteria 1061
43 Ga0070670_100048051 3300005331 Bacteria 3673
44 Ga0070670_100102159 3300005331 Bacteria 2469
45 Ga0070670_100141463 3300005331 Bacteria 2081
46 Ga0070670_100240069 3300005331 Bacteria 1578
47 Ga0070670_100926738 3300005331 Bacteria 790
48 Ga0070677_10004884 3300005333 Bacteria 4403
49 Ga0070677_10258656 3300005333 Bacteria 868
50 Ga0070677_10333427 3300005333 Bacteria 781
51 Ga0068869_100342621 3300005334 Bacteria 1217
52 Ga0068869_100755543 3300005334 Bacteria 833
53 Ga0068869_101101412 3300005334 Bacteria 695
54 Ga0070666_10035634 3300005335 Bacteria 3300
55 Ga0070666_10300052 3300005335 Bacteria 1144
56 Ga0070666_11118140 3300005335 Bacteria 586
57 Ga0070680_100163111 3300005336 Bacteria 1873
58 Ga0070680_101930326 3300005336 Bacteria 512
59 Ga0068868_100171717 3300005338 Bacteria 1795
60 Ga0068868_100208417 3300005338 Unclassified 1632
61 Ga0068868_100351247 3300005338 Bacteria 1263
62 Ga0068868_100457726 3300005338 Bacteria 1111
63 Ga0068868_100811627 3300005338 Unclassified 845
64 Ga0068868_100832922 3300005338 Bacteria 835
65 Ga0068868_100893058 3300005338 Bacteria 807
66 Ga0068868_101955778 3300005338 Bacteria 556
67 Ga0070660_100099088 3300005339 Unclassified 2307
68 Ga0070689_100008989 3300005340 Bacteria 7072
69 Ga0070689_100168468 3300005340 Bacteria 1774
70 Ga0070689_100655144 3300005340 Bacteria 914
71 Ga0070689_100690235 3300005340 Bacteria 891
72 Ga0070689_100859376 3300005340 Bacteria 801
73 Ga0070689_100946589 3300005340 Bacteria 764
74 Ga0070689_101404658 3300005340 Bacteria 631
75 Ga0070691_10008801 3300005341 Bacteria 4620
76 Ga0070691_10557864 3300005341 Unclassified 670
77 Ga0070687_100096394 3300005343 Bacteria 1647
78 Ga0070687_101296803 3300005343 Unclassified 541
79 Ga0070687_101381919 3300005343 Bacteria 526
80 Ga0070661_100223775 3300005344 Bacteria 1444
81 Ga0070692_10799808 3300005345 Bacteria 644
82 Ga0070668_100241033 3300005347 Unclassified 1498
83 Ga0070668_100771779 3300005347 Bacteria 852
84 Ga0070669_100062836 3300005353 Bacteria 2731
85 Ga0070669_100063629 3300005353 Bacteria 2716
86 Ga0070669_100365915 3300005353 Bacteria 1173
87 Ga0070669_100384749 3300005353 Bacteria 1145
88 Ga0070669_100495575 3300005353 Bacteria 1013
89 Ga0070669_100888754 3300005353 Bacteria 760
90 Ga0070669_100999164 3300005353 Unclassified 718
91 Ga0070669_101292534 3300005353 Bacteria 632
92 Ga0070675_100002703 3300005354 Bacteria 13321
93 Ga0070675_100008521 3300005354 Bacteria 7961
94 Ga0070675_100022828 3300005354 Bacteria 4999
95 Ga0070675_100165463 3300005354 Bacteria 1905
96 Ga0070675_100323880 3300005354 Bacteria 1362
97 Ga0070675_100942452 3300005354 Archaea 792
98 Ga0070675_100966217 3300005354 Unclassified 782
99 Ga0070675_101114548 3300005354 Bacteria 726
100 Ga0070671_100009515 3300005355 Bacteria 7800
101 Ga0070671_100283227 3300005355 Bacteria 1410
102 Ga0070671_100319526 3300005355 Bacteria 1323
103 Ga0070674_100017147 3300005356 Bacteria 4549
104 Ga0070674_100020633 3300005356 Bacteria 4215
105 Ga0070674_100056993 3300005356 Bacteria 2711
106 Ga0070674_100132955 3300005356 Bacteria 1857
107 Ga0070674_101045952 3300005356 Bacteria 718
108 Ga0070674_101137569 3300005356 Bacteria 691
109 Ga0070674_101831847 3300005356 Unclassified 551
110 Ga0070673_100025022 3300005364 Bacteria 4386
111 Ga0070673_100034160 3300005364 Bacteria 3845
112 Ga0070673_100117570 3300005364 Bacteria 2213
113 Ga0070673_100140159 3300005364 Bacteria 2039
114 Ga0070673_100152192 3300005364 Bacteria 1960
115 Ga0070673_100266605 3300005364 Bacteria 1498
116 Ga0070673_100307331 3300005364 Bacteria 1398
117 Ga0070673_100528290 3300005364 Bacteria 1070
118 Ga0070673_101271344 3300005364 Bacteria 691
119 Ga0070688_100227079 3300005365 Bacteria 1319
120 Ga0070688_100761117 3300005365 Bacteria 755
121 Ga0070688_101278511 3300005365 Bacteria 592
122 Ga0070688_101698052 3300005365 Bacteria 517
123 Ga0070659_100548765 3300005366 Bacteria 989
124 Ga0070659_100942786 3300005366 Bacteria 756
125 Ga0070667_100079430 3300005367 Bacteria 2804
126 Ga0070667_101315544 3300005367 Bacteria 677
127 Ga0070667_102122890 3300005367 Unclassified 529
128 Ga0070703_10020068 3300005406 Bacteria 1942
129 Ga0070703_10508517 3300005406 Bacteria 543
130 Ga0070709_10300047 3300005434 Unclassified 1173
131 Ga0070709_10401991 3300005434 Bacteria 1023
132 Ga0070709_10418295 3300005434 Bacteria 1004
133 Ga0070709_10476254 3300005434 Bacteria 944
134 Ga0070714_100136830 3300005435 Bacteria 2195
135 Ga0070713_101106507 3300005436 Bacteria 766
136 Ga0070713_101583405 3300005436 Bacteria 636
137 Ga0070701_10002074 3300005438 Bacteria 7608
138 Ga0070701_10109417 3300005438 Unclassified 1542
139 Ga0070701_10591492 3300005438 Unclassified 734
140 Ga0070701_11339991 3300005438 Unclassified 513
141 Ga0070705_100019380 3300005440 Bacteria 3581
142 Ga0070705_100567823 3300005440 Unclassified 872
143 Ga0070705_100784084 3300005440 Bacteria 757
144 Ga0070705_101168658 3300005440 Bacteria 633
145 Ga0070700_100009721 3300005441 Bacteria 5285
146 Ga0070700_100057416 3300005441 Bacteria 2443
147 Ga0070700_100104044 3300005441 Bacteria 1875
148 Ga0070700_100575683 3300005441 Bacteria 878
149 Ga0070700_100819963 3300005441 Bacteria 751
150 Ga0070700_100824854 3300005441 Bacteria 749
151 Ga0070700_101093215 3300005441 Bacteria 660
152 Ga0070700_101208174 3300005441 Bacteria 632
153 Ga0070700_101776853 3300005441 Bacteria 531
154 Ga0070694_100001478 3300005444 Bacteria 13778
155 Ga0070694_100065942 3300005444 Bacteria 2482
156 Ga0070694_100136129 3300005444 Bacteria 1780
157 Ga0070694_100503083 3300005444 Bacteria 964
158 Ga0070694_100879708 3300005444 Bacteria 738
159 Ga0070694_101024545 3300005444 Bacteria 686
160 Ga0070708_100587427 3300005445 Unclassified 1050
161 Ga0070708_100613021 3300005445 Bacteria 1026
162 Ga0070708_101397083 3300005445 Unclassified 653
163 Ga0070708_102244767 3300005445 Bacteria 504
164 Ga0070663_100427782 3300005455 Bacteria 1087
165 Ga0070663_100921028 3300005455 Bacteria 756
166 Ga0070663_101848390 3300005455 Bacteria 542
167 Ga0070678_100121981 3300005456 Bacteria 2057
168 Ga0070678_100875804 3300005456 Bacteria 820
169 Ga0070678_101146819 3300005456 Bacteria 719
170 Ga0070662_100221461 3300005457 Unclassified 1510
171 Ga0070662_100575182 3300005457 Bacteria 946
172 Ga0070662_101735280 3300005457 Bacteria 539
173 Ga0070681_10116786 3300005458 Bacteria 2605
174 Ga0070681_10424927 3300005458 Bacteria 1241
175 Ga0068867_100017505 3300005459 Bacteria 5089
176 Ga0068867_100246682 3300005459 Unclassified 1451
177 Ga0068867_100452098 3300005459 Bacteria 1095
178 Ga0068867_100577717 3300005459 Bacteria 977
179 Ga0068867_100844649 3300005459 Bacteria 820
180 Ga0068867_101083765 3300005459 Unclassified 730
181 Ga0070685_10635418 3300005466 Bacteria 772
182 Ga0070685_10650683 3300005466 Bacteria 764
183 Ga0070685_11012514 3300005466 Bacteria 624
184 Ga0070685_11403072 3300005466 Unclassified 536
185 Ga0070706_100235072 3300005467 Bacteria 1711
186 Ga0070706_100427223 3300005467 Bacteria 1233
187 Ga0070706_102022602 3300005467 Unclassified 522
188 Ga0070706_102146135 3300005467 Bacteria 505
189 Ga0070707_100064770 3300005468 Bacteria 3510
190 Ga0070707_100234791 3300005468 Bacteria 1785
191 Ga0070707_100302281 3300005468 Bacteria 1555
192 Ga0070707_100316041 3300005468 Bacteria 1518
193 Ga0070698_100059643 3300005471 Bacteria 3853
194 Ga0070698_102112967 3300005471 Bacteria 517
195 Ga0070699_100050398 3300005518 Bacteria 3605
196 Ga0070699_100063912 3300005518 Bacteria 3192
197 Ga0070699_100190054 3300005518 Bacteria 1824
198 Ga0070699_100228567 3300005518 Bacteria 1659
199 Ga0070699_100474743 3300005518 Bacteria 1135
200 Ga0070699_100995424 3300005518 Bacteria 769
201 Ga0070679_100314796 3300005530 Bacteria 1515
202 Ga0070684_100327827 3300005535 Bacteria 1407
203 Ga0070684_100418333 3300005535 Bacteria 1237
204 Ga0070697_100008387 3300005536 Bacteria 8063
205 Ga0070697_100827524 3300005536 Unclassified 820
206 Ga0070697_101291461 3300005536 Unclassified 651
207 Ga0068853_100624975 3300005539 Bacteria 1024
208 Ga0070672_100013127 3300005543 Bacteria 5838
209 Ga0070672_100277989 3300005543 Bacteria 1415
210 Ga0070672_100299916 3300005543 Bacteria 1362
211 Ga0070672_100516389 3300005543 Bacteria 1035
212 Ga0070672_100643624 3300005543 Bacteria 926
213 Ga0070686_100050701 3300005544 Bacteria 2639
214 Ga0070686_100064219 3300005544 Unclassified 2381
215 Ga0070686_100224057 3300005544 Bacteria 1360
216 Ga0070686_100470409 3300005544 Bacteria 970
217 Ga0070686_100886657 3300005544 Unclassified 725
218 Ga0070686_101486139 3300005544 Archaea 571
219 Ga0070686_101933208 3300005544 Bacteria 504
220 Ga0070695_100002536 3300005545 Bacteria 10547
221 Ga0070695_100078770 3300005545 Bacteria 2173
222 Ga0070695_100436680 3300005545 Bacteria 1000
223 Ga0070695_100499463 3300005545 Unclassified 941
224 Ga0070695_101632009 3300005545 Bacteria 539
225 Ga0070696_100010555 3300005546 Bacteria 6191
226 Ga0070696_100508037 3300005546 Bacteria 960
227 Ga0070696_100574405 3300005546 Unclassified 906
228 Ga0070665_100025305 3300005548 Bacteria 5980
229 Ga0070665_100314168 3300005548 Unclassified 1571
230 Ga0070665_100631931 3300005548 Bacteria 1084
231 Ga0070665_102492710 3300005548 Bacteria 519
232 Ga0070704_100014214 3300005549 Bacteria 4967
233 Ga0070704_100040555 3300005549 Bacteria 3206
234 Ga0070704_100243506 3300005549 Bacteria 1473
235 Ga0070704_100372419 3300005549 Bacteria 1211
236 Ga0070704_100437996 3300005549 Bacteria 1123
237 Ga0070704_100446260 3300005549 Bacteria 1113
238 Ga0070704_100709577 3300005549 Bacteria 893
239 Ga0070704_100794509 3300005549 Unclassified 845
240 Ga0070704_101394941 3300005549 Unclassified 643
241 Ga0068855_101429536 3300005563 Bacteria 712
242 Ga0068855_101508956 3300005563 Bacteria 690
243 Ga0068855_102352301 3300005563 Bacteria 532
244 Ga0070664_100151184 3300005564 Bacteria 2050
245 Ga0070664_100384948 3300005564 Bacteria 1281
246 Ga0070664_100389872 3300005564 Bacteria 1273
247 Ga0070664_100468096 3300005564 Bacteria 1159
248 Ga0070664_101783518 3300005564 Bacteria 584
249 Ga0068857_100201607 3300005577 Bacteria 1814
250 Ga0068857_100435014 3300005577 Bacteria 1225
251 Ga0068857_100726669 3300005577 Bacteria 945
252 Ga0068857_101152836 3300005577 Bacteria 750
253 Ga0068857_101750966 3300005577 Unclassified 608
254 Ga0068854_100119605 3300005578 Bacteria 1998
255 Ga0068856_100934547 3300005614 Bacteria 886
256 Ga0070702_100368232 3300005615 Bacteria 1018
257 Ga0068852_101371134 3300005616 Unclassified 729
258 Ga0068859_100027412 3300005617 Bacteria 5714
259 Ga0068859_100215636 3300005617 Bacteria 2007
260 Ga0068859_100260967 3300005617 Bacteria 1824
261 Ga0068859_100365710 3300005617 Unclassified 1538
262 Ga0068859_100562358 3300005617 Bacteria 1235
263 Ga0068859_100656459 3300005617 Bacteria 1141
264 Ga0068859_100831627 3300005617 Bacteria 1010
265 Ga0068859_100942749 3300005617 Bacteria 947
266 Ga0068859_101219439 3300005617 Bacteria 829
267 Ga0068864_100009227 3300005618 Bacteria 8135
268 Ga0068864_101272326 3300005618 Bacteria 735
269 Ga0068864_101343136 3300005618 Bacteria 716
270 Ga0068866_10406107 3300005718 Unclassified 880
271 Ga0068866_10657649 3300005718 Bacteria 714
272 Ga0068866_10820849 3300005718 Bacteria 648
273 Ga0068861_100007607 3300005719 Bacteria 7434
274 Ga0068861_100033834 3300005719 Bacteria 3774
275 Ga0068861_100974389 3300005719 Bacteria 808
276 Ga0068861_101132066 3300005719 Bacteria 754
277 Ga0068861_101243877 3300005719 Bacteria 722
278 Ga0068861_101410520 3300005719 Bacteria 681
279 Ga0068861_101924740 3300005719 Bacteria 589
280 Ga0068861_101945860 3300005719 Bacteria 586
281 Ga0068861_102382621 3300005719 Bacteria 532
282 Ga0068851_10121746 3300005834 Bacteria 1403
283 Ga0068851_10561394 3300005834 Unclassified 691
284 Ga0068870_10016844 3300005840 Bacteria 3503
285 Ga0068870_10122485 3300005840 Bacteria 1500
286 Ga0068870_11191782 3300005840 Unclassified 551
287 Ga0068863_100086786 3300005841 Bacteria 2965
288 Ga0068863_100451414 3300005841 Bacteria 1262
289 Ga0068863_100845972 3300005841 Bacteria 914
290 Ga0068858_100002143 3300005842 Bacteria 20006
291 Ga0068858_100099690 3300005842 Unclassified 2709
292 Ga0068858_100103521 3300005842 Bacteria 2656
293 Ga0068858_100243517 3300005842 Bacteria 1707
294 Ga0068858_100948861 3300005842 Unclassified 842
295 Ga0068858_101188379 3300005842 Bacteria 750
296 Ga0068858_101762673 3300005842 Bacteria 612
297 Ga0068858_102226323 3300005842 Bacteria 542
298 Ga0068860_100034524 3300005843 Bacteria 4852
299 Ga0068860_100235752 3300005843 Bacteria 1779
300 Ga0068860_100326753 3300005843 Bacteria 1506
301 Ga0068860_100746892 3300005843 Bacteria 990
302 Ga0068860_101019461 3300005843 Unclassified 846
303 Ga0068860_101535593 3300005843 Bacteria 688
304 Ga0068860_101841816 3300005843 Bacteria 627
305 Ga0068860_101847625 3300005843 Unclassified 626
306 Ga0068862_100014479 3300005844 Bacteria 6545
307 Ga0068862_100035548 3300005844 Bacteria 4220
308 Ga0068862_100113824 3300005844 Bacteria 2377
309 Ga0068862_100169199 3300005844 Bacteria 1955
310 Ga0068862_100961766 3300005844 Bacteria 843
311 Ga0068862_101563974 3300005844 Bacteria 666
312 Ga0081455_10102580 3300005937 Bacteria 2293
313 Ga0081455_10240787 3300005937 Bacteria 1330
314 Ga0081539_10047623 3300005985 Bacteria 2446
315 Ga0075364_10102384 3300006051 Bacteria 1907
316 Ga0070715_10168785 3300006163 Bacteria 1088
317 Ga0070715_10378586 3300006163 Bacteria 781
318 Ga0070715_10451177 3300006163 Bacteria 726
319 Ga0070715_10692770 3300006163 Bacteria 608
320 Ga0070715_10791405 3300006163 Unclassified 575
321 Ga0070716_100025743 3300006173 Bacteria 3144
322 Ga0070716_100121975 3300006173 Bacteria 1633
323 Ga0070712_100745231 3300006175 Bacteria 838
324 Ga0097621_100001741 3300006237 Bacteria 14904
325 Ga0097621_100027247 3300006237 Bacteria 4492
326 Ga0097621_100070046 3300006237 Bacteria 2896
327 Ga0097621_100071815 3300006237 Bacteria 2861
328 Ga0097621_100072229 3300006237 Bacteria 2854
329 Ga0097621_100194268 3300006237 Unclassified 1759
330 Ga0097621_100195647 3300006237 Bacteria 1753
331 Ga0097621_100330060 3300006237 Bacteria 1353
332 Ga0097621_101091041 3300006237 Unclassified 749
333 Ga0097621_101556869 3300006237 Bacteria 628
334 Ga0097621_101603236 3300006237 Unclassified 619
335 Ga0097621_101787731 3300006237 Bacteria 586
336 Ga0068871_100004322 3300006358 Bacteria 9869
337 Ga0068871_100048945 3300006358 Bacteria 3414
338 Ga0068871_100049837 3300006358 Bacteria 3386
339 Ga0068871_100105817 3300006358 Bacteria 2361
340 Ga0068871_100122217 3300006358 Bacteria 2201
341 Ga0068871_100237647 3300006358 Unclassified 1583
342 Ga0068871_100428206 3300006358 Bacteria 1183
343 Ga0068871_100606717 3300006358 Bacteria 996
344 Ga0068871_100785107 3300006358 Bacteria 877
345 Ga0068871_100971119 3300006358 Unclassified 790
346 Ga0068871_101515046 3300006358 Bacteria 634
347 Ga0075428_100146252 3300006844 Bacteria 2568
348 Ga0075428_100158491 3300006844 Bacteria 2457
349 Ga0075428_100382935 3300006844 Bacteria 1508
350 Ga0075428_101202532 3300006844 Bacteria 799
351 Ga0075428_101505069 3300006844 Bacteria 705
352 Ga0075430_100004158 3300006846 Bacteria 12212
353 Ga0075430_100198468 3300006846 Bacteria 1666
354 Ga0075430_100668803 3300006846 Bacteria 856
355 Ga0075430_101664101 3300006846 Unclassified 524
356 Ga0075430_101769986 3300006846 Bacteria 507
357 Ga0075431_100043715 3300006847 Bacteria 4621
358 Ga0075431_100329318 3300006847 Unclassified 1538
359 Ga0075431_101969089 3300006847 Bacteria 540
360 Ga0075433_10090444 3300006852 Bacteria 2705
361 Ga0075433_10224618 3300006852 Bacteria 1668
362 Ga0075433_10380098 3300006852 Bacteria 1247
363 Ga0075433_10382997 3300006852 Bacteria 1242
364 Ga0075433_10489761 3300006852 Bacteria 1083
365 Ga0075433_10903031 3300006852 Bacteria 770
366 Ga0075434_100000442 3300006871 Bacteria 30797
367 Ga0075434_100053203 3300006871 Bacteria 4023
368 Ga0075434_100084709 3300006871 Bacteria 3168
369 Ga0075434_100501206 3300006871 Bacteria 1235
370 Ga0075434_100533949 3300006871 Bacteria 1193
371 Ga0075434_100732415 3300006871 Bacteria 1006
372 Ga0075434_101337624 3300006871 Unclassified 727
373 Ga0075434_102007761 3300006871 Bacteria 584
374 Ga0075429_100022819 3300006880 Bacteria 5426
375 Ga0075429_100085016 3300006880 Bacteria 2758
376 Ga0075429_101901267 3300006880 Unclassified 516
377 Ga0075429_101943314 3300006880 Unclassified 510
378 Ga0068865_100037132 3300006881 Bacteria 3288
379 Ga0068865_100072828 3300006881 Bacteria 2441
380 Ga0068865_100123440 3300006881 Bacteria 1929
381 Ga0068865_100396916 3300006881 Unclassified 1129
382 Ga0068865_100452379 3300006881 Bacteria 1062
383 Ga0068865_100455973 3300006881 Bacteria 1058
384 Ga0068865_100540878 3300006881 Bacteria 977
385 Ga0075436_100002424 3300006914 Bacteria 12850
386 Ga0075436_100040069 3300006914 Bacteria 3232
387 Ga0075436_100045445 3300006914 Bacteria 3029
388 Ga0075436_100067944 3300006914 Bacteria 2462
389 Ga0075436_100301508 3300006914 Bacteria 1148
390 Ga0075436_100710955 3300006914 Bacteria 745
391 Ga0075436_101241538 3300006914 Unclassified 563
392 Ga0097620_100027412 3300006931 Bacteria 5714
393 Ga0097620_100215630 3300006931 Bacteria 2007
394 Ga0097620_100260968 3300006931 Bacteria 1824
395 Ga0097620_100365705 3300006931 Unclassified 1538
396 Ga0097620_100562343 3300006931 Bacteria 1235
397 Ga0097620_100656525 3300006931 Bacteria 1141
398 Ga0097620_100831657 3300006931 Bacteria 1010
399 Ga0097620_100942761 3300006931 Bacteria 947
400 Ga0097620_101219555 3300006931 Bacteria 829
401 Ga0075435_100000293 3300007076 Bacteria 30982
402 Ga0075435_100007134 3300007076 Bacteria 7941
403 Ga0075435_100035336 3300007076 Bacteria 3966
404 Ga0075435_100043143 3300007076 Bacteria 3610
405 Ga0075435_100143226 3300007076 Bacteria 2006
406 Ga0075435_100327567 3300007076 Bacteria 1311
407 Ga0075435_101706909 3300007076 Bacteria 553
408 Ga0075435_101914637 3300007076 Bacteria 521
409 Ga0099794_10088213 3300007265 Bacteria 1537
410 Ga0105251_10515183 3300009011 Bacteria 560
411 Ga0105240_10035120 3300009093 Bacteria 6464
412 Ga0105240_10946989 3300009093 Bacteria 924
413 Ga0111539_10006183 3300009094 Bacteria 15445
414 Ga0111539_10026198 3300009094 Bacteria 7135
415 Ga0111539_10043751 3300009094 Bacteria 5368
416 Ga0111539_10158522 3300009094 Bacteria 2648
417 Ga0111539_10273428 3300009094 Bacteria 1966
418 Ga0111539_10515979 3300009094 Bacteria 1392
419 Ga0111539_11302430 3300009094 Bacteria 843
420 Ga0111539_11556778 3300009094 Bacteria 767
421 Ga0111539_12136601 3300009094 Bacteria 650
422 Ga0111539_13312134 3300009094 Bacteria 519
423 Ga0105245_10016947 3300009098 Bacteria 6361
424 Ga0105245_10364918 3300009098 Bacteria 1434
425 Ga0105245_10609377 3300009098 Bacteria 1119
426 Ga0105245_10794356 3300009098 Bacteria 984
427 Ga0105245_10903170 3300009098 Bacteria 925
428 Ga0105245_11058678 3300009098 Bacteria 857
429 Ga0105245_12014394 3300009098 Bacteria 631
430 Ga0105247_10004717 3300009101 Bacteria 8686
431 Ga0105247_10021795 3300009101 Bacteria 3854
432 Ga0105247_10206195 3300009101 Unclassified 1324
433 Ga0105247_10449162 3300009101 Bacteria 929
434 Ga0105247_10509543 3300009101 Bacteria 878
435 Ga0105247_10890263 3300009101 Unclassified 687
436 Ga0114129_10002338 3300009147 Bacteria 26309
437 Ga0114129_10003015 3300009147 Bacteria 23608
438 Ga0114129_10006687 3300009147 Bacteria 16370
439 Ga0114129_10015456 3300009147 Bacteria 10857
440 Ga0114129_10021659 3300009147 Bacteria 9122
441 Ga0114129_10023706 3300009147 Bacteria 8700
442 Ga0114129_10024455 3300009147 Bacteria 8558
443 Ga0114129_10056128 3300009147 Bacteria 5518
444 Ga0114129_10093219 3300009147 Bacteria 4172
445 Ga0114129_10130821 3300009147 Bacteria 3447
446 Ga0114129_10165292 3300009147 Bacteria 3020
447 Ga0114129_10309202 3300009147 Bacteria 2104
448 Ga0114129_10330140 3300009147 Bacteria 2025
449 Ga0114129_10391996 3300009147 Bacteria 1831
450 Ga0114129_10719047 3300009147 Bacteria 1282
451 Ga0114129_10747510 3300009147 Bacteria 1252
452 Ga0114129_10816663 3300009147 Bacteria 1188
453 Ga0114129_11222011 3300009147 Bacteria 935
454 Ga0114129_11530256 3300009147 Bacteria 819
455 Ga0114129_12062384 3300009147 Bacteria 689
456 Ga0105243_10012745 3300009148 Bacteria 6350
457 Ga0105243_10018903 3300009148 Bacteria 5225
458 Ga0105243_10775857 3300009148 Bacteria 942
459 Ga0105243_10963781 3300009148 Unclassified 853
460 Ga0105243_11164771 3300009148 Unclassified 782
461 Ga0105243_12070034 3300009148 Bacteria 604
462 Ga0105241_10762047 3300009174 Bacteria 888
463 Ga0105241_11607033 3300009174 Bacteria 629
464 Ga0105242_10002327 3300009176 Bacteria 14984
465 Ga0105242_10006370 3300009176 Bacteria 9085
466 Ga0105242_10030730 3300009176 Bacteria 4289
467 Ga0105242_10052566 3300009176 Bacteria 3324
468 Ga0105242_10063391 3300009176 Bacteria 3044
469 Ga0105242_10087968 3300009176 Bacteria 2609
470 Ga0105242_10104858 3300009176 Bacteria 2401
471 Ga0105242_11119920 3300009176 Bacteria 802
472 Ga0105242_11335250 3300009176 Bacteria 742
473 Ga0105242_11392049 3300009176 Unclassified 728
474 Ga0105242_11687885 3300009176 Bacteria 669
475 Ga0105242_11712145 3300009176 Unclassified 665
476 Ga0105248_10002926 3300009177 Bacteria 18953
477 Ga0105248_10015582 3300009177 Bacteria 8380
478 Ga0105248_10024188 3300009177 Bacteria 6751
479 Ga0105248_10026562 3300009177 Bacteria 6440
480 Ga0105248_10137376 3300009177 Bacteria 2758
481 Ga0105248_10175193 3300009177 Bacteria 2418
482 Ga0105248_10266439 3300009177 Bacteria 1928
483 Ga0105248_10313723 3300009177 Bacteria 1766
484 Ga0105248_10371278 3300009177 Bacteria 1610
485 Ga0105248_10395460 3300009177 Bacteria 1556
486 Ga0105248_10624748 3300009177 Bacteria 1215
487 Ga0105248_10646152 3300009177 Bacteria 1194
488 Ga0105248_11075440 3300009177 Bacteria 909
489 Ga0105248_11631447 3300009177 Bacteria 731
490 Ga0105248_12274296 3300009177 Unclassified 617
491 Ga0105248_12463435 3300009177 Bacteria 593
492 Ga0105248_12836199 3300009177 Bacteria 553
493 Ga0105237_10361885 3300009545 Bacteria 1455
494 Ga0105237_10598633 3300009545 Bacteria 1109
495 Ga0105238_10680748 3300009551 Bacteria 1040
496 Ga0105238_10928520 3300009551 Bacteria 889
497 Ga0105238_11702631 3300009551 Unclassified 662
498 Ga0105238_11902489 3300009551 Unclassified 628
499 Ga0105238_11982788 3300009551 Bacteria 616
500 Ga0105238_12586549 3300009551 Unclassified 544
501 Ga0105238_13045308 3300009551 Bacteria 503
502 Ga0105249_10436392 3300009553 Bacteria 1346
503 Ga0105249_10949474 3300009553 Bacteria 928
504 Ga0105249_10954700 3300009553 Bacteria 925
505 Ga0105249_10965495 3300009553 Bacteria 920
506 Ga0105249_11236724 3300009553 Unclassified 818
507 Ga0105249_11551305 3300009553 Bacteria 735
508 Ga0105249_11674546 3300009553 Bacteria 709
509 Ga0105249_13162817 3300009553 Bacteria 529
510 Ga0099796_10078136 3300010159 Bacteria 1208
511 Ga0105239_13015784 3300010375 Unclassified 549
512 Ga0105246_10167791 3300011119 Bacteria 1678
513 Ga0105246_11295792 3300011119 Bacteria 675
514 Ga0105246_11358703 3300011119 Bacteria 661
515 Ga0105246_12449893 3300011119 Unclassified 513
516 Ga0157373_11063032 3300013100 Unclassified 606
517 Ga0157370_10981895 3300013104 Bacteria 765
518 Ga0157374_11196983 3300013296 Bacteria 781
519 Ga0157374_12069825 3300013296 Bacteria 596
520 Ga0157374_12785113 3300013296 Bacteria 517
521 Ga0157378_10223182 3300013297 Bacteria 1792
522 Ga0157378_10321628 3300013297 Bacteria 1503
523 Ga0157378_10413306 3300013297 Bacteria 1332
524 Ga0157378_10852836 3300013297 Bacteria 939
525 Ga0157378_10976886 3300013297 Bacteria 880
526 Ga0157378_11372238 3300013297 Unclassified 749
527 Ga0157378_12064115 3300013297 Unclassified 620
528 Ga0157378_12421608 3300013297 Unclassified 577
529 Ga0157378_12866413 3300013297 Unclassified 534
530 Ga0163162_10028358 3300013306 Bacteria 5539
531 Ga0163162_10068695 3300013306 Bacteria 3595
532 Ga0163162_10476287 3300013306 Bacteria 1380
533 Ga0163162_10602197 3300013306 Bacteria 1225
534 Ga0163162_10851411 3300013306 Bacteria 1027
535 Ga0163162_11270779 3300013306 Bacteria 836
536 Ga0163162_11657337 3300013306 Bacteria 730
537 Ga0163162_11681227 3300013306 Bacteria 725
538 Ga0163162_12630709 3300013306 Bacteria 579
539 Ga0163162_12977168 3300013306 Bacteria 545
540 Ga0163162_13051436 3300013306 Unclassified 538
541 Ga0157375_10062206 3300013308 Bacteria 3708
542 Ga0157375_10117857 3300013308 Bacteria 2761
543 Ga0157375_10122224 3300013308 Bacteria 2715
544 Ga0157375_10377809 3300013308 Bacteria 1583
545 Ga0157375_10464817 3300013308 Bacteria 1431
546 Ga0157375_10656638 3300013308 Bacteria 1205
547 Ga0157375_12150477 3300013308 Bacteria 664
548 Ga0157375_12290989 3300013308 Bacteria 644
549 Ga0157375_12579682 3300013308 Unclassified 607
550 Ga0157375_12953967 3300013308 Unclassified 568
551 Ga0163163_10076767 3300014325 Bacteria 3336
552 Ga0163163_10135331 3300014325 Bacteria 2505
553 Ga0163163_10168310 3300014325 Bacteria 2238
554 Ga0163163_10297120 3300014325 Bacteria 1667
555 Ga0163163_10930714 3300014325 Bacteria 932
556 Ga0163163_11929317 3300014325 Bacteria 650
557 Ga0157380_10034605 3300014326 Bacteria 3897
558 Ga0157380_10173938 3300014326 Bacteria 1884
559 Ga0157380_10304102 3300014326 Bacteria 1471
560 Ga0157380_10346606 3300014326 Bacteria 1388
561 Ga0157380_10605790 3300014326 Bacteria 1084
562 Ga0157380_10663131 3300014326 Bacteria 1043
563 Ga0157380_10836651 3300014326 Bacteria 941
564 Ga0157380_10998482 3300014326 Bacteria 870
565 Ga0157380_11382119 3300014326 Unclassified 754
566 Ga0157380_11629018 3300014326 Bacteria 701
567 Ga0157380_12880939 3300014326 Unclassified 547
568 Ga0157380_13303060 3300014326 Bacteria 516
569 Ga0157377_10018733 3300014745 Bacteria 3603
570 Ga0157377_10086187 3300014745 Bacteria 1845
571 Ga0157377_10460452 3300014745 Bacteria 880
572 Ga0157379_10014346 3300014968 Bacteria 6953
573 Ga0157379_10041606 3300014968 Bacteria 4102
574 Ga0157379_10080766 3300014968 Bacteria 2913
575 Ga0157379_10273652 3300014968 Bacteria 1536
576 Ga0157379_10901270 3300014968 Bacteria 839
577 Ga0157379_11586079 3300014968 Bacteria 639
578 Ga0157379_12548682 3300014968 Bacteria 512
579 Ga0157376_10039775 3300014969 Bacteria 3838
580 Ga0157376_10122636 3300014969 Bacteria 2306
581 Ga0157376_10150650 3300014969 Unclassified 2097
582 Ga0157376_10183534 3300014969 Unclassified 1914
583 Ga0157376_10244744 3300014969 Bacteria 1672
584 Ga0157376_10496888 3300014969 Bacteria 1198
585 Ga0157376_10735570 3300014969 Bacteria 994
586 Ga0157376_11475657 3300014969 Bacteria 713
587 Ga0157376_12851106 3300014969 Bacteria 523
588 Ga0182005_1065484 3300015265 Bacteria 995
589 Ga0163161_10143558 3300017792 Bacteria 1809
590 Ga0163161_10264533 3300017792 Bacteria 1344
591 Ga0163161_10482107 3300017792 Bacteria 1007
592 Ga0163161_12042270 3300017792 Bacteria 510
593 Ga0207697_10071482 3300025315 Unclassified 1454
594 Ga0207697_10151563 3300025315 Bacteria 1009
595 Ga0207697_10169115 3300025315 Bacteria 956
596 Ga0207656_10626914 3300025321 Unclassified 549
597 Ga0207682_10012638 3300025893 Bacteria 3292
598 Ga0207682_10090741 3300025893 Bacteria 1324
599 Ga0207682_10314691 3300025893 Bacteria 735
600 Ga0207692_10062884 3300025898 Unclassified 1928
601 Ga0207642_10320263 3300025899 Bacteria 905
602 Ga0207642_10511176 3300025899 Bacteria 737
603 Ga0207710_10043183 3300025900 Bacteria 2005
604 Ga0207710_10202155 3300025900 Bacteria 981
605 Ga0207710_10218751 3300025900 Unclassified 945
606 Ga0207710_10297964 3300025900 Bacteria 814
607 Ga0207688_10364950 3300025901 Unclassified 891
608 Ga0207680_10121808 3300025903 Bacteria 1707
609 Ga0207680_10226700 3300025903 Bacteria 1283
610 Ga0207680_10311233 3300025903 Bacteria 1099
611 Ga0207680_10443004 3300025903 Bacteria 921
612 Ga0207680_10620477 3300025903 Bacteria 774
613 Ga0207680_11205736 3300025903 Bacteria 540
614 Ga0207685_10100028 3300025905 Bacteria 1238
615 Ga0207699_10136467 3300025906 Bacteria 1607
616 Ga0207699_10138331 3300025906 Bacteria 1598
617 Ga0207645_10010119 3300025907 Bacteria 6490
618 Ga0207645_10167566 3300025907 Bacteria 1439
619 Ga0207645_10324205 3300025907 Bacteria 1028
620 Ga0207645_11039624 3300025907 Bacteria 554
621 Ga0207643_10028199 3300025908 Bacteria 3117
622 Ga0207705_10433255 3300025909 Unclassified 1019
623 Ga0207684_10340470 3300025910 Bacteria 1292
624 Ga0207684_10625897 3300025910 Bacteria 918
625 Ga0207654_10368923 3300025911 Bacteria 992
626 Ga0207707_10434753 3300025912 Bacteria 1124
627 Ga0207707_10581314 3300025912 Bacteria 949
628 Ga0207695_10043788 3300025913 Bacteria 4766
629 Ga0207693_10719179 3300025915 Bacteria 773
630 Ga0207660_10140304 3300025917 Bacteria 1847
631 Ga0207662_10349300 3300025918 Bacteria 993
632 Ga0207662_10463921 3300025918 Unclassified 868
633 Ga0207649_10270046 3300025920 Bacteria 1232
634 Ga0207652_10164394 3300025921 Bacteria 1990
635 Ga0207646_10129675 3300025922 Bacteria 2269
636 Ga0207646_10674278 3300025922 Bacteria 925
637 Ga0207646_10743847 3300025922 Bacteria 875
638 Ga0207681_10031728 3300025923 Bacteria 3452
639 Ga0207681_10057928 3300025923 Bacteria 2650
640 Ga0207681_10423925 3300025923 Bacteria 1078
641 Ga0207681_10460455 3300025923 Bacteria 1036
642 Ga0207681_10471969 3300025923 Bacteria 1023
643 Ga0207681_10481848 3300025923 Bacteria 1013
644 Ga0207681_10513259 3300025923 Bacteria 983
645 Ga0207681_10876159 3300025923 Bacteria 751
646 Ga0207694_10674236 3300025924 Bacteria 871
647 Ga0207650_10040451 3300025925 Bacteria 3411
648 Ga0207650_10081322 3300025925 Bacteria 2457
649 Ga0207650_10197071 3300025925 Bacteria 1612
650 Ga0207650_10303154 3300025925 Bacteria 1305
651 Ga0207650_10928129 3300025925 Bacteria 739
652 Ga0207650_11457074 3300025925 Unclassified 582
653 Ga0207659_10002378 3300025926 Bacteria 11202
654 Ga0207659_10011489 3300025926 Bacteria 5595
655 Ga0207659_10060634 3300025926 Bacteria 2724
656 Ga0207659_10216365 3300025926 Bacteria 1538
657 Ga0207659_10630644 3300025926 Bacteria 915
658 Ga0207659_11127876 3300025926 Bacteria 675
659 Ga0207659_11205399 3300025926 Unclassified 651
660 Ga0207659_11330369 3300025926 Unclassified 617
661 Ga0207659_11592795 3300025926 Bacteria 558
662 Ga0207659_11768859 3300025926 Unclassified 525
663 Ga0207687_10010364 3300025927 Bacteria 6089
664 Ga0207687_10063983 3300025927 Bacteria 2606
665 Ga0207687_10414846 3300025927 Bacteria 1110
666 Ga0207687_10468696 3300025927 Bacteria 1047
667 Ga0207687_10656542 3300025927 Bacteria 887
668 Ga0207700_10017407 3300025928 Bacteria 4800
669 Ga0207700_11141374 3300025928 Unclassified 696
670 Ga0207664_10393754 3300025929 Bacteria 1231
671 Ga0207644_10023932 3300025931 Bacteria 4188
672 Ga0207644_10462290 3300025931 Bacteria 1043
673 Ga0207644_10636534 3300025931 Bacteria 887
674 Ga0207644_10695062 3300025931 Bacteria 848
675 Ga0207644_10804097 3300025931 Unclassified 786
676 Ga0207644_10999269 3300025931 Bacteria 702
677 Ga0207644_11133823 3300025931 Unclassified 657
678 Ga0207690_10511590 3300025932 Bacteria 972
679 Ga0207706_10173659 3300025933 Bacteria 1893
680 Ga0207706_10478544 3300025933 Bacteria 1076
681 Ga0207706_10570791 3300025933 Bacteria 973
682 Ga0207706_10968940 3300025933 Bacteria 716
683 Ga0207706_11418283 3300025933 Bacteria 570
684 Ga0207686_10002322 3300025934 Bacteria 10411
685 Ga0207686_10094220 3300025934 Bacteria 1985
686 Ga0207686_10140293 3300025934 Bacteria 1669
687 Ga0207686_10167587 3300025934 Bacteria 1546
688 Ga0207686_10572959 3300025934 Unclassified 885
689 Ga0207686_10983927 3300025934 Bacteria 684
690 Ga0207709_10068365 3300025935 Bacteria 2245
691 Ga0207709_10440925 3300025935 Bacteria 1004
692 Ga0207670_10004961 3300025936 Bacteria 7245
693 Ga0207670_10400531 3300025936 Bacteria 1097
694 Ga0207670_10721337 3300025936 Bacteria 826
695 Ga0207670_11445109 3300025936 Unclassified 584
696 Ga0207670_11530940 3300025936 Bacteria 567
697 Ga0207669_10087257 3300025937 Bacteria 2020
698 Ga0207669_10324613 3300025937 Bacteria 1179
699 Ga0207669_10345563 3300025937 Bacteria 1147
700 Ga0207669_10679195 3300025937 Unclassified 845
701 Ga0207669_11305617 3300025937 Bacteria 616
702 Ga0207704_10041693 3300025938 Unclassified 2694
703 Ga0207704_10068414 3300025938 Bacteria 2238
704 Ga0207704_10397391 3300025938 Bacteria 1087
705 Ga0207704_10782727 3300025938 Bacteria 795
706 Ga0207704_10795203 3300025938 Bacteria 789
707 Ga0207665_10165305 3300025939 Bacteria 1594
708 Ga0207665_10268312 3300025939 Bacteria 1266
709 Ga0207665_11587582 3300025939 Bacteria 519
710 Ga0207691_10036213 3300025940 Bacteria 4572
711 Ga0207691_10038903 3300025940 Bacteria 4401
712 Ga0207691_10105089 3300025940 Bacteria 2516
713 Ga0207691_10115593 3300025940 Bacteria 2382
714 Ga0207691_10124187 3300025940 Bacteria 2285
715 Ga0207691_10506821 3300025940 Bacteria 1025
716 Ga0207691_10740292 3300025940 Unclassified 828
717 Ga0207691_10879539 3300025940 Bacteria 751
718 Ga0207691_11104478 3300025940 Unclassified 660
719 Ga0207691_11759295 3300025940 Bacteria 500
720 Ga0207711_10021612 3300025941 Bacteria 5375
721 Ga0207711_10056083 3300025941 Bacteria 3384
722 Ga0207711_10078314 3300025941 Bacteria 2883
723 Ga0207711_10091939 3300025941 Bacteria 2669
724 Ga0207711_10093412 3300025941 Bacteria 2650
725 Ga0207711_10104060 3300025941 Unclassified 2514
726 Ga0207711_10113116 3300025941 Unclassified 2417
727 Ga0207711_10228560 3300025941 Bacteria 1703
728 Ga0207711_10231413 3300025941 Unclassified 1693
729 Ga0207711_10985535 3300025941 Bacteria 782
730 Ga0207711_11179687 3300025941 Bacteria 707
731 Ga0207711_11571593 3300025941 Bacteria 601
732 Ga0207711_11945837 3300025941 Bacteria 531
733 Ga0207689_10044403 3300025942 Bacteria 3675
734 Ga0207689_11503490 3300025942 Unclassified 562
735 Ga0207661_10630101 3300025944 Bacteria 985
736 Ga0207661_10919152 3300025944 Unclassified 806
737 Ga0207661_11775764 3300025944 Bacteria 562
738 Ga0207679_10090637 3300025945 Bacteria 2364
739 Ga0207679_10120594 3300025945 Bacteria 2087
740 Ga0207679_11097439 3300025945 Bacteria 730
741 Ga0207667_11423415 3300025949 Bacteria 666
742 Ga0207651_10032004 3300025960 Bacteria 3371
743 Ga0207651_10039551 3300025960 Bacteria 3111
744 Ga0207651_10065620 3300025960 Bacteria 2547
745 Ga0207651_10095692 3300025960 Bacteria 2188
746 Ga0207651_10107516 3300025960 Bacteria 2085
747 Ga0207651_10293857 3300025960 Bacteria 1348
748 Ga0207651_10431195 3300025960 Bacteria 1127
749 Ga0207651_10830141 3300025960 Bacteria 820
750 Ga0207651_11153891 3300025960 Bacteria 695
751 Ga0207651_11447569 3300025960 Unclassified 619
752 Ga0207712_10224577 3300025961 Bacteria 1503
753 Ga0207712_11193726 3300025961 Unclassified 679
754 Ga0207712_11261088 3300025961 Unclassified 660
755 Ga0207668_10540561 3300025972 Bacteria 1008
756 Ga0207668_10742923 3300025972 Bacteria 865
757 Ga0207658_10061154 3300025986 Bacteria 2813
758 Ga0207658_10775846 3300025986 Bacteria 869
759 Ga0207658_11066025 3300025986 Unclassified 738
760 Ga0207658_11312981 3300025986 Bacteria 662
761 Ga0207677_10346849 3300026023 Bacteria 1243
762 Ga0207677_10523446 3300026023 Bacteria 1029
763 Ga0207677_10669910 3300026023 Bacteria 918
764 Ga0207677_10742060 3300026023 Bacteria 874
765 Ga0207677_10805004 3300026023 Bacteria 841
766 Ga0207677_10890180 3300026023 Bacteria 802
767 Ga0207677_11192592 3300026023 Bacteria 697
768 Ga0207703_10045078 3300026035 Unclassified 3546
769 Ga0207703_10063549 3300026035 Bacteria 3027
770 Ga0207703_10120624 3300026035 Bacteria 2251
771 Ga0207703_10312328 3300026035 Bacteria 1437
772 Ga0207703_11253999 3300026035 Unclassified 713
773 Ga0207703_11737685 3300026035 Unclassified 600
774 Ga0207703_12110997 3300026035 Bacteria 540
775 Ga0207639_10102270 3300026041 Bacteria 2319
776 Ga0207678_11004047 3300026067 Unclassified 738
777 Ga0207678_11024611 3300026067 Bacteria 731
778 Ga0207678_11843981 3300026067 Bacteria 529
779 Ga0207708_10004035 3300026075 Bacteria 10794
780 Ga0207708_10047836 3300026075 Bacteria 3255
781 Ga0207708_10264493 3300026075 Bacteria 1389
782 Ga0207708_10312951 3300026075 Bacteria 1280
783 Ga0207708_10521496 3300026075 Bacteria 998
784 Ga0207641_10015850 3300026088 Bacteria 6171
785 Ga0207641_10169646 3300026088 Bacteria 1991
786 Ga0207641_10187672 3300026088 Bacteria 1898
787 Ga0207641_11002431 3300026088 Bacteria 832
788 Ga0207641_11866408 3300026088 Bacteria 603
789 Ga0207641_12089814 3300026088 Unclassified 567
790 Ga0207648_10008593 3300026089 Bacteria 9877
791 Ga0207648_10035504 3300026089 Bacteria 4391
792 Ga0207648_10137226 3300026089 Bacteria 2155
793 Ga0207648_10186927 3300026089 Bacteria 1835
794 Ga0207648_10193990 3300026089 Unclassified 1800
795 Ga0207648_10407596 3300026089 Bacteria 1233
796 Ga0207648_10483546 3300026089 Bacteria 1131
797 Ga0207648_10966406 3300026089 Unclassified 797
798 Ga0207676_10055958 3300026095 Bacteria 3099
799 Ga0207674_10027294 3300026116 Bacteria 6042
800 Ga0207674_10386774 3300026116 Bacteria 1352
801 Ga0207674_11013489 3300026116 Bacteria 799
802 Ga0207674_11082751 3300026116 Bacteria 771
803 Ga0207675_100002422 3300026118 Bacteria 18488
804 Ga0207675_100082993 3300026118 Bacteria 3005
805 Ga0207675_100153886 3300026118 Bacteria 2190
806 Ga0207675_100182792 3300026118 Bacteria 2008
807 Ga0207675_100253866 3300026118 Bacteria 1702
808 Ga0207675_100726404 3300026118 Bacteria 1003
809 Ga0207675_100846333 3300026118 Bacteria 929
810 Ga0207683_10122282 3300026121 Bacteria 2337
811 Ga0207683_10643522 3300026121 Bacteria 982
812 Ga0207683_10877881 3300026121 Bacteria 833
813 Ga0207683_11101023 3300026121 Bacteria 737
814 Ga0207698_10241331 3300026142 Bacteria 1647
815 Ga0207698_11304916 3300026142 Bacteria 740
816 Ga0210002_1044820 3300027617 Bacteria 755
817 Ga0209971_1047897 3300027682 Bacteria 1031
818 Ga0209974_10212153 3300027876 Bacteria 718
819 Ga0207428_10051733 3300027907 Bacteria 3283
820 Ga0207428_10062981 3300027907 Bacteria 2931
821 Ga0207428_10078034 3300027907 Bacteria 2592
822 Ga0207428_10154865 3300027907 Bacteria 1743
823 Ga0207428_10316979 3300027907 Bacteria 1152
824 Ga0207428_10559032 3300027907 Bacteria 827
825 Ga0207428_10620296 3300027907 Bacteria 778
826 Ga0268266_10019590 3300028379 Bacteria 5764
827 Ga0268266_10084989 3300028379 Unclassified 2764
828 Ga0268266_10311578 3300028379 Bacteria 1471
829 Ga0268266_10441671 3300028379 Bacteria 1236
830 Ga0268266_10464319 3300028379 Bacteria 1205
831 Ga0268265_10038252 3300028380 Bacteria 3528
832 Ga0268265_10055548 3300028380 Bacteria 3009
833 Ga0268265_10111014 3300028380 Bacteria 2238
834 Ga0268265_10507124 3300028380 Bacteria 1138
835 Ga0268265_10850593 3300028380 Bacteria 892
836 Ga0268265_10914141 3300028380 Bacteria 862
837 Ga0268265_11265098 3300028380 Bacteria 737
838 Ga0268264_10087555 3300028381 Bacteria 2678
839 Ga0268264_10293128 3300028381 Bacteria 1529
840 Ga0268264_10385157 3300028381 Unclassified 1343
841 Ga0268264_10501572 3300028381 Bacteria 1184
842 Ga0268264_10725817 3300028381 Unclassified 988
843 Ga0268264_10802115 3300028381 Unclassified 941
844 Ga0268264_10928752 3300028381 Bacteria 874
845 Ga0265318_10021725 3300028577 Bacteria 2574
846 Ga0307517_10251990 3300028786 Bacteria 1035
847 Ga0265332_10053984 3300031238 Bacteria 1724
848 Ga0265331_10564218 3300031250 Bacteria 513
849 Ga0307408_101488087 3300031548 Unclassified 640
850 Ga0265314_10476031 3300031711 Bacteria 661
851 Ga0316576_10645974 3300031727 Bacteria 770
852 Ga0307410_11975573 3300031852 Bacteria 520
853 Ga0307410_12016734 3300031852 Unclassified 515
854 Ga0307412_10671804 3300031911 Bacteria 886
855 Ga0307409_101967283 3300031995 Bacteria 614
856 Ga0307416_101335115 3300032002 Bacteria 823
857 Ga0307416_101459955 3300032002 Bacteria 790
858 Ga0307415_100683239 3300032126 Bacteria 924
859 Ga0307415_101147579 3300032126 Bacteria 730
860 Ga0373948_0058262 3300034817 Bacteria 843
861 Ga0373926_0042743 3300035083 Bacteria 1621
862 Ga0373926_0233101 3300035083 Unclassified 712
863 Ga0373936_0160316 3300035113 Bacteria 980
864 Ga0373939_0031020 3300035114 Bacteria 1542
865 Ga0373941_0030938 3300035115 Bacteria 1591
866 Ga0373945_0033194 3300035116 Unclassified 1833
867 Ga0373945_0209875 3300035116 Bacteria 811
868 Ga0373956_0111321 3300035119 Bacteria 1275
869 Ga0373956_0205134 3300035119 Bacteria 935
870 Ga0373957_0280901 3300035120 Bacteria 704
871 Ga0373960_0061765 3300035121 Bacteria 1139
872 Ga0373943_0046647 3300035170 Bacteria 2115
873 Ga0373943_0320971 3300035170 Bacteria 883
874 Ga0373943_0693779 3300035170 Unclassified 603
875 Ga0373946_0005466 3300035171 Bacteria 4584
876 Ga0373946_0176115 3300035171 Bacteria 1013
877 Ga0373946_0554469 3300035171 Bacteria 593
878 Ga0373946_0627452 3300035171 Unclassified 559
879 Ga0373955_0065879 3300035172 Bacteria 2012
880 Ga0373955_0164771 3300035172 Bacteria 1310
881 Ga0373955_0394339 3300035172 Unclassified 841
882 Ga0373955_0421258 3300035172 Bacteria 812
883 Ga0373955_0594200 3300035172 Unclassified 678
884 Ga0373962_0013110 3300035242 Bacteria 2095
885 Ga0373924_0006037 3300035410 Bacteria 4322
886 Ga0373931_0026436 3300035691 Bacteria 2954
887 Ga0373935_0074946 3300035692 Bacteria 2189
888 Ga0373935_0914979 3300035692 Bacteria 650
889 Ga0373935_1445141 3300035692 Unclassified 514
890 Ga0373927_0387980 3300035695 Unclassified 921
891 Ga0373933_0113007 3300035724 Bacteria 1696
892 Ga0373933_0740059 3300035724 Unclassified 647
893 Ga0373947_0218138 3300035725 Bacteria 1253
894 Ga0373937_0108531 3300036401 Unclassified 2581
895 Ga0373937_0321795 3300036401 Bacteria 1463
896 Ga0373925_0207301 3300037068 Bacteria 1561
897 Ga0373925_0430024 3300037068 Bacteria 1079
898 Ga0373925_1116740 3300037068 Bacteria 648
899 Ga0373925_1191814 3300037068 Bacteria 626
900 Ga0395901_1807516 3300038443 Unclassified 560
901 Ga0242420_124051 3300038996 Bacteria 565
902 Ga0436365_0144352 3300039437 Unclassified 802
903 Ga0436365_0869875 3300039437 Unclassified 627
904 Ga0436363_0853021 3300039450 Bacteria 1016
905 Ga0439439_0116330 3300041406 Bacteria 744
906 Ga0439453_0128249 3300041408 Unclassified 587
907 Ga0451853_0483904 3300041512 Bacteria 512
908 Ga0451853_3060275 3300041512 Bacteria 571
909 Ga0439431_0074545 3300041997 Bacteria 908
910 Ga0439431_0212481 3300041997 Bacteria 566
911 Ga0439455_0070990 3300042012 Bacteria 936
912 Ga0450914_061023 3300042118 Bacteria 512
913 Ga0450923_052173 3300042125 Bacteria 881
914 Ga0439446_0016101 3300042156 Unclassified 2080
915 Ga0439435_0001925 3300042436 Bacteria 3988
916 Ga0439435_0023577 3300042436 Bacteria 1617
917 Ga0439435_0284399 3300042436 Bacteria 563
918 Ga0450916_008100 3300042530 Unclassified 1273
919 Ga0451577_0212644 3300042876 Bacteria 1747
920 Ga0451577_1252857 3300042876 Unclassified 661
921 Ga0439440_0063940 3300042993 Bacteria 945
922 Ga0466971_0429874 3300044719 Bacteria 646
923 Ga0466959_0269780 3300045049 Bacteria 1170
924 Ga0451576_0563594 3300045051 Bacteria 1197
925 Ga0451576_0620670 3300045051 Bacteria 1136
926 Ga0466967_0704719 3300045976 Bacteria 1000
927 Ga0466967_0746095 3300045976 Bacteria 971
928 Ga0495592_0004184 3300046454 Bacteria 10538
929 Ga0495592_0388408 3300046454 Bacteria 887
930 Ga0495603_0120330 3300046455 Bacteria 1530
931 Ga0495603_0279874 3300046455 Bacteria 959
932 Ga0495629_0137460 3300046459 Bacteria 1701
933 Ga0495629_0218286 3300046459 Bacteria 1316
934 Ga0495629_0587510 3300046459 Bacteria 746
935 Ga0495629_1067070 3300046459 Bacteria 523
936 Ga0495580_0083086 3300046472 Bacteria 2232
937 Ga0495580_0956447 3300046472 Unclassified 548
938 Ga0495582_0285867 3300046473 Unclassified 947
939 Ga0495639_0200820 3300046475 Bacteria 976
940 Ga0495639_0249810 3300046475 Bacteria 877
941 Ga0495594_0046875 3300046499 Bacteria 2374
942 Ga0495594_0425723 3300046499 Bacteria 755
943 Ga0495608_0014823 3300046511 Bacteria 5408
944 Ga0495618_0382931 3300046514 Bacteria 863
945 Ga0495628_0050827 3300046516 Bacteria 3278
946 Ga0495628_0341099 3300046516 Bacteria 1103
947 Ga0495630_0002518 3300046517 Bacteria 12703
948 Ga0495630_0454796 3300046517 Unclassified 981
949 Ga0495642_0462702 3300046528 Bacteria 561
950 Ga0495642_0531503 3300046528 Unclassified 521
951 Ga0495652_0079043 3300046529 Bacteria 2721
952 Ga0495665_0336919 3300046531 Bacteria 769
953 Ga0495640_0163548 3300046533 Bacteria 1425
954 Ga0495640_0394052 3300046533 Unclassified 851
955 Ga0495586_0369224 3300046535 Unclassified 825
956 Ga0495598_0071778 3300046537 Bacteria 1092
957 Ga0495621_0006942 3300046539 Bacteria 3332
958 Ga0495645_0031018 3300046543 Bacteria 3893
959 Ga0495633_0049958 3300046558 Unclassified 1973
960 Ga0495667_0205893 3300046559 Unclassified 1258
961 Ga0495656_0021020 3300046615 Bacteria 2537
962 Ga0495635_0903919 3300046663 Unclassified 565
963 Ga0495659_0054692 3300046664 Bacteria 1461
964 Ga0495659_0100318 3300046664 Bacteria 1121
965 Ga0495659_0300159 3300046664 Bacteria 678
966 Ga0495599_0478875 3300046678 Bacteria 735
967 Ga0495599_0521707 3300046678 Unclassified 698
968 Ga0495599_0709609 3300046678 Unclassified 579
969 Ga0495647_0557583 3300046681 Bacteria 536
970 Ga0495658_0201308 3300046683 Unclassified 1241
971 Ga0495658_0387374 3300046683 Bacteria 890
972 Ga0495658_0774041 3300046683 Unclassified 614
973 Ga0495669_0057656 3300046684 Bacteria 1752
974 Ga0495613_0002160 3300046689 Bacteria 14908
975 Ga0495613_0361043 3300046689 Unclassified 996
976 Ga0495624_0865524 3300046690 Unclassified 533
977 Ga0495624_0875961 3300046690 Bacteria 529
978 Ga0495624_0927928 3300046690 Unclassified 512
979 Ga0495600_0021685 3300046809 Bacteria 4118
980 Ga0495660_0442735 3300046810 Unclassified 563
981 Ga0495604_0215270 3300047317 Bacteria 1326
982 Ga0495636_0492593 3300047318 Unclassified 592
983 Ga0495674_0160785 3300047319 Unclassified 1879
984 Ga0495674_0458821 3300047319 Bacteria 1023
985 Ga0495674_0477154 3300047319 Bacteria 1000
986 Ga0495676_0817211 3300047321 Bacteria 600
987 Ga0495676_1068697 3300047321 Bacteria 514
988 Ga0495680_0328174 3300047322 Unclassified 1069
989 Ga0495680_0339993 3300047322 Bacteria 1047
990 Ga0495684_0000806 3300047471 Bacteria 25387
991 Ga0495684_0089655 3300047471 Bacteria 2330
992 Ga0495684_0333698 3300047471 Bacteria 1081
993 Ga0496100_0014084 3300048903 Bacteria 4635
994 Ga0496100_0178802 3300048903 Bacteria 1533
995 Ga0496101_0000865 3300048904 Bacteria 17908
996 Ga0496101_0115077 3300048904 Bacteria 2028
997 Ga0496102_0249331 3300048905 Bacteria 1674
998 Ga0496104_0012188 3300048907 Bacteria 7724
999 Ga0496104_0024834 3300048907 Bacteria 5518
1000 Ga0496104_0073240 3300048907 Unclassified 3259
1001 Ga0496104_0383558 3300048907 Bacteria 1318
1002 Ga0496105_0289093 3300048908 Bacteria 1320
1003 Ga0496106_0222151 3300048909 Bacteria 1507
1004 Ga0496106_0875254 3300048909 Bacteria 710
1005 Ga0496107_0760207 3300048910 Unclassified 711
1006 Ga0496107_1144038 3300048910 Bacteria 561
1007 Ga0496108_0151195 3300048911 Bacteria 2003
1008 Ga0496108_0193170 3300048911 Bacteria 1765
1009 Ga0496108_0359451 3300048911 Bacteria 1271
1010 Ga0496108_1405896 3300048911 Bacteria 583
1011 Ga0496109_0277579 3300048912 Bacteria 1579
1012 Ga0496109_0436734 3300048912 Bacteria 1237
1013 Ga0496109_0476928 3300048912 Bacteria 1178
1014 Ga0496109_1221812 3300048912 Bacteria 688
1015 Ga0496110_0077563 3300048913 Bacteria 2956
1016 Ga0496110_0509108 3300048913 Bacteria 1096
1017 Ga0496110_1285517 3300048913 Bacteria 641
1018 Ga0496111_0146270 3300048914 Bacteria 1752
1019 Ga0496111_1083079 3300048914 Bacteria 572
1020 Ga0496112_0029928 3300048915 Bacteria 5267
1021 Ga0496112_0054131 3300048915 Bacteria 3942
1022 Ga0496112_0337039 3300048915 Bacteria 1452
1023 Ga0496112_0742907 3300048915 Unclassified 908
1024 Ga0496112_0839126 3300048915 Unclassified 843
1025 Ga0496112_1080951 3300048915 Bacteria 721
1026 Ga0496112_1456085 3300048915 Unclassified 599
1027 Ga0496112_1840162 3300048915 Bacteria 517
1028 Ga0496113_0119037 3300048916 Bacteria 2063
1029 Ga0496113_0145309 3300048916 Bacteria 1868
1030 Ga0496113_1029311 3300048916 Bacteria 648
1031 Ga0496113_1283387 3300048916 Bacteria 570
1032 Ga0496113_1374943 3300048916 Bacteria 547
1033 Ga0496114_0002816 3300048917 Bacteria 13321
1034 Ga0496114_0122843 3300048917 Bacteria 2235
1035 Ga0496114_0400756 3300048917 Bacteria 1215
1036 Ga0496114_0762834 3300048917 Bacteria 845
1037 Ga0496114_0849217 3300048917 Bacteria 793
1038 Ga0496114_1388921 3300048917 Bacteria 590
1039 Ga0496115_0012590 3300048918 Bacteria 6372
1040 Ga0501034_0020919 3300049571 Bacteria 6680
1041 Ga0501034_0082399 3300049571 Bacteria 3219
1042 Ga0501036_0413994 3300049572 Bacteria 1124
1043 Ga0501039_0813186 3300049575 Bacteria 729
1044 Ga0501039_1113845 3300049575 Bacteria 612
1045 Ga0501039_1305341 3300049575 Bacteria 560
1046 Ga0501040_0002471 3300049576 Bacteria 11899
1047 Ga0501040_0285335 3300049576 Bacteria 1179
1048 Ga0501041_0062843 3300049577 Bacteria 2274
1049 Ga0501041_0251733 3300049577 Bacteria 1110
1050 Ga0501042_0034042 3300049578 Bacteria 3613
1051 Ga0501042_0223268 3300049578 Bacteria 1359
1052 Ga0501042_1277274 3300049578 Unclassified 535
1053 Ga0501043_0033720 3300049579 Bacteria 4029
1054 Ga0501046_0442179 3300049580 Bacteria 936
1055 Ga0501047_0037801 3300049581 Bacteria 4668
1056 Ga0501047_1426611 3300049581 Bacteria 508
1057 Ga0501048_0352346 3300049582 Unclassified 1050
1058 Ga0501067_0131711 3300049583 Bacteria 1392
1059 Ga0501067_0471335 3300049583 Bacteria 702
1060 Ga0501067_0604389 3300049583 Bacteria 615
1061 Ga0501068_0182206 3300049584 Bacteria 1328
1062 Ga0501068_1014524 3300049584 Unclassified 548
1063 Ga0501069_0396016 3300049585 Bacteria 817
1064 Ga0501071_0023181 3300049587 Bacteria 4334
1065 Ga0501071_0049981 3300049587 Bacteria 3011
1066 Ga0501071_0660889 3300049587 Bacteria 804
1067 Ga0501072_1021303 3300049588 Bacteria 644
1068 Ga0501073_0539290 3300049589 Bacteria 806
1069 Ga0501074_0149350 3300049590 Bacteria 1671
1070 Ga0501075_0205240 3300049591 Bacteria 1503
1071 Ga0501075_0455525 3300049591 Bacteria 976
1072 Ga0501075_0687028 3300049591 Bacteria 780
1073 Ga0501075_0918674 3300049591 Bacteria 665
1074 Ga0501076_0003692 3300049592 Bacteria 10768
1075 Ga0501076_0044241 3300049592 Unclassified 3511
1076 Ga0501076_0217999 3300049592 Bacteria 1560
1077 Ga0501214_102563 3300049659 Unclassified 505
1078 Ga0501243_071780 3300049675 Bacteria 659
1079 Ga0501079_0019810 3300049741 Bacteria 5141
1080 Ga0501079_0051096 3300049741 Bacteria 3191
1081 Ga0501079_0850517 3300049741 Bacteria 718
1082 Ga0501079_1042412 3300049741 Unclassified 644
1083 Ga0501080_0267929 3300049742 Bacteria 1555
1084 Ga0501080_0531245 3300049742 Unclassified 1049
1085 Ga0501081_0000392 3300049743 Bacteria 24176
1086 Ga0501081_0553500 3300049743 Bacteria 859
1087 Ga0501081_0616844 3300049743 Bacteria 812
1088 Ga0501083_0316576 3300049744 Bacteria 1015
1089 Ga0501083_0671142 3300049744 Unclassified 674
1090 Ga0501268_169482 3300049765 Unclassified 514
1091 Ga0501270_134903 3300049767 Unclassified 550
1092 Ga0501044_0002002 3300049823 Bacteria 23517
1093 Ga0501045_0046238 3300049824 Bacteria 3169
1094 Ga0501045_0116029 3300049824 Bacteria 1986
1095 nmdc:mga04h51_178688_c1 3300050495 Unclassified 825
1096 nmdc:mga05p37_10269_c1 3300050507 Bacteria 11117
1097 nmdc:mga05p37_1376256_c1 3300050507 Unclassified 713
1098 nmdc:mga05p37_161639_c1 3300050507 Bacteria 2735
1099 nmdc:mga05p37_194423_c1 3300050507 Bacteria 2461
1100 nmdc:mga05p37_227452_c1 3300050507 Bacteria 2248
1101 nmdc:mga05p37_24653_c1 3300050507 Bacteria 7312
1102 nmdc:mga05p37_263151_c1 3300050507 Bacteria 2063
1103 nmdc:mga05p37_30909_c1 3300050507 Bacteria 6537
1104 nmdc:mga05p37_3502_c1 3300050507 Bacteria 18353
1105 nmdc:mga05p37_50821_c1 3300050507 Bacteria 5098
1106 nmdc:mga05p37_53469_c1 3300050507 Bacteria 4966
1107 nmdc:mga05p37_65728_c1 3300050507 Bacteria 4462
1108 nmdc:mga05p37_76741_c1 3300050507 Bacteria 4113
1109 nmdc:mga05p37_79178_c1 3300050507 Bacteria 4047
1110 nmdc:mga05p37_83155_c1 3300050507 Bacteria 3943
1111 nmdc:mga05p37_85834_c2 3300050507 Bacteria 2585
1112 nmdc:mga05p37_878669_c1 3300050507 Bacteria 970
1113 nmdc:mga09592_160869_c1 3300050508 Bacteria 1939
1114 nmdc:mga09592_172387_c1 3300050508 Bacteria 1871
1115 nmdc:mga09592_31926_c1 3300050508 Bacteria 4389
1116 nmdc:mga09592_830557_c1 3300050508 Bacteria 780
1117 nmdc:mga0qj67_241032_c1 3300050509 Bacteria 1467
1118 nmdc:mga0qj67_286739_c1 3300050509 Bacteria 1334
1119 nmdc:mga0qj67_50929_c1 3300050509 Bacteria 3274
1120 nmdc:mga0qj67_8288_c1 3300050509 Bacteria 7705
1121 nmdc:mga06r32_140925_c1 3300050510 Bacteria 2387
1122 nmdc:mga06r32_202931_c1 3300050510 Bacteria 1970
1123 nmdc:mga06r32_265492_c1 3300050510 Bacteria 1704
1124 nmdc:mga06r32_553588_c1 3300050510 Unclassified 1124
1125 nmdc:mga06r32_73611_c1 3300050510 Bacteria 3310
1126 nmdc:mga08y16_142486_c1 3300050511 Bacteria 2492
1127 nmdc:mga08y16_24817_c1 3300050511 Bacteria 6326
1128 nmdc:mga08y16_34064_c1 3300050511 Bacteria 5350
1129 nmdc:mga08y16_35410_c1 3300050511 Bacteria 5242
1130 nmdc:mga08y16_547671_c1 3300050511 Bacteria 1171
1131 nmdc:mga08y16_89984_c2 3300050511 Bacteria 2215
1132 nmdc:mga08y16_9374_c1 3300050511 Bacteria 10268
1133 nmdc:mga0n895_104719_c1 3300050512 Bacteria 2842
1134 nmdc:mga0n895_1909573_c1 3300050512 Bacteria 553
1135 nmdc:mga0n895_2102075_c1 3300050512 Bacteria 521
1136 nmdc:mga0n895_21_c1 3300050512 Bacteria 93738
1137 nmdc:mga0n895_438051_c1 3300050512 Bacteria 1320
1138 nmdc:mga0n895_507800_c1 3300050512 Bacteria 1214
1139 nmdc:mga0n895_70703_c1 3300050512 Bacteria 3459
1140 nmdc:mga0n895_713782_c1 3300050512 Bacteria 998
1141 nmdc:mga0n895_81754_c1 3300050512 Bacteria 3219
1142 nmdc:mga0n895_855810_c1 3300050512 Bacteria 897
1143 nmdc:mga0n895_872062_c1 3300050512 Viruses 887
1144 nmdc:mga0n895_90637_c1 3300050512 Bacteria 3059
1145 nmdc:mga0rr50_153055_c1 3300050513 Bacteria 1866
1146 nmdc:mga0rr50_36154_c1 3300050513 Bacteria 3554
1147 nmdc:mga0rr50_636611_c1 3300050513 Archaea 910
1148 nmdc:mga0rr50_663697_c1 3300050513 Bacteria 890
1149 nmdc:mga0rr50_83848_c1 3300050513 Bacteria 2466
1150 nmdc:mga0rr50_868418_c1 3300050513 Bacteria 769
1151 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
1152 nmdc:mga0rr50_96006_c1 3300050513 Bacteria 2318
1153 nmdc:mga08x19_1149615_c1 3300050514 Unclassified 551
1154 nmdc:mga08x19_181580_c1 3300050514 Bacteria 1437
1155 nmdc:mga08x19_28342_c1 3300050514 Bacteria 3506
1156 nmdc:mga08x19_29254_c1 3300050514 Bacteria 3455
1157 nmdc:mga08x19_32007_c1 3300050514 Bacteria 3313
1158 nmdc:mga08x19_333_c1 3300050514 Bacteria 34084
1159 nmdc:mga08x19_7264_c1 3300050514 Bacteria 6578
1160 nmdc:mga0a205_1073428_c1 3300050515 Bacteria 652
1161 nmdc:mga0a205_117529_c1 3300050515 Bacteria 2557
1162 nmdc:mga0a205_215507_c1 3300050515 Bacteria 1807
1163 nmdc:mga0a205_270879_c1 3300050515 Bacteria 1575
1164 nmdc:mga0a205_314950_c1 3300050515 Bacteria 1436
1165 nmdc:mga0a205_3697_c1 3300050515 Bacteria 13689
1166 nmdc:mga0a205_37760_c1 3300050515 Bacteria 4644
1167 nmdc:mga0a205_427402_c1 3300050515 Bacteria 1186
1168 nmdc:mga0a205_510072_c1 3300050515 Bacteria 1059
1169 nmdc:mga0a205_592562_c1 3300050515 Bacteria 962
1170 nmdc:mga0a205_68215_c1 3300050515 Bacteria 3435
1171 nmdc:mga0a205_76248_c1 3300050515 Bacteria 3240
1172 nmdc:mga0a205_785652_c1 3300050515 Bacteria 800
1173 nmdc:mga0a205_865178_c1 3300050515 Bacteria 751
1174 nmdc:mga0a205_91564_c1 3300050515 Bacteria 2939
1175 Ga0495601_0005780 3300053077 Bacteria 7218
1176 Ga0495601_0062414 3300053077 Bacteria 2367
1177 Ga0495612_0321859 3300053078 Unclassified 696
1178 Ga0495595_0130849 3300053084 Unclassified 1226
1179 Ga0495595_0559026 3300053084 Bacteria 584
1180 Ga0495619_0002732 3300053085 Bacteria 11524
1181 Ga0495619_0034475 3300053085 Bacteria 3291
1182 Ga0495619_0140417 3300053085 Bacteria 1663
1183 Ga0495619_0331761 3300053085 Bacteria 1053
1184 Ga0495619_0502354 3300053085 Bacteria 834
1185 Ga0500555_000372 3300053103 Bacteria 19028
1186 Ga0500592_033064 3300053116 Bacteria 834
1187 Ga0500616_0002270 3300053153 Bacteria 16325
1188 Ga0500645_000759 3300053730 Bacteria 19735
1189 Ga0500599_009585 3300053736 Bacteria 1270
1190 Ga0501084_0003674 3300054114 Bacteria 12448
1191 Ga0587083_0223031 3300059505 Unclassified 549
1192 Ga0501082_0146115 3300060353 Bacteria 2053
1193 Ga0501082_0256042 3300060353 Bacteria 1523
1194 Ga0501082_1099971 3300060353 Bacteria 695
1195 Ga0530510_0321404 3300061734 Unclassified 1160
1196 Ga0070675_100000134
1197 JGI24751J29686_10016552
1198 Ga0065714_10160523
1199 Ga0065714_10533961
1200 Ga0065704_10188839
1201 Ga0065704_10405409
1202 Ga0065704_10505288
1203 Ga0065704_10868077
1204 Ga0065712_10000765
1205 Ga0065712_10035153
1206 Ga0065712_10082586
1207 Ga0065712_10095885
1208 Ga0065712_10144071
1209 Ga0065712_10207745
1210 Ga0065712_10231163
1211 Ga0065712_10371614
1212 Ga0065712_10522083
1213 Ga0065715_10033140
1214 Ga0065715_10105686
1215 Ga0065715_10246880
1216 Ga0065715_10403290
1217 Ga0065715_10892833
1218 Ga0065715_10916438
1219 Ga0065707_10125519
1220 Ga0065707_10134727
1221 Ga0065707_10328858
1222 Ga0065707_10364278
1223 Ga0065707_10481335
1224 Ga0065707_10610947
1225 Ga0065707_10665113
1226 Ga0065707_11095655
1227 Ga0070658_10730702
1228 Ga0070658_10781831
1229 Ga0070676_10000772
1230 Ga0070676_10325474
1231 Ga0070676_10641715
1232 Ga0070676_10855102
1233 Ga0070683_101361446
1234 Ga0070690_100164674
1235 Ga0070690_100211653
1236 Ga0070690_100314300
1237 Ga0070690_100358136
1238 Ga0070670_100048051
1239 Ga0070670_100102159
1240 Ga0070670_100141463
1241 Ga0070670_100240069
1242 Ga0070670_100926738
1243 Ga0070677_10004884
1244 Ga0070677_10258656
1245 Ga0070677_10333427
1246 Ga0068869_100342621
1247 Ga0068869_100755543
1248 Ga0068869_101101412
1249 Ga0070666_10035634
1250 Ga0070666_10300052
1251 Ga0070666_11118140
1252 Ga0070680_100163111
1253 Ga0070680_101930326
1254 Ga0068868_100171717
1255 Ga0068868_100208417
1256 Ga0068868_100351247
1257 Ga0068868_100457726
1258 Ga0068868_100811627
1259 Ga0068868_100832922
1260 Ga0068868_100893058
1261 Ga0068868_101955778
1262 Ga0070660_100099088
1263 Ga0070689_100008989
1264 Ga0070689_100168468
1265 Ga0070689_100655144
1266 Ga0070689_100690235
1267 Ga0070689_100859376
1268 Ga0070689_100946589
1269 Ga0070689_101404658
1270 Ga0070691_10008801
1271 Ga0070691_10557864
1272 Ga0070687_100096394
1273 Ga0070687_101296803
1274 Ga0070687_101381919
1275 Ga0070661_100223775
1276 Ga0070692_10799808
1277 Ga0070668_100241033
1278 Ga0070668_100771779
1279 Ga0070669_100062836
1280 Ga0070669_100063629
1281 Ga0070669_100365915
1282 Ga0070669_100384749
1283 Ga0070669_100495575
1284 Ga0070669_100888754
1285 Ga0070669_100999164
1286 Ga0070669_101292534
1287 Ga0070675_100002703
1288 Ga0070675_100008521
1289 Ga0070675_100022828
1290 Ga0070675_100165463
1291 Ga0070675_100323880
1292 Ga0070675_100942452
1293 Ga0070675_100966217
1294 Ga0070675_101114548
1295 Ga0070671_100009515
1296 Ga0070671_100283227
1297 Ga0070671_100319526
1298 Ga0070674_100017147
1299 Ga0070674_100020633
1300 Ga0070674_100056993
1301 Ga0070674_100132955
1302 Ga0070674_101045952
1303 Ga0070674_101137569
1304 Ga0070674_101831847
1305 Ga0070673_100025022
1306 Ga0070673_100034160
1307 Ga0070673_100117570
1308 Ga0070673_100140159
1309 Ga0070673_100152192
1310 Ga0070673_100266605
1311 Ga0070673_100307331
1312 Ga0070673_100528290
1313 Ga0070673_101271344
1314 Ga0070688_100227079
1315 Ga0070688_100761117
1316 Ga0070688_101278511
1317 Ga0070688_101698052
1318 Ga0070659_100548765
1319 Ga0070659_100942786
1320 Ga0070667_100079430
1321 Ga0070667_101315544
1322 Ga0070667_102122890
1323 Ga0070703_10020068
1324 Ga0070703_10508517
1325 Ga0070709_10300047
1326 Ga0070709_10401991
1327 Ga0070709_10418295
1328 Ga0070709_10476254
1329 Ga0070714_100136830
1330 Ga0070713_101106507
1331 Ga0070713_101583405
1332 Ga0070701_10002074
1333 Ga0070701_10109417
1334 Ga0070701_10591492
1335 Ga0070701_11339991
1336 Ga0070705_100019380
1337 Ga0070705_100567823
1338 Ga0070705_100784084
1339 Ga0070705_101168658
1340 Ga0070700_100009721
1341 Ga0070700_100057416
1342 Ga0070700_100104044
1343 Ga0070700_100575683
1344 Ga0070700_100819963
1345 Ga0070700_100824854
1346 Ga0070700_101093215
1347 Ga0070700_101208174
1348 Ga0070700_101776853
1349 Ga0070694_100001478
1350 Ga0070694_100065942
1351 Ga0070694_100136129
1352 Ga0070694_100503083
1353 Ga0070694_100879708
1354 Ga0070694_101024545
1355 Ga0070708_100587427
1356 Ga0070708_100613021
1357 Ga0070708_101397083
1358 Ga0070708_102244767
1359 Ga0070663_100427782
1360 Ga0070663_100921028
1361 Ga0070663_101848390
1362 Ga0070678_100121981
1363 Ga0070678_100875804
1364 Ga0070678_101146819
1365 Ga0070662_100221461
1366 Ga0070662_100575182
1367 Ga0070662_101735280
1368 Ga0070681_10116786
1369 Ga0070681_10424927
1370 Ga0068867_100017505
1371 Ga0068867_100246682
1372 Ga0068867_100452098
1373 Ga0068867_100577717
1374 Ga0068867_100844649
1375 Ga0068867_101083765
1376 Ga0070685_10635418
1377 Ga0070685_10650683
1378 Ga0070685_11012514
1379 Ga0070685_11403072
1380 Ga0070706_100235072
1381 Ga0070706_100427223
1382 Ga0070706_102022602
1383 Ga0070706_102146135
1384 Ga0070707_100064770
1385 Ga0070707_100234791
1386 Ga0070707_100302281
1387 Ga0070707_100316041
1388 Ga0070698_100059643
1389 Ga0070698_102112967
1390 Ga0070699_100050398
1391 Ga0070699_100063912
1392 Ga0070699_100190054
1393 Ga0070699_100228567
1394 Ga0070699_100474743
1395 Ga0070699_100995424
1396 Ga0070679_100314796
1397 Ga0070684_100327827
1398 Ga0070684_100418333
1399 Ga0070697_100008387
1400 Ga0070697_100827524
1401 Ga0070697_101291461
1402 Ga0068853_100624975
1403 Ga0070672_100013127
1404 Ga0070672_100277989
1405 Ga0070672_100299916
1406 Ga0070672_100516389
1407 Ga0070672_100643624
1408 Ga0070686_100050701
1409 Ga0070686_100064219
1410 Ga0070686_100224057
1411 Ga0070686_100470409
1412 Ga0070686_100886657
1413 Ga0070686_101486139
1414 Ga0070686_101933208
1415 Ga0070695_100002536
1416 Ga0070695_100078770
1417 Ga0070695_100436680
1418 Ga0070695_100499463
1419 Ga0070695_101632009
1420 Ga0070696_100010555
1421 Ga0070696_100508037
1422 Ga0070696_100574405
1423 Ga0070665_100025305
1424 Ga0070665_100314168
1425 Ga0070665_100631931
1426 Ga0070665_102492710
1427 Ga0070704_100014214
1428 Ga0070704_100040555
1429 Ga0070704_100243506
1430 Ga0070704_100372419
1431 Ga0070704_100437996
1432 Ga0070704_100446260
1433 Ga0070704_100709577
1434 Ga0070704_100794509
1435 Ga0070704_101394941
1436 Ga0068855_101429536
1437 Ga0068855_101508956
1438 Ga0068855_102352301
1439 Ga0070664_100151184
1440 Ga0070664_100384948
1441 Ga0070664_100389872
1442 Ga0070664_100468096
1443 Ga0070664_101783518
1444 Ga0068857_100201607
1445 Ga0068857_100435014
1446 Ga0068857_100726669
1447 Ga0068857_101152836
1448 Ga0068857_101750966
1449 Ga0068854_100119605
1450 Ga0068856_100934547
1451 Ga0070702_100368232
1452 Ga0068852_101371134
1453 Ga0068859_100027412
1454 Ga0068859_100215636
1455 Ga0068859_100260967
1456 Ga0068859_100365710
1457 Ga0068859_100562358
1458 Ga0068859_100656459
1459 Ga0068859_100831627
1460 Ga0068859_100942749
1461 Ga0068859_101219439
1462 Ga0068864_100009227
1463 Ga0068864_101272326
1464 Ga0068864_101343136
1465 Ga0068866_10406107
1466 Ga0068866_10657649
1467 Ga0068866_10820849
1468 Ga0068861_100007607
1469 Ga0068861_100033834
1470 Ga0068861_100974389
1471 Ga0068861_101132066
1472 Ga0068861_101243877
1473 Ga0068861_101410520
1474 Ga0068861_101924740
1475 Ga0068861_101945860
1476 Ga0068861_102382621
1477 Ga0068851_10121746
1478 Ga0068851_10561394
1479 Ga0068870_10016844
1480 Ga0068870_10122485
1481 Ga0068870_11191782
1482 Ga0068863_100086786
1483 Ga0068863_100451414
1484 Ga0068863_100845972
1485 Ga0068858_100002143
1486 Ga0068858_100099690
1487 Ga0068858_100103521
1488 Ga0068858_100243517
1489 Ga0068858_100948861
1490 Ga0068858_101188379
1491 Ga0068858_101762673
1492 Ga0068858_102226323
1493 Ga0068860_100034524
1494 Ga0068860_100235752
1495 Ga0068860_100326753
1496 Ga0068860_100746892
1497 Ga0068860_101019461
1498 Ga0068860_101535593
1499 Ga0068860_101841816
1500 Ga0068860_101847625
1501 Ga0068862_100014479
1502 Ga0068862_100035548
1503 Ga0068862_100113824
1504 Ga0068862_100169199
1505 Ga0068862_100961766
1506 Ga0068862_101563974
1507 Ga0081455_10102580
1508 Ga0081455_10240787
1509 Ga0081539_10047623
1510 Ga0075364_10102384
1511 Ga0070715_10168785
1512 Ga0070715_10378586
1513 Ga0070715_10451177
1514 Ga0070715_10692770
1515 Ga0070715_10791405
1516 Ga0070716_100025743
1517 Ga0070716_100121975
1518 Ga0070712_100745231
1519 Ga0097621_100001741
1520 Ga0097621_100027247
1521 Ga0097621_100070046
1522 Ga0097621_100071815
1523 Ga0097621_100072229
1524 Ga0097621_100194268
1525 Ga0097621_100195647
1526 Ga0097621_100330060
1527 Ga0097621_101091041
1528 Ga0097621_101556869
1529 Ga0097621_101603236
1530 Ga0097621_101787731
1531 Ga0068871_100004322
1532 Ga0068871_100048945
1533 Ga0068871_100049837
1534 Ga0068871_100105817
1535 Ga0068871_100122217
1536 Ga0068871_100237647
1537 Ga0068871_100428206
1538 Ga0068871_100606717
1539 Ga0068871_100785107
1540 Ga0068871_100971119
1541 Ga0068871_101515046
1542 Ga0075428_100146252
1543 Ga0075428_100158491
1544 Ga0075428_100382935
1545 Ga0075428_101202532
1546 Ga0075428_101505069
1547 Ga0075430_100004158
1548 Ga0075430_100198468
1549 Ga0075430_100668803
1550 Ga0075430_101664101
1551 Ga0075430_101769986
1552 Ga0075431_100043715
1553 Ga0075431_100329318
1554 Ga0075431_101969089
1555 Ga0075433_10090444
1556 Ga0075433_10224618
1557 Ga0075433_10380098
1558 Ga0075433_10382997
1559 Ga0075433_10489761
1560 Ga0075433_10903031
1561 Ga0075434_100000442
1562 Ga0075434_100053203
1563 Ga0075434_100084709
1564 Ga0075434_100501206
1565 Ga0075434_100533949
1566 Ga0075434_100732415
1567 Ga0075434_101337624
1568 Ga0075434_102007761
1569 Ga0075429_100022819
1570 Ga0075429_100085016
1571 Ga0075429_101901267
1572 Ga0075429_101943314
1573 Ga0068865_100037132
1574 Ga0068865_100072828
1575 Ga0068865_100123440
1576 Ga0068865_100396916
1577 Ga0068865_100452379
1578 Ga0068865_100455973
1579 Ga0068865_100540878
1580 Ga0075436_100002424
1581 Ga0075436_100040069
1582 Ga0075436_100045445
1583 Ga0075436_100067944
1584 Ga0075436_100301508
1585 Ga0075436_100710955
1586 Ga0075436_101241538
1587 Ga0097620_100027412
1588 Ga0097620_100215630
1589 Ga0097620_100260968
1590 Ga0097620_100365705
1591 Ga0097620_100562343
1592 Ga0097620_100656525
1593 Ga0097620_100831657
1594 Ga0097620_100942761
1595 Ga0097620_101219555
1596 Ga0075435_100000293
1597 Ga0075435_100007134
1598 Ga0075435_100035336
1599 Ga0075435_100043143
1600 Ga0075435_100143226
1601 Ga0075435_100327567
1602 Ga0075435_101706909
1603 Ga0075435_101914637
1604 Ga0099794_10088213
1605 Ga0105251_10515183
1606 Ga0105240_10035120
1607 Ga0105240_10946989
1608 Ga0111539_10006183
1609 Ga0111539_10026198
1610 Ga0111539_10043751
1611 Ga0111539_10158522
1612 Ga0111539_10273428
1613 Ga0111539_10515979
1614 Ga0111539_11302430
1615 Ga0111539_11556778
1616 Ga0111539_12136601
1617 Ga0111539_13312134
1618 Ga0105245_10016947
1619 Ga0105245_10364918
1620 Ga0105245_10609377
1621 Ga0105245_10794356
1622 Ga0105245_10903170
1623 Ga0105245_11058678
1624 Ga0105245_12014394
1625 Ga0105247_10004717
1626 Ga0105247_10021795
1627 Ga0105247_10206195
1628 Ga0105247_10449162
1629 Ga0105247_10509543
1630 Ga0105247_10890263
1631 Ga0114129_10002338
1632 Ga0114129_10003015
1633 Ga0114129_10006687
1634 Ga0114129_10015456
1635 Ga0114129_10021659
1636 Ga0114129_10023706
1637 Ga0114129_10024455
1638 Ga0114129_10056128
1639 Ga0114129_10093219
1640 Ga0114129_10130821
1641 Ga0114129_10165292
1642 Ga0114129_10309202
1643 Ga0114129_10330140
1644 Ga0114129_10391996
1645 Ga0114129_10719047
1646 Ga0114129_10747510
1647 Ga0114129_10816663
1648 Ga0114129_11222011
1649 Ga0114129_11530256
1650 Ga0114129_12062384
1651 Ga0105243_10012745
1652 Ga0105243_10018903
1653 Ga0105243_10775857
1654 Ga0105243_10963781
1655 Ga0105243_11164771
1656 Ga0105243_12070034
1657 Ga0105241_10762047
1658 Ga0105241_11607033
1659 Ga0105242_10002327
1660 Ga0105242_10006370
1661 Ga0105242_10030730
1662 Ga0105242_10052566
1663 Ga0105242_10063391
1664 Ga0105242_10087968
1665 Ga0105242_10104858
1666 Ga0105242_11119920
1667 Ga0105242_11335250
1668 Ga0105242_11392049
1669 Ga0105242_11687885
1670 Ga0105242_11712145
1671 Ga0105248_10002926
1672 Ga0105248_10015582
1673 Ga0105248_10024188
1674 Ga0105248_10026562
1675 Ga0105248_10137376
1676 Ga0105248_10175193
1677 Ga0105248_10266439
1678 Ga0105248_10313723
1679 Ga0105248_10371278
1680 Ga0105248_10395460
1681 Ga0105248_10624748
1682 Ga0105248_10646152
1683 Ga0105248_11075440
1684 Ga0105248_11631447
1685 Ga0105248_12274296
1686 Ga0105248_12463435
1687 Ga0105248_12836199
1688 Ga0105237_10361885
1689 Ga0105237_10598633
1690 Ga0105238_10680748
1691 Ga0105238_10928520
1692 Ga0105238_11702631
1693 Ga0105238_11902489
1694 Ga0105238_11982788
1695 Ga0105238_12586549
1696 Ga0105238_13045308
1697 Ga0105249_10436392
1698 Ga0105249_10949474
1699 Ga0105249_10954700
1700 Ga0105249_10965495
1701 Ga0105249_11236724
1702 Ga0105249_11551305
1703 Ga0105249_11674546
1704 Ga0105249_13162817
1705 Ga0099796_10078136
1706 Ga0105239_13015784
1707 Ga0105246_10167791
1708 Ga0105246_11295792
1709 Ga0105246_11358703
1710 Ga0105246_12449893
1711 Ga0157373_11063032
1712 Ga0157370_10981895
1713 Ga0157374_11196983
1714 Ga0157374_12069825
1715 Ga0157374_12785113
1716 Ga0157378_10223182
1717 Ga0157378_10321628
1718 Ga0157378_10413306
1719 Ga0157378_10852836
1720 Ga0157378_10976886
1721 Ga0157378_11372238
1722 Ga0157378_12064115
1723 Ga0157378_12421608
1724 Ga0157378_12866413
1725 Ga0163162_10028358
1726 Ga0163162_10068695
1727 Ga0163162_10476287
1728 Ga0163162_10602197
1729 Ga0163162_10851411
1730 Ga0163162_11270779
1731 Ga0163162_11657337
1732 Ga0163162_11681227
1733 Ga0163162_12630709
1734 Ga0163162_12977168
1735 Ga0163162_13051436
1736 Ga0157375_10062206
1737 Ga0157375_10117857
1738 Ga0157375_10122224
1739 Ga0157375_10377809
1740 Ga0157375_10464817
1741 Ga0157375_10656638
1742 Ga0157375_12150477
1743 Ga0157375_12290989
1744 Ga0157375_12579682
1745 Ga0157375_12953967
1746 Ga0163163_10076767
1747 Ga0163163_10135331
1748 Ga0163163_10168310
1749 Ga0163163_10297120
1750 Ga0163163_10930714
1751 Ga0163163_11929317
1752 Ga0157380_10034605
1753 Ga0157380_10173938
1754 Ga0157380_10304102
1755 Ga0157380_10346606
1756 Ga0157380_10605790
1757 Ga0157380_10663131
1758 Ga0157380_10836651
1759 Ga0157380_10998482
1760 Ga0157380_11382119
1761 Ga0157380_11629018
1762 Ga0157380_12880939
1763 Ga0157380_13303060
1764 Ga0157377_10018733
1765 Ga0157377_10086187
1766 Ga0157377_10460452
1767 Ga0157379_10014346
1768 Ga0157379_10041606
1769 Ga0157379_10080766
1770 Ga0157379_10273652
1771 Ga0157379_10901270
1772 Ga0157379_11586079
1773 Ga0157379_12548682
1774 Ga0157376_10039775
1775 Ga0157376_10122636
1776 Ga0157376_10150650
1777 Ga0157376_10183534
1778 Ga0157376_10244744
1779 Ga0157376_10496888
1780 Ga0157376_10735570
1781 Ga0157376_11475657
1782 Ga0157376_12851106
1783 Ga0182005_1065484
1784 Ga0163161_10143558
1785 Ga0163161_10264533
1786 Ga0163161_10482107
1787 Ga0163161_12042270
1788 Ga0207697_10071482
1789 Ga0207697_10151563
1790 Ga0207697_10169115
1791 Ga0207656_10626914
1792 Ga0207682_10012638
1793 Ga0207682_10090741
1794 Ga0207682_10314691
1795 Ga0207692_10062884
1796 Ga0207642_10320263
1797 Ga0207642_10511176
1798 Ga0207710_10043183
1799 Ga0207710_10202155
1800 Ga0207710_10218751
1801 Ga0207710_10297964
1802 Ga0207688_10364950
1803 Ga0207680_10121808
1804 Ga0207680_10226700
1805 Ga0207680_10311233
1806 Ga0207680_10443004
1807 Ga0207680_10620477
1808 Ga0207680_11205736
1809 Ga0207685_10100028
1810 Ga0207699_10136467
1811 Ga0207699_10138331
1812 Ga0207645_10010119
1813 Ga0207645_10167566
1814 Ga0207645_10324205
1815 Ga0207645_11039624
1816 Ga0207643_10028199
1817 Ga0207705_10433255
1818 Ga0207684_10340470
1819 Ga0207684_10625897
1820 Ga0207654_10368923
1821 Ga0207707_10434753
1822 Ga0207707_10581314
1823 Ga0207695_10043788
1824 Ga0207693_10719179
1825 Ga0207660_10140304
1826 Ga0207662_10349300
1827 Ga0207662_10463921
1828 Ga0207649_10270046
1829 Ga0207652_10164394
1830 Ga0207646_10129675
1831 Ga0207646_10674278
1832 Ga0207646_10743847
1833 Ga0207681_10031728
1834 Ga0207681_10057928
1835 Ga0207681_10423925
1836 Ga0207681_10460455
1837 Ga0207681_10471969
1838 Ga0207681_10481848
1839 Ga0207681_10513259
1840 Ga0207681_10876159
1841 Ga0207694_10674236
1842 Ga0207650_10040451
1843 Ga0207650_10081322
1844 Ga0207650_10197071
1845 Ga0207650_10303154
1846 Ga0207650_10928129
1847 Ga0207650_11457074
1848 Ga0207659_10002378
1849 Ga0207659_10011489
1850 Ga0207659_10060634
1851 Ga0207659_10216365
1852 Ga0207659_10630644
1853 Ga0207659_11127876
1854 Ga0207659_11205399
1855 Ga0207659_11330369
1856 Ga0207659_11592795
1857 Ga0207659_11768859
1858 Ga0207687_10010364
1859 Ga0207687_10063983
1860 Ga0207687_10414846
1861 Ga0207687_10468696
1862 Ga0207687_10656542
1863 Ga0207700_10017407
1864 Ga0207700_11141374
1865 Ga0207664_10393754
1866 Ga0207644_10023932
1867 Ga0207644_10462290
1868 Ga0207644_10636534
1869 Ga0207644_10695062
1870 Ga0207644_10804097
1871 Ga0207644_10999269
1872 Ga0207644_11133823
1873 Ga0207690_10511590
1874 Ga0207706_10173659
1875 Ga0207706_10478544
1876 Ga0207706_10570791
1877 Ga0207706_10968940
1878 Ga0207706_11418283
1879 Ga0207686_10002322
1880 Ga0207686_10094220
1881 Ga0207686_10140293
1882 Ga0207686_10167587
1883 Ga0207686_10572959
1884 Ga0207686_10983927
1885 Ga0207709_10068365
1886 Ga0207709_10440925
1887 Ga0207670_10004961
1888 Ga0207670_10400531
1889 Ga0207670_10721337
1890 Ga0207670_11445109
1891 Ga0207670_11530940
1892 Ga0207669_10087257
1893 Ga0207669_10324613
1894 Ga0207669_10345563
1895 Ga0207669_10679195
1896 Ga0207669_11305617
1897 Ga0207704_10041693
1898 Ga0207704_10068414
1899 Ga0207704_10397391
1900 Ga0207704_10782727
1901 Ga0207704_10795203
1902 Ga0207665_10165305
1903 Ga0207665_10268312
1904 Ga0207665_11587582
1905 Ga0207691_10036213
1906 Ga0207691_10038903
1907 Ga0207691_10105089
1908 Ga0207691_10115593
1909 Ga0207691_10124187
1910 Ga0207691_10506821
1911 Ga0207691_10740292
1912 Ga0207691_10879539
1913 Ga0207691_11104478
1914 Ga0207691_11759295
1915 Ga0207711_10021612
1916 Ga0207711_10056083
1917 Ga0207711_10078314
1918 Ga0207711_10091939
1919 Ga0207711_10093412
1920 Ga0207711_10104060
1921 Ga0207711_10113116
1922 Ga0207711_10228560
1923 Ga0207711_10231413
1924 Ga0207711_10985535
1925 Ga0207711_11179687
1926 Ga0207711_11571593
1927 Ga0207711_11945837
1928 Ga0207689_10044403
1929 Ga0207689_11503490
1930 Ga0207661_10630101
1931 Ga0207661_10919152
1932 Ga0207661_11775764
1933 Ga0207679_10090637
1934 Ga0207679_10120594
1935 Ga0207679_11097439
1936 Ga0207667_11423415
1937 Ga0207651_10032004
1938 Ga0207651_10039551
1939 Ga0207651_10065620
1940 Ga0207651_10095692
1941 Ga0207651_10107516
1942 Ga0207651_10293857
1943 Ga0207651_10431195
1944 Ga0207651_10830141
1945 Ga0207651_11153891
1946 Ga0207651_11447569
1947 Ga0207712_10224577
1948 Ga0207712_11193726
1949 Ga0207712_11261088
1950 Ga0207668_10540561
1951 Ga0207668_10742923
1952 Ga0207658_10061154
1953 Ga0207658_10775846
1954 Ga0207658_11066025
1955 Ga0207658_11312981
1956 Ga0207677_10346849
1957 Ga0207677_10523446
1958 Ga0207677_10669910
1959 Ga0207677_10742060
1960 Ga0207677_10805004
1961 Ga0207677_10890180
1962 Ga0207677_11192592
1963 Ga0207703_10045078
1964 Ga0207703_10063549
1965 Ga0207703_10120624
1966 Ga0207703_10312328
1967 Ga0207703_11253999
1968 Ga0207703_11737685
1969 Ga0207703_12110997
1970 Ga0207639_10102270
1971 Ga0207678_11004047
1972 Ga0207678_11024611
1973 Ga0207678_11843981
1974 Ga0207708_10004035
1975 Ga0207708_10047836
1976 Ga0207708_10264493
1977 Ga0207708_10312951
1978 Ga0207708_10521496
1979 Ga0207641_10015850
1980 Ga0207641_10169646
1981 Ga0207641_10187672
1982 Ga0207641_11002431
1983 Ga0207641_11866408
1984 Ga0207641_12089814
1985 Ga0207648_10008593
1986 Ga0207648_10035504
1987 Ga0207648_10137226
1988 Ga0207648_10186927
1989 Ga0207648_10193990
1990 Ga0207648_10407596
1991 Ga0207648_10483546
1992 Ga0207648_10966406
1993 Ga0207676_10055958
1994 Ga0207674_10027294
1995 Ga0207674_10386774
1996 Ga0207674_11013489
1997 Ga0207674_11082751
1998 Ga0207675_100002422
1999 Ga0207675_100082993
2000 Ga0207675_100153886
2001 Ga0207675_100182792
2002 Ga0207675_100253866
2003 Ga0207675_100726404
2004 Ga0207675_100846333
2005 Ga0207683_10122282
2006 Ga0207683_10643522
2007 Ga0207683_10877881
2008 Ga0207683_11101023
2009 Ga0207698_10241331
2010 Ga0207698_11304916
2011 Ga0210002_1044820
2012 Ga0209971_1047897
2013 Ga0209974_10212153
2014 Ga0207428_10051733
2015 Ga0207428_10062981
2016 Ga0207428_10078034
2017 Ga0207428_10154865
2018 Ga0207428_10316979
2019 Ga0207428_10559032
2020 Ga0207428_10620296
2021 Ga0268266_10019590
2022 Ga0268266_10084989
2023 Ga0268266_10311578
2024 Ga0268266_10441671
2025 Ga0268266_10464319
2026 Ga0268265_10038252
2027 Ga0268265_10055548
2028 Ga0268265_10111014
2029 Ga0268265_10507124
2030 Ga0268265_10850593
2031 Ga0268265_10914141
2032 Ga0268265_11265098
2033 Ga0268264_10087555
2034 Ga0268264_10293128
2035 Ga0268264_10385157
2036 Ga0268264_10501572
2037 Ga0268264_10725817
2038 Ga0268264_10802115
2039 Ga0268264_10928752
2040 Ga0265318_10021725
2041 Ga0307517_10251990
2042 Ga0265332_10053984
2043 Ga0265331_10564218
2044 Ga0307408_101488087
2045 Ga0265314_10476031
2046 Ga0316576_10645974
2047 Ga0307410_11975573
2048 Ga0307410_12016734
2049 Ga0307412_10671804
2050 Ga0307409_101967283
2051 Ga0307416_101335115
2052 Ga0307416_101459955
2053 Ga0307415_100683239
2054 Ga0307415_101147579
2055 Ga0373948_0058262
2056 Ga0373926_0042743
2057 Ga0373926_0233101
2058 Ga0373936_0160316
2059 Ga0373939_0031020
2060 Ga0373941_0030938
2061 Ga0373945_0033194
2062 Ga0373945_0209875
2063 Ga0373956_0111321
2064 Ga0373956_0205134
2065 Ga0373957_0280901
2066 Ga0373960_0061765
2067 Ga0373943_0046647
2068 Ga0373943_0320971
2069 Ga0373943_0693779
2070 Ga0373946_0005466
2071 Ga0373946_0176115
2072 Ga0373946_0554469
2073 Ga0373946_0627452
2074 Ga0373955_0065879
2075 Ga0373955_0164771
2076 Ga0373955_0394339
2077 Ga0373955_0421258
2078 Ga0373955_0594200
2079 Ga0373962_0013110
2080 Ga0373924_0006037
2081 Ga0373931_0026436
2082 Ga0373935_0074946
2083 Ga0373935_0914979
2084 Ga0373935_1445141
2085 Ga0373927_0387980
2086 Ga0373933_0113007
2087 Ga0373933_0740059
2088 Ga0373947_0218138
2089 Ga0373937_0108531
2090 Ga0373937_0321795
2091 Ga0373925_0207301
2092 Ga0373925_0430024
2093 Ga0373925_1116740
2094 Ga0373925_1191814
2095 Ga0395901_1807516
2096 Ga0242420_124051
2097 Ga0436365_0144352
2098 Ga0436365_0869875
2099 Ga0436363_0853021
2100 Ga0439439_0116330
2101 Ga0439453_0128249
2102 Ga0451853_0483904
2103 Ga0451853_3060275
2104 Ga0439431_0074545
2105 Ga0439431_0212481
2106 Ga0439455_0070990
2107 Ga0450914_061023
2108 Ga0450923_052173
2109 Ga0439446_0016101
2110 Ga0439435_0001925
2111 Ga0439435_0023577
2112 Ga0439435_0284399
2113 Ga0450916_008100
2114 Ga0451577_0212644
2115 Ga0451577_1252857
2116 Ga0439440_0063940
2117 Ga0466971_0429874
2118 Ga0466959_0269780
2119 Ga0451576_0563594
2120 Ga0451576_0620670
2121 Ga0466967_0704719
2122 Ga0466967_0746095
2123 Ga0495592_0004184
2124 Ga0495592_0388408
2125 Ga0495603_0120330
2126 Ga0495603_0279874
2127 Ga0495629_0137460
2128 Ga0495629_0218286
2129 Ga0495629_0587510
2130 Ga0495629_1067070
2131 Ga0495580_0083086
2132 Ga0495580_0956447
2133 Ga0495582_0285867
2134 Ga0495639_0200820
2135 Ga0495639_0249810
2136 Ga0495594_0046875
2137 Ga0495594_0425723
2138 Ga0495608_0014823
2139 Ga0495618_0382931
2140 Ga0495628_0050827
2141 Ga0495628_0341099
2142 Ga0495630_0002518
2143 Ga0495630_0454796
2144 Ga0495642_0462702
2145 Ga0495642_0531503
2146 Ga0495652_0079043
2147 Ga0495665_0336919
2148 Ga0495640_0163548
2149 Ga0495640_0394052
2150 Ga0495586_0369224
2151 Ga0495598_0071778
2152 Ga0495621_0006942
2153 Ga0495645_0031018
2154 Ga0495633_0049958
2155 Ga0495667_0205893
2156 Ga0495656_0021020
2157 Ga0495635_0903919
2158 Ga0495659_0054692
2159 Ga0495659_0100318
2160 Ga0495659_0300159
2161 Ga0495599_0478875
2162 Ga0495599_0521707
2163 Ga0495599_0709609
2164 Ga0495647_0557583
2165 Ga0495658_0201308
2166 Ga0495658_0387374
2167 Ga0495658_0774041
2168 Ga0495669_0057656
2169 Ga0495613_0002160
2170 Ga0495613_0361043
2171 Ga0495624_0865524
2172 Ga0495624_0875961
2173 Ga0495624_0927928
2174 Ga0495600_0021685
2175 Ga0495660_0442735
2176 Ga0495604_0215270
2177 Ga0495636_0492593
2178 Ga0495674_0160785
2179 Ga0495674_0458821
2180 Ga0495674_0477154
2181 Ga0495676_0817211
2182 Ga0495676_1068697
2183 Ga0495680_0328174
2184 Ga0495680_0339993
2185 Ga0495684_0000806
2186 Ga0495684_0089655
2187 Ga0495684_0333698
2188 Ga0496100_0014084
2189 Ga0496100_0178802
2190 Ga0496101_0000865
2191 Ga0496101_0115077
2192 Ga0496102_0249331
2193 Ga0496104_0012188
2194 Ga0496104_0024834
2195 Ga0496104_0073240
2196 Ga0496104_0383558
2197 Ga0496105_0289093
2198 Ga0496106_0222151
2199 Ga0496106_0875254
2200 Ga0496107_0760207
2201 Ga0496107_1144038
2202 Ga0496108_0151195
2203 Ga0496108_0193170
2204 Ga0496108_0359451
2205 Ga0496108_1405896
2206 Ga0496109_0277579
2207 Ga0496109_0436734
2208 Ga0496109_0476928
2209 Ga0496109_1221812
2210 Ga0496110_0077563
2211 Ga0496110_0509108
2212 Ga0496110_1285517
2213 Ga0496111_0146270
2214 Ga0496111_1083079
2215 Ga0496112_0029928
2216 Ga0496112_0054131
2217 Ga0496112_0337039
2218 Ga0496112_0742907
2219 Ga0496112_0839126
2220 Ga0496112_1080951
2221 Ga0496112_1456085
2222 Ga0496112_1840162
2223 Ga0496113_0119037
2224 Ga0496113_0145309
2225 Ga0496113_1029311
2226 Ga0496113_1283387
2227 Ga0496113_1374943
2228 Ga0496114_0002816
2229 Ga0496114_0122843
2230 Ga0496114_0400756
2231 Ga0496114_0762834
2232 Ga0496114_0849217
2233 Ga0496114_1388921
2234 Ga0496115_0012590
2235 Ga0501034_0020919
2236 Ga0501034_0082399
2237 Ga0501036_0413994
2238 Ga0501039_0813186
2239 Ga0501039_1113845
2240 Ga0501039_1305341
2241 Ga0501040_0002471
2242 Ga0501040_0285335
2243 Ga0501041_0062843
2244 Ga0501041_0251733
2245 Ga0501042_0034042
2246 Ga0501042_0223268
2247 Ga0501042_1277274
2248 Ga0501043_0033720
2249 Ga0501046_0442179
2250 Ga0501047_0037801
2251 Ga0501047_1426611
2252 Ga0501048_0352346
2253 Ga0501067_0131711
2254 Ga0501067_0471335
2255 Ga0501067_0604389
2256 Ga0501068_0182206
2257 Ga0501068_1014524
2258 Ga0501069_0396016
2259 Ga0501071_0023181
2260 Ga0501071_0049981
2261 Ga0501071_0660889
2262 Ga0501072_1021303
2263 Ga0501073_0539290
2264 Ga0501074_0149350
2265 Ga0501075_0205240
2266 Ga0501075_0455525
2267 Ga0501075_0687028
2268 Ga0501075_0918674
2269 Ga0501076_0003692
2270 Ga0501076_0044241
2271 Ga0501076_0217999
2272 Ga0501214_102563
2273 Ga0501243_071780
2274 Ga0501079_0019810
2275 Ga0501079_0051096
2276 Ga0501079_0850517
2277 Ga0501079_1042412
2278 Ga0501080_0267929
2279 Ga0501080_0531245
2280 Ga0501081_0000392
2281 Ga0501081_0553500
2282 Ga0501081_0616844
2283 Ga0501083_0316576
2284 Ga0501083_0671142
2285 Ga0501268_169482
2286 Ga0501270_134903
2287 Ga0501044_0002002
2288 Ga0501045_0046238
2289 Ga0501045_0116029
2290 nmdc:mga04h51_178688_c1
2291 nmdc:mga05p37_10269_c1
2292 nmdc:mga05p37_1376256_c1
2293 nmdc:mga05p37_161639_c1
2294 nmdc:mga05p37_194423_c1
2295 nmdc:mga05p37_227452_c1
2296 nmdc:mga05p37_24653_c1
2297 nmdc:mga05p37_263151_c1
2298 nmdc:mga05p37_30909_c1
2299 nmdc:mga05p37_3502_c1
2300 nmdc:mga05p37_50821_c1
2301 nmdc:mga05p37_53469_c1
2302 nmdc:mga05p37_65728_c1
2303 nmdc:mga05p37_76741_c1
2304 nmdc:mga05p37_79178_c1
2305 nmdc:mga05p37_83155_c1
2306 nmdc:mga05p37_85834_c2
2307 nmdc:mga05p37_878669_c1
2308 nmdc:mga09592_160869_c1
2309 nmdc:mga09592_172387_c1
2310 nmdc:mga09592_31926_c1
2311 nmdc:mga09592_830557_c1
2312 nmdc:mga0qj67_241032_c1
2313 nmdc:mga0qj67_286739_c1
2314 nmdc:mga0qj67_50929_c1
2315 nmdc:mga0qj67_8288_c1
2316 nmdc:mga06r32_140925_c1
2317 nmdc:mga06r32_202931_c1
2318 nmdc:mga06r32_265492_c1
2319 nmdc:mga06r32_553588_c1
2320 nmdc:mga06r32_73611_c1
2321 nmdc:mga08y16_142486_c1
2322 nmdc:mga08y16_24817_c1
2323 nmdc:mga08y16_34064_c1
2324 nmdc:mga08y16_35410_c1
2325 nmdc:mga08y16_547671_c1
2326 nmdc:mga08y16_89984_c2
2327 nmdc:mga08y16_9374_c1
2328 nmdc:mga0n895_104719_c1
2329 nmdc:mga0n895_1909573_c1
2330 nmdc:mga0n895_2102075_c1
2331 nmdc:mga0n895_21_c1
2332 nmdc:mga0n895_438051_c1
2333 nmdc:mga0n895_507800_c1
2334 nmdc:mga0n895_70703_c1
2335 nmdc:mga0n895_713782_c1
2336 nmdc:mga0n895_81754_c1
2337 nmdc:mga0n895_855810_c1
2338 nmdc:mga0n895_872062_c1
2339 nmdc:mga0n895_90637_c1
2340 nmdc:mga0rr50_153055_c1
2341 nmdc:mga0rr50_36154_c1
2342 nmdc:mga0rr50_636611_c1
2343 nmdc:mga0rr50_663697_c1
2344 nmdc:mga0rr50_83848_c1
2345 nmdc:mga0rr50_868418_c1
2346 nmdc:mga0rr50_8_c1
2347 nmdc:mga0rr50_96006_c1
2348 nmdc:mga08x19_1149615_c1
2349 nmdc:mga08x19_181580_c1
2350 nmdc:mga08x19_28342_c1
2351 nmdc:mga08x19_29254_c1
2352 nmdc:mga08x19_32007_c1
2353 nmdc:mga08x19_333_c1
2354 nmdc:mga08x19_7264_c1
2355 nmdc:mga0a205_1073428_c1
2356 nmdc:mga0a205_117529_c1
2357 nmdc:mga0a205_215507_c1
2358 nmdc:mga0a205_270879_c1
2359 nmdc:mga0a205_314950_c1
2360 nmdc:mga0a205_3697_c1
2361 nmdc:mga0a205_37760_c1
2362 nmdc:mga0a205_427402_c1
2363 nmdc:mga0a205_510072_c1
2364 nmdc:mga0a205_592562_c1
2365 nmdc:mga0a205_68215_c1
2366 nmdc:mga0a205_76248_c1
2367 nmdc:mga0a205_785652_c1
2368 nmdc:mga0a205_865178_c1
2369 nmdc:mga0a205_91564_c1
2370 Ga0495601_0005780
2371 Ga0495601_0062414
2372 Ga0495612_0321859
2373 Ga0495595_0130849
2374 Ga0495595_0559026
2375 Ga0495619_0002732
2376 Ga0495619_0034475
2377 Ga0495619_0140417
2378 Ga0495619_0331761
2379 Ga0495619_0502354
2380 Ga0500555_000372
2381 Ga0500592_033064
2382 Ga0500616_0002270
2383 Ga0500645_000759
2384 Ga0500599_009585
2385 Ga0501084_0003674
2386 Ga0587083_0223031
2387 Ga0501082_0146115
2388 Ga0501082_0256042
2389 Ga0501082_1099971
2390 Ga0530510_0321404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

21

120

0.73

Map